GenomeNet

Database: RefSeq
Entry: NC_016482
LinkDB: NC_016482
Original site: NC_016482 
LOCUS       NC_016482            1230053 bp    DNA     linear   CON 05-JUN-2017
DEFINITION  Naumovozyma dairenensis CBS 421 chromosome 4, complete genome.
ACCESSION   NC_016482
VERSION     NC_016482.1
DBLINK      BioProject: PRJNA79341
            BioSample: SAMEA2272418
            Assembly: GCF_000227115.2
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Naumovozyma dairenensis CBS 421
  ORGANISM  Naumovozyma dairenensis CBS 421
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Naumovozyma.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 1230053)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1230053)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE580270.
            Accession numbers for all the chromosomes in this genome project:
            HE580267-HE580278.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1230053
                     /organism="Naumovozyma dairenensis CBS 421"
                     /mol_type="genomic DNA"
                     /strain="type strain:CBS 421"
                     /db_xref="taxon:1071378"
                     /chromosome="4"
     gene            complement(<5012..>5578)
                     /gene="NDAI0D00100"
                     /locus_tag="NDAI_0D00100"
                     /db_xref="GeneID:11494814"
     mRNA            complement(<5012..>5578)
                     /gene="NDAI0D00100"
                     /locus_tag="NDAI_0D00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669519.1"
                     /db_xref="GeneID:11494814"
     CDS             complement(5012..5578)
                     /gene="NDAI0D00100"
                     /locus_tag="NDAI_0D00100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669567.1"
                     /db_xref="GeneID:11494814"
                     /db_xref="UniProtKB/TrEMBL:G0W963"
                     /translation="MVAISQLLVFFLVVRTVLAVTIRNGIIDSPLPRDNTTLVDALNL
                     MRCAQVWGMPNDTIVATDRTETLILFNNRTTTNTTHMKEIANHCFSRFGYTLAFTHYN
                     YKYFPGELTHICTLDDALRNWDLLPTFARNELIAETQRGPTSTSTFISHKDTSEYYFM
                     VMAVLFLVIIYSLLMRATAKSVPSMATK"
     gene            <14553..>15698
                     /gene="NDAI0D00110"
                     /locus_tag="NDAI_0D00110"
                     /db_xref="GeneID:11494777"
     mRNA            <14553..>15698
                     /gene="NDAI0D00110"
                     /locus_tag="NDAI_0D00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669520.1"
                     /db_xref="GeneID:11494777"
     CDS             14553..15698
                     /gene="NDAI0D00110"
                     /locus_tag="NDAI_0D00110"
                     /inference="similar to DNA sequence:INSDC:YGR260W"
                     /note="similar to Saccharomyces cerevisiae TNA1 (YGR260W);
                     ancestral locus Anc_5.50"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669568.1"
                     /db_xref="GeneID:11494777"
                     /db_xref="GOA:G0W964"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G0W964"
                     /translation="MQIYNLETAHILIFSEKMSLKHPFTVITSNTGNISSSKNEANIE
                     TIENDSELSTESKHITKRKVISLKDADITLAFMVENDTFVREIRQTEERKLRRKVALI
                     IVSLTATIDFLLYSDKATLSYASIFELWEDTHLTQNRYNNATTLFYVGYIVGLTNLLW
                     VQKFPIRNVMIFMCTSWTIITLLHCVAYNYYGIYALRFFLGFVEAIAVPTLNITMNQF
                     LTPNEKNVYAPIFYSSCMGCGIFRFFDCIWKLFMIIIGGMTFLMTMVVYFIYPSNPTD
                     AKFLSKEEKVWVIRRVQKSSNSSIEQKYSKKYQIIEAFRDPITWLFCAFFLFQQLANN
                     LTYMQNLLFENRSYYKSRYYHSLYRFRWICYFLCDNCYSFLIVQGKF"
     gene            <16762..>19065
                     /gene="NDAI0D00120"
                     /locus_tag="NDAI_0D00120"
                     /db_xref="GeneID:11494778"
     mRNA            <16762..>19065
                     /gene="NDAI0D00120"
                     /locus_tag="NDAI_0D00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669521.1"
                     /db_xref="GeneID:11494778"
     CDS             16762..19065
                     /gene="NDAI0D00120"
                     /locus_tag="NDAI_0D00120"
                     /inference="similar to DNA sequence:INSDC:YPR181C"
                     /note="similar to Saccharomyces cerevisiae SEC23
                     (YPR181C); ancestral locus Anc_7.537"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669569.1"
                     /db_xref="GeneID:11494778"
                     /db_xref="GOA:G0W965"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:G0W965"
                     /translation="MDFDANEDANGIRFSWNIFPSPASKVEVGKSVVPTGCLYTPLKE
                     LPEGQILHYNPVVCSTPHCKAIFNPYCAINTNNNTWTCPLCLGGNNLRTNYSNMTQET
                     MPMELISNTVEYITNKPVQVPPIFFFVIDLNIEKDNLEALRQSISTSLSLLPPNAMIG
                     LITYNNIVQLHDFSPSPINKCNVFRGDKEYTLSDLTKILTGTNTPNNMGNIPSAAPTN
                     NSLNRFFLPLEQIEFKLNQILENVIADNWPIPNGHRPLRGTGSALNIATLLLQGCYKN
                     AAARIILFASGPGTMAPGLIVSPELKDPLRSHHDIDSENASHYKKACKYYSQLTDRVV
                     ENGHTVDIFAGCYDQIGMSEMQKLTDSTGGVLLLTDSFSTAIFKQSYLRLFSKDEEGY
                     LNMAFNGELCVKTNNKLKLHGLIGHAAPVKKTDAKNISDTQIGIGGTSTWKMAALSPH
                     HTYAIYFDVMSMDVANGNANGNAMNQQQSQAFIQIITNYQHASGYHRTRVTTIANNVL
                     ATGTAQNQQIMYSFDQEAAIVLMARIAVFRTNFDDALSIAKWIDTTSIKFCKMYADYN
                     KNDPESFRLAANFTLYPQFIYYLRRSQFLSVFNNSPDETAFYRHIFTREDTTNSLIMI
                     QPTLTSYSMEEDPQPVLLDSISVRPNTILLLDTFFFILIYHGEQIAQWRKAGYQDQPE
                     YSDFKSLLEEPKLDAADILVDRFPLPRFIDTEAGGSQARFLLSKLNPSSHYQNGNLNS
                     ATVVLTDDVSLQDFMIRIQTLTVESKN"
     gene            <19397..>20458
                     /gene="NDAI0D00130"
                     /locus_tag="NDAI_0D00130"
                     /db_xref="GeneID:11494779"
     mRNA            <19397..>20458
                     /gene="NDAI0D00130"
                     /locus_tag="NDAI_0D00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669522.1"
                     /db_xref="GeneID:11494779"
     CDS             19397..20458
                     /gene="NDAI0D00130"
                     /locus_tag="NDAI_0D00130"
                     /inference="similar to DNA sequence:INSDC:YLR457C,YPR174C"
                     /note="similar to Saccharomyces cerevisiae NBP1 (YLR457C)
                     and YPR174C; ancestral locus Anc_7.531"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669570.1"
                     /db_xref="GeneID:11494779"
                     /db_xref="InterPro:IPR013743"
                     /db_xref="UniProtKB/TrEMBL:G0W966"
                     /translation="MFQAMRQLLNDLFNKNGSKSSIERQRRSRHEARKNRRNIRHERS
                     TRQNKYGTPRPNYNECRRRSVIHHDISDFAAGESDARRLHARNTPQPYENALARKSIN
                     RHRISKPIIAHNKLSKNKGSTFLASLKRVFSSEEEDLLKLKETCDNITKIIPHNKHLR
                     SDEQSIIRNRVVQSEAFKRKLKEIQYDKTLLQQLQGTKLVDDISTKKNYNKNVSGNIS
                     DDRVFLLVEKNRELNQTLNETTKELNIIKKNLRFANEKIRLLQSLLSDVDDDHVIWDK
                     KRDVTDNYPKLTSRKENADATARGRNENQRRYNNLSDNKIYKNDFDSFPHSVNETQKR
                     NNDSLSPIRIDFTKYSDIT"
     gap             20827..20846
                     /estimated_length=20
     gene            complement(<20848..>21339)
                     /gene="NDAI0D00140"
                     /locus_tag="NDAI_0D00140"
                     /db_xref="GeneID:11494780"
     mRNA            complement(<20848..>21339)
                     /gene="NDAI0D00140"
                     /locus_tag="NDAI_0D00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669523.1"
                     /db_xref="GeneID:11494780"
     CDS             complement(20848..21339)
                     /gene="NDAI0D00140"
                     /locus_tag="NDAI_0D00140"
                     /inference="similar to DNA sequence:INSDC:YLR456W,YPR172W"
                     /note="similar to Saccharomyces cerevisiae YLR456W and
                     YPR172W; ancestral locus Anc_7.529"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669571.1"
                     /db_xref="GeneID:11494780"
                     /db_xref="GOA:G0W967"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:G0W967"
                     /translation="MSTEDRFPKQLLDLIKTSKYVHVATSSIDGIPSVSLMNYIYVPR
                     EKNYSPNIDDKDYIILATFDDTEKYENIVNNPRISLLFHDWITANNLSLRKTSISNLQ
                     ASMEPPSDRLNNLLEDLNQDELNQMSATIKGFAEVLDPESNESLFYRRLLLAANPDAD
                     ISY"
     gene            complement(<22014..>23027)
                     /gene="NDAI0D00150"
                     /locus_tag="NDAI_0D00150"
                     /db_xref="GeneID:11494781"
     mRNA            complement(<22014..>23027)
                     /gene="NDAI0D00150"
                     /locus_tag="NDAI_0D00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669524.1"
                     /db_xref="GeneID:11494781"
     CDS             complement(22014..23027)
                     /gene="NDAI0D00150"
                     /locus_tag="NDAI_0D00150"
                     /inference="similar to DNA sequence:INSDC:YLR455W"
                     /note="similar to Saccharomyces cerevisiae YLR455W;
                     ancestral locus Anc_7.528"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669572.1"
                     /db_xref="GeneID:11494781"
                     /db_xref="InterPro:IPR000313"
                     /db_xref="UniProtKB/TrEMBL:G0W968"
                     /translation="MTGSTVTTEFKTGDLVLCKVGSFPPWPAIVFPQRLLRNDVYKKR
                     KLNCVAVCFFNDPTYYWEQPHRLRPLNKTIINQFLKEGYKNVTQKDLIEAYKQASKYS
                     NLKRFIKSRFTDENRINDLTVEESNNGSIIAGEDPFLGKKGDGRNLKVTAVAQRSKRR
                     KSTHAYDKDDDDESDDTDSAEPIIDGDTTSINKKKHDHYNIEKSNKVHTKLDRSRRIE
                     ICLLFRRRIQKNLIQRDTPPTQDEIKESHKLLNKMHDNLDNDPPFFDVESLKHSKIYK
                     LLKVIVNNDDLEEFHPICKDILNKWSSLIQQIKLEKNANEKSDQRKPGVDKQVGISTN
                     TRS"
     gene            complement(<23864..>24392)
                     /gene="NDAI0D00160"
                     /locus_tag="NDAI_0D00160"
                     /db_xref="GeneID:11494782"
     mRNA            complement(join(<23864..23972,24098..24228,24375..>24392))
                     /gene="NDAI0D00160"
                     /locus_tag="NDAI_0D00160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669525.1"
                     /db_xref="GeneID:11494782"
     CDS             complement(join(23864..23972,24098..24228,24375..24392))
                     /gene="NDAI0D00160"
                     /locus_tag="NDAI_0D00160"
                     /inference="similar to DNA sequence:INSDC:YPR170W-B"
                     /note="similar to Saccharomyces cerevisiae YPR170W-B;
                     ancestral locus Anc_7.526"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669573.1"
                     /db_xref="GeneID:11494782"
                     /db_xref="UniProtKB/TrEMBL:G0W969"
                     /translation="MKAIVSSGKAWFCTILSAFGVVILSVIAYLFNNNHESFVGSIND
                     PEDGPAVAHTVFLAALVYLIFFVFCGFQLYVGRKKPSVQLH"
     gene            24622..24695
                     /gene="NDAI0Dtrna6I"
                     /locus_tag="NDAI_0Dtrna6I"
                     /db_xref="GeneID:11494783"
     tRNA            24622..24695
                     /gene="NDAI0Dtrna6I"
                     /locus_tag="NDAI_0Dtrna6I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:11494783"
     gene            complement(<25205..>25702)
                     /gene="NDAI0D00170"
                     /locus_tag="NDAI_0D00170"
                     /db_xref="GeneID:11494832"
     mRNA            complement(<25205..>25702)
                     /gene="NDAI0D00170"
                     /locus_tag="NDAI_0D00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669526.1"
                     /db_xref="GeneID:11494832"
     CDS             complement(25205..25702)
                     /gene="NDAI0D00170"
                     /locus_tag="NDAI_0D00170"
                     /inference="similar to DNA sequence:INSDC:YPR168W"
                     /note="similar to Saccharomyces cerevisiae NUT2 (YPR168W);
                     ancestral locus Anc_7.524"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669574.1"
                     /db_xref="GeneID:11494832"
                     /db_xref="GOA:G0W970"
                     /db_xref="InterPro:IPR019145"
                     /db_xref="UniProtKB/TrEMBL:G0W970"
                     /translation="MMPTDTDATSQPNDQSSNNETLEKLHEELATTEQQVGSIIESFI
                     ELGVSIYDFPGTDEGTQGMITNLKRNVDRLAKLNQRSNDPTSQLNNISIPFEVFQYIE
                     DGRNPDIYTREFVEAIRRSNQYQRAKMNSLKQLRDSLAEKITEEFPDMENNVKDILQR
                     TDAKR"
     gene            complement(<26285..>26926)
                     /gene="NDAI0D00180"
                     /locus_tag="NDAI_0D00180"
                     /db_xref="GeneID:11494784"
     mRNA            complement(<26285..>26926)
                     /gene="NDAI0D00180"
                     /locus_tag="NDAI_0D00180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669527.1"
                     /db_xref="GeneID:11494784"
     CDS             complement(26285..26926)
                     /gene="NDAI0D00180"
                     /locus_tag="NDAI_0D00180"
                     /inference="similar to DNA sequence:INSDC:YPR165W"
                     /note="similar to Saccharomyces cerevisiae RHO1 (YPR165W);
                     ancestral locus Anc_7.520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669575.1"
                     /db_xref="GeneID:11494784"
                     /db_xref="GOA:G0W971"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W971"
                     /translation="MNQQNTASIRRKLTVVGDGSCGKTCLLIVFSKGQFPEVYVPTVF
                     ENYVADVDIDGRHVELALWDTAGQEDYDRLRPLSYPDSNVILICFSVDIPDSLENVQE
                     KWIAEVLHFCQGVPIILAGCKVDLRNDPQVIEALRAEGQQPVTTAEGQEVAEQIGAAG
                     YYECSAKTGFGVREVFEAATKAALAGKTKTNGKSKKNKKKNNGDKKKKKCVLL"
     gene            complement(<27544..>35442)
                     /gene="NDAI0D00190"
                     /locus_tag="NDAI_0D00190"
                     /db_xref="GeneID:11494785"
     mRNA            complement(<27544..>35442)
                     /gene="NDAI0D00190"
                     /locus_tag="NDAI_0D00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669528.1"
                     /db_xref="GeneID:11494785"
     CDS             complement(27544..35442)
                     /gene="NDAI0D00190"
                     /locus_tag="NDAI_0D00190"
                     /inference="similar to DNA sequence:INSDC:YLR454W"
                     /note="similar to Saccharomyces cerevisiae YLR454W;
                     ancestral locus Anc_7.518"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669576.1"
                     /db_xref="GeneID:11494785"
                     /db_xref="InterPro:IPR019409"
                     /db_xref="InterPro:IPR019415"
                     /db_xref="InterPro:IPR019439"
                     /db_xref="InterPro:IPR019441"
                     /db_xref="InterPro:IPR019443"
                     /db_xref="InterPro:IPR019449"
                     /db_xref="UniProtKB/TrEMBL:G0W972"
                     /translation="MNLIKDIFLQKWFLITIAVSTIIRFIIRYMTGIDIQLVNPFSCK
                     FINVSYKGKFSINSIQLLLLKREIIIEGLTINKEISNSAVDEGILEKTAIKLKENHNK
                     SKHEVYTPITLPTWLKKYYVMISNSLDKFHVNLENCEIKGSAIKIERFGFIIAADSQV
                     NGISFDFYARNIYWLDKVLCNDGFITLKTTLQFENEMINLKKDHIELPFSNSVLDIKL
                     GNISLSMSAIKKFKNITVSKSKLNTDSSNKSNNNNIEGLKEQTKKESPLTELEIEKAV
                     SKLQYIVQNQIRTYIAPCTELNISIDKISFADFPITSQPKLSKINQFLSYHICASNFT
                     FNVSRFRNEMPGFKLIFQEDDIPYKISLAFSRLNLCLNKSDKENKTRELLKIAEVPNI
                     SIFGESNLLSQKFEIFKTVDGLPINRPICNIKANIASPTIDVDIKSLSFLKSFLDNIK
                     VFEQTFTDPMKVTNRTENCIIKRRKQILQAVFKKFLPIFNTRCILEDPKIAINDGENL
                     NLFIFKFSALIFHTRQRNILLKITRKKKHISYESKSSLELLDMKLQHLIKDSTYKITI
                     LKIESISFKNQFKMLPESIFTLNGDIDSIEVDLSELPTMVTLNKIVRRLDCQMLNVEE
                     NYFKELYMSFASNIETSENQCSLIAKENIGEKKLLPSEFLFTSLPANFDYFKVNIRNI
                     KIMLGSRSVFMPPEVFSSMESQSSHDLVDGKLRKFCFTIDRIQISLFGDKTQWHNKIT
                     SSNADMVRSGSTDGFKKFAEEGLDDISTSDATEVEHLWNINVLINTMSSSIIAETAEV
                     TDELTHRVVNKVSVFSLKIFPETEFFSPDEPKKIAVQIENQKLKSVVSLMNIFLMVSG
                     VHTLHQIFGQEITTRRRSSWAKKYLIAIGNSKKKSCFRNIDWSELKTLVEMTLSSNFI
                     TEIIILPNGLKTKLEVIASFITIKNMSDIFVNGEHIRMLVELPSAPNIWSRFVSISKY
                     SISANIHQLLEQVSADFDNFENLEPAVLLENESWHFSIPHKFAMYRLIDNITTVVKSL
                     KQLLYSLRTSKNDLIIFPKEVPTPTLPKITLKSNRCVFSVADDPIEAKLNMVFQIGLQ
                     EQRARLTKLEEFNTSVLNKVIGRKPDVSIDEVYKILEKANCSSKSLNQNKSMMPTPFP
                     INDKELTLEEMLTEDIHRAYRNLQEHISDSWIKRIQEYKRKEREEFRKNFQFLWGNID
                     YSKLPLDINRKVIAFTTNPFLMTLIIDQINIDLYKPSCGTEGVVDFIHNTGNGVPKDT
                     EYSIMIPMYIDAKFGEIRWHLRDYPLPFVYIPPLDASQTKEKSAIRLYGDFIVTEKLS
                     HKDNALRTLFVPLVPSIALENTDTYYSLYVPRTVTSIKLYTSLKLDINSKDSTTVQIG
                     NSYQPAIQQAMQCFDNFSKPPLDPSPKMGLWDKLRYIFHASVTISWKNNGRFELGMKS
                     DRSPYKLNGKSAGFIIGFGKNVKLTCNEDADPMKNFLSCSADELYFSIPNHFAKPLLV
                     WCRPSRNSVFIPNQEDTNLTTYTSYYYLIDLVKMKNESAAVDIMNKNYIEKTGIKLTG
                     GTTLSMGIVLERLLNKTNERTFDSKKHYDINLTNPIYVNNLHTHDSYAGFRSDFIHMS
                     FTLISNNISSYNAMQLSPNGLTTFFKWWKSFSGNFPSRRGTLFGSQSVSPKFGEHLYT
                     ISYSADVSPFFVAHSCHDIEVSNILKKNYSDSVEFAGLKAKASHFKMDLHQRKELVTE
                     YQEMLDVTKRVKKLKFLEADIIVNNIDVRTLHGMFRKLNYIEEKEDAEYHIFDNDMRW
                     LDIMDFQEAFFVDVNNYFPVIEINPMLYAPGFMYKKRASYGDKYQVDAKDYKPIKPFE
                     NKVSHNCILGSPVEIHPEVFQKRLDVLKAFEMKTTQELNVVEDPEKKKKLEKLVRDTR
                     STIKDVQTLLVDFNSVCPKTGRVLTSSGKLKYSALQLLHDSKMCNEAFENRYFIFGML
                     LQWNESVRDVVFKFWYYFSLSKDFNILSAQHSLEIFENIIKERISSEGKPNSPLDDNT
                     SASRIKSHFQFEDTNDQSVLTAELLEMFERGLSELSCSFDFNKKENHYVQFITPQVQL
                     LTKEEPDSCIIVSTPNILLKVHAFEEAGHEAINMNNSFLKRTGVFFTNANAFLFHKDV
                     FKNRFALYFDTNSYGQKKGSDWPPWLGLELGFEPSPLQSEAIIKNLSSCFYYQKPYEF
                     SHVYGMLKGMMDDKITVYVPKINISTNSKNYLFMYKIITNLLLYVEPDKEELQKQINK
                     LIIGYDTENIVKTKNLVISLFYNYKKLELLENELLFKRALLDDVSRIDLSNIHNEKQS
                     HLLSLYYLMNILNVSSKWKDTSEKTLIFDFNIKEVLIHMLHDSGKPFLDVAIAKLHLE
                     RRQSSYGFNRNQLTVKMMQIFNLERDVIYHDLLGPYFAKHKRNIPAADLKPLIFIKWE
                     MDQPIGGIKVVHNVETELEGLKINIEEHTIKRIIDWLLLKESFLSSTDEGNEAIMSKL
                     FSNEDIDPESEISDGLNEDLNEMIKRSSDYIIIHALQLNQFKLCISYKGKGTRRIANV
                     SDFLFTFPTLSFANQTLRTIDILNALKRVLVRVFLRHTGKFIKSKLRRKSTGGSNIDS
                     NSSLKPLSRYQSYTDVRALVKDDRMSVVEQDDVHTF"
     gene            <36631..>38103
                     /gene="NDAI0D00200"
                     /locus_tag="NDAI_0D00200"
                     /db_xref="GeneID:11494786"
     mRNA            <36631..>38103
                     /gene="NDAI0D00200"
                     /locus_tag="NDAI_0D00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669529.1"
                     /db_xref="GeneID:11494786"
     CDS             36631..38103
                     /gene="NDAI0D00200"
                     /locus_tag="NDAI_0D00200"
                     /inference="similar to DNA sequence:INSDC:YPR163C"
                     /note="similar to Saccharomyces cerevisiae TIF3 (YPR163C);
                     ancestral locus Anc_7.517"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669577.1"
                     /db_xref="GeneID:11494786"
                     /db_xref="GOA:G0W973"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G0W973"
                     /translation="MAPPKNAKKTVKLDLNSFLNDDTFGSSWAEEDVDLNKISIPIEN
                     VPANTVPLEEIARKQNTGTMGGMGMGMGMGMGGGRGGSRLDPALAGPGSSRRDFSQRE
                     EYPVPEHPPFRAIINNIPWDISPEGVKAWVEDGLNKPEAVEEIDLPKSIKDPTRLKGL
                     AFITLKERNDLVKALTFNGTKLNERTVYVSVAAPRRDGYRSGGADFDWGSARGSAFQA
                     SNGPGQDADLNWDSARGSNYRAPREEPNLDWDSARGSNFRQQRSSREPREPREEVNLD
                     WDSARGSNFRQQQPREPREEVNLDWDSARGSNFRQQQPREPREPREEVNLDWDSARGS
                     NFRQQQRPPRGPRETREEVNLDWDSARGSNFRAQRPPREPREPREPRKQEPELNWGDA
                     RGANFGKKPTTTTTSTKEKASKSSIKANKPVEEPVKIQKSAFDVLRTDDDDEDDEEEE
                     EAAENSTEPKVENKEVDTLATETAKLAVDDDNEWEVVGKK"
     gene            <40889..>43150
                     /gene="NDAI0D00210"
                     /locus_tag="NDAI_0D00210"
                     /db_xref="GeneID:11494787"
     mRNA            <40889..>43150
                     /gene="NDAI0D00210"
                     /locus_tag="NDAI_0D00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669530.1"
                     /db_xref="GeneID:11494787"
     CDS             40889..43150
                     /gene="NDAI0D00210"
                     /locus_tag="NDAI_0D00210"
                     /inference="similar to DNA sequence:INSDC:YLR452C"
                     /note="similar to Saccharomyces cerevisiae SST2 (YLR452C);
                     ancestral locus Anc_7.514"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669578.1"
                     /db_xref="GeneID:11494787"
                     /db_xref="GOA:G0W974"
                     /db_xref="InterPro:IPR000342"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="UniProtKB/TrEMBL:G0W974"
                     /translation="MSAKDLLTTLHELASKSFNRTPNGLIFTNDLKTVYSLLLICLDL
                     KEENPLESKSLLNAFNSNHNKDFSFTFSINEAIEVMKDLRLNVDMNATCIKVSYSIKP
                     TLAFHLLKVFMSANLLHTPADRTRTEPKEKVLLQPTPKGVAILQKYVRDIGLKKLPEI
                     IFSSFNSLDLFTFERSSMTDSIIHSDYLIHILFIRVMGPHANVWSPSNISDPLPSLST
                     LLEYSNDSFTFENMDYSHFSNGFGSISGHFNDGSHNYNNNNNNATTHNIDFESWLDQI
                     PDEDLHDESRKSPFAHRFFTNPDSDSHIQYYVSDKGVRLFKSKLFGKNKTIIDYCFTT
                     KAIWQWLMDCTDIMYPKEAVSVAALFLKMGFIVPILLPPSKNSKKKFHISRSSFYTLT
                     KLGWDIIQWNTEIGIKQSINNFSNLKIQTPTQTHVDIGFTYTGNLVVPDEKKQLKQNI
                     DARPKSVDFTFNGKHQCNNLDDILRDPGMRYLFRRHLEKELCVENLDALIDIKKFSKK
                     MTLLKKLLDAKHNKESNNKNKSKVKSKSFEDNILSTIDSALMKQANECLEMAYHISSS
                     YIMVGSPYQVNIDHNLRESVTKIMLSPQSPLSKSFSVNFHSNFDSHDEILLSTNNVTP
                     KFSELSLKLTKPEPALKIDSLTSLSPTCMSPRQFKPAPLSLPPLSKDQYVSLDPFKND
                     TSDEDDKNLSCFYDDDPLGITLKALKKLYPLFEKVSRQMYHLMKIDSLQKFMNSDVYQ
                     EATLLIEKQDKTM"
     gene            complement(<43353..>46187)
                     /gene="NDAI0D00220"
                     /locus_tag="NDAI_0D00220"
                     /db_xref="GeneID:11494788"
     mRNA            complement(<43353..>46187)
                     /gene="NDAI0D00220"
                     /locus_tag="NDAI_0D00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669531.1"
                     /db_xref="GeneID:11494788"
     CDS             complement(43353..46187)
                     /gene="NDAI0D00220"
                     /locus_tag="NDAI_0D00220"
                     /inference="similar to DNA sequence:INSDC:YLR451W"
                     /note="similar to Saccharomyces cerevisiae LEU3 (YLR451W);
                     ancestral locus Anc_7.512"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669579.1"
                     /db_xref="GeneID:11494788"
                     /db_xref="GOA:G0W975"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G0W975"
                     /translation="MLHGAEEKKPVVVDASTVSISSDPMPNTLVSPSTSASVSSTKKR
                     KFACVECRQQKSKCDAYDKAPDPCTKCQKKGVPCVLKKDFRRTYKRARNEAIEKRFKE
                     LTQTLTNLSSEEILKKIEQEQQTLLDNRNFTKEKIKKLRESSSSSTTSLNSFTSQIPI
                     LNDSVGSFPLPSNHTTVPKSASPSSSPTSLQLQNLNTLKDFKMTEEQLKCTPKSLGDI
                     YMSSNDIAELFQEFATKYHQFLPVVDLTKGTERIYNLSPALFWVVLLIGLRRKFDSID
                     LMTRLSILVKSTLAEITISPIIRYTPSDTDEPLLNIASVYSVQSFLLYTFWPPLTSSL
                     SADTSWNTIGTAMFQAIRVGLNCADFSKEYATENSELINENIRTWISCNIVSQIVGSS
                     FGFPPYVSFDHAVMSSTRITSPDNDPTMGSKNNSINEVQNISKELKQMVQIAHFENQI
                     INTMNSNPSNKLGMVSDQEKQPLLHVLSQQLSQLEINLQENNLDDIRKFLLLVAKVHL
                     LTYFFTNSSSTHNINNDNVKTLPMSEIEANFETKRGLVKVYNASINLLTHANEMWQLN
                     PAIIKYFPSVFVLNIWQSACIIGKLVHSSLATVLDITKGEAVYKDAVSLTFNASVLKY
                     DMAYRSSGIMRSIWSLFANIHDEWKKSNTEQNTNDIFTNDFNLGITVKSRMAVSVFFD
                     CLYILKEKCGMAKLQRETNGTQEYKDDDDDDGEEEGVVNDDTHDDEKQEDGISKKRSS
                     QDSIKLSRLKLLPNTKHPEQRARRIIETIPLDPHPINATSRLKGISPSNSPHNQNNHD
                     DTYRRASPSQLQRTNTPSSYSIIRDSQYSQQKQTSEIPPISDDINTPSTNSIPSVFSI
                     QQTNFNDQAMKYISPLTETTGGYNLALQDATLSIKNKQHRDSSGLSESNGNAKESPTS
                     LITNFDNWDSDLVWKDVDILMNEFAFNPTV"
     gene            <47437..>48774
                     /gene="NDAI0D00230"
                     /locus_tag="NDAI_0D00230"
                     /db_xref="GeneID:11494789"
     mRNA            <47437..>48774
                     /gene="NDAI0D00230"
                     /locus_tag="NDAI_0D00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669532.1"
                     /db_xref="GeneID:11494789"
     CDS             47437..48774
                     /gene="NDAI0D00230"
                     /locus_tag="NDAI_0D00230"
                     /inference="similar to DNA sequence:INSDC:YJR124C"
                     /note="similar to Saccharomyces cerevisiae YJR124C;
                     ancestral locus Anc_7.511"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669580.1"
                     /db_xref="GeneID:11494789"
                     /db_xref="GOA:G0W976"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G0W976"
                     /translation="MQIVKEVRDAPKDIKLLWLSVFLRLLAYGLTNQVLTLFLRAIDM
                     TEDKIGIFMSLTLVGDVFCSYILTWYADSWGRRNVLIYGSIMMMLSGLVFNYFENFYI
                     LLTFAIFGVISPSSDEVGPFKSIEESMIAHLSPMNRRPEIYAMHALVGTMGSALGAIS
                     CGIFIDLLKKMTWATSDLQCYKLVFLLYALFASGKVIVMLLLSEKTELDGRFHDHIED
                     EHLAEAIVNDEMVPLIEQLSHPNQKSNKLSQETVSVLVKLLVIFMVDSLGSGFMTSGW
                     MVYYYKNTFAMSAVGLGMTFFVSQFVMASSTIPSSIIARMFGPVRATLLVQIPSGIFS
                     ILIPFAESYLPISILLLNCHFLTTAMDVTPRQILLTNIIKPKDLTKVMGIVNIGKTFS
                     RCIGPIFTGILAKMNYLWLCYIISGSLVITADFILACWFLPIDAQILKQVNQQ"
     gene            complement(<49274..>49951)
                     /gene="NDAI0D00240"
                     /locus_tag="NDAI_0D00240"
                     /db_xref="GeneID:11494790"
     mRNA            complement(<49274..>49951)
                     /gene="NDAI0D00240"
                     /locus_tag="NDAI_0D00240"
                     /product="ribosomal protein S5"
                     /transcript_id="XM_003669533.1"
                     /db_xref="GeneID:11494790"
     CDS             complement(49274..49951)
                     /gene="NDAI0D00240"
                     /locus_tag="NDAI_0D00240"
                     /inference="similar to DNA sequence:INSDC:YJR123W"
                     /note="similar to Saccharomyces cerevisiae RPS5 (YJR123W);
                     ancestral locus Anc_7.509"
                     /codon_start=1
                     /product="ribosomal protein S5"
                     /protein_id="XP_003669581.1"
                     /db_xref="GeneID:11494790"
                     /db_xref="GOA:G0W977"
                     /db_xref="InterPro:IPR000235"
                     /db_xref="InterPro:IPR005716"
                     /db_xref="InterPro:IPR020606"
                     /db_xref="InterPro:IPR023798"
                     /db_xref="UniProtKB/TrEMBL:G0W977"
                     /translation="MSDVEAPVEVQEDFEVVEEFTPVVLATPIPEEVQQAQTEIKLFN
                     KWSFEDVEVKDASLVDYIQVRQPIFVSHTAGRYANKRFRKAQCPIIERLTNSLMMNGR
                     NNGKKLKALRIVKHTLEIINVLTDANPLQVVVDAIANTGPREDTTRVGGGGAARRQAV
                     DVSPLRRVNQAIALLTIGSREAAFRNIKTIAETLAEELINAAKGSSTSYAIKKKDELE
                     RVAKSNR"
     gene            complement(<50557..>52179)
                     /gene="NDAI0D00250"
                     /locus_tag="NDAI_0D00250"
                     /db_xref="GeneID:11494843"
     mRNA            complement(<50557..>52179)
                     /gene="NDAI0D00250"
                     /locus_tag="NDAI_0D00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669534.1"
                     /db_xref="GeneID:11494843"
     CDS             complement(50557..52179)
                     /gene="NDAI0D00250"
                     /locus_tag="NDAI_0D00250"
                     /inference="similar to DNA sequence:INSDC:YJR122W"
                     /note="similar to Saccharomyces cerevisiae CAF17
                     (YJR122W); ancestral locus Anc_7.508"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669582.1"
                     /db_xref="GeneID:11494843"
                     /db_xref="InterPro:IPR017703"
                     /db_xref="UniProtKB/TrEMBL:G0W978"
                     /translation="MKTFTCYGVRYVNRTYMITNSSKVHRFLSTKLLSSTSHRLKSTD
                     PNLANSGNATTSITPTGLFTYAELSNKSYIKIRGPDAPKFLNGTITSKLLPHFIKKNL
                     TTIETKTDDGNDSNIPKEIPEFDMTQGNWGLYQDSGFNGPYVTRFGQYTGLLNGKGKL
                     ITDLIVYPTPLLSQDATLMKYPTYLLELNNSIITRIVSTLETHKLTSKIKIEKLDPKE
                     FKTWDVSIKFENIPHDVENPWIDNILNPIQLMKTPEDAFAFTESVISTLFAGHEDDIL
                     AMYVERRTDPIVQLDGAAPQLFRIVTKNKVEDISKLFNQQAFPFEFSFGKVQPSTFRK
                     FRFHYGFVDGYEDIKPESNLPLELNFDYLPNTVSDNKGCYVGQELTARTFSTGILRKR
                     LIPVKLTNWEKLDNLIKNQVVNPDNETNCLLEVQMKSTGKEQNIVDKTMAPNPFTTKS
                     PFGTSNAHIAKKLRKKRPVGSLIAHEGENGIVMMRTEHFPSAFKPDGKDHGQFYISLK
                     ENENENDIENGKDIVGVVPKRPYWFHDWQRSN"
     gene            complement(<52693..>54231)
                     /gene="NDAI0D00260"
                     /locus_tag="NDAI_0D00260"
                     /db_xref="GeneID:11494844"
     mRNA            complement(<52693..>54231)
                     /gene="NDAI0D00260"
                     /locus_tag="NDAI_0D00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669535.1"
                     /db_xref="GeneID:11494844"
     CDS             complement(52693..54231)
                     /gene="NDAI0D00260"
                     /locus_tag="NDAI_0D00260"
                     /inference="similar to DNA sequence:INSDC:YJR121W"
                     /note="similar to Saccharomyces cerevisiae ATP2 (YJR121W);
                     ancestral locus Anc_7.507"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669583.1"
                     /db_xref="GeneID:11494844"
                     /db_xref="GOA:G0W979"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005722"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR024034"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W979"
                     /translation="MVLPKLYTTSTRASATQLAKNLMKRSTVSTRSMATAASTSGTVG
                     KVRAVIGAIVDVHFDQGTLPAILNALEIKTPEGGKLVLEVAQHLGENTVRTIAMDGTE
                     GLVRGEKVFDTGAPISVPVGRETLGRIINVIGEPIDERGPINSKLRKPIHCDPPSFAE
                     QSTAAEVLETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVF
                     TGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEY
                     FRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGVLQERITTTK
                     KGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSISELGIYPAVDPLDSNSRLL
                     DAAVVGQEHYDVATKVQETLQAYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQ
                     PFAVAEVFTGIPGKLVRLKETVASFKDVLEGKYDDLPENAFYMVGGIEDVVAKAEKLA
                     AEAK"
     gene            <55322..>57925
                     /gene="NDAI0D00270"
                     /locus_tag="NDAI_0D00270"
                     /db_xref="GeneID:11494845"
     mRNA            <55322..>57925
                     /gene="NDAI0D00270"
                     /locus_tag="NDAI_0D00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669536.1"
                     /db_xref="GeneID:11494845"
     CDS             55322..57925
                     /gene="NDAI0D00270"
                     /locus_tag="NDAI_0D00270"
                     /inference="similar to DNA sequence:INSDC:YJR119C"
                     /note="similar to Saccharomyces cerevisiae JHD2 (YJR119C);
                     ancestral locus Anc_7.505"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669584.1"
                     /db_xref="GeneID:11494845"
                     /db_xref="GOA:G0W980"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR003349"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:G0W980"
                     /translation="MKSEAEKHPLSFVPSLYPTDEEFANPIEYLSRPAIRDLGLEYGI
                     LKLIPPKGFNPPLALDKPNFEFPIRIQNLPHLNIQNRNRLSFMKQLNNFHKFNGTLGD
                     SKLDEPFIIINHPYTKKETKLYIYDLFIEIVRNALIIKIENDQTRKNAELIQNNKAEE
                     IKTMIYIDQYKEKNFTLSKKEIILNNNELWRKVSTCLEEFTIRDLKNVFHKYLSEYYD
                     YYIRETTITKGEKDYNTINVSQSVAWKNDTESILTDPEDSSDDTPLIPEDDDYWEWEC
                     HICHRFTKEFCIEFCDSCERPFHFACIASSKIKLDCPNPKTWVCKNCMIGNGVYGFRT
                     RTRPYKLSDFKKRCEREEDPKDKNLTISQLEDKFWGYVNDIKGHKVVKYGADIHNTTP
                     GQASGFPNREYMHMTPNYDSKEFEKYIDHPMNLINLPTAKGSLLKELRYKNISGLTLP
                     WLYVGSKFSTFCWHMEDQYTLSANYQHEGSPKIWYSIPPIYYGIFNSLIFDICPDLTF
                     KQPDILHQLISLISPYDKRFQKERIKCYKAIQNPNEYIITFPHCYHSGFNTGYNLNEA
                     VNFTTDFWVPYGINASREYRGTATPGLFDMYDLLVSVLDQFRSNNFTFRGKEKSYLLE
                     ETYAQVKFFFNAQKKIVDQLTTQFLRKPAKNIKFEKHLDSNCGRTLRRTSSDKKKIRK
                     KVNSSNSTSNDSKEAANEDIDIYCTKCKTICSFAFAVHYQDVVKNKGKEDDEGGFTNE
                     EEDASYEEADFDDMNEETGEGESVDIWNEMLAPEWNKLGEQGIQLLCLDDYKSFIRPH
                     EREMRKHKEAHHNNKECFCQVHKELFARDEVFYVRDWKGITDLLSDVCPFIFPLGDQE
                     ITCTRFNVFNL"
     gene            <58433..>58984
                     /gene="NDAI0D00280"
                     /locus_tag="NDAI_0D00280"
                     /db_xref="GeneID:11494846"
     mRNA            <58433..>58984
                     /gene="NDAI0D00280"
                     /locus_tag="NDAI_0D00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669537.1"
                     /db_xref="GeneID:11494846"
     CDS             58433..58984
                     /gene="NDAI0D00280"
                     /locus_tag="NDAI_0D00280"
                     /inference="similar to DNA sequence:INSDC:YJR118C"
                     /note="similar to Saccharomyces cerevisiae ILM1 (YJR118C);
                     ancestral locus Anc_7.504"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669585.1"
                     /db_xref="GeneID:11494846"
                     /db_xref="InterPro:IPR018815"
                     /db_xref="UniProtKB/TrEMBL:G0W981"
                     /translation="MASVLSSLNVLYFRITFLLTISYCCFKDVNLILQNTYFLILTQA
                     MNLPALQLPQHSGQLGLFGILFIFSALNDIVAILENNKKYLNSIVPIRLLGFFVLTGI
                     SFLWETNLFIHNNSVFIYSFLEMWINFVIYNSLREEKNEEFKLQNRFMNDSLIEEPTP
                     FEVANNAGAATIEIIEEEEIIEK"
     gene            complement(<59320..>60888)
                     /gene="NDAI0D00290"
                     /locus_tag="NDAI_0D00290"
                     /db_xref="GeneID:11494847"
     mRNA            complement(<59320..>60888)
                     /gene="NDAI0D00290"
                     /locus_tag="NDAI_0D00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669538.1"
                     /db_xref="GeneID:11494847"
     CDS             complement(59320..60888)
                     /gene="NDAI0D00290"
                     /locus_tag="NDAI_0D00290"
                     /inference="similar to DNA sequence:INSDC:YER021W"
                     /note="similar to Saccharomyces cerevisiae RPN3 (YER021W);
                     ancestral locus Anc_7.502"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669586.1"
                     /db_xref="GeneID:11494847"
                     /db_xref="GOA:G0W982"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="InterPro:IPR013586"
                     /db_xref="UniProtKB/TrEMBL:G0W982"
                     /translation="MSADLMEVDSIEDVDAVDSINSNNVQVKYAEETIMEEIIHLLKE
                     ISKTTTTLDPRYIWRALKELGSIRKNNLSQESLSALVNILYPDNSSFKIPLLKFINEN
                     HKSSVPHADEIRSKYPASFYQIVSNDSNNGGKTIEVAPELNSFIHLLVQVYLLDSSKF
                     NELSNFNTKIILPKILAFYNQRSLDLINAKLWFYIIIADEKIGNQSNPVLRSEMIKFL
                     RTASLKHDNETRAMLITLVLRNFLAAGEIESASDFINKIEFPTTDVSSPLEARYYFYL
                     SKISAIQLDYSMANEYIIAAIRKAPHNAKSIGFLQQSNKLLCVIQLLMGDIPELSFFN
                     QKNLKNSLVPYYNLSKAVRLGDLKKFTQTITKYKKNFITDGNYQLCVRLRSNVIKTGI
                     RIISLTYKKISLKDICLKLRLDSEQTAEYMVSRAIRDGVIEAKINHEKGFIETSELLN
                     VYGTKEPQTAFDERIRFVYQLHDECIVAMRYPEDKKLSNHNGKDDDGHGEFIDGELFD
                     ELDDFSDIEDMDFM"
     gene            complement(<61659..>63038)
                     /gene="NDAI0D00300"
                     /locus_tag="NDAI_0D00300"
                     /db_xref="GeneID:11494848"
     mRNA            complement(<61659..>63038)
                     /gene="NDAI0D00300"
                     /locus_tag="NDAI_0D00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669539.1"
                     /db_xref="GeneID:11494848"
     CDS             complement(61659..63038)
                     /gene="NDAI0D00300"
                     /locus_tag="NDAI_0D00300"
                     /inference="similar to DNA sequence:INSDC:YJR117W"
                     /note="similar to Saccharomyces cerevisiae STE24
                     (YJR117W); ancestral locus Anc_7.501"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669587.1"
                     /db_xref="GeneID:11494848"
                     /db_xref="GOA:G0W983"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="InterPro:IPR027057"
                     /db_xref="UniProtKB/TrEMBL:G0W983"
                     /translation="MSWFESLSELLDNSSIPWKTIVVAFSIGQFAFENYLTYRQYKVL
                     SKKELPPVLVNEIDKETFEKSEEYSKAKAKFSIVSDILGLVEKLAIIKYDVFPRLWHM
                     GNKLATILPYKYRVVSTVAQSLWFLLVLSNISTITGLPLAYYQHFILEEKFGFNKLTI
                     KLWIMDMIKGIVLGTAIGGPILYAFLKIFEKFETNFIWYVCLFLLIVQILAMTLIPVY
                     IMPLFNTFTPLEDGKLKESIENLAKSVGFPLDKIFVIDGSKRSSHSNAYFTGLPFTSK
                     RIVLFDTLVDNNSVEEITAVLAHEIGHWQKNHILNMLFYSQIHTLAIFSLFTSVYRNL
                     SFYNAFGFFIADTQMDINVHTPTKVFIDSFPIIIGFMFFNDLLTPLECGMQFMMSLIS
                     RLHEYQADAYAKALGYTQHLCRALIELQIKNLSTMNVDTLYSSYHYSHPTLAERLTAL
                     GYVSEKKKE"
     gene            complement(<63561..>64400)
                     /gene="NDAI0D00310"
                     /locus_tag="NDAI_0D00310"
                     /db_xref="GeneID:11494849"
     mRNA            complement(<63561..>64400)
                     /gene="NDAI0D00310"
                     /locus_tag="NDAI_0D00310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669540.1"
                     /db_xref="GeneID:11494849"
     CDS             complement(63561..64400)
                     /gene="NDAI0D00310"
                     /locus_tag="NDAI_0D00310"
                     /inference="similar to DNA sequence:INSDC:YJR116W"
                     /note="similar to Saccharomyces cerevisiae YJR116W;
                     ancestral locus Anc_7.500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669588.1"
                     /db_xref="GeneID:11494849"
                     /db_xref="GOA:G0W984"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="UniProtKB/TrEMBL:G0W984"
                     /translation="MTHLGKDPFMELSWFPESDSLYLSHAHEIVYSFLFYLTCSALIA
                     PMINKFIFGKHYTSIKDKNIKIDFNVHTVSMIQAIISMIIIYPTLFLPNDNTLNITTY
                     HHHYTSMVASLTLGYFIWDLLVCLKHFKLYGFQFLGHAVGALYVMIIALKPFCQPWIG
                     KFVLYEASTPFVNINWFIIQLTDPITKKCVIPTWVNVLNGLMLLVVFFLVRIAWGTLA
                     TLMIVKNMWHVKHQIPLISAFILMSINVLLNGLNFVWFSKMIKIAKKLAGGSSSSGKI
                     KQV"
     gene            <64823..>66109
                     /gene="NDAI0D00320"
                     /locus_tag="NDAI_0D00320"
                     /db_xref="GeneID:11494850"
     mRNA            <64823..>66109
                     /gene="NDAI0D00320"
                     /locus_tag="NDAI_0D00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669541.1"
                     /db_xref="GeneID:11494850"
     CDS             64823..66109
                     /gene="NDAI0D00320"
                     /locus_tag="NDAI_0D00320"
                     /inference="similar to DNA sequence:INSDC:YJR105W"
                     /note="similar to Saccharomyces cerevisiae ADO1 (YJR105W);
                     ancestral locus Anc_7.499"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669589.1"
                     /db_xref="GeneID:11494850"
                     /db_xref="GOA:G0W985"
                     /db_xref="InterPro:IPR001805"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:G0W985"
                     /translation="MLIRILTRTTGPKESRSGFNLALWKIYQNEKFLKNYNHQHYHHY
                     NFNSSYYSTTNSASLRSTSTSTSTPSPIEILKFIMSTASTTKEFPPLICLGNPLLDLQ
                     ATVTPDYLAKYNLKANDAILVDASSNDEKMKIFDEILTFPDVKFVAGGAAQNTARGAA
                     YILGSQKTNQVGYFGSVGNDKFSENLLNENKKAGVLSLYQIQSDIGTGKCAALITGHD
                     RSLVTDLGAANHFKPSHLEANWEFVQNAKLFYVGGFHLTVSPEAIVLLGKHAKETGKP
                     LVLNLSAPFIPQFFKDALVKVLPYATVVIGNESEAESYAESFGLDCDKKDLVAIAKSI
                     VGNDDKKTVIFTHGLEPTVVVSTKGVSTFAVKPLESSSIVDTNGAGDAFAGGFMAGLT
                     QGKDLETCIDMGQWLAALSIQEIGPSYPTEIIQYQA"
     gene            <67632..>69866
                     /gene="NDAI0D00330"
                     /locus_tag="NDAI_0D00330"
                     /db_xref="GeneID:11494851"
     mRNA            <67632..>69866
                     /gene="NDAI0D00330"
                     /locus_tag="NDAI_0D00330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669542.1"
                     /db_xref="GeneID:11494851"
     CDS             67632..69866
                     /gene="NDAI0D00330"
                     /locus_tag="NDAI_0D00330"
                     /inference="similar to DNA sequence:INSDC:YJR106W"
                     /note="similar to Saccharomyces cerevisiae ECM27
                     (YJR106W); ancestral locus Anc_7.498"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669590.1"
                     /db_xref="GeneID:11494851"
                     /db_xref="GOA:G0W986"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="UniProtKB/TrEMBL:G0W986"
                     /translation="MDFLFKITHPSLLYPNASYSFTFIIPSIIHVILSFVLLGMCASD
                     YLCPNVAQISELNRSSVSTRRRNSRTQDNSTNSSGVLMAVLLSWCNSSPDLFSNLMSW
                     TTTPKSSDPSLNAAALSIGEVLGACGIILCIVEGSIFIVMSRTNISINKLQRRNLLKD
                     LSFTTIAMCFMTYISLRNRVTILNCLLMCFVYVTYLVGKFSHNESKFISINDEENIIH
                     EHGSASSEQIDEQMEASSDPFMDLSTNQLNTGIKPSLISAMDYQSLLSILESSDSNSN
                     LEIDYSEDANELSTLSQENVHNTTIDNKTSIPYKDRPISEPIKSNLNNNNILPQRQIQ
                     TSPATFQPYSDTPETQRDDVFNNNNTNNNNQLTNNETILAPPVINIHKPRNRRKIKRI
                     QNSFLKIFLPHLLNFRKKSILHKILSILTIPFVIILRMSCPHPSAELVEFDENLQKYI
                     YSKLELMTLFIQGSLCPFVPYFLLSSLLFREPRMWLITLPSIIALCYIVLVISFYQTI
                     RSHNKFSIIITTADQESEINEKSQSRRSIESLNTIINITFLSIGILNSILYISVIANS
                     LIEMMEIYQSITGISKAILGLTIFAWGNSISDLISNIAMCRLYLRVPHQDDIEHITKI
                     ATKFFIISITSCLGGVMLNSMGGIGFSGLIAMLFIHKGSNYWWFLRYVELKEGESTTN
                     YNHKFIVSCIGIIIQLIILIIIFGGPDQVREWAQRKMRLLGIIMCNIWGVATLCNVLF
                     ELFT"
     gene            <70457..>71584
                     /gene="NDAI0D00340"
                     /locus_tag="NDAI_0D00340"
                     /db_xref="GeneID:11494852"
     mRNA            <70457..>71584
                     /gene="NDAI0D00340"
                     /locus_tag="NDAI_0D00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669543.1"
                     /db_xref="GeneID:11494852"
     CDS             70457..71584
                     /gene="NDAI0D00340"
                     /locus_tag="NDAI_0D00340"
                     /inference="similar to DNA sequence:INSDC:YJR107W"
                     /note="similar to Saccharomyces cerevisiae YJR107W;
                     ancestral locus Anc_7.497"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669591.1"
                     /db_xref="GeneID:11494852"
                     /db_xref="GOA:G0W987"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0W987"
                     /translation="MFAFTSKKSFVITLLITLFQFCSSSKMKPDLIPSSDFQDTNSVS
                     SRQQYQANSKKIVKITNPTYERLVYFSKMSGMTSCITQDTIIPGKTLNQGGCPSTIRF
                     CYDPLLNPTCSDTWIAAVLTAESGELGTGYVAIDHEKKVVICAFRSSTTIQDWFSDFE
                     ISPTKWNPVCVDEYKKMIERGIIKECKDCMIHRGFSKFSRTLGRFFLNKLENILRQYP
                     DYHSIVTGHSLGAALASMAGIELRLRGYEPSVITYATPRLFNNEMKEWVDELFHSKEL
                     HDTYVSKGEMKLDKGYYRIIHTRDYIPMVPPFYEPAGLEIFIDKISLPHYIEDLSYIG
                     LASEEASKQSIRDDLIEKVEEWLRTEEHRSYFINLAGCNGF"
     gene            complement(<71675..>71914)
                     /gene="NDAI0D00350"
                     /locus_tag="NDAI_0D00350"
                     /db_xref="GeneID:11494853"
     mRNA            complement(<71675..>71914)
                     /gene="NDAI0D00350"
                     /locus_tag="NDAI_0D00350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669544.1"
                     /db_xref="GeneID:11494853"
     CDS             complement(71675..71914)
                     /gene="NDAI0D00350"
                     /locus_tag="NDAI_0D00350"
                     /inference="similar to DNA
                     sequence:INSDC:Scer_YGOB_Anc_7.495"
                     /note="similar to Saccharomyces cerevisiae Anc_7.495
                     (Scer_YGOB_Anc_7.495); ancestral locus Anc_7.495"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669592.1"
                     /db_xref="GeneID:11494853"
                     /db_xref="UniProtKB/TrEMBL:G0W988"
                     /translation="MEGNDTVEEYYLNRLSSKDLEQQQQFKKLQEQQIYQRNSQAQQN
                     MSVVKIVQAEQASTTNGQKRVRNNMDVISYKRMKS"
     gene            complement(<72274..>75624)
                     /gene="NDAI0D00360"
                     /locus_tag="NDAI_0D00360"
                     /db_xref="GeneID:11494854"
     mRNA            complement(<72274..>75624)
                     /gene="NDAI0D00360"
                     /locus_tag="NDAI_0D00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669545.1"
                     /db_xref="GeneID:11494854"
     CDS             complement(72274..75624)
                     /gene="NDAI0D00360"
                     /locus_tag="NDAI_0D00360"
                     /inference="similar to DNA sequence:INSDC:YJR109C"
                     /note="similar to Saccharomyces cerevisiae CPA2 (YJR109C);
                     ancestral locus Anc_7.494"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669593.1"
                     /db_xref="GeneID:11494854"
                     /db_xref="GOA:G0W989"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005480"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005483"
                     /db_xref="InterPro:IPR006275"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:G0W989"
                     /translation="MTSIYKSTEPSVSTFNTPSYNPQLVEGVNSVLIIGSGGLSIGQA
                     GEFDYSGSQAIKALKEAEKKTILINPNIATNQTSHSLADKIYYLPVTPEYITYIIERE
                     RPDAILLTFGGQTGLNCGVALDKNGTLKKYNVKVLGTPIQTLITSEDRDLFAQALKEI
                     NIPIAESIACETIDQALDAAEQVKYPVIVRSAYALGGLGSGFANNAEEMKQLASQSLS
                     LAPQILVEKSLKGWKEVEYEVVRDRVGNCITVCNMENFDPLGIHTGDSMVFAPSQTLS
                     DEEYHMLRSAAIKIIRHLGVIGECNVQYALQPNGLDYCVIEVNARLSRSSALASKATG
                     YPLAYTAAKIALGYTLPELPNPITKTTVANFEPSLDYIVAKIPKWDLSKFQYVDRSIG
                     SSMKSVGEVMAIGRNYEEAFQKALRQVDPSLLGFQGSNEFGDKLDEALSVPTDRRVLA
                     IGQALIHENYTVEKVHDLTKIDKWFLHKCMNIVKMYKELEQVEKLNDLTQDILQRAKK
                     VGFSDKQIASSIKDPNVNEFDVRKLRKSFGIIPFVKRIDTLAAEFPATTNYLYTTYNA
                     TKSDVEFDEHGMLVLGSGVYRIGSSVEFDWCAVNTAKTLRNEGKKTIMINYNPETVST
                     DFDEVDRLYFEELSYERVMDIYELESSEGCIISVGGQLPQNIALTLFNNGCNILGTSP
                     IDIDRAEDRHKFSSILDSIEVGQPDWSELSSVEEANVFAAKVGFPVLIRPSYVLSGAA
                     MSVVNNEEELKNKLTLASDVSPDHPVVMSKFIEGAQEIDVDAVAYKGHVLIHAISEHV
                     ENAGVHSGDASLILPPQTLSDKVKADLKEIADKVAVAWKITGPFNMQIIKDGDKPLKV
                     IECNIRASRSFPFVSKVLGTNFIEIAVKAFLGGDKVPKPVDLMLGKKYDYVATKVPQF
                     SFTRLAGADPFLGVEMASTGEVASFGKDLLESYWAAIQSTMNFHVPLPDCGILLGGDL
                     SKDYLGQVAAILAPLKYKLYVTNEAAQKYILQHIGETAGSIVKIIEFPKNDKRKLREL
                     FQKYDIKAVFNLASKRAENTDDVDYVMRRNAIDFAIPLFNEPQTALLFAKALNAKLAE
                     KMKILESKEVIIPSEVRSWEEFVGFRPM"
     gene            <77608..>78444
                     /gene="NDAI0D00370"
                     /locus_tag="NDAI_0D00370"
                     /db_xref="GeneID:11494855"
     mRNA            <77608..>78444
                     /gene="NDAI0D00370"
                     /locus_tag="NDAI_0D00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669546.1"
                     /db_xref="GeneID:11494855"
     CDS             77608..78444
                     /gene="NDAI0D00370"
                     /locus_tag="NDAI_0D00370"
                     /inference="similar to DNA sequence:INSDC:YBL049W"
                     /note="similar to Saccharomyces cerevisiae MOH1 (YBL049W);
                     ancestral locus Anc_7.492"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669594.1"
                     /db_xref="GeneID:11494855"
                     /db_xref="InterPro:IPR004910"
                     /db_xref="UniProtKB/TrEMBL:G0W990"
                     /translation="MGLRYTSYIERPSNLTFKEKKRSSYNSISNNRSRNENVGTNRSG
                     IFSSAPSPIPPPRHLRYENGAFRIVRTPSSVVTTSLIYPHLNHESSTRSYRNGRRNHR
                     NHQNRHTVFSPTDNDFNSIYNNQYDENGNGNENENDEYYDEDEDGEGVEHDNMLFDNR
                     MSGITRSIAPSNGSISLKKFMTFGCRHCRTHLSSSNEIMSKDYRGKTGDAYLMDHVVN
                     VIEGTMETRPMITGEYLVCDILCHWCKNLVGWKYIQSEMNDQKFKEGKYILELETICL
                     CD"
     gene            <80006..>82225
                     /gene="NDAI0D00380"
                     /locus_tag="NDAI_0D00380"
                     /db_xref="GeneID:11494856"
     mRNA            <80006..>82225
                     /gene="NDAI0D00380"
                     /locus_tag="NDAI_0D00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669547.1"
                     /db_xref="GeneID:11494856"
     CDS             80006..82225
                     /gene="NDAI0D00380"
                     /locus_tag="NDAI_0D00380"
                     /inference="similar to DNA sequence:INSDC:YJR110W"
                     /note="similar to Saccharomyces cerevisiae YMR1 (YJR110W);
                     ancestral locus Anc_7.491"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669595.1"
                     /db_xref="GeneID:11494856"
                     /db_xref="GOA:G0W991"
                     /db_xref="InterPro:IPR010569"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G0W991"
                     /translation="MEYIKITKVENVVLHKRGIPVIGTLHLTTHHLIFSSNALSTEFW
                     FAYPMIGSVFKNQGSTLLSKLKDKNQLNESQFHNKSTFQWYEHRDLWSLINIKIIGKD
                     YTIISLDFINEFEANAVFDSLLKLTSLNDISQLYAFLYTPNRAELQFNGWNLYSPERE
                     FKRQGLQLIGNNDEHTEHGETFPWRLSLINSDYKFSSTYPSKLIVPTSTSDSLLTHAA
                     KYRSQNRIPVLTYFYKRNGASIVRSAQPLPGIINQRSIQDEKLVMECFNCCNKLPLNN
                     NIASISTRQNVIVDARPMTNAIAQVALGGGTENMDNYAFPQLSTPNGKNHTKRMFLGI
                     DNIHVMSDIMNSLIDNFLVDGDLNLPINKRQLNGITNSNLKKNLKNNSANTSSKGKNW
                     LKTIKILLSSTETLVKSVIFNGSNLLIHCSDGWDRTAQVCSLIELCIDPYYRTMEGFI
                     ILVEKEWVSFGHKFLERCGHLGSERIFHDNTTFSTTSTTKNIPSKIINDQRGLLGGGD
                     SHNDYDELLIMDKSLQNNINSNSVLINKMSNKFKINKKWKNNDLKFISPIFQQFLDCV
                     YQLLIQNPTSFEFNERFLRRLVYHLYSCQYGTFLFDNERTLIEMDAKHRTRSVWDYFL
                     SREKEFINTQYIPFQGNKDAMNEGEEIQGDNGNDIALISDEEDWILPDLNKIQWWWQL
                     YGRREDEMNGPFVAVDDSDLMKDKDNSTLDRSISVGESVKGIGLKLQSFGLDLFGKK"
     gene            complement(<82439..>83317)
                     /gene="NDAI0D00390"
                     /locus_tag="NDAI_0D00390"
                     /db_xref="GeneID:11494857"
     mRNA            complement(<82439..>83317)
                     /gene="NDAI0D00390"
                     /locus_tag="NDAI_0D00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669548.1"
                     /db_xref="GeneID:11494857"
     CDS             complement(82439..83317)
                     /gene="NDAI0D00390"
                     /locus_tag="NDAI_0D00390"
                     /inference="similar to DNA sequence:INSDC:YJR111C"
                     /note="similar to Saccharomyces cerevisiae YJR111C;
                     ancestral locus Anc_7.490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669596.1"
                     /db_xref="GeneID:11494857"
                     /db_xref="InterPro:IPR029032"
                     /db_xref="UniProtKB/TrEMBL:G0W992"
                     /translation="MNSFATHSILNPQRLIQLYQFHPKLKNIWYLVAATSFSVCNEPQ
                     EIPKLYHYAMSLSDDHAKKYRVTLAHKTMELVNNPDHDLKARLINEIYSNPSTPQLKL
                     TQKFRDALLTSGPLAGLPRAINGLSSLKEYTPTVLLPKTPQIDPWEAAMGREEPCPAT
                     MREQIHSMQDRTKIIQRGLNHWNSLYNKVSTRVVNNMNSSYPDLWYYALVHVYGPLLS
                     FVDVLNAQEKSLIVIASLVPQDVNPQLRGHLKGALNIGCDFETIEATRRLSILVSQWC
                     GITWRDGIVQLTKKKK"
     gene            complement(<84150..>84992)
                     /gene="NDAI0D00400"
                     /locus_tag="NDAI_0D00400"
                     /db_xref="GeneID:11494858"
     mRNA            complement(<84150..>84992)
                     /gene="NDAI0D00400"
                     /locus_tag="NDAI_0D00400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669549.1"
                     /db_xref="GeneID:11494858"
     CDS             complement(84150..84992)
                     /gene="NDAI0D00400"
                     /locus_tag="NDAI_0D00400"
                     /inference="similar to DNA sequence:INSDC:YJR113C"
                     /note="similar to Saccharomyces cerevisiae RSM7 (YJR113C);
                     ancestral locus Anc_7.486"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669597.1"
                     /db_xref="GeneID:11494858"
                     /db_xref="GOA:G0W993"
                     /db_xref="InterPro:IPR000235"
                     /db_xref="InterPro:IPR020606"
                     /db_xref="InterPro:IPR023798"
                     /db_xref="UniProtKB/TrEMBL:G0W993"
                     /translation="MLLPMLRNRGIAVSSSLIAITRPMSSYSTCPSIMNVKQIPLQHS
                     KRFQSTTTTTTNENISPGNLNESLQSLTDEEVDQWLESINELKKQFQQTGFNPETSLA
                     PPGQPKIDLIQESLQDQQFQPTKEQLEEYESLSGKPIPLKFDPIVKHVTNMIMRDGKR
                     AKAERIISKALYLVHRQLKVDPIQVLKENLENLSPLMITKTFKTKVAKAAMIPVTLNE
                     RQRHRIAWKWIVEGANSRVSKDFSVRLGEELVAVYKGQSSAFDKRDQIHKTSIAHRAY
                     IKLK"
     gene            <86277..>87239
                     /gene="NDAI0D00410"
                     /locus_tag="NDAI_0D00410"
                     /db_xref="GeneID:11494859"
     mRNA            <86277..>87239
                     /gene="NDAI0D00410"
                     /locus_tag="NDAI_0D00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669550.1"
                     /db_xref="GeneID:11494859"
     CDS             86277..87239
                     /gene="NDAI0D00410"
                     /locus_tag="NDAI_0D00410"
                     /inference="similar to DNA sequence:INSDC:YBL043W,YJR115W"
                     /note="similar to Saccharomyces cerevisiae ECM13 (YBL043W)
                     and YJR115W; ancestral locus Anc_7.483"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669598.1"
                     /db_xref="GeneID:11494859"
                     /db_xref="UniProtKB/TrEMBL:G0W994"
                     /translation="MKILCWFLHSYSIITQTNNQAKNKEMNSFTYTSIQKQKRLLTLV
                     EQKLSKCAKQGETKGYNLREMVGHANLLDQLLDNIQNFENFENHQRQHSYYYNNKNND
                     MMGPLPRITNYADPPISQDDDFFNKNNENMLIPRNLSAQPQNFYDIEKDDDNDYDSQE
                     QYHSYLGDTYAHTTTNSKSSYSLGTGTAEAIQKMNDMIPRSYVDDIGNMSSNSKNMGR
                     NNMNLEPMTKLPECPPLLSSSPSSVVPCSSDLETISEAPLSDEEYDIKPNIYGLTFAS
                     LCSKSNGYPSQSSPSSSSSSSSSICDRKDCTAHIKQGNLPQLTN"
     gene            <87785..>88252
                     /gene="NDAI0D00420"
                     /locus_tag="NDAI_0D00420"
                     /db_xref="GeneID:11494860"
     mRNA            <87785..>88252
                     /gene="NDAI0D00420"
                     /locus_tag="NDAI_0D00420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669551.1"
                     /db_xref="GeneID:11494860"
     CDS             87785..88252
                     /gene="NDAI0D00420"
                     /locus_tag="NDAI_0D00420"
                     /inference="similar to DNA sequence:INSDC:YJR104C"
                     /note="similar to Saccharomyces cerevisiae SOD1 (YJR104C);
                     ancestral locus Anc_7.477"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669599.1"
                     /db_xref="GeneID:11494860"
                     /db_xref="GOA:G0W995"
                     /db_xref="InterPro:IPR001424"
                     /db_xref="InterPro:IPR018152"
                     /db_xref="UniProtKB/TrEMBL:G0W995"
                     /translation="MVKAVAVLNGTAGVSGVVHFEQKSESDPTLVSWEITGNSPDAMR
                     GFHVHEFGDVSNGCVSAGPHFNPFGQTHGAPTDKVRHVGDMGNVKTDSQGVAKGSLSD
                     HMIKLIGPNSIIGRAVVIHAGQDDLGKGGNEESLKTGNAGGRNACGVIGVANN"
     gene            <88630..>89232
                     /gene="NDAI0D00430"
                     /locus_tag="NDAI_0D00430"
                     /db_xref="GeneID:11494861"
     mRNA            <88630..>89232
                     /gene="NDAI0D00430"
                     /locus_tag="NDAI_0D00430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669552.1"
                     /db_xref="GeneID:11494861"
     CDS             88630..89232
                     /gene="NDAI0D00430"
                     /locus_tag="NDAI_0D00430"
                     /inference="similar to DNA sequence:INSDC:YJR102C"
                     /note="similar to Saccharomyces cerevisiae VPS25
                     (YJR102C); ancestral locus Anc_7.474"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669600.1"
                     /db_xref="GeneID:11494861"
                     /db_xref="InterPro:IPR008570"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014041"
                     /db_xref="UniProtKB/TrEMBL:G0W996"
                     /translation="MNETNEPTRNEDNTSSGDQSSSLPATYSFPPLYTRQPNVMIRKQ
                     QINAWIDIILQFAQLHKYWIISQDGTPVSSNLSIFNNESIQRSVPQVFIDEIWSQMIQ
                     EKKALPVQEHHKNINQYFILWKDIQSWASIILQWFEDFNKLNQVVTIYELSQSDETME
                     YEFHQMPESLLKVCLKPLCKRNRATMLNDEHGTPIAIKVV"
     gene            complement(<89341..>90144)
                     /gene="NDAI0D00440"
                     /locus_tag="NDAI_0D00440"
                     /db_xref="GeneID:11494862"
     mRNA            complement(<89341..>90144)
                     /gene="NDAI0D00440"
                     /locus_tag="NDAI_0D00440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669553.1"
                     /db_xref="GeneID:11494862"
     CDS             complement(89341..90144)
                     /gene="NDAI0D00440"
                     /locus_tag="NDAI_0D00440"
                     /inference="similar to DNA sequence:INSDC:YJR101W"
                     /note="similar to Saccharomyces cerevisiae RSM26
                     (YJR101W); ancestral locus Anc_7.473"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669601.1"
                     /db_xref="GeneID:11494862"
                     /db_xref="GOA:G0W997"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019831"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="UniProtKB/TrEMBL:G0W997"
                     /translation="MLRMSRSIITRRSIHTIPKLNNITQLQTVGIPQILSAKGFNIIW
                     TQTQDYLCKKLTMNTMGTEMESNYPFHIVLKTSKDPMMSHVFNYASGVHNNHLFIENI
                     LPSATGKDNVPSKMFLNRVKEYFDGKTWEELKELMIQEAMTRCLGQGWLFLVERANKR
                     LDLMVLQNNGTPYYFGKNQQLDLNSAINLDEFNQLHDMKRRLKKGKGSPVVEGQEHDN
                     NKDWTVPIICVNLWDHAYLNDYGFLGKKDYIKNVLDNLNWAVINNRLYS"
     gene            <90373..>91377
                     /gene="NDAI0D00450"
                     /locus_tag="NDAI_0D00450"
                     /db_xref="GeneID:11494863"
     mRNA            <90373..>91377
                     /gene="NDAI0D00450"
                     /locus_tag="NDAI_0D00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669554.1"
                     /db_xref="GeneID:11494863"
     CDS             90373..91377
                     /gene="NDAI0D00450"
                     /locus_tag="NDAI_0D00450"
                     /inference="similar to DNA sequence:INSDC:YJR100C"
                     /note="similar to Saccharomyces cerevisiae YJR100C;
                     ancestral locus Anc_7.472"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669602.1"
                     /db_xref="GeneID:11494863"
                     /db_xref="InterPro:IPR005552"
                     /db_xref="UniProtKB/TrEMBL:G0W998"
                     /translation="MLPMKKLSIIRPLLYIPCLSKRSYSSAFKRVRNNNTPSSSSSNS
                     RSTVKNNITLPQETSPYVIQPNNTWNSQTSFLNEPTILIERQIEMMNVFLGYEQSNKY
                     IIMDVMGNRLGYMIEKDLSLWKSILRQFYKLHRPFTVDVFDNWNNLIMSIKRPFSWIN
                     SHIKTYVPREYEHIPSSSETSGSHSVLDEHDGILIGETIQNWHLWRRRYELFQRSSKG
                     QNEGMDQFGEIDAPFLSFEFPVLDSRGKIMASIDRNWVGLGREMFTDTGVYNLRFDSR
                     QSFNGIYPQESMSNQVLNLNQRAILLANAVSIDFDYFSRHSRHTGGGLLSFGNGGDYD
                     "
     gene            complement(<91649..>92485)
                     /gene="NDAI0D00460"
                     /locus_tag="NDAI_0D00460"
                     /db_xref="GeneID:11494864"
     mRNA            complement(<91649..>92485)
                     /gene="NDAI0D00460"
                     /locus_tag="NDAI_0D00460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669555.1"
                     /db_xref="GeneID:11494864"
     CDS             complement(91649..92485)
                     /gene="NDAI0D00460"
                     /locus_tag="NDAI_0D00460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669603.1"
                     /db_xref="GeneID:11494864"
                     /db_xref="UniProtKB/TrEMBL:G0W999"
                     /translation="MRFNSKLFCFVCLSSILSVVINSTNAAPITIAANQPSLSMFYIM
                     MLVQVYVMFQSLGACSMGWTPITATACYLSLIAAMINLLAMVLQGLDRFEEDMAIKLS
                     ASDFLLMLGIHDFKKFHKFTFGIFDVNFNLYGLDIDGSTHLNCIEFITRSNILLPKDT
                     DVEVCVSDIGKERVRNLPHKFTKSELLKKIKKLIENEKFNDVLENPLLFYKLLWGMYG
                     ENTIQFLDELYRMVNSLRSDKWKIIHAEDSSAKKLEESIHLYSDPVLHDRELLYRFRI
                     FR"
     gene            <98485..>99540
                     /gene="NDAI0D00470"
                     /locus_tag="NDAI_0D00470"
                     /db_xref="GeneID:11494865"
     mRNA            <98485..>99540
                     /gene="NDAI0D00470"
                     /locus_tag="NDAI_0D00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669556.1"
                     /db_xref="GeneID:11494865"
     CDS             98485..99540
                     /gene="NDAI0D00470"
                     /locus_tag="NDAI_0D00470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669604.1"
                     /db_xref="GeneID:11494865"
                     /db_xref="UniProtKB/TrEMBL:G0W9A0"
                     /translation="MAQVITHSIFNYNKDVLEDNDKSMWEHPTDRAAELPYKKIRITA
                     FRYEIIEVSDGNTNKMRGMAFFEKLKNGHNSTRVFLVPSFYHDLYSDCLSPMPIAGHF
                     LFRDQYFRVAKVYFMKVGTDVVISLESGVFDTAVVNMLVQDLAAGHLFHPGSDWYLRQ
                     SLRRFTLSLDTTIKEWENVYHPPAKKLTCQDVREEISKLIDIEGLLNLAPKILSEDIT
                     IAGGFSEQESEERRKRLHRVIIPAKQRTYDVKIILFCRIYPELPRKLFAGLVGLMQTF
                     MKVLSPVLSTLSQLNTISTPAKIIVLLMALTVSNVWITYIPPVALTDAVSITHEMVWH
                     PLKILLGSFGWLFSRFH"
     gene            complement(<100433..>101197)
                     /gene="NDAI0D00480"
                     /locus_tag="NDAI_0D00480"
                     /db_xref="GeneID:11494866"
     mRNA            complement(<100433..>101197)
                     /gene="NDAI0D00480"
                     /locus_tag="NDAI_0D00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669557.1"
                     /db_xref="GeneID:11494866"
     CDS             complement(100433..101197)
                     /gene="NDAI0D00480"
                     /locus_tag="NDAI_0D00480"
                     /inference="similar to DNA sequence:INSDC:YJR099W"
                     /note="similar to Saccharomyces cerevisiae YUH1 (YJR099W);
                     ancestral locus Anc_7.470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669605.1"
                     /db_xref="GeneID:11494866"
                     /db_xref="GOA:G0W9A1"
                     /db_xref="InterPro:IPR001578"
                     /db_xref="UniProtKB/TrEMBL:G0W9A1"
                     /translation="MMVSHEDKERAVIPLESNPEVFTDFAKNLGLDPLFAFHDIYSLT
                     DADLLAFLPRPVKAIILLFPISDKQEKQDDVIKNDTQSVMSLSSKDAVWFKQTIKNAC
                     GLYAILHSLANNKSMLTSDSILGQFINDNYETKNENNGNKNELTDDFIFDICNKFLKI
                     FEAGETKAPDAHSDVDLHFITFVSNDKNQIFELDGRNPKGPSYLGDITASKNNADDTD
                     LIGEKAIIDRVQWYMDNVEEGNSLNFSLLGLSKSWD"
     gene            <101486..>103807
                     /gene="NDAI0D00490"
                     /locus_tag="NDAI_0D00490"
                     /db_xref="GeneID:11494867"
     mRNA            <101486..>103807
                     /gene="NDAI0D00490"
                     /locus_tag="NDAI_0D00490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669558.1"
                     /db_xref="GeneID:11494867"
     CDS             101486..103807
                     /gene="NDAI0D00490"
                     /locus_tag="NDAI_0D00490"
                     /inference="similar to DNA sequence:INSDC:YJR098C"
                     /note="similar to Saccharomyces cerevisiae YJR098C;
                     ancestral locus Anc_1.114"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669606.1"
                     /db_xref="GeneID:11494867"
                     /db_xref="GOA:G0W9A2"
                     /db_xref="InterPro:IPR003386"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0W9A2"
                     /translation="MSNSRPTTPLSTTSAGSGIAATRPTGIPTSSHYTISPRISSESK
                     NVRPAYLNDPAETGSFSYQGVETVHNFDTMDANALIGGSQVRPSKITDKKHRHIHNQE
                     DVLYHTNTVSAADTIVAASAASSATDDLSPSSSNRSQHTWHSFIHRPSREQERKRKQS
                     INEEEDRINAVTAAEQEAVLETEEEEEEEEEGEGDETSSIISSSSSRASVQKLTTTTS
                     MVTTRTKIKKPKKKTTIKPNTTHTIFSFSLPFGSTNLIPSTPITIIKNILVTENEKEK
                     IKTKLKRNGSISSLEERMLFQDDYGIDNGHVRAVKETLRIDSLRSSIRQLKVAESNGT
                     ARTKDGYLLTRLSSIWNELEGDIVILGGYRGSILRDAHTGKRIWVPIKAGFNMITNDL
                     LLGPNDEDEMNVEKNIIPDGMLTHVGPVDVSKRLIKKLEGNPKVHIEDFGYDWRVSLD
                     ISAIKLKDKLQELYDKQPEGNKKGTYLIAHSMGGLVAHKVLQDYTHLVRGIIYVAAPS
                     QCPNILGPLRFGDEVMWNKTLLSKEANFFMRSSFYFLPLDGRCWIDSKTYKDYDLDYF
                     DVNVWIKYGLSPLVSEKRLKLIESRKKNVNNNLRRKIQVMPFLARIKCDNKFVLGSVP
                     IVKKVPYIKEEKSAFVETIDEREFRTSYATCVEYLSRTLRRAKAFLESLEYIPDKKYP
                     PLVIVHGNTVPTVRGGKINGLVDLKNAHYDDFYYGPGDGVVYYKWLLPEQRGFPIESK
                     ISSDMGHVSLMADHKAMAKAFIDLVDAEKRDAS"
     gene            complement(<103935..>104507)
                     /gene="NDAI0D00500"
                     /locus_tag="NDAI_0D00500"
                     /db_xref="GeneID:11494918"
     mRNA            complement(<103935..>104507)
                     /gene="NDAI0D00500"
                     /locus_tag="NDAI_0D00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669559.1"
                     /db_xref="GeneID:11494918"
     CDS             complement(103935..104507)
                     /gene="NDAI0D00500"
                     /locus_tag="NDAI_0D00500"
                     /inference="similar to DNA sequence:INSDC:YJR097W"
                     /note="similar to Saccharomyces cerevisiae JJJ3 (YJR097W);
                     ancestral locus Anc_1.113"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669607.1"
                     /db_xref="GeneID:11494918"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR007872"
                     /db_xref="UniProtKB/TrEMBL:G0W9A3"
                     /translation="MTKSSSRITHYEVLNINSDATLQEIKKAYKQKLLNIHPDKSSTQ
                     ILPISITTNDLTSVSINQIQQAYKILSNESTREQYDEELLETFKKLGYHNHGDGLDEF
                     SLDDFTFDETTCNYNMNCPRCKTLNGFQFNEDSLDEFANTNINTNTNTNGGSSAFQVL
                     AQCNSCSLWLKVNFAIASEDENEDENEDEE"
     gene            complement(<105042..>106088)
                     /gene="NDAI0D00510"
                     /locus_tag="NDAI_0D00510"
                     /db_xref="GeneID:11494919"
     mRNA            complement(<105042..>106088)
                     /gene="NDAI0D00510"
                     /locus_tag="NDAI_0D00510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669560.1"
                     /db_xref="GeneID:11494919"
     CDS             complement(105042..106088)
                     /gene="NDAI0D00510"
                     /locus_tag="NDAI_0D00510"
                     /inference="similar to DNA sequence:INSDC:YJR095W"
                     /note="similar to Saccharomyces cerevisiae SFC1 (YJR095W);
                     ancestral locus Anc_7.467"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669608.1"
                     /db_xref="GeneID:11494919"
                     /db_xref="GOA:G0W9A4"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G0W9A4"
                     /translation="MPQQKTDKKSGPIINLVAGGTAGLFEALCCHPLDTIKVRMQIAR
                     RSANIKPHGFIKTGNLIYSQEGFLALYKGLGAVVMGIIPKMAIRFSSYEYYRSALTNK
                     ETQTISTGNTFIAGVGAGITEAVLVVNPMEVVKIRLQSQHIPVTAPAVTATSAVLSSG
                     GTAAATGTAAAVGSAPKYTNAIHAVYTIVKEEGVSALYRGVSLTAARQATNQGANFTV
                     YSQLKDYLQKYHKVESLPSWETSLVGLISGAIGPFSNAPLDTIKTRLQKDHSLSSKNH
                     SAWKKITIIGTQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRKQMEKYDFFK
                     PAGASSKPSSKPLK"
     gene            <108190..>109140
                     /gene="NDAI0D00520"
                     /locus_tag="NDAI_0D00520"
                     /db_xref="GeneID:11494920"
     mRNA            <108190..>109140
                     /gene="NDAI0D00520"
                     /locus_tag="NDAI_0D00520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669561.1"
                     /db_xref="GeneID:11494920"
     CDS             108190..109140
                     /gene="NDAI0D00520"
                     /locus_tag="NDAI_0D00520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669609.1"
                     /db_xref="GeneID:11494920"
                     /db_xref="UniProtKB/TrEMBL:G0W9A5"
                     /translation="MLSTIMIPKFARENQEEQSTENHDLIQTQPIHLRKHTKEISQNF
                     FLESENKIRLANFPTNSESNNNNNNNNPNGDSRSASLNSLFSTYNNNSNNSNNNYENG
                     YDILQWDIQEWEENEYNEDYINIDNDYGYDSKEPQSFDDGYYYSFPSKPNTHDPNLLK
                     FHYFYPRVSTGNNNDYSNLKYPSYEVNIPRVGSPTNKVLKIRNVSTSAREKRTLAYDD
                     HYGNDYVVNMEEDNLLYQTNKFISSDQNIMPIDDDGDDDDDELFQILHYKLARYLGVT
                     NNYNNIIYQDAYNDKSPREQEYLQQLRLEEISCRFSTTYF"
     gene            <109657..>110772
                     /gene="NDAI0D00530"
                     /locus_tag="NDAI_0D00530"
                     /db_xref="GeneID:11494921"
     mRNA            <109657..>110772
                     /gene="NDAI0D00530"
                     /locus_tag="NDAI_0D00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669562.1"
                     /db_xref="GeneID:11494921"
     CDS             109657..110772
                     /gene="NDAI0D00530"
                     /locus_tag="NDAI_0D00530"
                     /inference="similar to DNA sequence:INSDC:YJR093C"
                     /note="similar to Saccharomyces cerevisiae FIP1 (YJR093C);
                     ancestral locus Anc_7.464"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669610.1"
                     /db_xref="GeneID:11494921"
                     /db_xref="InterPro:IPR007854"
                     /db_xref="UniProtKB/TrEMBL:G0W9A6"
                     /translation="MSSSDEEDDKFLYGSDTENDNTSTGKRTFDEANGNHSDVQVTNK
                     KPKVLSASTLDLSKPSETSSSTSDEDSDGEESDYDSDFDIEFIISAGPDTSRLDSMDT
                     TSISTATTTPIPITTTTTTELPKNAISVASDEVLPDNLIENDVKAEPTPTATGYSMAN
                     DESSTITSDSLKNNKTMLGSIDLDKDGLFEGEPITNIDPEVLREKPWRQPGANLSDYF
                     NYGFNEFTWLEYLKRHEKLRIEYNPRRILMGLLSLQQQGKLDPQNTTTQNNDTTNVNN
                     NMIPNNMSPPKQQQMTQLNQQSQKQPPLMPPVGFPPMPMFGGFPPFGMPNMMAPLPAQ
                     FQPSQGLKQSSPPSQFQQQQQQQQQKQPPPNQQQINK"
     gene            complement(<111078..>115082)
                     /gene="NDAI0D00540"
                     /locus_tag="NDAI_0D00540"
                     /db_xref="GeneID:11494922"
     mRNA            complement(<111078..>115082)
                     /gene="NDAI0D00540"
                     /locus_tag="NDAI_0D00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669563.1"
                     /db_xref="GeneID:11494922"
     CDS             complement(111078..115082)
                     /gene="NDAI0D00540"
                     /locus_tag="NDAI_0D00540"
                     /inference="similar to DNA sequence:INSDC:YJR092W"
                     /note="similar to Saccharomyces cerevisiae BUD4 (YJR092W);
                     ancestral locus Anc_7.463"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669611.1"
                     /db_xref="GeneID:11494922"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR012966"
                     /db_xref="UniProtKB/TrEMBL:G0W9A7"
                     /translation="MSEIDPEETVESLMKEIEHDMEVAKEKFNEQFQVETKDSNILFN
                     ALKNEDTNLNTINEDDNNDESELFIPLHDTSREPLCELKSPLRMNNSNSVPSIHSSPL
                     RMKQMIEEHYGADDRTLQTFSPTKDILYIMKGTKPLLSSSTSNGQLISELELNILNDD
                     DSDPSYLLENNSNLMDEDDDVSFIERSPQRIHFPSKIPIINTMTINTFSKSNLEDEND
                     VNSSGIADSSYSIDIDDNNSDNHVHLVTKKYKLGNQECNNDMTSLEEIQNHSISTQHS
                     PTMSAYVEELDILDTSSLHISNVGDNELLNEHITSDNSILPNIASDLPRLSSPHDERR
                     EEEENCAYLSGPEFVDTLIDCVSIVASKDEEEKLEYGYNSGPDFNDRMINTVDIISTG
                     SIEENKTESVFLMDNDHELKIKTKRTNLSLSNDIDKLAVNSEIDNPDINEPKIEVKIA
                     ENNQSLRYLQKSEEQDIIDLERKPEKKQVKIPKLVKNYLEKINFEDRKQSKIKEILQD
                     EEFPKQKAIRTPVPKVEERKTTPLLQFNTTFSPLLPVIPVLEKLIQDDPFSEPVPHET
                     ALPPYPNSKFSKVTPPTTYIHIWHQQESYPPLTNPTSITSKRTISPTSSYNSNFSQVS
                     SASTKLTVGSTVNTSNNNYAASPPLTPTIHQSLTATNFKFKPKLATRPRRIMLDPMRR
                     NTIKSKKIQERINESKSFKPNLSYPERFYEEQDYSIGDDIYEKEEEEEEEESSHAAIL
                     QNLKPKNFKVWNEYFNKDHEDDGVNKYDSIAPEVIQKLLKDESFLDGDYDDNTLAVAH
                     SIKGREYEDKNKSADMNLNIGLGILRTPVKCVSVDEGLSFKGYEPSISDNDDYENSKN
                     NNDNAVEMSIHTPKSNSINGDIHSFERMNPSQNHIHSPFKVVSPKKNSKGMNVSQDII
                     SLREENQEINTIHDDDIAAPAQTKENDKTKDAFDECTSKEIGKRNKDEATAEMTDLGV
                     LYVTIKKITNIRLSNILQHKGKYCIEFDNGTNMFTTPWEIMPSDGNLMFGKEFEIPLK
                     LDRETMKPLDIELQITLKIKYMKLENELVEIVEKVPIAKKKKLPFAKTKYQMIKRYVS
                     RPTRYDDWGNLFAEDGSFGQTKVRINETNLKRCEFIKCNENFDMINRWAKGLTSKDSA
                     GGYHPIHVPSRAPPYSIGNIELEMCYLKRSSSLERFPKSLDLAQDILKKIREQESINK
                     EGYLLQEGGDVTGIFQRRYFKLNGIEMIGYHEITQEPKVNINLLKVIDVINIDDTVTE
                     ANKRIFTDSVLMGECFQLVFDDGEIITFNVEANYKERKDWYRKIKKVVELNTLRQPWI
                     KQFNENSKIEKIFR"
     gene            <117204..>120905
                     /gene="NDAI0D00550"
                     /locus_tag="NDAI_0D00550"
                     /db_xref="GeneID:11494923"
     mRNA            <117204..>120905
                     /gene="NDAI0D00550"
                     /locus_tag="NDAI_0D00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669564.1"
                     /db_xref="GeneID:11494923"
     CDS             117204..120905
                     /gene="NDAI0D00550"
                     /locus_tag="NDAI_0D00550"
                     /inference="similar to DNA sequence:INSDC:YJR091C,YPR042C"
                     /note="similar to Saccharomyces cerevisiae JSN1 (YJR091C)
                     and PUF2 (YPR042C); ancestral locus Anc_7.462"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669612.1"
                     /db_xref="GeneID:11494923"
                     /db_xref="GOA:G0W9A8"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0W9A8"
                     /translation="MHTMNNDLTSNKKNKKQQPSADSSLSKIPEVIDPGITIPIYDDE
                     DERADNSLLTENGSSNGSSQLENNSNNQQNAAPQKLGSYRARAGKFSNTLSNLLPSIS
                     AKLHHSKKSATHLKNINPENDTAEFPNSSSGSSTVDLSNFPLTPIKNQQKVAGSSTTT
                     TAIPSKTINDLTPPNENAKLVHFPDSATTTTNAFMNIPRSSNDSFTFNSPLPTNRSSR
                     SRNNTTSSQITSLSGAQQINNNSMASGIWATTSNSMDPLQQQILQQINSNTTAVSASN
                     STMNPNMNQYNLTGVQDYSTIQPLQPSQQPLPNYYDVMSSQNNTNNRNSTTQQQHSHS
                     HPQSINLQLPGAIWNNNGRQRSQSNASSIYTDAIQFYDQQQQQQQSTSRSRRTSNYSS
                     QQMQQQQQQQQQQQQQHNICPIVGDETDPISINWVSLDPSVPPINQINHLLPTNTISF
                     SNIFPLQHQQPQLNNAINLTSTSLATLCSKYGQVISSRTFRGLNMALVEFDTVENATR
                     CMDALQGKDVSVIGTPSHIAFAKILPMHHSNQQQQQQQAQSFNMLKNENQQKPLLYEQ
                     LYNGALTFQQQGNISIPVFNQYQIQNPSSNQSQQNYNHHHYPGHSISSLSSNPNYNNN
                     NNNNNNINKYTNPSTTTQPSSSATNTGEKEQCPFPLPPPNLSMESKDLKTIVHSFKTK
                     CDQVQIDALIQNGINYKGTSDTTNFGPLPEPLIIKEFDAPKLRELRKSIDSNSISNLE
                     LEQLALSMIDELPELSSDYLGNTIVQKLFEKSSDLIKDIMLRKTCKYLTSMGVHKNGT
                     WACQKMITMAKTARQIDLVTKGVKNFATPLMNDQFGNYVIQCVLKFGFPWNDFIFQNI
                     ISNFWIIVQNRYGARAVRACLESHEIITAEQTLVLSAMIVCYSKYLSTNNNGTLLLTW
                     FLDTCTLPKRHTILAKVLIPNIVELCRHRLASLTILKILNFRGDEEARKLIFESIFGG
                     SPDFSSSSSPAKNLNDKNNDYNNNNNLLQILNDYSYGPTFIYKVLSMPLLEDDVRSHI
                     IKQVRNVVMESPIPQQHRRLMEEIGFDTMTTNNSINQQPQVQVHTSGPIQTHTDRKSS
                     LTANVYNATVDPNINHIRGLSVSSIRSNGSRQQNGLLPTSSNNANGSTTNTINALPQN
                     TNKNNNIPPSYFNYPGMFPGNNYPVPNDDLVSQFDMLALNNGTHLSLPQLSVTNQDNT
                     VTSFLNRTTSNSNTNTNPTTATTDQSQPN"
     gap             121042..121061
                     /estimated_length=20
     gene            <121520..>124897
                     /gene="NDAI0D00560"
                     /locus_tag="NDAI_0D00560"
                     /db_xref="GeneID:11494924"
     mRNA            <121520..>124897
                     /gene="NDAI0D00560"
                     /locus_tag="NDAI_0D00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669565.1"
                     /db_xref="GeneID:11494924"
     CDS             121520..124897
                     /gene="NDAI0D00560"
                     /locus_tag="NDAI_0D00560"
                     /inference="similar to DNA sequence:INSDC:YJR090C"
                     /note="similar to Saccharomyces cerevisiae GRR1 (YJR090C);
                     ancestral locus Anc_7.461"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669613.1"
                     /db_xref="GeneID:11494924"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR006553"
                     /db_xref="InterPro:IPR026940"
                     /db_xref="UniProtKB/TrEMBL:G0W9A9"
                     /translation="MSNNNSNGNQSVNNDVDMDIDDLSNNEQPSINQNSRQQNLWYPT
                     NRQASTVSQLPSLFRQTSIRLGDNNNNNNNMLRMSDANVTTTTNMNPIPHSADLLLEA
                     SALLADNPNRTRSANMKMNNTHSNNNNNNNNDLLLTMATDLANLQTNIELLSEEDAQQ
                     VLEFQTLLREKTILFLNNIEKRRQETLENLHIDNLKLQHSQSPQASIILNKLQRMRVR
                     AVETETRELQKLRLKILTIVDEYEKSLEYYYTHRGLDTNYMTIINPTYLFKEWVQSLD
                     PDTNPELTDGLNQLNEKSRRLLIDILHTTKNPDLFANPPRDQALIRYSNNMYVPFPLH
                     KMPSEILHLVLDKLANRNELVYLLTVNKLWAEIIVKIIYYRPHLNKKHQLELFMRTMS
                     RTNTETIFDYRSLIKRLNFSFVGDFLTDEELMYFIGCSNLERLTLVFCKHITSAPVAA
                     VLNNCKYLQSVDITGVKEISDDVFDSLARSCPRLQGFYVPQAKTVTLNSLTNFIHHVP
                     MLKRVKITANVNMNDELVELMADKCPLLVEVDITSSPNIHDSSLLKLFTKLTQLREFR
                     ITHNLNITDQFVLELYKKVKLLPSLRLIDFSSCDLITDRMIETLVLMAPKLRNVFVGK
                     CSKISDRSLRSLAKLGKNLQTVHFGHCFNITDQGVRTLVQSCPRIQYVDFACCTNLTN
                     RTLYELSDLTRLKRIGLVKCSQMTDEGLLNMISLRGRNDTLERVHLSYCSNLTIYPIY
                     ELLMACPRLSHLSLTAVPSFLRPDITAFCRTAPADFSDNQRQIFCVFSGRGVHRLRHY
                     LMSLTTPTDSPQTSIHDVLTRYIIAKNMLKPGESIKDAIKRITKDLTKESAAILTATS
                     INQISGINTDYSHIEFGAIPNLISWTRESVEYDEATITGTDELIDEVDTSFCDDPFQE
                     RFNNGEVIVAPGATRELNRQLCHAIKKFHELFDRVEDFEVNVASLARVQFQFTGFLLQ
                     EMSNIYLQLDDWNNLLARMQMETYRSGIEENIRGFYTWKLSFVEKPEKALEKFEISTV
                     VLRLYLKDSLALLARQRELILAQQRNGWNANGNGNQGENGAPDAVQNINDRAPLSPEQ
                     MRILQFGLPAEVIMDEDRLRTQVGESRSETPEEEVTD"
     gene            complement(<125340..>128330)
                     /gene="NDAI0D00570"
                     /locus_tag="NDAI_0D00570"
                     /db_xref="GeneID:11494925"
     mRNA            complement(<125340..>128330)
                     /gene="NDAI0D00570"
                     /locus_tag="NDAI_0D00570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669566.1"
                     /db_xref="GeneID:11494925"
     CDS             complement(125340..128330)
                     /gene="NDAI0D00570"
                     /locus_tag="NDAI_0D00570"
                     /inference="similar to DNA sequence:INSDC:YJR089W"
                     /note="similar to Saccharomyces cerevisiae BIR1 (YJR089W);
                     ancestral locus Anc_7.460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669614.1"
                     /db_xref="GeneID:11494925"
                     /db_xref="InterPro:IPR001370"
                     /db_xref="UniProtKB/TrEMBL:G0W9B0"
                     /translation="MSKTIKLDIPSDSPLYSIDSRLQTFRETTTIDKKKFKWRYTVIP
                     FENMSQLGFFYHPFKDPKTNQIHRDAVCCIYCHHLTSNFQKCRTKSIIQTFTKVLKKH
                     LDSSPNCSILQMKLSALEDELSLTNNQNNSISSIPLSNLYSKIFENPDTINAAWSTFK
                     GDPWFFQPSNNWNEISIKEAGLVKYDPSFTKFNNLLKDKQNKKNFKHSCYCWYCNTLI
                     IPDETNNNLSPKEHHIQKIEKNSKKCYFLERMINTKNININNSKNNIKSKESSTFDYT
                     NNIPNSTSLQSIDQNFSPASNPNKTTDPSRNVTDNNKDNNNRKDNDVISSSPIRKKRK
                     LQKLSPQMISENETSLNNNSSSSLSMSLSQKKKNTDKDLVVNFHGHVNRKRNTTDKKA
                     SSQSKQRINPIIDDSTNDEFSFSNQGHSTFDIPIPTSSVHLSKETPSTTKQSPTPLSA
                     ENRTKATEIEHVDNNNNSKNIENDNVTDDMDDLSKLKAIPLIKFTANKTSRRKQVGIA
                     PRDEDNIIKATGNQRAQSSKDKVDTSSTPRPSIGKMNSPAPSLSKETEYIEPFQKDKD
                     QEKGSVSTIKTRKRSTSVSSTSGSSSYSPSSEFESGSESEPNSDRSSSSNLGSNQDSL
                     ESIPSIPLEIEDVKEQPINALELDESKKSKQEPLRAEETVKLVNNNDRIEQVPENNEL
                     ANNSIRLSNVNDLEMESTPLTTRALIQHDKAMAASPSNPFILFVFNVFLILIKYIIYS
                     NSKSEKKDPLPALLELYPDDNGIIEQSPSLRANKKEEGTPPMESTSVPDFVKAGSNMR
                     TGGVLGISNRTSIILPQHESNFNVNSNSSSKFNLIGLNQHSSNISTMHILQERSLSHS
                     YSIQTPLKQSSVPVVENESQHAATNPDSSVQVDFEMPEVPSSQPRISPSPLEERFKIE
                     EEYKNNDFLQELNKIDENTLIVKKYFHKLLKYINNNDATLHHDRDGDLTFFINQMPNT
                     ELDMTFEEWIKSKKIIYSRNFKRR"
     gene            <128715..>129284
                     /gene="NDAI0D00580"
                     /locus_tag="NDAI_0D00580"
                     /db_xref="GeneID:11494926"
     mRNA            <128715..>129284
                     /gene="NDAI0D00580"
                     /locus_tag="NDAI_0D00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669567.1"
                     /db_xref="GeneID:11494926"
     CDS             128715..129284
                     /gene="NDAI0D00580"
                     /locus_tag="NDAI_0D00580"
                     /inference="similar to DNA sequence:INSDC:YPR037C"
                     /note="similar to Saccharomyces cerevisiae ERV2 (YPR037C);
                     ancestral locus Anc_7.456"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669615.1"
                     /db_xref="GeneID:11494926"
                     /db_xref="GOA:G0W9B1"
                     /db_xref="InterPro:IPR017905"
                     /db_xref="UniProtKB/TrEMBL:G0W9B1"
                     /translation="MVMIHLNKKHIRLVVGIITMVTIFVLITRYSEELQGQINNISSS
                     TSNSSGNNEKERDPEAEAKHKKMMEETIMPSMTDTKAKKELGNASWKYFHTLLARFPE
                     NPTDEERSKLKSFIQLYAELYPCGECSYHFVKLLDKHPVQTSSRLAAATWGCHMHNIV
                     NQFLKKKQYDCSKILEDYDCGCGGGPKQK"
     gene            complement(<129510..>129824)
                     /gene="NDAI0D00590"
                     /locus_tag="NDAI_0D00590"
                     /db_xref="GeneID:11494927"
     mRNA            complement(<129510..>129824)
                     /gene="NDAI0D00590"
                     /locus_tag="NDAI_0D00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669568.1"
                     /db_xref="GeneID:11494927"
     CDS             complement(129510..129824)
                     /gene="NDAI0D00590"
                     /locus_tag="NDAI_0D00590"
                     /inference="similar to DNA sequence:INSDC:YJR086W"
                     /note="similar to Saccharomyces cerevisiae STE18
                     (YJR086W); ancestral locus Anc_7.455"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669616.1"
                     /db_xref="GeneID:11494927"
                     /db_xref="GOA:G0W9B2"
                     /db_xref="InterPro:IPR015898"
                     /db_xref="UniProtKB/TrEMBL:G0W9B2"
                     /translation="MSNLQEQQPFSQQKQQLNLKIKNIKLKRINELNNKLRNELSRER
                     ITASNACLTIINYTNNTKDYTLPDIWGYPPPGSNHFRNNLKRSIQRPTTSSNSAGCCT
                     IM"
     gene            <131820..>132803
                     /gene="NDAI0D00600"
                     /locus_tag="NDAI_0D00600"
                     /db_xref="GeneID:11494928"
     mRNA            <131820..>132803
                     /gene="NDAI0D00600"
                     /locus_tag="NDAI_0D00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669569.1"
                     /db_xref="GeneID:11494928"
     CDS             131820..132803
                     /gene="NDAI0D00600"
                     /locus_tag="NDAI_0D00600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669617.1"
                     /db_xref="GeneID:11494928"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:G0W9B3"
                     /translation="MTKLVEQVQSHHNCWLHVIWFQKLGLNGLKMTRKKFFQILKHCY
                     DIGFRTFDTADVYSNGESERLLGEFLKEFNIKKGNSGYLLTKTYFPMDETLVLAMVEA
                     PQSESGVLDLVNQQGLSRKHILQAVKNSVERLGTYIDVLQIHRFDSTTPIKGTMKALN
                     DVVENGDVRYIGASSMLPTQFVEMQAVADKYDWFQFVNVQSQYNLLYRKDERDCKKHN
                     IALTPWSPNYQSLLTISVGVESIRSKTDKSSLIEICKIWMLQHKEIINRVEDLSKKKG
                     APMATIPTAWVMAMVCQSIVGRSSVKRVDEAREALKIKFTEEELAYLEKTL"
     gene            <133678..>135138
                     /gene="NDAI0D00610"
                     /locus_tag="NDAI_0D00610"
                     /db_xref="GeneID:11494929"
     mRNA            <133678..>135138
                     /gene="NDAI0D00610"
                     /locus_tag="NDAI_0D00610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669570.1"
                     /db_xref="GeneID:11494929"
     CDS             133678..135138
                     /gene="NDAI0D00610"
                     /locus_tag="NDAI_0D00610"
                     /inference="similar to DNA sequence:INSDC:YDL161W,YLR206W"
                     /note="similar to Saccharomyces cerevisiae ENT1 (YDL161W)
                     and ENT2 (YLR206W); ancestral locus Anc_7.342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669618.1"
                     /db_xref="GeneID:11494929"
                     /db_xref="InterPro:IPR001026"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:G0W9B4"
                     /translation="MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISK
                     RSFDSVDFFEIMDMLDKRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYII
                     KTLKEFKLEDDNVDESSIIRVKAKELTALLQDDERLKEERSINLKNNRRSERKNRSRR
                     GTNATRRGTKSDEDLQKALEESRITAEEDERRRRELAQYDNQDTDYQTALQLSKEEEE
                     LKKLQELQRLQQLQQQQQQQMQFQQQPQQQEQVYYDIFGNPISPEEYLQFQQQQQAFA
                     QQQALQQQHLEQQRLAEEQYRLLQQQQQQQQQQAYTQQQQSLQPLPTGSNNPFALNAT
                     INTSPIRPAEQQPQPQFTAPQQQQQPLQQPLKQTRTGNQSISDKYNELNNLLASGTGI
                     DTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDPVKKNPFLNNQYTGLPSSNIVPS
                     HTGYGFGNGPQQGQGQAPPPQQQQQQSQQSFSLIDL"
     gene            <135782..>138532
                     /gene="NDAI0D00620"
                     /locus_tag="NDAI_0D00620"
                     /db_xref="GeneID:11494930"
     mRNA            <135782..>138532
                     /gene="NDAI0D00620"
                     /locus_tag="NDAI_0D00620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669571.1"
                     /db_xref="GeneID:11494930"
     CDS             135782..138532
                     /gene="NDAI0D00620"
                     /locus_tag="NDAI_0D00620"
                     /inference="similar to DNA sequence:INSDC:YLR207W"
                     /note="similar to Saccharomyces cerevisiae HRD3 (YLR207W);
                     ancestral locus Anc_7.339"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669619.1"
                     /db_xref="GeneID:11494930"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G0W9B5"
                     /translation="MRKPIISVTNCYTCILIFVLILVPFLSFTAAAQEEVQQQQQYEE
                     QLVGQQLEDPWNYEIQSLIEQLPPISDPLNPSLSSSSSNNTLSRRDNLYDKSFYLPMD
                     YSIENEEIISNQFWSKNITNLQSKLYDSLLISSENFNNVQSTYLLSQIHLYGKFGFPQ
                     NKSEAHKTLLKFNQLTNFNNHTALFDLAMMYSTGLFGTIPIDISKSLIYFQKSASLGN
                     LMAKQVMAYKYYMGLNVPRDFNKALLLYNEISTTLRTISPTSYFKFLHWDINFPDLET
                     FQVRILDFNKKNFGLLGKGLSSVASSITRRKAIRPDITSSVLTQMNPGGQIVLQFGLG
                     ADINSFSLSENDDRNEDDVYDEDQLVDLFYTAWDLYKGTYTQLRDVPQAKRILEKIIK
                     DYENDVDFMDNLQRFFFSKSLDLLGHIYFMGEHIETPPNEDPKPDLNIAIHYLERAVK
                     VLETSTVVKSRANVDLALICHYAENNIPKALGFYNKMVDSRYNNGNIDYQLSKLAKEH
                     PDLKNLGDPMVHLQNAFMKRYPPAVYDYAKMLESGVNGKYNVEETTYIYKAFAEEMEP
                     IMAPHLQNAFRQLLLGNIEIALWEYSKAAEQGYETAQVSAASLMYQTPFKFEPNPTTT
                     PERKNMAITYFSRAFKQNNVDAGVVAGDIYYDMGQFDKAISIYQSAALKMSPQAVWDL
                     GYMYEHGLGVPKDIHLAKRYYDQILEINHKLFIASKLSVWKLQFNIWIDWLKETKIYK
                     LFIKLILNRIKLRTTNIPFVDMMNPIIPIKQSHMVHNYTNKLKSFIFQETKYLTTSVN
                     VNSNTTIISRPPRKIIVQPGLESLRGINGEQHADDESFFSSLGLNTEDLLTMGLILFM
                     FLMTIVLRIVGPRQDWNIGINGIPIQRDQDDREGQDGGNAGAPRGAGGIFGNLDIQVV
                     AI"
     gap             138765..138854
                     /estimated_length=90
     gene            <139065..>139967
                     /gene="NDAI0D00630"
                     /locus_tag="NDAI_0D00630"
                     /db_xref="GeneID:11494931"
     mRNA            <139065..>139967
                     /gene="NDAI0D00630"
                     /locus_tag="NDAI_0D00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669572.1"
                     /db_xref="GeneID:11494931"
     CDS             139065..139967
                     /gene="NDAI0D00630"
                     /locus_tag="NDAI_0D00630"
                     /inference="similar to DNA sequence:INSDC:YLR208W"
                     /note="similar to Saccharomyces cerevisiae SEC13
                     (YLR208W); ancestral locus Anc_7.338"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669620.1"
                     /db_xref="GeneID:11494931"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0W9B6"
                     /translation="MVAITNAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGENYK
                     LIDTLIGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIASHAVHSASV
                     NSIQWAPHEYGAVLLAAASDGKVSVVEFKENGTLSPIIIDAHAIGVNSASWAPATIIQ
                     GNNGGDGKNVDELRRFVTGGADNLVKVWKYNKENSTYILDDTLEGHSDWVRDVAWSPS
                     VLLRSYLASVSQDRSCIIWTQEDNEGPWKKTELQQEKFPDVLWRASWSLSGNILALSG
                     GDNKVTLWKENLEGNWESAGEVEQ"
     gene            complement(<140229..>141176)
                     /gene="NDAI0D00640"
                     /locus_tag="NDAI_0D00640"
                     /db_xref="GeneID:11494932"
     mRNA            complement(<140229..>141176)
                     /gene="NDAI0D00640"
                     /locus_tag="NDAI_0D00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669573.1"
                     /db_xref="GeneID:11494932"
     CDS             complement(140229..141176)
                     /gene="NDAI0D00640"
                     /locus_tag="NDAI_0D00640"
                     /inference="similar to DNA sequence:INSDC:YLR209C"
                     /note="similar to Saccharomyces cerevisiae PNP1 (YLR209C);
                     ancestral locus Anc_7.337"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669621.1"
                     /db_xref="GeneID:11494932"
                     /db_xref="GOA:G0W9B7"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR001369"
                     /db_xref="InterPro:IPR011268"
                     /db_xref="UniProtKB/TrEMBL:G0W9B7"
                     /translation="MTSFNIDYQRDLIQQAANYLTTAVASHATNFLESFEYPRTLIIC
                     GSGLGGISNRLSTLSPPPLIIPYSEIPRVKKSTVPGHSGTLIFGKMNGSPVVLMNGRL
                     HTYEGNSIWETVFPIRALHSMPKNAIKNLIVTNAAGGLNPEFKACDLMCIYDHINLPG
                     LSGLHPLKGPNFDEEGPRFLPLSDAYDLELRKLLFGKFKELGINERRKLFEGTYTFVS
                     GPTFETRAESRFIRSMGGDAVGMSTVPEVIVARHCGWKVLALSLITNESVLDHPASAL
                     DENPVPLDAGIASHKEVLENGKAASSDVEILIEAIVGEL"
     gene            <141638..>142945
                     /gene="NDAI0D00650"
                     /locus_tag="NDAI_0D00650"
                     /db_xref="GeneID:11494933"
     mRNA            <141638..>142945
                     /gene="NDAI0D00650"
                     /locus_tag="NDAI_0D00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669574.1"
                     /db_xref="GeneID:11494933"
     CDS             141638..142945
                     /gene="NDAI0D00650"
                     /locus_tag="NDAI_0D00650"
                     /inference="similar to DNA sequence:INSDC:YDL155W,YLR210W"
                     /note="similar to Saccharomyces cerevisiae CLB3 (YDL155W)
                     and CLB4 (YLR210W); ancestral locus Anc_7.332"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669622.1"
                     /db_xref="GeneID:11494933"
                     /db_xref="GOA:G0W9B8"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:G0W9B8"
                     /translation="MFDIREDENYDPAFRFNTFKKSANSSQQHIRNNRSALGDVTSQV
                     ANRQQRNTTDGKRNNYHNLKNGNPHYSKFASKYINQYYENKEPAAINDNNIRTTNKVN
                     IQSTTKLDNNNVNTTKQQNSEIDRTDDNKSDDIIPLLPIYNEEITRALQIAYSAYYND
                     LPDNTDADTYDIAMVTENSNDIFTYMRDLELNLRPNPHYMDVQPHLKWSYRATLIDWI
                     VEVHLKFQLLPETLFLTINLIDRFLSKKLVTLNKFQLVGASALFIAAKYEEINCPTLK
                     DMIYILDNLYTREELLEAEKFMIDSLEFEIGWPGPMSFLRRISKADEYEYNTRTLAKY
                     LLETTIMDPKLCSSPTSWLASGAYYLSKIILGDNDWSLKHVYYSGYTQDQLIPLVSLI
                     IDNCRIPNINHPAIWEKYSSRRYHRSSQTVIKWIKAADEKVNS"
     gap             143773..143792
                     /estimated_length=20
     gene            <144078..>145142
                     /gene="NDAI0D00660"
                     /locus_tag="NDAI_0D00660"
                     /db_xref="GeneID:11494934"
     mRNA            <144078..>145142
                     /gene="NDAI0D00660"
                     /locus_tag="NDAI_0D00660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669575.1"
                     /db_xref="GeneID:11494934"
     CDS             144078..145142
                     /gene="NDAI0D00660"
                     /locus_tag="NDAI_0D00660"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669623.1"
                     /db_xref="GeneID:11494934"
                     /db_xref="GOA:G0W9B9"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:G0W9B9"
                     /translation="MYEQSTPKNVPFMHAPYPYHYYGMPPPQGYYYPYPAMNHNMAPP
                     SHMSAPPSPHVYSQPMYNNHLPIPQTFSQPPLQPIVNHYRDVPHALNPQNPSPLYPIS
                     STGEFSNWIRTLMDHLKSAQYGDLIPNKHGVAARTPSHWEELGLQWLFSTYVKKDFYP
                     KWVKQAQEASVPLFTILQRAMTLAMQATDITIIMRKLRDLHFEGKEPAFIFNANVQSI
                     ISQIDTKELTQYEPLIKDCILNALAGPYSTINKEFRTSQSPYSISDIYTRISAEYDYI
                     TTTQSARPKCSYCHIVGHTRDQCFKAVAPSTTNPIPKPKSNTRTTRSSPTHRKQSAKS
                     SKITNNITVDRTTEHDHYWT"
     gene            <145289..>145612
                     /gene="NDAI0D00670"
                     /locus_tag="NDAI_0D00670"
                     /db_xref="GeneID:11494935"
     mRNA            <145289..>145612
                     /gene="NDAI0D00670"
                     /locus_tag="NDAI_0D00670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669576.1"
                     /db_xref="GeneID:11494935"
     CDS             145289..145612
                     /gene="NDAI0D00670"
                     /locus_tag="NDAI_0D00670"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669624.1"
                     /db_xref="GeneID:11494935"
                     /db_xref="UniProtKB/TrEMBL:G0W9C0"
                     /translation="MRCTGQGTLRLKLYHSKTIDIPAYVIPELEHNLLSTNSLEHHGI
                     FVDAKHGTLESRDGNTLAQFVRFNSLPWLTFHHVVIPPHARINNLIQKFPLDVVHRLL
                     GHVNS"
     gene            <145699..>146403
                     /gene="NDAI0D00680"
                     /locus_tag="NDAI_0D00680"
                     /db_xref="GeneID:11494936"
     mRNA            <145699..>146403
                     /gene="NDAI0D00680"
                     /locus_tag="NDAI_0D00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669577.1"
                     /db_xref="GeneID:11494936"
     CDS             145699..146403
                     /gene="NDAI0D00680"
                     /locus_tag="NDAI_0D00680"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669625.1"
                     /db_xref="GeneID:11494936"
                     /db_xref="GOA:G0W9C1"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:G0W9C1"
                     /translation="MYNVPTRQSRKHNHTVGSRLKYQKNYEPFQYIHTDVFGPVSVDK
                     PYPSWFVAFTDEATRFRWVFPLENKTADLMLHVITALVNTIKRQFNSKVLCFQFDHGR
                     EYDNKLLQNYLESNGIQSIFNSVADSASNGVAERMNLTLLNDCRTLLKAAQLPDNLWF
                     YAIQFSTVIRNSVYNESIKSSPRAIAGLSGLDVQNNLTIWSTGYRSYEPNLLLSYILE
                     ANLGFALTPSTHSYDT"
     gap             146410..146818
                     /estimated_length=409
     gene            complement(<146976..>148520)
                     /gene="NDAI0D00690"
                     /locus_tag="NDAI_0D00690"
                     /db_xref="GeneID:11494937"
     mRNA            complement(<146976..>148520)
                     /gene="NDAI0D00690"
                     /locus_tag="NDAI_0D00690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669578.1"
                     /db_xref="GeneID:11494937"
     CDS             complement(146976..148520)
                     /gene="NDAI0D00690"
                     /locus_tag="NDAI_0D00690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669626.1"
                     /db_xref="GeneID:11494937"
                     /db_xref="InterPro:IPR018789"
                     /db_xref="UniProtKB/TrEMBL:G0W9C2"
                     /translation="MLSTLIFFLLLLLRQTFSAVIETPKELSLHKRETEICQTVTNGC
                     PNLNFDFKSKCTNTLKYDLKILNVEWLHENLYQITINVKGEKQIPLKYLYSLKIIEVD
                     GPQGTVQLYGKNENTYLIDNPTDFTATFQIYGGSPRDRCDIWLPNFQIQYEYLQGDAA
                     QYADTWEWGTTAFDLISGCNNFDNMGNSQTDFPGYYWKINCDDRCHILVISTTITSSP
                     TSSKVPVTSTRNIHWSFSSSIFKPYPNSTFISHLSSSTTPVIHSTWLLASSTTETEPA
                     LTTTSATSTDTTLQFSTTTSTVTSLAAVTTTSHCLSSTLPTGFLSISDTTSHWSSSTL
                     PTGFLSISNTTSHWSSSTLPTSFLLTSNTTSHWSSSTLPTGFLLTSNTTSHRSSSTLP
                     TGYLLTSNTTSVSIPILPSTTTTINTTANTTTYSITINTIPNTFSSATNIISTISPTT
                     SPTSTFKYQTRTTSTLTMTQPTSNVIPPVTPNSISEYLGKGNILNSGKITWLIDAAFI
                     FIFNVI"
     gene            complement(<154528..>155387)
                     /gene="NDAI0D00700"
                     /locus_tag="NDAI_0D00700"
                     /db_xref="GeneID:11494938"
     mRNA            complement(join(<154528..155307,155370..>155387))
                     /gene="NDAI0D00700"
                     /locus_tag="NDAI_0D00700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669579.1"
                     /db_xref="GeneID:11494938"
     CDS             complement(join(154528..155307,155370..155387))
                     /gene="NDAI0D00700"
                     /locus_tag="NDAI_0D00700"
                     /inference="similar to DNA sequence:INSDC:YLR211C"
                     /note="similar to Saccharomyces cerevisiae YLR211C;
                     ancestral locus Anc_7.325"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669627.1"
                     /db_xref="GeneID:11494938"
                     /db_xref="UniProtKB/TrEMBL:G0W9C3"
                     /translation="MTTLNDIYELIDDAEEESRKGNITNSVRKYKETVKSLEELIKST
                     KREDINNEILVALDMLKKDISKTICELDKLLTIQRQQQQQQQHNGQVQGLNQRPNSKS
                     SNVSFNHRTPNMLSSLLMNPSVSNTMRYSYNLNYNNAMTNSMNNANVERINPFNDVVI
                     RTITDNLKMNLLESIKGQYHLLNGNAKDERKNDEDEFIKQLNTTFESQFDMFRKELGF
                     YEQKKFSEYDTNLDNLIKENKKLLNQIVKLRERWDSLVESAKQRRNK"
     gene            complement(<155662..>157143)
                     /gene="NDAI0D00710"
                     /locus_tag="NDAI_0D00710"
                     /db_xref="GeneID:11494939"
     mRNA            complement(<155662..>157143)
                     /gene="NDAI0D00710"
                     /locus_tag="NDAI_0D00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669580.1"
                     /db_xref="GeneID:11494939"
     CDS             complement(155662..157143)
                     /gene="NDAI0D00710"
                     /locus_tag="NDAI_0D00710"
                     /inference="similar to DNA sequence:INSDC:YLR212C"
                     /note="similar to Saccharomyces cerevisiae TUB4 (YLR212C);
                     ancestral locus Anc_7.323"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669628.1"
                     /db_xref="GeneID:11494939"
                     /db_xref="GOA:G0W9C4"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002454"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:G0W9C4"
                     /translation="MTGEIITLQIGQCGNHVGKQFWSQLADEHGLNRSGESTQATTNT
                     TDNNAKTNIARDDFTTPFFKENNNSTRYTPRAIMIDMEPSAIFDVQNHFPGFFDDRNT
                     WISQGELGAGNTWAKGYDCGTTNEDTFLNMIDKEIDSTENFEGFQIIHSVAGGTGSGL
                     GSSLLEAISERYPKKFLSTYSVFPGKESEVVVQPYNTILTLRRLAENSDAAIIFDNNA
                     LLDLTGKVFRDPKTDYDHTNQLIAATMSSITNSIRFPSYMYCSMPSIFSTLVPSPDLQ
                     FLSPSFTPFTSDYVTQTQTHHNTYKRNNTAYDVLLDLLDPSNSLISSHVNNPTYFNVF
                     NTIIGNVDRNDITRAIGKIQQRINFAPWASNIVHVNVGRRSPYLIEKKTNNTCTNEIN
                     GMMLASSTQILSVLDRACKTFDKIFAKKAFLKTFEDGNLFKNGQDEFIASREVVQNVI
                     DEYLAATGEDYLDEVLIPDENMFGDYNDTVGHKNIDDEGDNIM"
     gene            complement(<157493..>159010)
                     /gene="NDAI0D00720"
                     /locus_tag="NDAI_0D00720"
                     /db_xref="GeneID:11494940"
     mRNA            complement(<157493..>159010)
                     /gene="NDAI0D00720"
                     /locus_tag="NDAI_0D00720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669581.1"
                     /db_xref="GeneID:11494940"
     CDS             complement(157493..159010)
                     /gene="NDAI0D00720"
                     /locus_tag="NDAI_0D00720"
                     /inference="similar to DNA sequence:INSDC:YLR213C"
                     /note="similar to Saccharomyces cerevisiae CRR1 (YLR213C);
                     ancestral locus Anc_7.321"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669629.1"
                     /db_xref="GeneID:11494940"
                     /db_xref="GOA:G0W9C5"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:G0W9C5"
                     /translation="MVLINLNLIILSFLFQTIKLTKAELYKPNIPIRCSINKHCPPEW
                     PCCSPYGECGAGPMCVGGCNPKFSFNDDSCIPSHILFSPLTLQFDRNSFPKNTIDIEK
                     KKTPLLIRRYSNNERYHNLDMAPIVDTTNLNDRMELHKRGLFHHTNYLVTNSEVEAKE
                     HSKMYNFIYSGSTSIDPNLGDIVLGMPKRTTGSQIASTKQFLYGKAKVRMRTGRSRGV
                     VTGLVLISQVGDEIDFEFLGSELNSVQSNYYYQGELIHTRMQRFFINTDIWANYHDYE
                     IDWNQERIQWIVDGHVVRTLFKRDTWDGNLRIFKYPQTPMRLEIAIWPGGAETNAPGT
                     ISWAGGLIDWENSPDILEKGQFSAQIQYISITPYENQFRIEVNDCIQRIYGPNRLNRE
                     TLSHITFSYNKFKDPSYTSNALELYCHLTPRVNGWTSSGNNFDKKCKKYRQIQANIER
                     PGNAMSSSNELNHDDRSNLDNNAGQDMVSNKAPTLLNLQIGWHIFVYFFIAFLLA"
     gene            <160541..>161884
                     /gene="NDAI0D00730"
                     /locus_tag="NDAI_0D00730"
                     /db_xref="GeneID:11494941"
     mRNA            <160541..>161884
                     /gene="NDAI0D00730"
                     /locus_tag="NDAI_0D00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669582.1"
                     /db_xref="GeneID:11494941"
     CDS             160541..161884
                     /gene="NDAI0D00730"
                     /locus_tag="NDAI_0D00730"
                     /inference="similar to DNA sequence:INSDC:YLR300W,YOR190W"
                     /note="similar to Saccharomyces cerevisiae EXG1 (YLR300W)
                     and SPR1 (YOR190W); ancestral locus Anc_6.99"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669630.1"
                     /db_xref="GeneID:11494941"
                     /db_xref="GOA:G0W9C6"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR018087"
                     /db_xref="UniProtKB/TrEMBL:G0W9C6"
                     /translation="MLALFALLTTFTTLISTVLTQPIPPKSDTSLQFLTEKNNKRFYD
                     YDNGSLGAPIRGVNIGGWLVLEPYITPSLFEAFRTNPYNDDGIPVDEYHYCQQLGYDE
                     ASNRLQQHWSSFYQESDFKDIASQGFNLVRIPIGYWAFKTLNDDPYVTGLQESYLDQA
                     IQWARNNGLKVWVDLHGAAGSQNGFDNSGLRDTIQMLDDNNLAVTLDVIKYLLKKYSS
                     NQFTDTVIGVELINEPLGPAMDVDKLKNDYLKPCYDYLRNEVQGDQVIIIHDAFEAYN
                     YWDDFLTADGGAWGVTIDHHHYQVFSPGELVRTMDERISVTCSWGTGILNEAHWSVAG
                     EFSAALTDCAKWLNGVGIGARYDGSYRKGNDGSYYIGSCANNEDINSWSYERRNNTRR
                     YVEAQLDAFEMRGGWIIWCYKTETSLEWSVQNLIQNNLFPQPITDRLYPNQCGTK"
     gene            <162765..>167219
                     /gene="NDAI0D00740"
                     /locus_tag="NDAI_0D00740"
                     /db_xref="GeneID:11494942"
     mRNA            <162765..>167219
                     /gene="NDAI0D00740"
                     /locus_tag="NDAI_0D00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669583.1"
                     /db_xref="GeneID:11494942"
     CDS             162765..167219
                     /gene="NDAI0D00740"
                     /locus_tag="NDAI_0D00740"
                     /inference="similar to DNA sequence:INSDC:YOR191W"
                     /note="similar to Saccharomyces cerevisiae RIS1 (YOR191W);
                     ancestral locus Anc_6.100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669631.1"
                     /db_xref="GeneID:11494942"
                     /db_xref="GOA:G0W9C7"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W9C7"
                     /translation="MTTALPTIDLTLEDSDSDADENYDIFHSFHNTSDPRNKTIETSH
                     VDAKKHDNVNLDDNKSSLPSSASTSLNMDLTTEKLENDYEDVANKNNINDDDDFFPVN
                     DDSDTDSQKYFDTNPTFIEDNNLETNVASNNTDLIESGSGSTNPTVAPTPIPQIELKS
                     NSPLIIRTDQEGKRSSYEIPSINKRRLSDTTPDITKQDTPVTNEEPVSKKLTVQAYSK
                     SYPYPAASAPSDKNSIIVLSDDEDEGNEGNNIVETSTTPTTTNENSKRKEESKDILPS
                     NPQRKEEQFERKSIPIPFRRDKNQDRAPIHPFHDTILEDTLKSPVQPGQFMDMEQYNN
                     YMNKMNRYENRLRESLTNTENQVKILKRRLTFREEELKDIQKKCDSLSKRLVGSSRTR
                     QLLLDDAKQTLKTAKEKRDNTREKLRQQTGVASDQTRKLIEFVELKNEKVKEAQQSFT
                     ITQKDNVTQNVVMERQKLLKEKEDLANMVKEGSLSLGTFAQLSKDIQTKLDNLDVQKN
                     QQNLEQQQRQTTAKPNEDLYIKSLDTAKNLLAKNSSRTELTKRMLYSHMDLLKNYKKI
                     FEDGRPCSVDLRKRARESAETLFSNGVKMPIVFETLQDYGIRFLKNGILTTDRRAQYF
                     KSLHVARELVSNSNRTTDVKFKIYDSLTSLEQFRSSIDTGIPPTLESKIKIGKEIQEL
                     KAQGLKMEKLYANLEKYGVCTTKETLIKQMEQNPSPNFYNDGNDPFSYMTKEAWGILG
                     NKTDLNLSRSSNPSSSGMEYVKDQYRVANVMAADDQEHIRELLQNVKQSESEIEGEAL
                     TPEDMTVNLLRHQKLGLHWLLKIEQSRKKGGLLADDMGLGKTVQGIALMLANRSKDES
                     RKTNLIVAPVAVLRVWQGELETKVKKQGAFSTFIYGGNNKVSSWKDLARYDAVMVSYP
                     TLAIEFKKHWPTKLGKESKDLPPVPDVRAMNSLERKRRIIFPPFFTNKILTFFRIILD
                     EGQNIKNKNTKAAKACCTLDGIYRWVFSGTPIQNSMDELYSLVRFLRIAPYHREERFM
                     ADIGRPFLRNRSGSYDDQDKKQAIKKVRVLLSAIMLRRTKTDKIDGKPLLELPGKEVE
                     VNTSKLEGEELEFYTDLETKNQKKAAILMRRKARGGYSNVLTLLLRLRQACVHPELVM
                     IGERKSEGTKVANGKSFENDWLRLFYLVSRLSSQVKNTVEASTDSMTCFVCMEQLELE
                     STSILTGCGHMMCEACFDPFYEEASTSTDAKLHDDGTVYLPCKECQKLTNENSIVSYR
                     LYDQVINQGFTREMLYEEYKSAMEIQKDNTKNNYRIDFNHLEPSQKMKQCFDVINEVF
                     ENSSTDKIVIFSQFTSFFDIFSHFLETKLKVPYLLYTGALSGQKRSDIISRFYREAEQ
                     RILLISMKAGNSGLTLTCANHVIIVDPFWNPFVEEQAQDRCYRISQTKEVHVHRLFIK
                     NSVEDRIAALQDKKREMVDAAMDPSKIKEINRLGARELGFLFGLNALN"
     gene            <167622..>168353
                     /gene="NDAI0D00750"
                     /locus_tag="NDAI_0D00750"
                     /db_xref="GeneID:11494943"
     mRNA            <167622..>168353
                     /gene="NDAI0D00750"
                     /locus_tag="NDAI_0D00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669584.1"
                     /db_xref="GeneID:11494943"
     CDS             167622..168353
                     /gene="NDAI0D00750"
                     /locus_tag="NDAI_0D00750"
                     /inference="similar to DNA sequence:INSDC:YLR301W"
                     /note="similar to Saccharomyces cerevisiae YLR301W;
                     ancestral locus Anc_6.101"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669632.1"
                     /db_xref="GeneID:11494943"
                     /db_xref="UniProtKB/TrEMBL:G0W9C8"
                     /translation="MPELLKRIAFEVAGNPDERTFTLSSGSNDGHYLSLRPLVKPRTP
                     EGKEFPFEWAFAGTNKDITVTPIEGSENTVKQDFNFWIDINAYLNVPNTHRGVVNTVW
                     TTWDSGCIKEAGEVFPFGKDKQAVPFIELWQPIDANKEDLVIVQESNKTLKSIVLKID
                     DSEYSGLVIVVGKWVQGILIKKSDGTKKGLNFMRLQEASNGSYKSLIEYGIDSSKFPK
                     KFDSLEKDAVLSVAGLNWTVIEATY"
     gene            <168639..>169442
                     /gene="NDAI0D00760"
                     /locus_tag="NDAI_0D00760"
                     /db_xref="GeneID:11494944"
     mRNA            <168639..>169442
                     /gene="NDAI0D00760"
                     /locus_tag="NDAI_0D00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669585.1"
                     /db_xref="GeneID:11494944"
     CDS             168639..169442
                     /gene="NDAI0D00760"
                     /locus_tag="NDAI_0D00760"
                     /inference="similar to DNA sequence:INSDC:YEL072W"
                     /note="similar to Saccharomyces cerevisiae RMD6 (YEL072W)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669633.1"
                     /db_xref="GeneID:11494944"
                     /db_xref="UniProtKB/TrEMBL:G0W9C9"
                     /translation="MMSTFNRKRFDKYLLSLTFKVYSILFYNFFISKTIKHALLEISC
                     FIDLMTQSKSKIIVLPTPSLKTCPVSTIQQLVDIINKGYEKPMIKYNLVQTQRIRGPA
                     VFFQELALADDRSLLYLTVKDTEEVSGALQEDTTIGDYEFFTIKSNESYNFTPDNVQA
                     TIAYRPNPQDDAPNTFEVTAFTSFIRNGGLDIFNATLPHFKKIDQKCDRLLVKVIADH
                     ELVPYYENKLDFIETHRVLVPKSQLEKSGFHDTFRVSRDFHVASMIRDI"
     gene            complement(<169737..>173606)
                     /gene="NDAI0D00770"
                     /locus_tag="NDAI_0D00770"
                     /db_xref="GeneID:11494945"
     mRNA            complement(<169737..>173606)
                     /gene="NDAI0D00770"
                     /locus_tag="NDAI_0D00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669586.1"
                     /db_xref="GeneID:11494945"
     CDS             complement(169737..173606)
                     /gene="NDAI0D00770"
                     /locus_tag="NDAI_0D00770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669634.1"
                     /db_xref="GeneID:11494945"
                     /db_xref="GOA:G0W9D0"
                     /db_xref="InterPro:IPR002821"
                     /db_xref="InterPro:IPR003692"
                     /db_xref="InterPro:IPR008040"
                     /db_xref="UniProtKB/TrEMBL:G0W9D0"
                     /translation="MHIENPQQSGKFRISIDRGGTFTDVIGNKGSGKQEDDVIFKLLS
                     VDPKNYPDAPLEGIRRILEIFEHKKIPRGMPLDISNVASIRMGTTLATNSALERKGER
                     CAFITTKGFKDALLIGDQTRPKIFELNIKKSKPLYETVVEIDERVTLEDFTEQSPFKK
                     SSVHAGDNNLVLGESGEIVRILKKPNEVDVKKILNSIYNTGIRSIGIAFLHSYTYPNH
                     EKLVGRIAKEVGFTHVSLSSEVSPMIKFLPRAHSSVADAYLTPVIKSYLDSISKGLVN
                     SENTSIQFMQSDGGLVEGEKFSGLKSILSGPAGGVVGYSRTCFDRKSKVPLIGFDMGG
                     TSTDVSRFGDGKLEHVFETTTAGIIIQSPQLDIHTVAAGGSSILTWENGLFKVGPGSA
                     AADPGPSAYRKNGPLTITDANLVLGRLVPQFFPNIFGPNEDQPLDLETPTKKFNELAL
                     KINKDLNLEMTSEEVAYGFIEVANESMARPIRAITEAKGYSVSKHNLVTFGGAGGQHA
                     VAVAESLGISTVIAHRYSSVLSAYGIYLADVVEETQEPCSLILNSSSTINELKQKFEQ
                     LTEKSTNELIKQGFQKENISIEKYLNLRYEGTETPLMIRQRKNKWDFEQWFAENHKRE
                     FGFSFPNKNIIVDDIRIRGVGNSYVREDDSAEAQLLQTDELTELDHAKNVSFYQKVFF
                     QNRFIETPVFKIDNLPLGTTVDGPAILADGTQTNLIPPNAKATILKSHILINIIDKST
                     LKEKNNNDEIIDPVLLSIFSHRFMDIAEQMGIQLRKTSVSTNVKERLDFSCALFDPEG
                     NLVANAPHVPVHLGSMSTCVAAQAKLWNGKLKPGDVIITNHPDIGGTHLPDITVISPA
                     FSSSGNILFYVASRAHHADIGGILPGSIPPNSKELYEEGAAIYSELLMKDGIFQEDLV
                     EYLFITEPASHPGCSGARRISDNLSDLKAQIAANNKGIQLIAALVKEFKYPVILKYMQ
                     AIQLNASQTIKEMLRQLVQHFGSNEYSGVDYMDDGSRIELKVTLDITNEKYIFDFTGT
                     SPQIYGNTNAPKAITYSAILYCLRCLVGKDIPLNQGCLDPITIKIPDGSILSPNTNAA
                     VVGGNVLTSQRVTDVILKTLNIQADSQGDCNNFTFGTSSFKDPQTNETFSGFGYYETI
                     CGGSGAGCDSWESKGWNGTDAVHTNMTNTRMTDTEVFERRYPVILREFSIRQGSGGLG
                     KFTGGNGVIRDIEFRQEVTTSVLSERRVTAPHGLKGGQDGKRGENIWIRGDKETVVNI
                     GGKNTIIAKPKDRLIIKTPGGGGYGKY"
     gene            173840..173911
                     /gene="NDAI0Dtrna7E"
                     /locus_tag="NDAI_0Dtrna7E"
                     /db_xref="GeneID:11494946"
     tRNA            173840..173911
                     /gene="NDAI0Dtrna7E"
                     /locus_tag="NDAI_0Dtrna7E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:11494946"
     gene            complement(<174072..>175334)
                     /gene="NDAI0D00780"
                     /locus_tag="NDAI_0D00780"
                     /db_xref="GeneID:11494835"
     mRNA            complement(<174072..>175334)
                     /gene="NDAI0D00780"
                     /locus_tag="NDAI_0D00780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669587.1"
                     /db_xref="GeneID:11494835"
     CDS             complement(174072..175334)
                     /gene="NDAI0D00780"
                     /locus_tag="NDAI_0D00780"
                     /inference="similar to DNA sequence:INSDC:YBR211C"
                     /note="similar to Saccharomyces cerevisiae AME1 (YBR211C);
                     ancestral locus Anc_6.103"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669635.1"
                     /db_xref="GeneID:11494835"
                     /db_xref="UniProtKB/TrEMBL:G0W9D1"
                     /translation="METETTSAAAAAAAAASVQTMEDNEEEEFPRLNYVWDMDTERNI
                     KLLLRQRGSHLRKTVDEDNIIVIRTPKRKLPLPSNFRISKQNNPSKLSQQSDLNVQNN
                     ILTKESLQLNDAILPSVGTDISIYEDNIPEDPPSIINKHQFQPLFDAHNPLKEKKVNN
                     YNRDVDNFDVDLTRDSHYLPAFDNYKKSIAPNKRKNLNNNKKNTNPFESSFQFQDCKN
                     IDELLVSNMSMTSIGIFKDLFKNLFQDNLVMQAIKDFKMNDHNKIKKMMYKLDLKIFQ
                     KLTDMIENDLDDIFDINLANNELCNKISAIQNKKESISSELNIIKKELKDLERNDDGA
                     SGNNKQQQNEMHEENYLKSMSDKDDNDKFQLNKKLQELSNMLGNPNINEIVPSSRNNE
                     VDDDREEEQAEHQQQSLLGDIFKTHSSH"
     gene            complement(<175697..>176902)
                     /gene="NDAI0D00790"
                     /locus_tag="NDAI_0D00790"
                     /db_xref="GeneID:11494947"
     mRNA            complement(<175697..>176902)
                     /gene="NDAI0D00790"
                     /locus_tag="NDAI_0D00790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669588.1"
                     /db_xref="GeneID:11494947"
     CDS             complement(175697..176902)
                     /gene="NDAI0D00790"
                     /locus_tag="NDAI_0D00790"
                     /inference="similar to DNA sequence:INSDC:YOR006C"
                     /note="similar to Saccharomyces cerevisiae YOR006C;
                     ancestral locus Anc_6.19"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669636.1"
                     /db_xref="GeneID:11494947"
                     /db_xref="GOA:G0W9D2"
                     /db_xref="InterPro:IPR007177"
                     /db_xref="InterPro:IPR007209"
                     /db_xref="InterPro:IPR022968"
                     /db_xref="UniProtKB/TrEMBL:G0W9D2"
                     /translation="MMYHHPLRRVIIIDQEIRLSLPNLRQTKTRGDGTEEEHIFITIK
                     MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEI
                     HSVKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSP
                     DDADIIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKL
                     NCVEALAACFAIIGRSDWASDLLSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEE
                     WLDKIEQEATERKLQAQETDIWMMGNTNRLDANLRSMNISDEDEEEEEEYDEEEDGGE
                     HITRNKELRYDNLGNVIEDTDEEYLSEEEKEIRYDNLGNIIESEEEEEEEKEEGIELR
                     YDSLGNIIE"
     gene            <177862..>181443
                     /gene="NDAI0D00800"
                     /locus_tag="NDAI_0D00800"
                     /db_xref="GeneID:11494948"
     mRNA            <177862..>181443
                     /gene="NDAI0D00800"
                     /locus_tag="NDAI_0D00800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669589.1"
                     /db_xref="GeneID:11494948"
     CDS             177862..181443
                     /gene="NDAI0D00800"
                     /locus_tag="NDAI_0D00800"
                     /inference="similar to DNA sequence:INSDC:YML002W"
                     /note="similar to Saccharomyces cerevisiae YML002W;
                     ancestral locus Anc_6.20"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669637.1"
                     /db_xref="GeneID:11494948"
                     /db_xref="GOA:G0W9D3"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="InterPro:IPR020675"
                     /db_xref="InterPro:IPR020679"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G0W9D3"
                     /translation="MSQYHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLV
                     PPTSTLLNYTDSYYKLSLNELCYHNSDFLGSHILTWSNAIDSNKDSTTTNDDEEFDNL
                     NGNKFIIKWKHNIIFTRGNFSNDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITV
                     SSLIANDSLKCLLPNTRDLKSQEKETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILS
                     NNYKIESSELEPNHKLFRELVNEAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLY
                     DEIWSRIWKMMMNSVKNYADDQKAQHLIKHFSIVEIDPNFYDIFPLKFVPMLEKNLKH
                     SVTCINKLKSTKSYTEKSTILIESLQIITDSNTGGEESKDKNKSGYLIDADNLLNLLT
                     LVILQSNITLHDLKANLYYLKYFSTDESSSSFGILNYTIATFHMVSHVLENVIDWDRL
                     KEKSDLIEELIMTDDLSTLSSTFENDKKTLLMYRNSNGESLLALSIINKQNKKFTQYL
                     IEYEDILNMDIISNDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYIN
                     QVDIHNRNIGHYLVINLTILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQ
                     VFQIAIKWYAANNLKFQMNDHDDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNC
                     KGFTPLMMYFKYKRYDNIRMIIKEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLL
                     SNGQLFGKIIVLSLKKQMSTVPSLPRGLYINYTILIDEADKSTLTKTMKFTSLVKFLK
                     IMKRKYAISFLPLDTLLNESQSFLDKKSKNNNNLRTIPLRYIEKLRIRRFLKRLNTCL
                     DVLLHFDDSTIATPLLLSETELLEWISIEESKLRRSSTTPSAKSKLENAMGEKKKKEL
                     KPENINIIQNFLKFNLNELNTISMNLKVLSKLVIFMNLKTLDIHDAQIRFNGLVKGLN
                     NKEVPSIIEKSFNVIDSSRYDDDKGVLLESLHEDISFFNECTLKLIHDVENIIKIKIP
                     NWWKLYGELLELNKYYHKNFPNCVVHARRTDLLSGNNANTNTNTNTNTNTNSPQRLHH
                     HSEHQNNSNNGVFANLIENQKNKLERKTSHHIDETISLLESLGSGLLNKHEHLAEELN
                     RYMEFKNRFFGRNIMKNFVGEDIKLLEEHVLVLNENMNKNNEMFLTS"
     gene            complement(<181659..>182708)
                     /gene="NDAI0D00810"
                     /locus_tag="NDAI_0D00810"
                     /db_xref="GeneID:11495205"
     mRNA            complement(<181659..>182708)
                     /gene="NDAI0D00810"
                     /locus_tag="NDAI_0D00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669590.1"
                     /db_xref="GeneID:11495205"
     CDS             complement(181659..182708)
                     /gene="NDAI0D00810"
                     /locus_tag="NDAI_0D00810"
                     /inference="similar to DNA sequence:INSDC:YOR007C"
                     /note="similar to Saccharomyces cerevisiae SGT2 (YOR007C);
                     ancestral locus Anc_6.21"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669638.1"
                     /db_xref="GeneID:11495205"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G0W9D4"
                     /translation="MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEAL
                     EFDREVVPETIKNKFNGKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAE
                     AFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES
                     AIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRV
                     EESMNVEKSKTPEQGQGQQQTNESAQGNAPNPFAGGMPDMSSLFGGAGMGGGLGSLLS
                     NPDFMSTAQKLMSDPNAMQQVQSMMSDPSMRDLANNFKNGNTDMNDIMNNPAIRNMAS
                     NLFKGNPSEENQDKQ"
     gene            complement(<183287..>184975)
                     /gene="NDAI0D00820"
                     /locus_tag="NDAI_0D00820"
                     /db_xref="GeneID:11495206"
     mRNA            complement(<183287..>184975)
                     /gene="NDAI0D00820"
                     /locus_tag="NDAI_0D00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669591.1"
                     /db_xref="GeneID:11495206"
     CDS             complement(183287..184975)
                     /gene="NDAI0D00820"
                     /locus_tag="NDAI_0D00820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669639.1"
                     /db_xref="GeneID:11495206"
                     /db_xref="GOA:G0W9D5"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G0W9D5"
                     /translation="MDYSQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQII
                     EIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYL
                     SKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWY
                     QYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGT
                     KTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTI
                     DDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNY
                     FFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCC
                     MVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPL
                     RVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPET
                     KGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYKRMFSKN"
     gene            complement(<188085..>189209)
                     /gene="NDAI0D00830"
                     /locus_tag="NDAI_0D00830"
                     /db_xref="GeneID:11495207"
     mRNA            complement(<188085..>189209)
                     /gene="NDAI0D00830"
                     /locus_tag="NDAI_0D00830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669592.1"
                     /db_xref="GeneID:11495207"
     CDS             complement(188085..189209)
                     /gene="NDAI0D00830"
                     /locus_tag="NDAI_0D00830"
                     /note="ancestral locus Anc_6.23"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669640.1"
                     /db_xref="GeneID:11495207"
                     /db_xref="InterPro:IPR003829"
                     /db_xref="InterPro:IPR008778"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR012093"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:G0W9D6"
                     /translation="MSEPIPPTPKTKKPFYRYFKFLATLLLFLVPLIFSISMSKTKEQ
                     QPQQHQQVFTNKNIVNEDIARIATTDDARTILKYFIPDEQSEGVGARVRRAIGTNEMP
                     RFPPFLMLDHFKVTPPEQGFPDHPHHGQETITYILDGMIAHEDFTGSKGVLRPGDLQF
                     MTAGKGIVHSEMPVLMKDGRPGIGLQLWVDLPRELKNCEPRYRNLRKNEIPIVHTDDE
                     KHMTVKVISGNAYGVDSVRDLAYTPIHFYHYISDKAGVEFKQSVPDDFNVFLYVMKGA
                     VVIDDQIFKQNTAVFFNVDGHSIKGQSATNDTEFAIIGGKILDQPLVQHGPFVETTRE
                     DLYKVFENYQQGINGFERAVNWRSSIADGIDEDTANALLN"
     gene            <189925..>190551
                     /gene="NDAI0D00840"
                     /locus_tag="NDAI_0D00840"
                     /db_xref="GeneID:11495208"
     mRNA            <189925..>190551
                     /gene="NDAI0D00840"
                     /locus_tag="NDAI_0D00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669593.1"
                     /db_xref="GeneID:11495208"
     CDS             189925..190551
                     /gene="NDAI0D00840"
                     /locus_tag="NDAI_0D00840"
                     /inference="similar to DNA sequence:INSDC:YML001W"
                     /note="similar to Saccharomyces cerevisiae YPT7 (YML001W);
                     ancestral locus Anc_6.24"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669641.1"
                     /db_xref="GeneID:11495208"
                     /db_xref="GOA:G0W9D7"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W9D7"
                     /translation="MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGAD
                     FLTKEVTIDDDKIATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS
                     WRDEFLIHANISTPETFPFVILGNKIDVEESKKIVSSNSATELAKSLGDIPLFFTSAK
                     DSINIENAFEEIARSALQQNQNDVDAFDEDFNDAINIRLDGEPNSCSC"
     gene            complement(<190801..>193173)
                     /gene="NDAI0D00850"
                     /locus_tag="NDAI_0D00850"
                     /db_xref="GeneID:11495209"
     mRNA            complement(<190801..>193173)
                     /gene="NDAI0D00850"
                     /locus_tag="NDAI_0D00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669594.1"
                     /db_xref="GeneID:11495209"
     CDS             complement(190801..193173)
                     /gene="NDAI0D00850"
                     /locus_tag="NDAI_0D00850"
                     /inference="similar to DNA sequence:INSDC:YOR001W"
                     /note="similar to Saccharomyces cerevisiae RRP6 (YOR001W);
                     ancestral locus Anc_6.25"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669642.1"
                     /db_xref="GeneID:11495209"
                     /db_xref="GOA:G0W9D8"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR012588"
                     /db_xref="UniProtKB/TrEMBL:G0W9D8"
                     /translation="MSSSSIDQTGTPPTAAGANEKQSPKDQLLPQVVQTVRASVALAA
                     QDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSETLDGTKENLEDNWKDFSN
                     LMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSSKRRAIGKPQLEFDVP
                     VDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYEYEIDNQPYNDKIL
                     QLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDYRTYYGIVCLMQ
                     ISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDLGLYIVSLFD
                     TFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARSDTHFLLN
                     IFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDPWKTLM
                     YQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVVSVS
                     NMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSEQL
                     SIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIKY
                     SVSPDKKDKITTEELLKREEMFDQAMEQLQQVEYSIPIPENEIVVVESEQQEPSIPAA
                     NAEITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSDDDDEGEIEVIDYSKMEKVL
                     DNSNTKRNQNKNNNGNKRKRFDPYNVNNEGPRAPKKRKAMTRGKNVSFKR"
     gene            <193625..>195625
                     /gene="NDAI0D00860"
                     /locus_tag="NDAI_0D00860"
                     /db_xref="GeneID:11495210"
     mRNA            <193625..>195625
                     /gene="NDAI0D00860"
                     /locus_tag="NDAI_0D00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669595.1"
                     /db_xref="GeneID:11495210"
     CDS             193625..195625
                     /gene="NDAI0D00860"
                     /locus_tag="NDAI_0D00860"
                     /inference="similar to DNA sequence:INSDC:YEL062W"
                     /note="similar to Saccharomyces cerevisiae NPR2 (YEL062W);
                     ancestral locus Anc_6.17"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669643.1"
                     /db_xref="GeneID:11495210"
                     /db_xref="InterPro:IPR009348"
                     /db_xref="UniProtKB/TrEMBL:G0W9D9"
                     /translation="MHNISNLNSINHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNL
                     AASDIHFDAIKNYIIPKKQLCNKLLTFKYANYRIVSYPITINSDFYARNFFSFNFVFV
                     FPYDCETSPYEPAIARLGKMFKVLEEQNQILSKAENDPIYFKSDYTPYQPTLIIPTNN
                     DNDGKRNKKLMKKENTIFSTRQQRSNSNRILEENSNSNSNSNSNSNGNENDNNYNTIE
                     QYLNNNSRISVQDLIMRIYQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIED
                     VPMSLVDLTKITDVNWDPTMLKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYN
                     CVIITDIFQFSNTYSTTSLISTFLTDPNMATLCQNYVVLPLGSKLTRLPFHIETETSV
                     QSSSAYRHHHNRHEKTPSFGSSITSNNGRSSFSADDRKQSETSLNSSNDPSNSNLIST
                     AHLPTKMSLFELYRSLNQRTDLKNWYKLNYTTIIENNIDIRKFIKFGIIKGLIYRCHS
                     YPIVITPVVSAPESAKSTSPFVSSSGISSSVDSKQHTQKGPISRFPGLGSHVPSSGVR
                     DTRDKLMKSFYEKLEKGKNHSKVSFSDKIAFQNDENDHSATSSDNDDKSKSQLTLKQR
                     NILLDSISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVINC"
     gene            complement(<195749..>198958)
                     /gene="NDAI0D00870"
                     /locus_tag="NDAI_0D00870"
                     /db_xref="GeneID:11495211"
     mRNA            complement(<195749..>198958)
                     /gene="NDAI0D00870"
                     /locus_tag="NDAI_0D00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669596.1"
                     /db_xref="GeneID:11495211"
     CDS             complement(195749..198958)
                     /gene="NDAI0D00870"
                     /locus_tag="NDAI_0D00870"
                     /inference="similar to DNA sequence:INSDC:YEL061C"
                     /note="similar to Saccharomyces cerevisiae CIN8 (YEL061C);
                     ancestral locus Anc_6.16"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669644.1"
                     /db_xref="GeneID:11495211"
                     /db_xref="GOA:G0W9E0"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:G0W9E0"
                     /translation="MVEVPSSNISLSSINSTLSATSRQNNSRRIPQEQQKQSRRDPKE
                     GEQEEEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMN
                     SKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEK
                     LYNGELSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINN
                     SKSNINKLRIFDSSTASNVNVPGSNASSRANSRNNSPRLNPSTSNVGTTNNNYLRRKL
                     KSSRYSNPENSNIFTSNASSSVKNMTKNSFLSNSKNQTSNLNTNSNTRTNPPKLPTSS
                     LETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIF
                     TITLYKEHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINS
                     LADRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI
                     KNKPQLGSIISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKT
                     EADESKRIIERLSSQNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKE
                     QMLVSSVSKLQTSCDTFKKMIENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIK
                     TLNSGTDFDIGSNLDMIQNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDI
                     NDINIKIQNHHAAVAQNLSDISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTN
                     SADVLFNTFKDMMNKHLESNRNLMLNSFKAATDEVINKEMELFIPRKKKWEESIDLIN
                     QCDSLNNGFQKEVTDGLSYTRSKITASINQMYDNSTRLKTEMSADNGGYNSINTKNVV
                     EDNQIIRTQFNELARKNSIFQDNVENSLKCAVASVNNLNHLEDSIKMAVRDTRIKGGP
                     TEGEVGVPFKKENGKEGPTKPGLQPLQPTNEIFLNSQQDQQHTTNGHGNYINKDNDNI
                     NHKSNNSGNVTIIKHSKKRQLEKIDEKNVSNKKITSNKG"
     gene            <199644..>201383
                     /gene="NDAI0D00880"
                     /locus_tag="NDAI_0D00880"
                     /db_xref="GeneID:11495212"
     mRNA            <199644..>201383
                     /gene="NDAI0D00880"
                     /locus_tag="NDAI_0D00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669597.1"
                     /db_xref="GeneID:11495212"
     CDS             199644..201383
                     /gene="NDAI0D00880"
                     /locus_tag="NDAI_0D00880"
                     /inference="similar to DNA sequence:INSDC:YLR259C"
                     /note="similar to Saccharomyces cerevisiae HSP60
                     (YLR259C); ancestral locus Anc_6.47"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669645.1"
                     /db_xref="GeneID:11495212"
                     /db_xref="GOA:G0W9E1"
                     /db_xref="InterPro:IPR001844"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR018370"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:G0W9E1"
                     /translation="MLRSTAATLRQSLTLSRSLQSSSTIARSYSSFKVLKFGVEGRAA
                     LLKGVETLADAVSTTLGPKGRNVLIEQPFGAPKITKDGVTVAKSIVLEDKFENMGAKL
                     LQEVASKTNEAAGDGTTSATVLGRAIFSESVKNVAAGCNPMDLRKGSQLAVEKVIKYL
                     SEKKKEITTSEEIAQVATISANGDVHVGKLLASAMEKVGKEGVITIREGRTMEDELEV
                     TEGMRFDRGFISPYFITDAKSGKVEFEKPLLLLSEKKLSSIQDILPALELSNQSRRPL
                     LIIAEDIDGEALAACILNKLRGQVKVCAVKAPGFGDNRKNVLGDIAILTGSTVFTEEL
                     DLKPDQCTIEHLGSCDSITITKEDTVILNGNGSKENIQERIEQIKNSIDITTTNSYEK
                     EKLQERLAKLSGGVAVIRVGGSSEVEVGEKKDRYDDALNATRAAVEEGILPGGGTALV
                     KASRILDDIEVENFDQKLGVDIIRKAITRPAKQIIENAGEEGSVIVGKLTDEYGEDFA
                     KGYDAAKGEYTDMLASGIIDPFKVVRSGLVDASGVASLLATTEVAIVDAPEPPAPAGG
                     MPGGMPGGMPGMM"
     gene            <203085..>204704
                     /gene="NDAI0D00890"
                     /locus_tag="NDAI_0D00890"
                     /db_xref="GeneID:11495213"
     mRNA            <203085..>204704
                     /gene="NDAI0D00890"
                     /locus_tag="NDAI_0D00890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669598.1"
                     /db_xref="GeneID:11495213"
     CDS             203085..204704
                     /gene="NDAI0D00890"
                     /locus_tag="NDAI_0D00890"
                     /inference="similar to DNA sequence:INSDC:YML043C"
                     /note="similar to Saccharomyces cerevisiae RRN11
                     (YML043C); ancestral locus Anc_6.46"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669646.1"
                     /db_xref="GeneID:11495213"
                     /db_xref="InterPro:IPR007224"
                     /db_xref="UniProtKB/TrEMBL:G0W9E2"
                     /translation="MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHNNNNNN
                     NGILPTPESSATESHDDDDATTSDDLIKRKRLRRRWKSVIGEAYSDTDLDDDDDDEEE
                     EEDVDVEDEMSDHHESAHHIHENEERKFFKKYEKPQETFEIWQTNNLKRVPINKSMIT
                     YTKLKKIEKQAKRKITVPLLHASKINKLCFEAMSEGLELVTPLVTIENFSLQHIEKLT
                     TLLYLNVSRENWDIAYRIFTLLIRIKKLDIRSIWGIGVRILSEKSPTKTLDFLNWMNS
                     VYSSRLNFIQGINYRMDPVFKSGSRTHTPKYTLTWLWKSLIQYSTKKIISGNNNSNES
                     LEDGSSSELDIDINIDRNNLLDLIEKISEMVLIPPFMEDSEVWFIYSLCHMVLADDLS
                     SKFNPLISNGSRGDIERNQVIQHIQKTKSYLQTSMNKGDFEYPEKYILKQLSIYEQRL
                     YASDPTSNNNNVTDEDVDMQLQDIPNPYSNNTNNATTNINNSIAEDYIFSDFSFDKDL
                     EDLDTQDPKIYGREEDEEHYENNLVQSDSSE"
     gene            <205039..>207636
                     /gene="NDAI0D00900"
                     /locus_tag="NDAI_0D00900"
                     /db_xref="GeneID:11495214"
     mRNA            <205039..>207636
                     /gene="NDAI0D00900"
                     /locus_tag="NDAI_0D00900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669599.1"
                     /db_xref="GeneID:11495214"
     CDS             205039..207636
                     /gene="NDAI0D00900"
                     /locus_tag="NDAI_0D00900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669647.1"
                     /db_xref="GeneID:11495214"
                     /db_xref="GOA:G0W9E3"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G0W9E3"
                     /translation="MKSRHAIEGTHQYKMSLQQKSLRRQRRSHVCITCKNQKLRCDRE
                     RPSCSRCRRIGRDCVYESPTPEETMTNHGNKELSVTSGISTDGSLENNDEFHNEKPNN
                     SNTLQFDEKLHLWNPKDMYLTHGYQTFVDFPYGTHSIAQYDPYLRLFCPSIHGTTLAD
                     LQSRLEFILDESKNPEALSKSPFKTLEDISPLMFIEDAVVKWVDKTNSYLNSQIPLEY
                     FNTMYTIEDRMHPSLMAVVKQIVEDIESLLVSKPTIDKLLKDFYENIYPYYPFIEIEL
                     FDQNLSKIYTEVLGSSRYKINVFQENIRFNLEILTLFLLILSITLNNPNLNYTDYNTP
                     RENNTILSKKLLTISKKLLFLLNGFKFTTENILCCSLYVFVAEFLDPANPDMHIAHDQ
                     ILTLKCLTELSYTLGLYEEPSQFTRYSNRTESNYRFFMFRRKLWIGLQSLILEFLSAD
                     GGCNEVNHRYLSNFLGKNQQIIPSFMEHFHSASTFDRQLFEIHDSVYHFHILLNNVML
                     DCTSNSQEQDLSKIMESLERLKKFTFRKFPLSKLAEIESYTIIGGLQWKNARFDIEMI
                     ERTIILKINMIFFSSLMNIFNCLAIYFEKKCSNNWEKYERFYLFFFPRGLDAYLEVAT
                     LTINYLRGSFSSSISASHEYFLNKSVAYISIKIISIQLSYLLRVSYKLDMVKKNEPST
                     YMFFQESSNSTNAVSEITILSSTLEHIRGHVYSIIHSTLERYDDFLFGIYQVMLMGNY
                     VYYLLEHNILTKTTNEFWRKILKTNDIPIKILDKIKLKWGLGKEDQNVINYYTENPIS
                     LSSFNGNLLKTVEHKLQTADVYDKLLSVSNIPYPSFHEEGTLDQLLESNIDLFSTIIG
                     DNLGELPIL"
     gene            complement(<207939..>208970)
                     /gene="NDAI0D00910"
                     /locus_tag="NDAI_0D00910"
                     /db_xref="GeneID:11495215"
     mRNA            complement(<207939..>208970)
                     /gene="NDAI0D00910"
                     /locus_tag="NDAI_0D00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669600.1"
                     /db_xref="GeneID:11495215"
     CDS             complement(207939..208970)
                     /gene="NDAI0D00910"
                     /locus_tag="NDAI_0D00910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669648.1"
                     /db_xref="GeneID:11495215"
                     /db_xref="GOA:G0W9E4"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G0W9E4"
                     /translation="MSVFISGATGFIAQHIVAQLLENDFKVIGSVRSQEKADKLLKQF
                     NNNENLTLEIVKDISLPNAFHEVFAKYKGKIKYVLHTSSPFFFDSDDYEKDLLIPALN
                     GTENILNAILDHAADTVERVVITSSEAAMIDITRYFDPTFFYDENSWNPTSHEEALIN
                     GVHAYTASKKFAEKYAWDFIEEHKNQIKFALTTVNPCNVFGPQQFDENVTSPMNTSCE
                     IINKLVHSSVDTKVDRTTMGKFIDVRDVAKAHLLALQNDNLIGERLLLISSGFDEQSI
                     LDIINDDFPALKGKIRVGNPGTGALQNWKGSIHDNSKTRKLLRFEFLPLKKSVDDTVS
                     QILRHEEKL"
     gene            <211004..>212974
                     /gene="NDAI0D00920"
                     /locus_tag="NDAI_0D00920"
                     /db_xref="GeneID:11495216"
     mRNA            <211004..>212974
                     /gene="NDAI0D00920"
                     /locus_tag="NDAI_0D00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669601.1"
                     /db_xref="GeneID:11495216"
     CDS             211004..212974
                     /gene="NDAI0D00920"
                     /locus_tag="NDAI_0D00920"
                     /inference="similar to DNA sequence:INSDC:YMR008C,YOL011W"
                     /note="similar to Saccharomyces cerevisiae PLB1 (YMR008C)
                     and PLB3 (YOL011W); ancestral locus Anc_6.42"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669649.1"
                     /db_xref="GeneID:11495216"
                     /db_xref="GOA:G0W9E5"
                     /db_xref="InterPro:IPR002642"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:G0W9E5"
                     /translation="MKLQLQDLLVLSVISLNQVEAWSPSNSYVPANVTCDDNINLIRE
                     ANELSQSEIDWLEKRDSYTRNALRSFLQRSTSNFSDNSLLDRLFQGSNSSNIPKIGVA
                     CSGGGYRAMLSGAGMLSAMDNRTEGANEHGLGGLLQSTTYLAGLSGGNWLTGTLAWNN
                     WTSVQDIINNMTVDDSIWDISDSIINSGGWNILSSAERWDHISDAVQAKQDAGFNISM
                     ADVWGRALSYNFFPSLYRGGVGYTWSTIRDADVFKNGEMPFPISVADGRYPGTTVINL
                     NATVFEFNPFEMGSWDPTLNSFTDVKYLGTNVSNGKPINEGTCVAGFDNTGFIMGTSS
                     TLFNQFLLQINNTSLPSFIRNLATHFLKDLSEDYNDIAIYSPNPFKDAEFIGSNHSKS
                     IVESKDLFLVDGGEDNQNIPLVPLLQEERNLDVIFALDNSADTNESWPDGASLVNTYQ
                     RQFGIQGESMTFPYVPDVETFINLGLNKKPTFFGCDARNLTDLSYVPPLIVYIPNTRY
                     SFNSNQSTFKMSYSTSERLNMIKNGFEATTRGNFTDDEDFLGCVGCAIMRRKQQSLNE
                     TLPSECERCFTNYCWNGTRDSRPVSGINNSDFSSSASIALAAEATSAASASGSSSTTQ
                     SSATKRNGAINMESSKSFMFIFTIFNIVLNML"
     gene            complement(<213261..>214217)
                     /gene="NDAI0D00930"
                     /locus_tag="NDAI_0D00930"
                     /db_xref="GeneID:11495217"
     mRNA            complement(<213261..>214217)
                     /gene="NDAI0D00930"
                     /locus_tag="NDAI_0D00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669602.1"
                     /db_xref="GeneID:11495217"
     CDS             complement(213261..214217)
                     /gene="NDAI0D00930"
                     /locus_tag="NDAI_0D00930"
                     /inference="similar to DNA sequence:INSDC:YMR005W"
                     /note="similar to Saccharomyces cerevisiae TAF4 (YMR005W);
                     ancestral locus Anc_6.40"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669650.1"
                     /db_xref="GeneID:11495217"
                     /db_xref="GOA:G0W9E6"
                     /db_xref="InterPro:IPR007900"
                     /db_xref="UniProtKB/TrEMBL:G0W9E6"
                     /translation="MASPTTNKPSTVTPTNPKTNPTVILALPKRDDSNKQNSSTKSKS
                     KGTVNSGNGGTQQQSDPNKMQDVLFSAGVDIREEEALLHSSINQSKSKTPLDIKIPPH
                     PPFLHPEQVNKFMQRVMLEQQHHQILINQQNYKQNPKQKTPEILQMISDACEDYMKDI
                     ITNTLVISRHRRKAIKVNTGRRSEISMILRTMAINEKKEEEKRVKKRIALGLEKEDLE
                     NKLDSEETLHRASNVTAGLRAGSKKQYGWLTSSVNKPTNTTVKSAGKVAAEIAARGEL
                     GLKFREAREEPGIVMRDLLFALENRRIGVHNVISKGYARIRD"
     gene            <215501..>216172
                     /gene="NDAI0D00940"
                     /locus_tag="NDAI_0D00940"
                     /db_xref="GeneID:11495218"
     mRNA            <215501..>216172
                     /gene="NDAI0D00940"
                     /locus_tag="NDAI_0D00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669603.1"
                     /db_xref="GeneID:11495218"
     CDS             215501..216172
                     /gene="NDAI0D00940"
                     /locus_tag="NDAI_0D00940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669651.1"
                     /db_xref="GeneID:11495218"
                     /db_xref="InterPro:IPR007518"
                     /db_xref="UniProtKB/TrEMBL:G0W9E7"
                     /translation="MTSSLPATNTKSKPIRFDVKNIKIRDTPHKILLQNENGPCALLA
                     LINLLVLSSNEISSLGVVTKQELKKLISKDSIPITAATTTTTTTTTTTENEDGIKKKK
                     VKNGKVSLEELIQILANNALQGNTLEDQDYQNDVDQLLHLLPQLHTGLNINPRFDGTF
                     EDSKELSIFRLFGIPLVHGWVIDHDKYPAIYHLSYEDAQNILTEASEIEETNDADDKD
                     KECNE"
     gene            <216218..>216739
                     /gene="NDAI0D00950"
                     /locus_tag="NDAI_0D00950"
                     /db_xref="GeneID:11495219"
     mRNA            <216218..>216739
                     /gene="NDAI0D00950"
                     /locus_tag="NDAI_0D00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669604.1"
                     /db_xref="GeneID:11495219"
     CDS             216218..216739
                     /gene="NDAI0D00950"
                     /locus_tag="NDAI_0D00950"
                     /inference="similar to DNA sequence:INSDC:YGL082W,YPL191C"
                     /note="similar to Saccharomyces cerevisiae YGL082W and
                     YPL191C; ancestral locus Anc_6.195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669652.1"
                     /db_xref="GeneID:11495219"
                     /db_xref="InterPro:IPR007518"
                     /db_xref="UniProtKB/TrEMBL:G0W9E8"
                     /translation="MKIATQLTDLGLQYILTILENESYAILFRNDHFSTIWKTNDELY
                     SLVTDLGFKRRENIVWQKIKSVDGSQDIFCDGMFEPIKFTEEQEQEQEQGQEEEEDTS
                     RRTLNEEEIHQIENDELLAKQLQEDEDHHIGNTQKEKKIREKSNRKQQIKVMYQYQNR
                     ITKNKMNCGQKKK"
     gene            <217137..>217592
                     /gene="NDAI0D00960"
                     /locus_tag="NDAI_0D00960"
                     /db_xref="GeneID:11495220"
     mRNA            <217137..>217592
                     /gene="NDAI0D00960"
                     /locus_tag="NDAI_0D00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669605.1"
                     /db_xref="GeneID:11495220"
     CDS             217137..217592
                     /gene="NDAI0D00960"
                     /locus_tag="NDAI_0D00960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669653.1"
                     /db_xref="GeneID:11495220"
                     /db_xref="UniProtKB/TrEMBL:G0W9E9"
                     /translation="MSETKEETPSMLHVDSTAVYSSSSTPSNNKQKEQMLELENILIR
                     EEEKVNANDDAINLPELTEDKQQVNIKKQESSSEEVVTTNITSKDIETFTDCTETGET
                     QKHRPSRRFDTKKNETGKKIVSGRWKISKVTKEKNGSSSSNNKKLKRRN"
     gene            complement(<217927..>219522)
                     /gene="NDAI0D00970"
                     /locus_tag="NDAI_0D00970"
                     /db_xref="GeneID:11495221"
     mRNA            complement(<217927..>219522)
                     /gene="NDAI0D00970"
                     /locus_tag="NDAI_0D00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669606.1"
                     /db_xref="GeneID:11495221"
     CDS             complement(217927..219522)
                     /gene="NDAI0D00970"
                     /locus_tag="NDAI_0D00970"
                     /inference="similar to DNA sequence:INSDC:YPL193W"
                     /note="similar to Saccharomyces cerevisiae RSA1 (YPL193W);
                     ancestral locus Anc_6.198"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669654.1"
                     /db_xref="GeneID:11495221"
                     /db_xref="InterPro:IPR019496"
                     /db_xref="UniProtKB/TrEMBL:G0W9F0"
                     /translation="MDYGNNNNNNNFYYGNNNNFNNGSVRPNLPQPTSSGTLNKGTVS
                     DEVQNPSTYTSSQYSQYPINNLNNNNVVSYQQLPQMRAYQPRPQPFQNNQYHPYHPNL
                     QGFPPTAPLSPFQQMIPPMGAPFQPQPQPQPPHYMNGDNQWNLNQPGDNRFRNRNVRT
                     RTKRDEPINYDEDEDDANNNNEEEQSILNQENTTVEKIQKQMKRTEPISYEDPITYNN
                     TMDSNINSSSNRTDKENAIESKSNHNHIVITNDNGKNFDRVSSRDNNNKKRDLTNEHG
                     EGTNTIITGKKRKTEESVPKEGREKVTVSTNFIPVISGNIKKKVVVTNLGNDNANDRN
                     NDSDGDDDDDYDDLKDGKSNPTTIPGTSITLLTEEDIEKWREERRKMWLLKISNNKIK
                     HMASMGIKEDELKKQKSILNESKKDNRFIQSIQNQVNRFHPQVNLNIKLVQREMAKDN
                     LKLLEFIKELGDSGLLEYELSQEEKDKLFGGDKADNQRGYNNKNTHYNNKDNNAFRNN
                     KRPLPRQSRYDTKTDNSNMKGEQ"
     gene            complement(<220940..>223117)
                     /gene="NDAI0D00990"
                     /locus_tag="NDAI_0D00990"
                     /db_xref="GeneID:11495222"
     mRNA            complement(<220940..>223117)
                     /gene="NDAI0D00990"
                     /locus_tag="NDAI_0D00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669607.1"
                     /db_xref="GeneID:11495222"
     CDS             complement(220940..223117)
                     /gene="NDAI0D00990"
                     /locus_tag="NDAI_0D00990"
                     /inference="similar to DNA sequence:INSDC:YPL190C"
                     /note="similar to Saccharomyces cerevisiae NAB3 (YPL190C);
                     ancestral locus Anc_6.193"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669655.1"
                     /db_xref="GeneID:11495222"
                     /db_xref="GOA:G0W9F1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G0W9F1"
                     /translation="MPVTEDQMYSPTPYDGGDNQNENEDQQIETLEDDSNSENFKQSN
                     QSNQKEEISNEDALESNDNTDANPKNNDDKDDEDEDEDDGDDDDDDDDASDLYKEDDN
                     EEKTQAIDTADEAESVLELQSDSESEHASENDDKNNEEDVDDDDEEEEEEEDDNAKND
                     AGSSQSDDEKESLEHNDSNNEDESTESTKESSSSSDEEEDKQEIQNTKIESSISSNIS
                     NLDADVDQNLLQKQANYIIESGMLDRAEFKSLDERQKLTAILTMLNSNPATKLTMPQE
                     TAPVESQIYDTTSNINQQHQKQERKLTPAEKRRLAPRPDLTRPMTQEERERYSAYLRG
                     ENKITEMHNIPLKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKNAYGFIQYNNP
                     QSVKDAIELESNEMNFSKKLILEVSSSNSRPQFDHGDHGTNNSTTFISSSKRPFDNAD
                     EDDGGDMYSDGSAKKSKRRTPACVIYVKKVADRGYANEVFKRFRNSTGLETDMIFLRQ
                     GMDLRKLVNDAAYDGVWGVVFLNKSRNVDIQTFYKGPRGETKFDEYINVSLDDTISIF
                     TSLKNGTGPTGHQLPMPNNAKNAYGYNQPIQPMGTAQGPPPPPQQQQQQQQQGYYPGY
                     GMQAPPQQQQNAYVQQGYGIPQAPQQQQSDYNQMNQGYGRYQGNMSGVPPVQNQMNQS
                     YGRYQNPNMQPLSQQQQQPVQPVQMTPPVQTNQQNQLTSLFRR"
     gene            <225030..>226382
                     /gene="NDAI0D01000"
                     /locus_tag="NDAI_0D01000"
                     /db_xref="GeneID:11495223"
     mRNA            <225030..>226382
                     /gene="NDAI0D01000"
                     /locus_tag="NDAI_0D01000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669608.1"
                     /db_xref="GeneID:11495223"
     CDS             225030..226382
                     /gene="NDAI0D01000"
                     /locus_tag="NDAI_0D01000"
                     /inference="similar to DNA sequence:INSDC:YIL123W,YNL066W"
                     /note="similar to Saccharomyces cerevisiae SIM1 (YIL123W)
                     and SUN4 (YNL066W); ancestral locus Anc_2.239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669656.1"
                     /db_xref="GeneID:11495223"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="UniProtKB/TrEMBL:G0W9F2"
                     /translation="MFISKRFPKRLLSFPIEILKIKNKMKFSTATVLAYASIVGSNVM
                     GSALPQGHHIHKRAVAVEYVYETVVVDVNGKTLTAAAPQETVAGHVAAIKTAILAPTT
                     TSSSTPVAAPVTDVPTTTTNAAIESKPTTTLVAPTSIQTTTTSSQITTQTSTSTSTTS
                     TLAPKETTSTTSSNNNGGIYGDLSPFSAPTEQFVDGTIPCDQFPSGQGVISVDWLDTN
                     GWSGIENTDKSTGGSCAEGSYCSYACQPGMSKTQWPSEQPADGRSIGGLLCKNGFLYR
                     SNTDSNYLCEWGIEAAEVVSEIDQGVAICRTDYPGTENMVIPTFVEAGNSLPLTVVDQ
                     DSYYTWRGMKTSAQYYVNNAGVSVEDGCVWGTDGSGVGNWAPLNFGAGYTNGIGYLSL
                     IPNPNNKSPLNFNVKIVAADDNSVVDGTCYYENGSFVNGEDGCTVAVRSGKAKFVLYN
                     "
     gene            complement(<226976..>228244)
                     /gene="NDAI0D01010"
                     /locus_tag="NDAI_0D01010"
                     /db_xref="GeneID:11495224"
     mRNA            complement(<226976..>228244)
                     /gene="NDAI0D01010"
                     /locus_tag="NDAI_0D01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669609.1"
                     /db_xref="GeneID:11495224"
     CDS             complement(226976..228244)
                     /gene="NDAI0D01010"
                     /locus_tag="NDAI_0D01010"
                     /inference="similar to DNA sequence:INSDC:YIL122W"
                     /note="similar to Saccharomyces cerevisiae POG1 (YIL122W);
                     ancestral locus Anc_2.240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669657.1"
                     /db_xref="GeneID:11495224"
                     /db_xref="UniProtKB/TrEMBL:G0W9F3"
                     /translation="MGQLEGQNDNNNNNLPSSSSTAGTTRRSPSPKHDPNVKEQRADS
                     EHSTNTNIPKEDTVKNQNIGEAPIPKHQPTLSSLPFDHRRWILKDLDIDQEVIANIHS
                     FDDETFNKYLSIILEKERKNIEKIKETNLNTLNQIIDKCIQSDDFNARTIENLVEFVA
                     SDPKKVKNIPKIPSLTPNKRSRTGSMSPRGHHKSISEIPSNISSQQQTASWFPPQQFQ
                     PYQPHISQPYGYFDQNQQMNTDYGNQQRPGLPGPPPQQYLPYQQYQPQQQPQQQQQQQ
                     QPFPPHFSSQSNQNFPSQSSNLPGTASTFSQPSSFLQVPHNNQQRFSLIRERLPDESL
                     EHDLSKRPLTNTTTLLGRPPKLNATMRRQQGGHRRSRSAATVLPQISRNNSIGGSMRS
                     PNQSSNNNSNRTPQKPVSFLIHTPKHPPPT"
     gene            complement(<229357..>231135)
                     /gene="NDAI0D01020"
                     /locus_tag="NDAI_0D01020"
                     /db_xref="GeneID:11495225"
     mRNA            complement(<229357..>231135)
                     /gene="NDAI0D01020"
                     /locus_tag="NDAI_0D01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669610.1"
                     /db_xref="GeneID:11495225"
     CDS             complement(229357..231135)
                     /gene="NDAI0D01020"
                     /locus_tag="NDAI_0D01020"
                     /inference="similar to DNA sequence:INSDC:YNL065W,YIL120W"
                     /note="similar to Saccharomyces cerevisiae AQR1 (YNL065W)
                     and QDR1 (YIL120W); ancestral locus Anc_2.242"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669658.1"
                     /db_xref="GeneID:11495225"
                     /db_xref="GOA:G0W9F4"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G0W9F4"
                     /translation="MSNESIIYTDEEDESFQEETRTYEGDIKAKKDNIEIPATKDGLY
                     HLHGTLSRTTTREINEGEDDEEDGEDSSLDTVPDEEKLEQTSESTAPYTLLSYKQKWG
                     MVFLLVMCGFWSSLGSPIYYPALRQLEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGL
                     ADVFGRRPIILGGMVIYVVASIGLACAPSYGVICFLRCIQSIGISPTIAISSGVVGDF
                     TLKHERGTFVGATSGLVLLGQCFGSLIGAVLTARWDWRAIFWFLAIGSGVALIVAAFT
                     LPETKRTIVGNLSIKPKNILNRAPVFLLKPVQKRFKYDNPDYETLDKTIPRLDLASAF
                     KICALPEILLSLFPAGLQFALWTLMLSSISSTLSAPPYNYRLTIIGVCYLPGGVGGLL
                     GSMLTGRFLDYIYKKALRDFEKKKQNGTIPENEEFNTIKVRLNAIIPQNFIAVISFLL
                     FGWSADKGWKIPAMLITSCVSSFCAMSTLSSSTTLLVDLYPKKASTASSCFNFIRCSL
                     SSIFMGCFAKMKFAMTVGGTFTFMVGLILVGNFLMLIPMKYGMEWRREREAKEQALLE
                     QKLNESMDGNDDDNSQSKDKKKYLLF"
     gene            complement(<232909..>234144)
                     /gene="NDAI0D01030"
                     /locus_tag="NDAI_0D01030"
                     /db_xref="GeneID:11495226"
     mRNA            complement(<232909..>234144)
                     /gene="NDAI0D01030"
                     /locus_tag="NDAI_0D01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669611.1"
                     /db_xref="GeneID:11495226"
     CDS             complement(232909..234144)
                     /gene="NDAI0D01030"
                     /locus_tag="NDAI_0D01030"
                     /inference="similar to DNA sequence:INSDC:YNL064C"
                     /note="similar to Saccharomyces cerevisiae YDJ1 (YNL064C);
                     ancestral locus Anc_2.243"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669659.1"
                     /db_xref="GeneID:11495226"
                     /db_xref="GOA:G0W9F5"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:G0W9F5"
                     /translation="MVKDTKFYDILGVSPSASSSEIKKAYRKFALKYHPDKNPSEEAA
                     EKFKEASAAYEVLSDDEKREMYDQFGPEGMNGGPGGPGGFGGFGGFGDDIFSQFFGGA
                     GAGAGRPRGPQRGRDIKHELSATLEELYKGRTAKLALNKQILCKTCEGRGGKKGAVKK
                     CSSCNGQGVKFVTRQMGPMLQRFQAECEVCHGTGDIIDPKDRCKTCNAKKVTNERKIL
                     EVHIEPGMKDGQKVVFKGEADQAPDIIPGDVIFVVSQKPHEHFQRAGDDLVYEAEIDL
                     LTAIAGGEFAIKHVSGEWLKVAIVPGEVISPGARKIISDKGMPIPKYGGYGNLIVKFN
                     IKFPPNHFTDEESLKKLEEILPPRTKTNIPEGAVIDECVLSPFDPSKYKPSGARGGQS
                     YDSDEEEERGGEGVQCASQ"
     gene            complement(<234644..>236020)
                     /gene="NDAI0D01040"
                     /locus_tag="NDAI_0D01040"
                     /db_xref="GeneID:11495227"
     mRNA            complement(<234644..>236020)
                     /gene="NDAI0D01040"
                     /locus_tag="NDAI_0D01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669612.1"
                     /db_xref="GeneID:11495227"
     CDS             complement(234644..236020)
                     /gene="NDAI0D01040"
                     /locus_tag="NDAI_0D01040"
                     /inference="similar to DNA sequence:INSDC:YNL062C"
                     /note="similar to Saccharomyces cerevisiae GCD10
                     (YNL062C); ancestral locus Anc_2.246"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669660.1"
                     /db_xref="GeneID:11495227"
                     /db_xref="GOA:G0W9F6"
                     /db_xref="InterPro:IPR007316"
                     /db_xref="InterPro:IPR017423"
                     /db_xref="UniProtKB/TrEMBL:G0W9F6"
                     /translation="MDPLKTICAEQHVIIKLPSDNNKLVQLKPDTSISLGKFGAFNVN
                     DIIGYPLGTKFEILYDGDEKEEQVPATGKFKYKIPTGKIKVLDDDVEKTEGERLENVV
                     NSENNQHLVNLGNEVQKLSAEEIEALKEKSVSSSEIISKMIESHGSFDKKTVYSQEKY
                     LKRKKQKFDKIFTVDYLSSSALLQFLIDKGDIQRIMDMSQESVAMLLNLANIKENGNY
                     LCMDETGGLLVYFLLERMFGGDDKSKSPGKIIVVHENEHPNLDLLKFSNYSESFINEH
                     VITISLLEFFEPPTIEDINKGFTPLSKDELYQLKSGQKNKYYRRLKWYHTKMDILKFS
                     TEIEFDALIIASTLHLPSLVPILGEKVHGSRPIVCYSQFKETLLELAHVLYEDLRYLA
                     PSVLETRCRPYQTIRGRLHPLMTMKGGGGYLLWCHRVIPASEPLTIQNPDVSKAIEQD
                     IKVGEGQD"
     gene            <236435..>238312
                     /gene="NDAI0D01050"
                     /locus_tag="NDAI_0D01050"
                     /db_xref="GeneID:11495228"
     mRNA            <236435..>238312
                     /gene="NDAI0D01050"
                     /locus_tag="NDAI_0D01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669613.1"
                     /db_xref="GeneID:11495228"
     CDS             236435..238312
                     /gene="NDAI0D01050"
                     /locus_tag="NDAI_0D01050"
                     /inference="similar to DNA sequence:INSDC:YNL061W"
                     /note="similar to Saccharomyces cerevisiae NOP2 (YNL061W);
                     ancestral locus Anc_2.247"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669661.1"
                     /db_xref="GeneID:11495228"
                     /db_xref="GOA:G0W9F7"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR011023"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023273"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0W9F7"
                     /translation="MGSRRHKNKQAAPPTLDEFQAKKDRKLKRSNDKDSERKSKKPKF
                     DDKKDVKPKSEKKSKNKKKRSVEDEEEQQQKEEMEKLPEVDLEELSQAKKSLFDDAED
                     VQEQLSGEEDELKDEFDLEQEYEDDSDEEARAHPMFSDEEEDMEELNAANMEALSMKL
                     DEEEALEAEEAEKELIETDKFQPRADVLPTEEQELELAQQQPDLTTVRTRMIEIVKVL
                     EDFKNLAAEGRSRTEYTDRLLKDICEYFGYTPFLAEKLFNLFSPAEAMEFFEANEIAR
                     PITIRTNTLKTRRRDLAQALVNRGVNLQPIGSWTKVGLQIFDSQVPIGATPEYLAGNY
                     ILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALMKNTGTVFANDANKNRTKS
                     LIANIHRLGCTNTIVCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEK
                     DFIQIPHLQKQLLLSAIDSVDCNSKHGGIIVYSTCSVAVEEDEAVVDYALRKRPNVKL
                     VDTGLAIGKDGFTSFRGKNFHPSIKLTKRYYPHTYNVDGFYVAKFQKIGPSPHDDNQA
                     SAREKENLARQEAAAEGIIHSDFSKFDDEEDEKYINKSKKVNLLKKGMNPKGTKNAAR
                     D"
     gene            complement(<238631..>240892)
                     /gene="NDAI0D01060"
                     /locus_tag="NDAI_0D01060"
                     /db_xref="GeneID:11495229"
     mRNA            complement(<238631..>240892)
                     /gene="NDAI0D01060"
                     /locus_tag="NDAI_0D01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669614.1"
                     /db_xref="GeneID:11495229"
     CDS             complement(238631..240892)
                     /gene="NDAI0D01060"
                     /locus_tag="NDAI_0D01060"
                     /inference="similar to DNA sequence:INSDC:YNL059C"
                     /note="similar to Saccharomyces cerevisiae ARP5 (YNL059C);
                     ancestral locus Anc_2.248"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669662.1"
                     /db_xref="GeneID:11495229"
                     /db_xref="GOA:G0W9F8"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR027664"
                     /db_xref="UniProtKB/TrEMBL:G0W9F8"
                     /translation="MSRDDSLQPLKVTVIDDPPLTDQPEAFNDKSNYNPEIPIAIDFG
                     SSTVRAGYTNEARPSHIFPTKLTRYRDRKINKTFTFTGNDCSLDQTIRSQMKSPFDGA
                     LITNWDYVEDILQYTFNHLGVVPDHGVQNPIIITEKLATIQSQRSNWYQLLFETYNVP
                     KATFGIDSLFAFYNNNNGSATSTGMVIDCSHEETNIIPIVDGQGILTDAKRINWGGRH
                     AIDYLSNLLALKYPYFPTKLSSYQYESMYQNFCYVSQDYDEEISKILTLDVLEEKDVV
                     IETPFTEVLQPQKTEEELRIQAEKRKESGRRLQEQAKKRRIEKLIEKEEEYEYFSKIR
                     EDLKDQPKKKILSILQNSGFDDEDDFKRYLFNLERSLKRARANDEDAMLENIQDNETT
                     DGKFDLLEIPDEKLDPEQIKEKRKQRLLKAGQDARKKAREEKQKAAEKAEELRLKEIE
                     WRKIDLNGWIKDKRSKLNTLVKRRKDKIRMRDEMKDRKSQAAQNRMKNLATLAEDNLR
                     TGTKRSRQQATIDNDPNDTFGTNDEDWFVYNDITKNPDAFEEALEEEYKEIIELEGLL
                     LEHDPNFTEEDTVEAQYDWRNSTLHLFLRGPRPHDSEDIHQQHQIHLNVERIRVPEIV
                     FQPSMGGLDQAGIAELSETILLRKFGSEPKHLSELSLTMANNIWLTGGNSKIPGLRER
                     IVKEFREFLPVNTQFNVNMTSDPTFDAWNGMAKLAQNETDYKKTIISKKEYEEYGPEY
                     IKEHKLGNMKYFE"
     gene            complement(<241303..>242547)
                     /gene="NDAI0D01070"
                     /locus_tag="NDAI_0D01070"
                     /db_xref="GeneID:11495230"
     mRNA            complement(<241303..>242547)
                     /gene="NDAI0D01070"
                     /locus_tag="NDAI_0D01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669615.1"
                     /db_xref="GeneID:11495230"
     CDS             complement(241303..242547)
                     /gene="NDAI0D01070"
                     /locus_tag="NDAI_0D01070"
                     /inference="similar to DNA sequence:INSDC:YIL117C,YNL058C"
                     /note="similar to Saccharomyces cerevisiae PRM5 (YIL117C)
                     and YNL058C; ancestral locus Anc_2.250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669663.1"
                     /db_xref="GeneID:11495230"
                     /db_xref="UniProtKB/TrEMBL:G0W9F9"
                     /translation="MSLVQNLHVRALPKLVTTTATTTSSTGKPTTTSSFSKATTTSAK
                     TIGLLSSTIKLPSLPSLTTTSDPTSSSSSSSATTTVTTTPIILPPSSEGNPYITGRDT
                     RLDGTVFIAVGAIIGAIFLTMIVWRLLATIKSNKNARYDRYDLGNRNLFNDIYHISDD
                     RENNTYRYPSSSTDNDVEEKVTNSELAHGKENFKKSTLSLLLSSRSNSNDDQEENHDL
                     EAFIYDKGEDHDTDNFHSKIQTRYNPIHHEPTFNINRKSLFISPTLEILQPNNNEELH
                     QPSNNNARAFLGVSTNPFNDHNYSNTSLISDSDLDDSNNYSLRQPQRAASPERKMKKS
                     PIREGYHKRNKSSLGMISTTTLLSSPSYHNNQSNHQNNNNNNEQLIDEVVPASLESTP
                     TKKNGRHQKTPSTYLDDLLKGE"
     gene            <243907..>244458
                     /gene="NDAI0D01080"
                     /locus_tag="NDAI_0D01080"
                     /db_xref="GeneID:11495231"
     mRNA            <243907..>244458
                     /gene="NDAI0D01080"
                     /locus_tag="NDAI_0D01080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669616.1"
                     /db_xref="GeneID:11495231"
     CDS             243907..244458
                     /gene="NDAI0D01080"
                     /locus_tag="NDAI_0D01080"
                     /inference="similar to DNA sequence:INSDC:YNL056W"
                     /note="similar to Saccharomyces cerevisiae OCA2 (YNL056W);
                     ancestral locus Anc_2.251"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669664.1"
                     /db_xref="GeneID:11495231"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G0W9G0"
                     /translation="MTRITNYIPPLNFSPVVSTDVSLYRSGYPMPLNYQFIKDQLNLK
                     TIIYIGDKEPISPEYSDFLERENISYYHVYMDSCRDKDIQKGMDQVLKLVLDVDNYPI
                     LMHSNKGKHRVGVVVGIIRKLLQGWSIAGIYQEYGIFSGGLKGDADLEFITMFATDLT
                     VRNEKIPGFAKLCLIQNSNEKKV"
     gene            <246140..>249814
                     /gene="NDAI0D01090"
                     /locus_tag="NDAI_0D01090"
                     /db_xref="GeneID:11495232"
     mRNA            <246140..>249814
                     /gene="NDAI0D01090"
                     /locus_tag="NDAI_0D01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669617.1"
                     /db_xref="GeneID:11495232"
     CDS             246140..249814
                     /gene="NDAI0D01090"
                     /locus_tag="NDAI_0D01090"
                     /inference="similar to DNA sequence:INSDC:YNL054W"
                     /note="similar to Saccharomyces cerevisiae VAC7 (YNL054W);
                     ancestral locus Anc_2.255"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669665.1"
                     /db_xref="GeneID:11495232"
                     /db_xref="InterPro:IPR024260"
                     /db_xref="UniProtKB/TrEMBL:G0W9G1"
                     /translation="MNADDLKFTVETETVETPALDLPIPLNNNPSTLLLSNKNEQQQQ
                     QQQQQQQPQQSVHRELSHTEILNNSHKNNSSPSSKVRPEIVSSTQQMQRPSPLSNIII
                     DGSTHDNIDSLMRSSSTIGRSSERVHVDNDTNINNKSLKNREFTDEIREPNHLIDNNP
                     LSSHLSHQPLKNKKSSLLVGSSYGLPSMTTDISRIDSTKGTLGNNAKPRAPMAEIHNS
                     GNDRNTNNAIRENHTSLSNANLISRSESVTSMSQPNKLTASLLPEKSSIHSGPNSNAM
                     GTKIVSSAKIIDRPSLPLRNSRELLLSATVKADGSDHSSLAIDNGVRHEASITAGSEI
                     KLKKDTDNLGSVSIRKTVSQDKGIEPNEIIETQQHDVSQKPTKTDFFAAKLASAVGDN
                     EVSDSEETFVYESAANSTKNAIFPNSNGELLAHQQQQQVSENRSHGITPKMSVPILNN
                     NKKLLSRLKNTRHISTGGIPTTSLAALAPLNAQNVEYDHSGIVQAQPHSVLQNPLKAG
                     ANSNNQDDLESFTSYERQQQQTNRTKIDRQSINSYNLEQQQLLERSPNRRLNGSVSTT
                     DGLVMPSSSFLPQATGMISSPSIPRRNMNGNTNNNYSMNNINNSDNTNTTNNNNNNNN
                     NNNIQSKTYGTSMNATLSNPTQRKSSITRHTANLPKQQEGISASGSKRKLRTTVSKIF
                     DADGAPPLRRYSGVPDNVNLEDYIEQSDEYHIPNSIKMNSYIAPKGTQIGQDEYRRSS
                     THTYTSDYDYNNNIKPSNNMNANSNGNGNFFNEPGAIKEENEEDLSINSNKKESMNFN
                     HPNNNSNLEQMLDDDDEMVPDDDRSMFYYSHRDDLEARPHIADYRNDFVDDEEDVGED
                     HDPLSHNNHVNNQNHPLYYDNGYTTEINNGRRSFKHTSYYDPTLSPTFFQHQQLPQQH
                     NLTLTGAQSQHNAGFLATHPQQQQQQLQPNINENTPLRPKNRPARNGFSYSPHNFNTK
                     KSSWSKIKNCVYFTFVVISLLTVGFILGFLLATNKELQGIDIVVMDNIISSSDELVFD
                     VTVSAFNPGFFSITIRDIDIDVFARSSFINKEYYVDGKSSGNNNKNMETTILLGTIYS
                     LETPLQFQGGFFNRNYDVSRSSIKILHPGSNDAKHNGGSGGNDEDDNDDRDKQGAKQE
                     KGLSISRNGWFAGGDDNDDDHDDHDDSKKWKTLIQHDYELIIRGNMKYRIPFFNNEKS
                     VAVQKSEEVPLKTKRMGMQT"
     gene            <250596..>252188
                     /gene="NDAI0D01100"
                     /locus_tag="NDAI_0D01100"
                     /db_xref="GeneID:11495233"
     mRNA            <250596..>252188
                     /gene="NDAI0D01100"
                     /locus_tag="NDAI_0D01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669618.1"
                     /db_xref="GeneID:11495233"
     CDS             250596..252188
                     /gene="NDAI0D01100"
                     /locus_tag="NDAI_0D01100"
                     /inference="similar to DNA sequence:INSDC:YIL113W,YNL053W"
                     /note="similar to Saccharomyces cerevisiae SDP1 (YIL113W)
                     and MSG5 (YNL053W); ancestral locus Anc_2.256"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669666.1"
                     /db_xref="GeneID:11495233"
                     /db_xref="GOA:G0W9G2"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G0W9G2"
                     /translation="MAERRDSFVSRSMKINSKSPRSLQSRNTKNLSLSFQNDEFMKPL
                     KVAPASSINQAVSVSAASLTAPLIINKNFVSMKQQQQQRPRLFNRSSEAAIYTLPNSS
                     RPINPGPLSLSINKNKIDDDANNNSNNDNFSNNIPKSTNEGGSVAPPIPLSICTKKSK
                     SILKRSKTLPSLETSTPLMQDRNSNSNNTQTTFIFSDKGKDVNSINGQYLQTDYHNVF
                     KKNAYPDGPLLVIRPNIYLYSEPRLEEILSFDLVINVAEEIDNLSTHLPTNKNIEYYQ
                     ILWSHNSKISEDLKELTEIMYHATLQNRRILIHCQCGVSRSASLIVAYIMRYHHLNLN
                     KAYDELKSIAHDISPNMGLIFQLMEWNEQLTRMNEAATENLQNNSSGITHSTISNDFD
                     EQASSLLDADVTSSKNDNNNNNNNVSDTSACTASSASSSSSASSSSTFASSNLITTTT
                     KMETIVSESSLSTMFNYHDPEDESIIDSENNNINDGSSQQQQQQRSSFINSSSKYTPF
                     FSYIALNNILPQLINLSKNSIH"
     gene            <252528..>253709
                     /gene="NDAI0D01110"
                     /locus_tag="NDAI_0D01110"
                     /db_xref="GeneID:11495234"
     mRNA            <252528..>253709
                     /gene="NDAI0D01110"
                     /locus_tag="NDAI_0D01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669619.1"
                     /db_xref="GeneID:11495234"
     CDS             252528..253709
                     /gene="NDAI0D01110"
                     /locus_tag="NDAI_0D01110"
                     /inference="similar to DNA sequence:INSDC:YNL051W"
                     /note="similar to Saccharomyces cerevisiae COG5 (YNL051W);
                     ancestral locus Anc_2.260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669667.1"
                     /db_xref="GeneID:11495234"
                     /db_xref="GOA:G0W9G3"
                     /db_xref="InterPro:IPR019465"
                     /db_xref="UniProtKB/TrEMBL:G0W9G3"
                     /translation="MEELEDFEALLEDSFNKRQFANDLLKATNDESSTTTELDIETPI
                     KKLKYDLDEVDARIDDLLRNNSTNIINQLYKGKSSQNIINNELNDSFGYLSMSYKRLQ
                     EEVLEPYEKAQKLQSVLSKVHQTSILLRDSLIYIHIINEIENLSAEKSTTNTSSNKLT
                     TAKAIKLATLYSQLQLNLNQNVNLKSLQVIKHLEGTILVKKKELLGFISLEFSKECLN
                     SFKIKKNKDIISQLAYSLYIVSPQDYVSTIQKYILSNVLMDSQTLTKTINSIKNFPMA
                     FEDVVKRSYDIYSLEDALHNIKFEDTNLLTEYTKQRKPKSSTPRELYWNKISSNFKKE
                     FEISYNRGGPVGKSLAKNYDMIVSTIKENMPKSTGNNDYHHNLDTMLKSISIITSESH
                     K"
     gene            complement(<253926..>254809)
                     /gene="NDAI0D01120"
                     /locus_tag="NDAI_0D01120"
                     /db_xref="GeneID:11495235"
     mRNA            complement(join(<253926..254682,254793..>254809))
                     /gene="NDAI0D01120"
                     /locus_tag="NDAI_0D01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669620.1"
                     /db_xref="GeneID:11495235"
     CDS             complement(join(253926..254682,254793..254809))
                     /gene="NDAI0D01120"
                     /locus_tag="NDAI_0D01120"
                     /inference="similar to DNA sequence:INSDC:YNL050C"
                     /note="similar to Saccharomyces cerevisiae YNL050C;
                     ancestral locus Anc_2.261"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669668.1"
                     /db_xref="GeneID:11495235"
                     /db_xref="InterPro:IPR018555"
                     /db_xref="UniProtKB/TrEMBL:G0W9G4"
                     /translation="MAGLKIVSRKDLFDDSTMFSEHVEPELIAEEGHDDLEIVEIAPS
                     TKSDSVEENNHDDNGQQQNDEDEFEFFPLFSMATEPTSRIDGVETSTTEYDEERGRST
                     NRLMKISLREPSPEIINQKRPKSHYFASYSKEEIDKFQLSAITYDSLLKEFEMGPNKG
                     FEQFRGKVIDLKEYNDKIEAEDLREMRLKRRRPSQKQRLAKKLGAERLKERENRAKEI
                     RKMIKKQFHKRGGKKNKKKAMNPLANAGLKPPVPKFRTE"
     gene            complement(<255432..>258185)
                     /gene="NDAI0D01130"
                     /locus_tag="NDAI_0D01130"
                     /db_xref="GeneID:11495236"
     mRNA            complement(<255432..>258185)
                     /gene="NDAI0D01130"
                     /locus_tag="NDAI_0D01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669621.1"
                     /db_xref="GeneID:11495236"
     CDS             complement(255432..258185)
                     /gene="NDAI0D01130"
                     /locus_tag="NDAI_0D01130"
                     /inference="similar to DNA sequence:INSDC:YIL109C,YNL049C"
                     /note="similar to Saccharomyces cerevisiae SEC24 (YIL109C)
                     and SFB2 (YNL049C); ancestral locus Anc_2.262"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669669.1"
                     /db_xref="GeneID:11495236"
                     /db_xref="GOA:G0W9G5"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:G0W9G5"
                     /translation="MSHKKRVYPQAQLQMGQQPMDPNAFYPQAGNVAMNMQQQSQPLS
                     PQQASQQPQQMQPGMAVPSQMFTPAQQQLNQQLDQTAYSMANLQLNNNAMDPSAYYQQ
                     QQQQQQQLDQYGQYQNPNIVGMNQNQAKPQKPMNQLFSIDLLTSLPPHIEELQYPPPP
                     IMVEPSNFLVPSDAANASPDYLRSTLNAVPRTNSLLKKSKLPFAIVIRPYQHLQDNID
                     PPPLSEDMIVSRCRRCRSYMNPFVKIDNDANRRWRCNFCRLANDIPMAMDEPMGNENF
                     VNRYERNEIKYAVMEYLAPKEYTLRQPPPSIYTFILDVSQNAIRNGLLATATRSILDN
                     LEYLPNHDGRTRVSILCVDNAIHYFAVPNDEESDQIEMMDICDLDEPFLPRPNSLVAS
                     LRLCRNNLEKVLNKIPEIFQANSMTKFALGPGLKAAYNLISGIGGKIIVISATLPNIG
                     IGALQKRQENNVTNTPKESSALLSCQDNFYKNFTVDCSKLQIAIDIFVASDDYKDIAT
                     LSNLTRFTGGQIHQYPGFIATNLIDVTKFTKEFSKHITMDLSTETVMRARGSPGVRTD
                     KFYGHFFNRSSDLCAFSALPRDQEYVFELTLDENLIGEYCYIQVATLLSLNTGQRRIR
                     VITLCLPTSDNISDIFASADQLAITAVLTQKAIQKAINSSLNEARDFLTRSIQDILLS
                     YKKEIVSSNVTGTSPLRLSSNLRMLPLLIHCLTKNAAFRASIIPSDHRSGALNYLETA
                     PLKYLIKNIYPNVYSLHDMPDDVGLPDENGSIVLPQPVNASSASFDKYGLYLIDNSKE
                     LFLWMGGDAVSELISDVFGTPEIFQIPTGKAELPVVPSSTFNERVRNIISKVREHDDV
                     VTYQQLYIVRGISQSEPVAHVSAKELSTLRLWANSELVEDKILNNESYREFLQIIKGK
                     LNK"
     gene            <259072..>259950
                     /gene="NDAI0D01140"
                     /locus_tag="NDAI_0D01140"
                     /db_xref="GeneID:11495237"
     mRNA            join(<259072..259076,259218..>259950)
                     /gene="NDAI0D01140"
                     /locus_tag="NDAI_0D01140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669622.1"
                     /db_xref="GeneID:11495237"
     CDS             join(259072..259076,259218..259950)
                     /gene="NDAI0D01140"
                     /locus_tag="NDAI_0D01140"
                     /inference="similar to DNA sequence:INSDC:YEL012W"
                     /note="similar to Saccharomyces cerevisiae UBC8 (YEL012W);
                     ancestral locus Anc_1.436"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669670.1"
                     /db_xref="GeneID:11495237"
                     /db_xref="GOA:G0W9G6"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:G0W9G6"
                     /translation="MNNINSRNSNSSNNSSGGGTNSKRRIETDVMKLLMSDHDVELVN
                     DNMQEFYIKFCGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSI
                     CLDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLELKDKKLYEERIKEY
                     IAKYATEDRYIQTFGAGTDDSSGEDDDPLDGFQKEDEDEEEEEDIDKGFAGESGDDFG
                     KGNKNKDETDGSSEELSDIEVSEEEEA"
     gene            <261356..>263467
                     /gene="NDAI0D01150"
                     /locus_tag="NDAI_0D01150"
                     /db_xref="GeneID:11495238"
     mRNA            <261356..>263467
                     /gene="NDAI0D01150"
                     /locus_tag="NDAI_0D01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669623.1"
                     /db_xref="GeneID:11495238"
     CDS             261356..263467
                     /gene="NDAI0D01150"
                     /locus_tag="NDAI_0D01150"
                     /inference="similar to DNA sequence:INSDC:YEL011W"
                     /note="similar to Saccharomyces cerevisiae GLC3 (YEL011W);
                     ancestral locus Anc_1.435"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669671.1"
                     /db_xref="GeneID:11495238"
                     /db_xref="GOA:G0W9G7"
                     /db_xref="InterPro:IPR004193"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR006048"
                     /db_xref="InterPro:IPR006407"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR015902"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G0W9G7"
                     /translation="MMEIPENVKGAVEFDPYLKPYAQVLSERRYLADKWAYEITHATP
                     DGSYQSLAKFSRDSYKSYGLHANPQTKEISYKEWAPNAKRAFLVGEFNNWDGSNHELK
                     NKDEFGNFYITIPPLSNGDYAIPHDSKIKVKFQLEDGSEIYRLPAWITRATQPTKETA
                     KQFGPTYEGRFWNPTEPYQFQNNRPVFNESHDSLRIYEAHVGISSPEPKVTTYKEFTQ
                     NILPRIKKLGYDAIQLMAIMEHAYYASFGYQVTNFFAPSSRYGTPEDLKELIDTAHGM
                     GILVLLDVVHSHASKNVEDGLNNFDGSDHQYFHSLSSGRGEHPLWDSRLFNYGNFEVQ
                     RFLLSNLTYYIDVYQFDGFRFDGVTSMLYLHHGVGEGGAFSGDYNEYLSKERSGVDHE
                     ALAYLMLANDLVHELLPESAVTVAEDVSGYPTLCLPRNIGGVGFDYRLAMALPDMWIK
                     LLKEKSDDQWDMGHIVHTLTNRRYGEKVVAYCESHDQALVGDKTLAFWLMDAEMYTGM
                     TVLKEPSLVIDRGIALHKMIRLITHSLGGEAYLNFEGNEFGHPEWLDFPNVNNNDSYH
                     YARRQFNLVDDHLLRYQHLNNFDSTMQHTEMKYQWLNTPQAYVSLKHEVDKVIAFERN
                     GKLFIFNFHPTNSFSDYRIGVEQAGSYRIILNTDRQEFGGQNRIDENARFFTTDLEWN
                     NRKNFIQVYIPCRTAIILALE"
     gene            complement(<266808..>267005)
                     /gene="NDAI0D01160"
                     /locus_tag="NDAI_0D01160"
                     /db_xref="GeneID:11495239"
     mRNA            complement(<266808..>267005)
                     /gene="NDAI0D01160"
                     /locus_tag="NDAI_0D01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669624.1"
                     /db_xref="GeneID:11495239"
     CDS             complement(266808..267005)
                     /gene="NDAI0D01160"
                     /locus_tag="NDAI_0D01160"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669672.1"
                     /db_xref="GeneID:11495239"
                     /db_xref="UniProtKB/TrEMBL:G0W9G8"
                     /translation="MDPAKINAMVKWPIPRTAQDARRFIGLAGSYRRFVKDFSAIARL
                     IHKLLLENRNGYEINRLLSKN"
     gene            complement(<268420..>269448)
                     /gene="NDAI0D01170"
                     /locus_tag="NDAI_0D01170"
                     /db_xref="GeneID:11495240"
     mRNA            complement(<268420..>269448)
                     /gene="NDAI0D01170"
                     /locus_tag="NDAI_0D01170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669625.1"
                     /db_xref="GeneID:11495240"
     CDS             complement(268420..269448)
                     /gene="NDAI0D01170"
                     /locus_tag="NDAI_0D01170"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669673.1"
                     /db_xref="GeneID:11495240"
                     /db_xref="GOA:G0W9G9"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:G0W9G9"
                     /translation="MAAITQKQDASTAKNGETYSKTSVTNDTDGNISMDDGTDTAAAT
                     VGGEEHVGSKVITRSVNSTIEPSTTTTSSVSQDVMVSLHNPALQTLMQSLIKTAIEGA
                     KSQTQLAETSLSSKLHKAASTVAKFDGKNFYDPEKDWVEWVARLRNVAMDIDPKGLDD
                     ATMLDLARRTLVDRALELFLRHKDELKSLDDFKKVMMSASTNSPYWKSAKAITSIRFG
                     GDVEDYNRRFNRLKSSLPANFYSPEVLDPFFYLMGLGETNAAQLLGEIGDLSKTLDEC
                     QQIATNLSFKLKRESSDDSFHARVGKKRKINPLANRITPNMTAKSRCYRCNETGHFAA
                     KCPSKSKN"
     gene            complement(269899..269971)
                     /gene="NDAI0Dtrna7K"
                     /locus_tag="NDAI_0Dtrna7K"
                     /db_xref="GeneID:11495241"
     tRNA            complement(269899..269971)
                     /gene="NDAI0Dtrna7K"
                     /locus_tag="NDAI_0Dtrna7K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:11495241"
     gap             270011..270605
                     /estimated_length=595
     gene            complement(<274695..>275141)
                     /gene="NDAI0D01180"
                     /locus_tag="NDAI_0D01180"
                     /db_xref="GeneID:11494838"
     mRNA            complement(<274695..>275141)
                     /gene="NDAI0D01180"
                     /locus_tag="NDAI_0D01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669626.1"
                     /db_xref="GeneID:11494838"
     CDS             complement(274695..275141)
                     /gene="NDAI0D01180"
                     /locus_tag="NDAI_0D01180"
                     /inference="similar to DNA sequence:INSDC:YNR004W"
                     /note="similar to Saccharomyces cerevisiae YNR004W;
                     ancestral locus Anc_1.433"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669674.1"
                     /db_xref="GeneID:11494838"
                     /db_xref="UniProtKB/TrEMBL:G0W9H0"
                     /translation="MDFDTNSSFGTETLTTFLNNFDDLNLISENYTEFLLPYFEAISK
                     DNKLRRLAKKKCKNYFERWVSTNDKEISTRYQEFWFILNGTFYELEGNLFHNLIINEV
                     DIKEYENVLNNQAKKEFEPDTGKPLPNPLNNLILEEVEVTDYVDAS"
     gene            complement(<275476..>276327)
                     /gene="NDAI0D01190"
                     /locus_tag="NDAI_0D01190"
                     /db_xref="GeneID:11495242"
     mRNA            complement(<275476..>276327)
                     /gene="NDAI0D01190"
                     /locus_tag="NDAI_0D01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669627.1"
                     /db_xref="GeneID:11495242"
     CDS             complement(275476..276327)
                     /gene="NDAI0D01190"
                     /locus_tag="NDAI_0D01190"
                     /inference="similar to DNA sequence:INSDC:YCR016W"
                     /note="similar to Saccharomyces cerevisiae YCR016W;
                     ancestral locus Anc_1.431"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669675.1"
                     /db_xref="GeneID:11495242"
                     /db_xref="InterPro:IPR019327"
                     /db_xref="UniProtKB/TrEMBL:G0W9H1"
                     /translation="MSSNHIPAWRKIAIKKKLENKDGAVLNDDPLNVTTHLATGSLTR
                     KEKKRIIKGESSVSVDRNKVSKLKKSGKREKLPKDQRITKKSKVLKDQLRYLIEFYKS
                     RVENTLPKELYALENVKLNFPGNDEDDKIDPASGVIEIWKFSKQKQNWLIKHFFNMEE
                     IPSEYDPLLISYFKDLPGKSKDDLSEKCLGQIKSWNEYVEKEEAKMSAIVNGDENKEG
                     TNDEGNDDEASKEDEIKEKKPEDISKIEIEVVPNKEATIRSHLLLKQWFINEEDLTKI
                     ILKNLPI"
     gene            <276800..>277768
                     /gene="NDAI0D01200"
                     /locus_tag="NDAI_0D01200"
                     /db_xref="GeneID:11495243"
     mRNA            <276800..>277768
                     /gene="NDAI0D01200"
                     /locus_tag="NDAI_0D01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669628.1"
                     /db_xref="GeneID:11495243"
     CDS             276800..277768
                     /gene="NDAI0D01200"
                     /locus_tag="NDAI_0D01200"
                     /inference="similar to DNA sequence:INSDC:YCR015C"
                     /note="similar to Saccharomyces cerevisiae YCR015C;
                     ancestral locus Anc_1.430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669676.1"
                     /db_xref="GeneID:11495243"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G0W9H2"
                     /translation="MRNDIIISDFDETITTRDTTSLVASLPYKVKQGLSPPWSYFKDK
                     YMDACVEYKKENANCIQNRKLPLLPFLDVSRNHGFRSAFNAEFVYQSDSKFVELKSIS
                     EIEEYNLFKGITHHQVQEYASNLLNEEDPLIRPGFMNFISSNVKPENFYIVSVNWSKE
                     FIYSILRYANIDPSHIFCDHLLSSGSEYTGIFSKELMTGCDKANILDTILLSRSNDLD
                     LLSKNTRVWYIGDSETDILPLLHPSVNGAILINPLHELKKYLTISRDVLGASASVVES
                     FMNVDREYIKVVDKSATTSVYFVKSWDAFDKLLNEPYMMEAPMNEG"
     gene            <279095..>279970
                     /gene="NDAI0D01210"
                     /locus_tag="NDAI_0D01210"
                     /db_xref="GeneID:11495244"
     mRNA            <279095..>279970
                     /gene="NDAI0D01210"
                     /locus_tag="NDAI_0D01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669629.1"
                     /db_xref="GeneID:11495244"
     CDS             279095..279970
                     /gene="NDAI0D01210"
                     /locus_tag="NDAI_0D01210"
                     /inference="similar to DNA sequence:INSDC:YCR010C,YNR002C"
                     /note="similar to Saccharomyces cerevisiae ADY2 (YCR010C)
                     and ATO2 (YNR002C); ancestral locus Anc_1.425"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669677.1"
                     /db_xref="GeneID:11495244"
                     /db_xref="GOA:G0W9H3"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="UniProtKB/TrEMBL:G0W9H3"
                     /translation="MSIQEESSGYTAFENHVSNHDADKGENYHPYGLTDNDDSGPRNP
                     SQESLCKIYTGGANNEYIYIGRQKFLREQLTEAFGGTLNPGLAPTSVHRFANPAPLGL
                     SAFALTTFVLSMFNSKAQGITTPNVVVGLAMFYGGVVQIIAGIWEVALENTFGATALC
                     SYGGFWLSFGSIYIPWFGILDAYTDKESELGNALGFYLLGWCIFTFGLSVCTMKSTVM
                     FFALFFLLGVTFLLLSIGEFSGESRVTRAGGILGVIVAFIAWYNAYAGLANKQNSYIL
                     AHPFPLPDNEKVLHI"
     gene            complement(280464..280537)
                     /gene="NDAI0Dtrna3N"
                     /locus_tag="NDAI_0Dtrna3N"
                     /db_xref="GeneID:11495245"
     tRNA            complement(280464..280537)
                     /gene="NDAI0Dtrna3N"
                     /locus_tag="NDAI_0Dtrna3N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:11495245"
     gene            <285219..>287075
                     /gene="NDAI0D01215"
                     /locus_tag="NDAI_0D01215"
                     /db_xref="GeneID:11494820"
     mRNA            <285219..>287075
                     /gene="NDAI0D01215"
                     /locus_tag="NDAI_0D01215"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669630.1"
                     /db_xref="GeneID:11494820"
     CDS             285219..287075
                     /gene="NDAI0D01215"
                     /locus_tag="NDAI_0D01215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669678.1"
                     /db_xref="GeneID:11494820"
                     /db_xref="InterPro:IPR018789"
                     /db_xref="UniProtKB/TrEMBL:G0W9H4"
                     /translation="MLISFLLFVIKATYVFSSYIKDSEKSLWERESSTCRTVTNGCPD
                     LNFGWHATTTNLLKYYLDILYVEWLGDNLYEITIQVTGEEQIDLKYLYSLKVIGVQGP
                     KSTIQLYGKNENTFLIDNPTNYTVTFQVYGGAKKDGCNIWLPDFQIQYEYLQGDASKY
                     QDSWKWGTTTFDLSTGCTNYDNQMNSQTDFPGFYWSMHCSDNCGKSARFFPPVIPSEL
                     TSLTSSNISPTIDVSSIVTSYFSTFLGTVTPQTSMPVSDPGSDPTSGMPSNIWPIPTN
                     TQTSTLISTILSTSLYSSAASTFIDHITSISTASSSLHGLTSSHYVTSDPSTVPSASS
                     SLHILTSSDPVTSAPSTAPSASSSLQTSTSGSPVTSDPSTVPSASSSLHGLTSSDPVT
                     SDPSTAPSASSSLQTSTSGGPVTSDPSTVPSASGSLQTSTSGSPVTSDPSTVPSASSS
                     LHGLTSSHYVTSDPSTHPSASSSLHILTSSDPVTSDPSTVPSASGSLHISSTYIAAQN
                     STAPYITSSQSPFQLQSFSSEYFNGQTSLTQRSPKFSSLTSTLPLKSTSSVKLAIKSG
                     SNFSQATIFSSTLSTTNIRTTLVTSSVYQNKAIGVKLARMKLLSLLAFIFFL"
     gene            complement(<291053..>291919)
                     /gene="NDAI0D01220"
                     /locus_tag="NDAI_0D01220"
                     /db_xref="GeneID:11495246"
     mRNA            complement(<291053..>291919)
                     /gene="NDAI0D01220"
                     /locus_tag="NDAI_0D01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669631.1"
                     /db_xref="GeneID:11495246"
     CDS             complement(291053..291919)
                     /gene="NDAI0D01220"
                     /locus_tag="NDAI_0D01220"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669679.1"
                     /db_xref="GeneID:11495246"
                     /db_xref="UniProtKB/TrEMBL:G0W9H5"
                     /translation="MKDLGPINKFLGTNCSQDKDGNITLKMTDYITKATDAMDNESKK
                     PTYNPMSGGKDYFDITSPPVQSIKAYQSIIGQLLFIANAGRPDVAFPVSFLSRFLKDP
                     REVHMDAATRIMRYLYTTREYGIKYRSKSKRQLTVYTDASQGAAWDMPFSTSGYATFL
                     AGGAITWCSRRIRSTICLSSTEAEYIAASEAVLETMWLYNLLEHMGYPLSENLLMIDN
                     EPAIKLASHPILHSRTKHIKLRYHKIREAVDDGIVKIEYVNTLDQVADILTKALPQKQ
                     FNYLRDKLVSMC"
     gene            complement(<293860..>294493)
                     /gene="NDAI0D01230"
                     /locus_tag="NDAI_0D01230"
                     /db_xref="GeneID:11495247"
     mRNA            complement(join(<293860..294366,294470..>294493))
                     /gene="NDAI0D01230"
                     /locus_tag="NDAI_0D01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669632.1"
                     /db_xref="GeneID:11495247"
     CDS             complement(join(293860..294366,294470..294493))
                     /gene="NDAI0D01230"
                     /locus_tag="NDAI_0D01230"
                     /inference="similar to DNA sequence:INSDC:YNL044W"
                     /note="similar to Saccharomyces cerevisiae YIP3 (YNL044W);
                     ancestral locus Anc_2.269"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669680.1"
                     /db_xref="GeneID:11495247"
                     /db_xref="InterPro:IPR004895"
                     /db_xref="UniProtKB/TrEMBL:G0W9H6"
                     /translation="MNQLGRFAQVSRLAEDFSVENMKNQFQSLQTKLSTLRSPQEFFN
                     VKNMSKPQNVGDLQNRVSFNLNHYSSNYALIIGLLSIYTLLTNLLLLFVIILVFFGIA
                     GINRLRGQDLVTPLGTFKTSQLYTALLCLALPLGFLASPISTMLWLIGASAVTVFGHA
                     ALMEKPVESVFDEETV"
     gene            complement(<295063..>297048)
                     /gene="NDAI0D01240"
                     /locus_tag="NDAI_0D01240"
                     /db_xref="GeneID:11495248"
     mRNA            complement(<295063..>297048)
                     /gene="NDAI0D01240"
                     /locus_tag="NDAI_0D01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669633.1"
                     /db_xref="GeneID:11495248"
     CDS             complement(295063..297048)
                     /gene="NDAI0D01240"
                     /locus_tag="NDAI_0D01240"
                     /inference="similar to DNA sequence:INSDC:YNL045W"
                     /note="similar to Saccharomyces cerevisiae YNL045W;
                     ancestral locus Anc_2.268"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669681.1"
                     /db_xref="GeneID:11495248"
                     /db_xref="GOA:G0W9H7"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR012777"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR015211"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0W9H7"
                     /translation="MYSLLKAFPPRTRVRSISLVPPRKIRMNAMLPDILESRRPKESP
                     EFDHSTLSNYKSYQVHHTRLELQILFDECIVKGRVIYNLSARGVDFHEIALDSSFLNI
                     ESIQLNNETIENFEVLPRIEPLGSKITIKPPTIPKEPFELGLTFTTTDRCTALQWLTK
                     KQTSGMPYVFSQLEAIHARSLFPCFDTPSVKSPFSASITSPLPVVFSGISTGSKNNIY
                     CFEQKVPIPAYLVGIASGDLASAAIGPRSTVYTEPFRLEEAKWEFSDDVEKFIQAAEN
                     IIFDYEWGTYDILINVNSYPYGGMESPNMTFATPTLIAHDKSNIDVIAHELAHSWSGN
                     LVTNCSWNHFWLNEGWTVYLERRIVAAIHGESTRHFSALIGWNDLENSIHAMRNPNRF
                     STLVQNLNDGTDPDEAFSSVPYEKGFNLLFFLENLLGGTKEFDPFIKHYFKKFSYKSL
                     DTFQFLDTLFEFFTDKRELLENVDWETWLFKPGMPPKPQFDTTLANTVYALAKKWLHN
                     ASEFNSVEEFESAFSSEDIKGFNSNQIVLFLEVLVQKEFLGHNAPGGYDWANYPLASS
                     SLLSIYSEKIAQSQNAEIIFKTFKFEILCALNIYYEKLAAWLGTVGRMKFVRPGYRLL
                     DSVDHKLAVDTFHKFKDSYHPICKMLVSQDLNMVEKM"
     gene            complement(<297880..>298512)
                     /gene="NDAI0D01250"
                     /locus_tag="NDAI_0D01250"
                     /db_xref="GeneID:11495249"
     mRNA            complement(<297880..>298512)
                     /gene="NDAI0D01250"
                     /locus_tag="NDAI_0D01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669634.1"
                     /db_xref="GeneID:11495249"
     CDS             complement(297880..298512)
                     /gene="NDAI0D01250"
                     /locus_tag="NDAI_0D01250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669682.1"
                     /db_xref="GeneID:11495249"
                     /db_xref="UniProtKB/TrEMBL:G0W9H8"
                     /translation="MKNLKGYNEANQSKIRKHIKNYSGLFITKPSYSKLSTVAKGSNF
                     WELVCYKNMDFFKPSHERTESFSLSTPCCKLCQYKIGMTRGFATARLWTVNKLLRTNS
                     EKKMLISKDSKSTILQTNPFLEKVVHHNIFSFECFTDTKTILLVLILLFSILYVLNLL
                     VHIVHDLVDVTQKTLRWVFLIKFLCNDGFSGSRMSILCLAKNCVFGWLGI"
     gene            complement(<299369..>300751)
                     /gene="NDAI0D01260"
                     /locus_tag="NDAI_0D01260"
                     /db_xref="GeneID:11495250"
     mRNA            complement(<299369..>300751)
                     /gene="NDAI0D01260"
                     /locus_tag="NDAI_0D01260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669635.1"
                     /db_xref="GeneID:11495250"
     CDS             complement(299369..300751)
                     /gene="NDAI0D01260"
                     /locus_tag="NDAI_0D01260"
                     /inference="similar to DNA sequence:INSDC:YNL048W"
                     /note="similar to Saccharomyces cerevisiae ALG11
                     (YNL048W); ancestral locus Anc_2.266"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669683.1"
                     /db_xref="GeneID:11495250"
                     /db_xref="GOA:G0W9H9"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="UniProtKB/TrEMBL:G0W9H9"
                     /translation="MIPYLFFVIAVIGLPIIITRILCNFIRKKLFALPNDFKQQAGHI
                     QTFSNVPSGLKQGSIRRSLILSSLNPNKFNNFRNQKLSSIITQSDKEELSKGKKRRYI
                     YGFFHPYCNAGGGGEKVLWKAVEATLTDDSTNIVLIYTGDIDTDGATILRNVQEKFDY
                     TLDSNRIVFIYLKYRTLVDDKTWPRFTLLGQGFGSIILSIEALFTCPPDVWCDTMGYP
                     FGYPFVSFLLGIPIVTYTHYPIISTDMLKKLRKQPRTMKNLLKYYYWRIFMLSYQAIG
                     KYVTVIVTNSTWTNNHIKQIWSDFPTTIIYPPCSTEKLVSYIETSRKNQCVVLAQFRP
                     EKRHKLIIRSYHSFMNKHPDCKPLNLVFLGSTRSVIDKAYVKELTNLCFEELKIPKHL
                     IEFKTDCPYEEIKAILNESTFGINAMWNEHFGIAVVEYLASGLIPLVHASAGPLLDIV
                     VPWDIVGKKR"
     gene            301031..301102
                     /gene="NDAI0Dtrna5M"
                     /locus_tag="NDAI_0Dtrna5M"
                     /db_xref="GeneID:11495251"
     tRNA            301031..301102
                     /gene="NDAI0Dtrna5M"
                     /locus_tag="NDAI_0Dtrna5M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:11495251"
     gene            302833..302904
                     /gene="NDAI0Dtrna4Q"
                     /locus_tag="NDAI_0Dtrna4Q"
                     /db_xref="GeneID:11494827"
     tRNA            302833..302904
                     /gene="NDAI0Dtrna4Q"
                     /locus_tag="NDAI_0Dtrna4Q"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAA"
                     /db_xref="GeneID:11494827"
     gene            complement(<303462..>305273)
                     /gene="NDAI0D01270"
                     /locus_tag="NDAI_0D01270"
                     /db_xref="GeneID:11494824"
     mRNA            complement(<303462..>305273)
                     /gene="NDAI0D01270"
                     /locus_tag="NDAI_0D01270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669636.1"
                     /db_xref="GeneID:11494824"
     CDS             complement(303462..305273)
                     /gene="NDAI0D01270"
                     /locus_tag="NDAI_0D01270"
                     /inference="similar to DNA sequence:INSDC:YEL013W"
                     /note="similar to Saccharomyces cerevisiae VAC8 (YEL013W);
                     ancestral locus Anc_1.441"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669684.1"
                     /db_xref="GeneID:11494824"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0W9I0"
                     /translation="MGSCCSCLKNTSDSYSDNESNINDSQFNNTNNANIDDDSNILPI
                     ADNEREAVTALLGYLENKDNLDFYSGGPLKALTTLVYSDNLNLQRSAALAFAEITEKY
                     VCQVDRKVLEPILILLQSNDSQIQIAACAALGNLAVNNENKLLIVEMGGLNPLINQMM
                     GDNVEVQCNAVGCITNLATRDDNKSKIATSGALIPLTKLAKSKHMRVQRNATGALLNM
                     THSGENRKELVNAGAVPILVSLLSSTDPDVQYYCTTALSNIAVDEENRQKLSQTEPRL
                     VTKLVNLMDSTSSRVKCQATLALRNLASDTSYQLEIVRAGGLPHLVKLIQSDSIPLIL
                     ASVACIRNISIHPLNEGLIVDAGFLKPLVNLLDYKDSEEIQCHAVSTLRNLAASSEKN
                     RKEFFESGAVEKCKELALVSPISVQSEISACFAILALADVSKLDLLDMDILDALIPMT
                     YSANQEVSGNAAAALANLCSRINNYNKIIEFWNKPSNGIRGFLLRFLDSDYATFEHIA
                     LWTILQLLESHNEKIMNLVKSDKDMIDGVTRMANVTFERIQNSGIDINENGENRADKN
                     KNGQANGEIENSRMSEPVEDASIELYNITQQILQFLN"
     gene            complement(<306153..>307895)
                     /gene="NDAI0D01280"
                     /locus_tag="NDAI_0D01280"
                     /db_xref="GeneID:11495252"
     mRNA            complement(<306153..>307895)
                     /gene="NDAI0D01280"
                     /locus_tag="NDAI_0D01280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669637.1"
                     /db_xref="GeneID:11495252"
     CDS             complement(306153..307895)
                     /gene="NDAI0D01280"
                     /locus_tag="NDAI_0D01280"
                     /inference="similar to DNA sequence:INSDC:YEL015W"
                     /note="similar to Saccharomyces cerevisiae EDC3 (YEL015W);
                     ancestral locus Anc_1.442"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669685.1"
                     /db_xref="GeneID:11495252"
                     /db_xref="InterPro:IPR004443"
                     /db_xref="InterPro:IPR019050"
                     /db_xref="InterPro:IPR025762"
                     /db_xref="UniProtKB/TrEMBL:G0W9I1"
                     /translation="MSQFVGFEVQVELKDGKLITGKIAKATNKGLTLNNVKFSDGGRS
                     QAFKVRSSRLKDLKVLNVAKKKAVSNNINANNANNNNKQRQISNEIGNGNANEIDWKN
                     DDVEKIKQDEDFDFQGNLNLFNKKDIFNQLREYDNNNNITHVVNKDHYQNNEMIVTGN
                     ENVNNDEDEDEDDYEFDDIDDPNYLPITKSINITHLLHSAVSGSNDKDANSHNINTNN
                     KDVLQNIENLLLNETLNKNTNNVVHDGQSLNSSTSSLQLQYQPQQQNTVKDSKTNQNI
                     PLVTPIQLLEIERINFEKFHISTDSLAENFAINSSYFLKDKLLDKSKNKNDKNFKNDK
                     NNDKNPLAVIIASDVGRSGLKAISLAKYLVQSNKIDVILLFVQSSFSNNADNNNSNKM
                     REISENLKIFEKCGGKLIIRNNDKNKEGVNRKNIIESLKAIFQTLNNPSIELVIDGLQ
                     GFDCDLLDDFDTGLEYELIEILTWCNYQKNNKNNNSNCELWSIDFPSGYESSTGMKNF
                     ENCINHVDGILCSNWPINSLLNLHKTMDNKKLSHLVLVDTGIANQVYFEKNSFKKFQN
                     IDLFVTKGHKIIDL"
     gene            <308373..>309551
                     /gene="NDAI0D01290"
                     /locus_tag="NDAI_0D01290"
                     /db_xref="GeneID:11495253"
     mRNA            <308373..>309551
                     /gene="NDAI0D01290"
                     /locus_tag="NDAI_0D01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669638.1"
                     /db_xref="GeneID:11495253"
     CDS             308373..309551
                     /gene="NDAI0D01290"
                     /locus_tag="NDAI_0D01290"
                     /inference="similar to DNA
                     sequence:INSDC:YNL001W,YCL001W-B"
                     /note="similar to Saccharomyces cerevisiae DOM34 (YNL001W)
                     and YCL001W-B; ancestral locus Anc_1.418"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669686.1"
                     /db_xref="GeneID:11495253"
                     /db_xref="GOA:G0W9I2"
                     /db_xref="InterPro:IPR004405"
                     /db_xref="InterPro:IPR005140"
                     /db_xref="InterPro:IPR005141"
                     /db_xref="InterPro:IPR005142"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:G0W9I2"
                     /translation="MRVLKLLKNATGGASISLLPEDKEDLFTIHQLIDKDDEIIFKKK
                     FTTKTAQVNEQSSTTKKTTDLARLRIKVLSNEFSLADDYLKYKGVTTTDESGQSNVDI
                     PVGKFLSFVVNFTYPFTIIKDEFDKYAEKLLNNACNPESKSDTAAVVLQEGIAHVCLL
                     TPSSTILKQKIEYSMPKKKRSTDVMKFDEKTTKFYKAIYESIKKNFDISNLKLILLCS
                     PAFYAKTLYDKILQYAKEEQNKLILSNQNKFLVAHCSTGYLQGISEVLKDPLFTSKLN
                     DTKYTQDVQILDDFLKHLDADDFKAWYGESEVVKAAEMGAINYLLITDIIMRSSDLVQ
                     RKKFQNVADVVEQNGGKVIVFSTLHESGEELDKLTGVACILKYPLPDLDEDYEDGEDI
                     "
     gene            complement(<309779..>310738)
                     /gene="NDAI0D01300"
                     /locus_tag="NDAI_0D01300"
                     /db_xref="GeneID:11495254"
     mRNA            complement(<309779..>310738)
                     /gene="NDAI0D01300"
                     /locus_tag="NDAI_0D01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669639.1"
                     /db_xref="GeneID:11495254"
     CDS             complement(309779..310738)
                     /gene="NDAI0D01300"
                     /locus_tag="NDAI_0D01300"
                     /inference="similar to DNA sequence:INSDC:YCR002C"
                     /note="similar to Saccharomyces cerevisiae CDC10
                     (YCR002C); ancestral locus Anc_1.419"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669687.1"
                     /db_xref="GeneID:11495254"
                     /db_xref="GOA:G0W9I3"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W9I3"
                     /translation="MSLSMTAALEPTSYVGFDTITTQIEHRLLKRGFQFNIMVVGHSG
                     LGKSTLINTLFASHLIDTATGNDITKLPISKTTEMKVSTHSLIEDKVRLNINIIDTPG
                     FGDQINNDKVWEPIVKYIKEQHSIYLRKELTAQRERHLPDTRVHAILYFLQPNNKGLT
                     KLDIAALKKLTELANVIPVIAKSDALTIDERVNFRSNIQKQFQKYNFKIYPYDNEDLT
                     DEELELNKSIRSIIPFAVVGSEKEIEVDGQTFRGRKTRWGAINVEDMNQCEFVYLREF
                     LIRTHLQDLIESTSYIHYERFRARQLIALKENANSNRSSAQLK"
     gene            <311133..>312089
                     /gene="NDAI0D01310"
                     /locus_tag="NDAI_0D01310"
                     /db_xref="GeneID:11494949"
     mRNA            <311133..>312089
                     /gene="NDAI0D01310"
                     /locus_tag="NDAI_0D01310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669640.1"
                     /db_xref="GeneID:11494949"
     CDS             311133..312089
                     /gene="NDAI0D01310"
                     /locus_tag="NDAI_0D01310"
                     /inference="similar to DNA sequence:INSDC:YNL063W"
                     /note="similar to Saccharomyces cerevisiae MTQ1 (YNL063W);
                     ancestral locus Anc_2.245"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669688.1"
                     /db_xref="GeneID:11494949"
                     /db_xref="GOA:G0W9I4"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR004556"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0W9I4"
                     /translation="MPRISPVLAKKALSIQPYLPLLLPECRTLESAKQELKWIRYELS
                     SSNRTHYRMSVKKACLLRYQHVPLQYILGTQPFGSLNIICKRNVLIPRWETEEWATAL
                     LKCLIKYWKNHQLRKPLSIWDLCSGSGCISLLSKSELNKADIKSNITAIDLSSAAISL
                     IKLNMQKLKIQAINVKQLNILDCGPTNNSFQEIDVLICNPPYIPKHDFNISVNKSVRL
                     YEPKLALIGDLEFYENLIDSWLLKGNNRTVNSFVYEIGDIHQFNYIKERINKNPLLKD
                     TWEVGLKFDSNGKPRCVFGFNKIKPAFKYIFHEFGSSSGIQL"
     gene            complement(<312502..>313521)
                     /gene="NDAI0D01320"
                     /locus_tag="NDAI_0D01320"
                     /db_xref="GeneID:11494950"
     mRNA            complement(<312502..>313521)
                     /gene="NDAI0D01320"
                     /locus_tag="NDAI_0D01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669641.1"
                     /db_xref="GeneID:11494950"
     CDS             complement(312502..313521)
                     /gene="NDAI0D01320"
                     /locus_tag="NDAI_0D01320"
                     /inference="similar to DNA sequence:INSDC:YCR004C"
                     /note="similar to Saccharomyces cerevisiae YCP4 (YCR004C);
                     ancestral locus Anc_1.421"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669689.1"
                     /db_xref="GeneID:11494950"
                     /db_xref="GOA:G0W9I5"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR010089"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:G0W9I5"
                     /translation="MKIAIITYSTYGHITNLAKAVQSGIESMGGHADIFRVEETLTQV
                     VLDKMSAPPKPSDIPVATKDTLIEYDAFLFGIPTRFGNLPAQWCAFWDKTGSIWVKGQ
                     LDGKIAGLFVSTASYGGGQEVTIKTCLNYLAHHGIIYVPLGYKNVFGNLSNIDEIHGG
                     SPWGAGTLAGSDGSRTASELELKVAAIQGQTFYGIASKYYGTTGKTSNRDKEKGTMAT
                     GTAGTTGATEAAVGAGGRSGDDSIGTKRTTGKQVTGATGTEATTGTAGAKETKTGTTP
                     VRRRRSSIGTAVSSAGYAGAGASIPVAILGEEEKPAGRNIRPSKATKEQEKRKSVFAE
                     CCSIM"
     gene            <314395..>315447
                     /gene="NDAI0D01330"
                     /locus_tag="NDAI_0D01330"
                     /db_xref="GeneID:11494951"
     mRNA            <314395..>315447
                     /gene="NDAI0D01330"
                     /locus_tag="NDAI_0D01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669642.1"
                     /db_xref="GeneID:11494951"
     CDS             314395..315447
                     /gene="NDAI0D01330"
                     /locus_tag="NDAI_0D01330"
                     /inference="similar to DNA sequence:INSDC:YEL018W"
                     /note="similar to Saccharomyces cerevisiae EAF5 (YEL018W);
                     ancestral locus Anc_1.447"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669690.1"
                     /db_xref="GeneID:11494951"
                     /db_xref="UniProtKB/TrEMBL:G0W9I6"
                     /translation="MDPIINDLLVLQLIYSLLFNKYKDEILPHSNKQNRDKFDPDNDN
                     FIISSIKLSLIKITDEFQNNLLINEMVQYHNTNNENDPKKTIKKLTINDILNIVENLF
                     PINQFNITLMNGQLNFQNLKLNQLRSLIIEKYLLFRTNSIQHIKRLDDEISNRLGFAP
                     SSAPSSVSKSPSPQPLTQKNIVSTSNNNISVLSTSTSPILTPAVPLSSSSLSSSTTTT
                     HPTITTTTINNNNKKNVTNTISPAIDPKREKLLNLYRDTVLNRLQSKNKLLDELYINL
                     MREKNYTKIINKIIEIEMIKNETPKSVHFLQLILQRSISDGIMSSSTGTKTWEIARQV
                     QFDFDDTVQFMRRALE"
     gene            <315958..>317241
                     /gene="NDAI0D01340"
                     /locus_tag="NDAI_0D01340"
                     /db_xref="GeneID:11494952"
     mRNA            <315958..>317241
                     /gene="NDAI0D01340"
                     /locus_tag="NDAI_0D01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669643.1"
                     /db_xref="GeneID:11494952"
     CDS             315958..317241
                     /gene="NDAI0D01340"
                     /locus_tag="NDAI_0D01340"
                     /inference="similar to DNA sequence:INSDC:YEL017W"
                     /note="similar to Saccharomyces cerevisiae GTT3 (YEL017W);
                     ancestral locus Anc_1.445"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669691.1"
                     /db_xref="GeneID:11494952"
                     /db_xref="UniProtKB/TrEMBL:G0W9I7"
                     /translation="MSTSFSSFTSSSPMKSPSSPFNRWKKADLLDLINKLKISDIPTS
                     TRKYDLIEIIQDYLIELGKPLDYDHEFPELKGFYKSTVWLSSPTLKNDIIVPKRVEDA
                     IVLNEEEKENQQEVASGSQYDSKIEDHNIDIASKISSQLAPASNSEFTSSASVSGTSS
                     ASDSELDEITSENETNEGEEEEAEEEEAEEEEVGKEEIEIETDTDTENENESKNFNNL
                     NFKTIDQESSFAKRFKFNFHECINDIVDKTSRLNRYTQDSLSTVASVDFIFHSIEFIV
                     LFNYIFKEENNENCDSVFDFIVPILIWLTFNILMPIFVSYYVNFVRYEYYLEIDPMVF
                     HLAKGLIAIALFTTFKNGNNNKYETIKNDVEKIDLDDLKHALGSNKSYSSINNALTQY
                     CQVLSANLITINQALGIIPLVFAITGSLLTLYVLI"
     gene            complement(<317414..>318292)
                     /gene="NDAI0D01350"
                     /locus_tag="NDAI_0D01350"
                     /db_xref="GeneID:11494953"
     mRNA            complement(<317414..>318292)
                     /gene="NDAI0D01350"
                     /locus_tag="NDAI_0D01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669644.1"
                     /db_xref="GeneID:11494953"
     CDS             complement(317414..318292)
                     /gene="NDAI0D01350"
                     /locus_tag="NDAI_0D01350"
                     /inference="similar to DNA sequence:INSDC:YLR351C"
                     /note="similar to Saccharomyces cerevisiae NIT3 (YLR351C);
                     ancestral locus Anc_4.183"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669692.1"
                     /db_xref="GeneID:11494953"
                     /db_xref="GOA:G0W9I8"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="UniProtKB/TrEMBL:G0W9I8"
                     /translation="MSSILSQKIKVALIQFKSSNVNKLINLQNVEKFIDKAMIQQPDT
                     KINCPPRMFNSPYSIYKFKDYAEPISSTDLTTPTLSILSKISLKYKIILVGGSIPELD
                     PTTSKLYNTSIIFNEMGQLIGKHRKAHLFDIDIPNGITFKESTTLSPGSKATTLKTTY
                     GNIGIGICYDLRFPELAMISARKNAFVMIYPGAFNTVTGPMHWHLLAKSRSIDNQIYT
                     ILCSPARNLESDYHAYGHSLVVNPKGEIIAEAGEGEEIVFATLDPMEIENFRKAIPIT
                     TQRRFDIYDDVSANIE"
     gene            <319037..>320221
                     /gene="NDAI0D01360"
                     /locus_tag="NDAI_0D01360"
                     /db_xref="GeneID:11494954"
     mRNA            <319037..>320221
                     /gene="NDAI0D01360"
                     /locus_tag="NDAI_0D01360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669645.1"
                     /db_xref="GeneID:11494954"
     CDS             319037..320221
                     /gene="NDAI0D01360"
                     /locus_tag="NDAI_0D01360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669693.1"
                     /db_xref="GeneID:11494954"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR016639"
                     /db_xref="UniProtKB/TrEMBL:G0W9I9"
                     /translation="MEINKCSSFNGTIDDDYETIEKGRYWLYVSLGCPFAHRALIARS
                     LLGLNDLIGISVVHWHLEPSKSWELFVPPNNDTVSDEDTRRSLTDSEINIESKNEQGQ
                     EQAKWKIDDRFFQVDGGIITTRCNESASSFADIKVDDKREWFDFTYDPIENVHYLREL
                     YDKSEKYYDCKYTGRITVPVLWDSQRKTIINNESSEIIRIFNSINQKRPENNRIGYDL
                     YPNKLHDEIDDLNSWIYENVNTGVYKAGFTDDPQVYERIVLNLFKYLDKIEAILSKNY
                     SKLEERYSRDKDSNDEIMKRYYMVGEEITEVDIRLYPTIIRFDTVYYQHFKCNLKMIR
                     SNEYKYLNLWLKNLYWNSEFEAFRMTTNFDHLKLGYTRSQPKINPLGITPLGPKPDIE
                     PL"
     gene            complement(<320647..>321843)
                     /gene="NDAI0D01370"
                     /locus_tag="NDAI_0D01370"
                     /db_xref="GeneID:11494955"
     mRNA            complement(<320647..>321843)
                     /gene="NDAI0D01370"
                     /locus_tag="NDAI_0D01370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669646.1"
                     /db_xref="GeneID:11494955"
     CDS             complement(320647..321843)
                     /gene="NDAI0D01370"
                     /locus_tag="NDAI_0D01370"
                     /inference="similar to DNA sequence:INSDC:YML048W"
                     /note="similar to Saccharomyces cerevisiae GSF2 (YML048W);
                     ancestral locus Anc_1.496"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669694.1"
                     /db_xref="GeneID:11494955"
                     /db_xref="InterPro:IPR022757"
                     /db_xref="UniProtKB/TrEMBL:G0W9J0"
                     /translation="MEVYLRLNDDTEKDYAFQISRDEKINTKLSQIFSTDKNNEKALA
                     NTMVLRPSIFHNYKPDYFNKSTHPGYLTEGGCLIFDYDADLPQYISKIDEEKPLFDQL
                     WPGQLILPKWSYNKKYITIYSMIMLFWLYTDLPDVISPTPGICVTNLLSRILIPILEK
                     GFDSIDLANKLREEIQPNYSSFWAQWCFFIFHILKIGLITLFLQLGIANPITFNPITI
                     IKLTTAASPQEFIKNDDLKHLLRSIGWIGSKKGGYDSYQSNFYSYIINKFGGPVQAYR
                     AGMIKTAAKPGIPLNNGEGFQTPLNERFTADTFKTMEETGKFILSEEYFIELENNLKE
                     NLDLCEGDVGKMNEEIRRFRRFGLYEPNEKIKKMVAKRKQVYLNDQKLLEEEKEQKKE
                     EKKKTK"
     gene            <322838..>327091
                     /gene="NDAI0D01380"
                     /locus_tag="NDAI_0D01380"
                     /db_xref="GeneID:11494956"
     mRNA            <322838..>327091
                     /gene="NDAI0D01380"
                     /locus_tag="NDAI_0D01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669647.1"
                     /db_xref="GeneID:11494956"
     CDS             322838..327091
                     /gene="NDAI0D01380"
                     /locus_tag="NDAI_0D01380"
                     /inference="similar to DNA sequence:INSDC:YML049C"
                     /note="similar to Saccharomyces cerevisiae RSE1 (YML049C);
                     ancestral locus Anc_1.497"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669695.1"
                     /db_xref="GeneID:11494956"
                     /db_xref="GOA:G0W9J1"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="UniProtKB/TrEMBL:G0W9J1"
                     /translation="MNTEAQQHEHEHEQELTLYHLTLQSKSNYTHSTIGHFVNIHSEH
                     AYDSKSSTKLPLQLCLATENHLEFYDVSNGHLNKFFQSIEFQFKIINCKSLTPKESNC
                     SFIVITTDNGDFSIIKLSLQNNNNNNNNYNIKTILNYQFTRSGIRRLSPIQFLEINDD
                     SLTIILSALEKNKLIFNLTYSKNDSSLQIMDSSPLEIIKSNFITMILINCYNKNNNIS
                     NIVSSHHYHHKENPFFASIEIDTITNDFFLIFYMIDLNLNLIIKKNQLKLSDKNINFL
                     CSLPNDLITTTNKNNNTKVDTPLPSPLVLLGFNDYILIKDLNNHYNIKLDIPNNNNLS
                     LKKNYPTTIINGIIQKLNSKDNDNSYLILLQSNNGDLFKLNFNSLKNNFKLSYFDSIP
                     MAQSLNIFKNGLLFVNNEFNNNYLLQFENINTTESIHNSEEDNFYKLNNLIIPSSNNN
                     NNNIQKNLNPIISSSYSHSQNNTNIDLWINSMNSKLFNLTNSINFIDIINSNLPPNVK
                     NLWSLSLHPKTVSHYHDILFLAFNNSMIILKIKPDSMENLSFKHTNPFIMKNDCTLLI
                     KKLGNLIIQVCKNQFKQITFSIEEKNDDYNFVEKSVWYPPAGIHIIHSIATNSQLILA
                     LSNNEIIYFQLYDTTTTTNNNNNINYTNNQDSLIEYQNNPNFSNFIKSIDLINSSSSS
                     SSSSSSSSSSHYSDYLAIALDNSTINILSLKRNNQDEFLEVVSLQNTMAPINDLKLIS
                     NNYNNSNKQINLHVTLTNGVYMNSKINPLNGQIFDVKLKYLGPNQINLSSLSSLNLLQ
                     KSDNEDEDEDEEDSDEDSDNNGKINETIIKKRSSQKTYNCVIIHSLKNSWISYEYDSL
                     LYIRPIQFANTNQSLIKITSFKTESIPINGCCALSSSGNLIIGTMNDFIFKDNNNWFN
                     LNEFIMPNVFDHKQEDDDNAENENDSNSDEEDEDEDEDEITGITKINYRNKAILSLNE
                     SHAQIIIENSIANSSNCRISIFNTTTKSFLKNANVVENTYYHILSNIKCLSAIITKFS
                     STINHLILATNDMKLLTFKLTFHAGSESKAKRKLFSNFKLESLHETLISDHIYTMVEF
                     NQMILLSSLNNLILLNLGKKQLLKKSITIISKKLSIKKIVKITQWNNERIAVGELNES
                     VTFFQFDSLTNSFIPLADDITKRHVTSLLFLDKSTVIGGDKFGNVWTLRLSRENERKV
                     LNAQSIANASASSSSSSSLSFQELLNRNITKSTQINKSNIYDVPFKLKLLNHFFINDI
                     ILNFHLIENINWSDRPTIIYTTLQGSIGCLIPLLSKSQIIILKQIEKKLSNVDTILND
                     HNEDDEITNDNDAEREIKKKNKGTDDEFIMYSIVGRDHSKYRGYYTPVRNVIDGDLCE
                     TFSTYKSIEKDKLTKSIGKKNLNANDIIKYINEIRTNYL"
     gene            complement(<327203..>328105)
                     /gene="NDAI0D01390"
                     /locus_tag="NDAI_0D01390"
                     /db_xref="GeneID:11494957"
     mRNA            complement(<327203..>328105)
                     /gene="NDAI0D01390"
                     /locus_tag="NDAI_0D01390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669648.1"
                     /db_xref="GeneID:11494957"
     CDS             complement(327203..328105)
                     /gene="NDAI0D01390"
                     /locus_tag="NDAI_0D01390"
                     /inference="similar to DNA sequence:INSDC:YML050W"
                     /note="similar to Saccharomyces cerevisiae YML050W;
                     ancestral locus Anc_1.498"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669696.1"
                     /db_xref="GeneID:11494957"
                     /db_xref="InterPro:IPR009737"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:G0W9J2"
                     /translation="MLKPIFRNSSNVNVLRIRKSLHTKYSIISVPTIIQTKEVKDYER
                     DINECKLCDKENKLESCLPANAKGFGLIPAYNRHVLLISPIGVSGFQWCSNLKMDGLS
                     WPFNVIKQLQDSFRFENEGNDILINAISLQNHTWGELKLSKNENICHVLVLPDYKIYK
                     IKKDKVEVDKFIQFLKCKPNDNMPVLWKNYEECLKDWIFICGHQQRDERCGIIGHELV
                     PLFEKYYGDKKNIAIISHIGGHKYAGNVIYYNQIKNDDKNKELADCLWFGKVLPPNLK
                     TLCDSLENKKIIKELYRGGVSMQK"
     gene            complement(<328582..>329916)
                     /gene="NDAI0D01400"
                     /locus_tag="NDAI_0D01400"
                     /db_xref="GeneID:11494958"
     mRNA            complement(<328582..>329916)
                     /gene="NDAI0D01400"
                     /locus_tag="NDAI_0D01400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669649.1"
                     /db_xref="GeneID:11494958"
     CDS             complement(328582..329916)
                     /gene="NDAI0D01400"
                     /locus_tag="NDAI_0D01400"
                     /inference="similar to DNA sequence:INSDC:YML051W"
                     /note="similar to Saccharomyces cerevisiae GAL80
                     (YML051W); ancestral locus Anc_1.500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669697.1"
                     /db_xref="GeneID:11494958"
                     /db_xref="GOA:G0W9J3"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G0W9J3"
                     /translation="MDYNKRSSVSTVPNTGPIRVGFIGLSSFKGWAIKTHYPAILQLS
                     SQFQITALYNPDIGTALSTIRTLKLSNATAYSTLESFASSANVDMIVLSIQVSKNFET
                     LIPLLEYSKTNPNLKYLFVEWALACSVQEAETIYKMAAERGLQTIISLQGRKSPYILR
                     AKELIHEGYIGDINSIEIAGNGGWYGYERLQKSPSYIYELGKGVDLVTTAFGHTIDLL
                     QYMTGSYFSRINSMVFNNIPEQDVIDEHGNRTGQRVSKTVPDHLLFQGTLLNGNVPVS
                     CSFKGGKPTKKFTKNLVIDIHGTKGDLKLEGDAGFAEMSNLVLYYSGIRANDYPVTNN
                     NNSNGNDSTNNNNNGPNGYDAGKEIMEVYHLRNYNAVNGNIFRLYQSIADFHFNTKQI
                     PHLPTQFIMQGFEFEGFPTLMDALILHRLVDNVYRSNILGSTLDVSSICRYP"
     gene            complement(<330831..>331763)
                     /gene="NDAI0D01410"
                     /locus_tag="NDAI_0D01410"
                     /db_xref="GeneID:11494959"
     mRNA            complement(<330831..>331763)
                     /gene="NDAI0D01410"
                     /locus_tag="NDAI_0D01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669650.1"
                     /db_xref="GeneID:11494959"
     CDS             complement(330831..331763)
                     /gene="NDAI0D01410"
                     /locus_tag="NDAI_0D01410"
                     /inference="similar to DNA sequence:INSDC:YML052W"
                     /note="similar to Saccharomyces cerevisiae SUR7 (YML052W);
                     ancestral locus Anc_1.501"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669698.1"
                     /db_xref="GeneID:11494959"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:G0W9J4"
                     /translation="MRRSLSITLRLLGLLFFAGNTLLLILIIISGTTRHYPVDRFYWV
                     QGDTSGIPNAPNLTRWTYWGACERLDGVTHCSGNLAPAYPISPVDNFNTKVNVPSKFI
                     SNRDAFYYLTRFSFCFFWIALAFIGITFILYIFSWCSSIMLKIIFILMIFGFIFNITS
                     VVLQTAASVMARNAFHDADRSASVGASLMGIAWASVTLCFLELGLTTYWFTTNEYNAT
                     FSSTPHLEHRHNKHRGFFHRKKDPMVDRTLNSPIPTSTAADPYAFTPNPNINATITNN
                     NASSFVPPPQETTHKGINFFKIRRTQHLNDDDSL"
     gene            complement(333576..333625)
                     /gene="NDAI0Dtrna4Y"
                     /locus_tag="NDAI_0Dtrna4Y"
                     /db_xref="GeneID:11495103"
     tRNA            complement(join(333576..333612,333576..333625))
                     /gene="NDAI0Dtrna4Y"
                     /locus_tag="NDAI_0Dtrna4Y"
                     /product="tRNA-Tyr"
                     /note="codon recognized: UAC"
                     /db_xref="GeneID:11495103"
     gene            <333855..>334508
                     /gene="NDAI0D01420"
                     /locus_tag="NDAI_0D01420"
                     /db_xref="GeneID:11494826"
     mRNA            <333855..>334508
                     /gene="NDAI0D01420"
                     /locus_tag="NDAI_0D01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669651.1"
                     /db_xref="GeneID:11494826"
     CDS             333855..334508
                     /gene="NDAI0D01420"
                     /locus_tag="NDAI_0D01420"
                     /inference="similar to DNA sequence:INSDC:YJR057W"
                     /note="similar to Saccharomyces cerevisiae CDC8 (YJR057W);
                     ancestral locus Anc_1.504"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669699.1"
                     /db_xref="GeneID:11494826"
                     /db_xref="GOA:G0W9J5"
                     /db_xref="InterPro:IPR018094"
                     /db_xref="InterPro:IPR018095"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W9J5"
                     /translation="MGRGKLILVEGLDRTGKTTQTTLLLKKLSSQDAKLIKFPDRTTP
                     IGKLIDNYLTDKEFHLPDQAVHLLFSANRWEVADSIKQLLLEGKIVILDRYVYSGIAY
                     SAAKNIPGMDLKWCLQPDKGLLKPDLTIFLTNDNDNDDKKGFGEERYENVQFQKEVKN
                     QFIKVFSELDSIDKESETLKIVNVTNKSIIQVEEEIWSFVQPVVLNENCHSDTFSYF"
     gene            complement(<334601..>335083)
                     /gene="NDAI0D01430"
                     /locus_tag="NDAI_0D01430"
                     /db_xref="GeneID:11494961"
     mRNA            complement(<334601..>335083)
                     /gene="NDAI0D01430"
                     /locus_tag="NDAI_0D01430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669652.1"
                     /db_xref="GeneID:11494961"
     CDS             complement(334601..335083)
                     /gene="NDAI0D01430"
                     /locus_tag="NDAI_0D01430"
                     /inference="similar to DNA sequence:INSDC:YJR058C"
                     /note="similar to Saccharomyces cerevisiae APS2 (YJR058C);
                     ancestral locus Anc_1.505"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669700.1"
                     /db_xref="GeneID:11494961"
                     /db_xref="GOA:G0W9J6"
                     /db_xref="InterPro:IPR000804"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027156"
                     /db_xref="UniProtKB/TrEMBL:G0W9J6"
                     /translation="MAIQFILCFNKQGVVRLLRWYDMCACNGNGSGGSSSNNNDELLP
                     QDLIAQIYRLISARDHKHQSNFVEFSERTKLVYRRYAGLYFVMGIDLQDEEPIYLSHI
                     HLVVEVLDAFFGNVCELDIVFNFYKTYMVLDEVFLGGEIQEVSKDMLLEKLGTLDRLA
                     "
     gene            <335388..>338645
                     /gene="NDAI0D01440"
                     /locus_tag="NDAI_0D01440"
                     /db_xref="GeneID:11494962"
     mRNA            <335388..>338645
                     /gene="NDAI0D01440"
                     /locus_tag="NDAI_0D01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669653.1"
                     /db_xref="GeneID:11494962"
     CDS             335388..338645
                     /gene="NDAI0D01440"
                     /locus_tag="NDAI_0D01440"
                     /inference="similar to DNA sequence:INSDC:YKL197C"
                     /note="similar to Saccharomyces cerevisiae PEX1 (YKL197C);
                     ancestral locus Anc_1.506"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669701.1"
                     /db_xref="GeneID:11494962"
                     /db_xref="GOA:G0W9J7"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR009010"
                     /db_xref="InterPro:IPR015342"
                     /db_xref="InterPro:IPR025653"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029067"
                     /db_xref="UniProtKB/TrEMBL:G0W9J7"
                     /translation="MTSLQFVQLQIHCSPNIRGNFVRLPPAICDTLDLTNLPIQCFNV
                     CLEPGSGRSDTDIQQKKIYLGWDGFTSQSSNSIEINNIVAKTYNLQEDEFIDIIIRKL
                     DENQIIEEALIEPCTSDDWEIIENNVPFLQDQIIYQTRVMTLNSVIICYVGDIVAKFQ
                     VKKISPENLDVGKISAGTMIIVEPKENEIRNQQFKKQSMINNDGEHDIIIKQKILRSL
                     QWNIQDDCALEDDIVVWIDQNDDKILDCKYAFVSVLHNKLEIMKTKEKQKKLDFHDDR
                     NEKPMSFNKKIIVKIKRFEKRKHTIMKDHILLSDSLWSILSLTPQNGVKLKVQFVKNR
                     TIVQKHTFMNEKRINIYPIFSSNLSAKPNPESIARNTKFLMERLKASTLGKRTIFWEY
                     KLLIELNLSKGTSTFFDFSNEPITSNSWILLNENYKKVQPPPTFRKELTNLKVPKIVG
                     MDNTIDEIVKYLTIPILPSPGIIVEGRQGSGKTSLLLNIWKTLSSSPYPYYVKYIDCE
                     TITDVFSFDNMKTMLNECISSLYWHYPSILILDNADYLFTESLTDEQQQGKINNNNSI
                     SSKLTANLINIVDNISNKRPEAIRVIFGVKDKKAINTLFFDKHFIGKTWTLLPPNREK
                     RLLLLEHLFKLRNESMGEDFNMSLHTDLNLNDMSLEIEGYSILDIEKLIDKLFYEVQI
                     SSRNNNESSTDLLITNNAFIKCLKVFVPSSLQNVSLTKDTGVRWSDIGGLKNVKRLLL
                     ETLEWPTKYSPIFKRCPLRLRSGILLYGYPGCGKTLLASAIAQQCGLNFISVKGPEIL
                     NKYIGASEQNVRELFERAQSVQPCILFFDEFDSIAPKRGHDSTGVTDRVVNQLLTQMD
                     GAEGLEGVYILAATSRPDLIDPALLRPGRLDKSVLCNIPNEEDRYDIMCSITGDETSN
                     NELKLKNDTDLKAVVQATVGYSGADLQGLCYNAYLKAVHRYLSQESEPSQMKKRMNKN
                     AGHINLIFNLINENVTLANKDILDEINGELQGRLSKEKGTDQESNSNPIKKSSPNVLI
                     TLADLLDACQETKPSISLSELRKLRDIYNKFQTDRDGALPTGETSDEIGSRLSLM"
     gene            <339780..>341948
                     /gene="NDAI0D01450"
                     /locus_tag="NDAI_0D01450"
                     /db_xref="GeneID:11494963"
     mRNA            <339780..>341948
                     /gene="NDAI0D01450"
                     /locus_tag="NDAI_0D01450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669654.1"
                     /db_xref="GeneID:11494963"
     CDS             339780..341948
                     /gene="NDAI0D01450"
                     /locus_tag="NDAI_0D01450"
                     /inference="similar to DNA sequence:INSDC:YJR059W,YKL198C"
                     /note="similar to Saccharomyces cerevisiae PTK2 (YJR059W)
                     and PTK1 (YKL198C); ancestral locus Anc_1.507"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669702.1"
                     /db_xref="GeneID:11494963"
                     /db_xref="GOA:G0W9J8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0W9J8"
                     /translation="MTSSDSKNNIKSKNTSLKAFKVFGKKILTSNSDGSSDSQTSTKS
                     DNNKSKINFFNGKKSGSKTSKQSSTHTIVKPSKAVADLIAQSSNPFVSKEKSAGNKSA
                     TSSSISSLSSNAKSSNYNVDALQSLPKKLSFTSSCQSSLKSQRMAHNPYAATASLTNS
                     TIGNTSKNITQQSSIISGKKQEDLSFYMQDGDKKIRILPSPLGNPNDFLPTHMKQTSI
                     QLTGNFTLDKDYKLIGSGGSSDVCKVVSTFKKKEIYALKKLNMVYDETPERFYKRCSK
                     EFIISKHLSSSKNIHIVNTFYLLKIATTTYTTRGWGFIMELCSKDLFNLIQKTGWRNV
                     PLSEKYCLFKQIVEGVKFMHEQGVAHRDLKPENVLLTQDGICKITDFGISDWYHIKPL
                     DFSSPVKKCAGMIGSAPYASPEVMMYDAKKKYPESLQIPYDPLKLDSYSLGIILITMV
                     NNIIPFLNSCNKDAKFRKYVTSYENFIRHQNSTFRQKGCYKAGPGAEYTLAKNFKNTA
                     ASRVAWRLADPNPETRYTMEDLVNDPWYKSIETCVDNIDGFSSCTTPKIKDELKLDYS
                     ENNNENDSMFSKLDDNNNFPAMNADHTHRENKAMFILNEDSFDEKQVFNSSNSKIPES
                     NPPSTPKPLSTATTLASINYPPISTNPHTMLPLRRFSEMSIGSRASTVSTNGRTLVSA
                     STDSSISIRNGNFTSRRKRKVVHNHMHIVNSVTGMSNIRF"
     gap             343726..343745
                     /estimated_length=20
     gene            <344982..>348197
                     /gene="NDAI0D01460"
                     /locus_tag="NDAI_0D01460"
                     /db_xref="GeneID:11494964"
     mRNA            <344982..>348197
                     /gene="NDAI0D01460"
                     /locus_tag="NDAI_0D01460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669655.1"
                     /db_xref="GeneID:11494964"
     CDS             344982..348197
                     /gene="NDAI0D01460"
                     /locus_tag="NDAI_0D01460"
                     /inference="similar to DNA sequence:INSDC:YKL201C,YJR061W"
                     /note="similar to Saccharomyces cerevisiae MNN4 (YKL201C)
                     and YJR061W; ancestral locus Anc_1.509"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669703.1"
                     /db_xref="GeneID:11494964"
                     /db_xref="InterPro:IPR007074"
                     /db_xref="InterPro:IPR009644"
                     /db_xref="UniProtKB/TrEMBL:G0W9J9"
                     /translation="MTEKKKQFYRKSSRFIIPILSKLNATHLRQALASLIVIQFIITA
                     IIWSTYNSTSVSLTTNSLSSSSSSSPIPLLFSGGGSFFDAISSFSPFSSSSSQAVDDA
                     PKFISTAEPIEVEDDIGYAAALYRKIKFDTKPTWIDDYTLKKNLLTVNVGPRRGQRLK
                     HTDELRFYDFDPRLSWSVYLHYLLSQNYTSILNEASNSQFDFTQPFDAQSTNASASPR
                     TTYTNLNHKVTMPFSWYDWTDFHELNKIIALEKAEIRCEFMFNSAFDIETLSAIETEI
                     DETLFLNDRDKYDNKKWYRLARKSSVRHESTKIDKVCEKINPEDTYVNLRNSSIPKKL
                     PRFTTQFKIKRLFDKLRPEVFQLQARNYILTTQKHPLSLTIVANNNASYQINLEQNER
                     LNLVESNLLRNFVEDYQNSPEFLKEVPMDSLSTIDSELPSGKITPEGANVEYDLVFNH
                     YKVFQDFLDNEDIAKIFKVDIPETDKSFFDYDLVHLQHEDFEFDVEAKIKELESIPES
                     ELSPHFKQYLESLKVSSWTIPTLQKKYFEEAGQLQQFKGMGHHRDQRFFNGDNLINDE
                     QEYFGRLNSMIRTFQKFTRSNGLISWLSHGTLYGYLYNGHSFPWDNDFDLQLPIKHLH
                     LLAQYFNQSLILEDPREGNGRYLIDIGTSITVRTNGNGKNNIDARLVDVDTGLYIDLT
                     GLSVSNGEVRENFADWMKKKAKELHINLDKEKVYDESEVKDLDKFDGKDLRKLNCTQL
                     VTWIEKHQEKFSKNDLDKAREAVKKETVDIPKSRSGSKNLNPRERYEVNKKLQLFNCR
                     NNHYTNLELVSPLINTVFHGVPALIPSKYIASLKKEYGVPKEYYYLTFEKMTFLPELR
                     GWFKTHYIDRCSNLHGWFPPKFTKLPNTDSLKNISFPAVKTLYQNIQKAGYIDMFANH
                     FNCFHATSYRLKELEIQYGADLTPEQKRIYLHDLRTNVAPKLNSPAKDPIIFQYERHI
                     YNRLLRKINDTTVVAALENSIQMEHVSKVWELTMALKHKKFDIFNITRVVRIPSPDGL
                     SYHEKIDNVDLNQVGNQLFANYNGSKIQIFDKDPVLDFQTL"
     gene            <348789..>356171
                     /gene="NDAI0D01470"
                     /locus_tag="NDAI_0D01470"
                     /db_xref="GeneID:11494965"
     mRNA            <348789..>356171
                     /gene="NDAI0D01470"
                     /locus_tag="NDAI_0D01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669656.1"
                     /db_xref="GeneID:11494965"
     CDS             348789..356171
                     /gene="NDAI0D01470"
                     /locus_tag="NDAI_0D01470"
                     /inference="similar to DNA sequence:INSDC:YJR066W,YKL203C"
                     /note="similar to Saccharomyces cerevisiae TOR1 (YJR066W)
                     and TOR2 (YKL203C); ancestral locus Anc_1.515"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669704.1"
                     /db_xref="GeneID:11494965"
                     /db_xref="GOA:G0W9K0"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR009076"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR024585"
                     /db_xref="UniProtKB/TrEMBL:G0W9K0"
                     /translation="MLTLKKRAESKRLARKKLASTSHSTDDISTTSGQVSIPSNPNNS
                     RRVLLVPGSDTTRLNEGDFTTADLDSAFSTFDPIFEQLKSPISQERINAAAELNISLI
                     SLVRELSVEDFQRFSNILNNKIFELVHGTDSNEKIGGILAVDTLINLYLHTEELPNQT
                     SRLANYLRVLIPSNDIEVMRLAANTLGKLAVPGGTLTSDFVDFEVKTCLEWLTSTPET
                     ISSSSKQEYRKHAALLLITALADNSPYLLYPYINPILENIWRALRDIKLVIRMDAAVT
                     LRKCLSIIRERDPSLTKDWFQKLFKGCQRGLTLNTNESIHATLLVYRELLSLRDSFLN
                     GKLNEIYLSTIKYKDHKFEVIRKEVYAILPLLSSFDTKLFIKSYLDPIMLHYLMVLKS
                     TTSSSTVNSDKAAILVSIGDIAFQVKSHITRYIDPILDTIRDGLKSKFKHRKLFEKEL
                     FYCIGKLACAVGPALAKNLNRDLLDLMLNCLLSDYMQETFIILNKEIPALEATINSRL
                     LDYISASLSGQKYDVAGTLTPLEPLDMERSRRWRNKIIHDKTGEINDDIRDAQYLTQA
                     LKMLRSINYKKSLTEFARQIIIFYIEHEDSDVRKLAALITCELFTKDPICKQISRNAL
                     QSVSEVLSKLLTVSITDPVSEIRLEVLRHLTSAFDSHLAQPDNSRLLFMAVNDEIFTI
                     QIEAIKIVARLSSVNPAYFMPSLRKTLLELLTQLRYSNMPRKKEEYATLLYTMIQSGS
                     EITKPYIEPVLDVLLPRCQDPSSSVASTSLKALGELSVVAGEDIKKHLNVLMPLIINT
                     FQDHSSFKRNAALKTLSQLATSSSYVIEPLLDYPELLGILINILRGDGPQDVKRETIK
                     LIGILGALDPYKVRAIEGRASLESQIEQNTPSIDIALLMKGMSPSDDEYYPTVVVNTL
                     LKILYDPTLSSHHTAVIQAILNIYQSLGVRCVSFLDKVVPGLLSVMRTCTPSLLEFYF
                     QQLSMLISIVRQHVRPYVDEIFSVIQMFFPIIKLQITIISTIEAISKALESEFKKYVP
                     LVLTSYLAILENDKSNKKAVSIRILKSLIVLGPYLEDFSHLIIPSVVRMSEYSPGMLG
                     KIAVIALGKLAKNINLCEMSSRIVQTLIRLLNRGEPDLIKTSMNTLCLLLLQQGTDFV
                     VFIPILNKVLINNHIQHSIYDQLVNKLLNNESLPTNIIFDKEFDVSSKELKENDSGYK
                     KLPLNQEALKNTWEASQQRTKEDWQEWLRRLSIQLIRESPSPALRACANLVSVYYPLA
                     RELFNASFSSCWSDLYSPYRDDLIKALCVALSSPQNPPEIYQTLLNLVEFMEHDDKPL
                     PIPFETLGQYAQKCHAFAKALHYKEVEFLQEPTAPTIEALISINNELHQNDAAIGILK
                     LAQQHHDLQLKEIWYEKLQRWEDALTAYNEREVAGEGSIEVTMGKMRALHALGEWEQL
                     GSLTEEKWAISKPNVQKLMAPLAAGAAWGLGQWDKLEEYSTVMNVHSSDKEFFDAILC
                     IHRNNLDEGQHHILNARDLLLTELSTLINESYNRAYGVLVRAQIVSELEEIISYKKLP
                     YNSSKRGLMRKTWNKRLLGCQKNVDIWQRVLRIRSLVIKPKQDADLWIKFANLCRKSG
                     RMGLAKKALTSLLEEDGEPHRFNTVRASPLVVYSQLKYLWAIGSQEKALKYLMNFTSR
                     VACDLGLDPSNMISEHYPQNDRIAPEATEEYMKLLARCFLKQGEWRVALEPNWRLKNP
                     DEVLGSYLLATHFDNSWYKAWHNWALANFEVISVITSGGGTNITDKDISLGNINLQKS
                     GMIGANTFDTEGGNYPLTMINRHVIPAIRGFFHSISLSDSSSLQDALRLLTLWFTFGG
                     IPEANQAMHEGFTLIKIATWLEVLPQLISRIHQPNQFVSRSLLSLLSELGKAYPQALV
                     YPLTVAIKSESVSRQRAALSIIEKMRMHSPVLVAQAELVSSELIRVAVLWHELWYEGL
                     ENASRHYFGENDISKMLSSLEPLHDLLQNGAETLREISFQNAFGRDLNNAYEWVNNYK
                     QTKDKTNLNQAWDIYYNVFRKISKQLPSLQTLELPHVSPKLFNAHDLELAVPGTNILT
                     KEIVKISSFEPVFSVISSKQRPRKVNILGSDGKQYQYVLKGHEDIRQDSLVMQLFGLV
                     NTLLKNDDECFRRHLNIQQYPAIPLSPKSGILGWVQNSDTFHVLIKEYREARKIPLNL
                     EHWVILQMAPDFDNLTLLEKVEVFTHALENTQGQDLYKVLWFKSRSSESWLERRTIYT
                     RSLAVMSMAGYILGLGDRHPSNLMLNRITGKVVHIDFGDCFEAAILREKFPEKVPFRL
                     TRMLRKAMEVSGIEGTFRITCENVMRVLRDNKESLMAILEAFAFDPLIHWGFDLSTEK
                     IIEQTGIDLPSTNPNDLLRENRVTVEEAAKMEIEQKNAIRNARALLVLKRITNKLTGN
                     DIGNNHELAVPEQVEQLIQQAISVENLCQHYIGWCPFW"
     gene            complement(<356427..>359624)
                     /gene="NDAI0D01480"
                     /locus_tag="NDAI_0D01480"
                     /db_xref="GeneID:11494966"
     mRNA            complement(<356427..>359624)
                     /gene="NDAI0D01480"
                     /locus_tag="NDAI_0D01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669657.1"
                     /db_xref="GeneID:11494966"
     CDS             complement(356427..359624)
                     /gene="NDAI0D01480"
                     /locus_tag="NDAI_0D01480"
                     /inference="similar to DNA sequence:INSDC:YKL205W"
                     /note="similar to Saccharomyces cerevisiae LOS1 (YKL205W);
                     ancestral locus Anc_1.519"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669705.1"
                     /db_xref="GeneID:11494966"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0W9K1"
                     /translation="MLQRIREVITIANSPTSDPASKKQALDFLTEARSDPNAAQLFSS
                     LLTDLQSDDLARFVALQVLCDIVKDSSNNNSQQSLIFIKDVVSELLQTKITNNIRDPE
                     YVRNKISELITGLFYNMYGDCNSNHWSSFFQDLITLSKIDSLTKSPIDEFSKLGLDYF
                     LRICGFINSEIADQTFIRSKELQIKNNNLKDTMRIRDIQTLVTIWLNTLKASIPQQLQ
                     QQSNATGIVVLTLSVIGSYISWIDLSLIVNPEYISVIYSYLDFPGTRIACAQALCEII
                     AKKMKPMEKLNLLSMLNLTDKVTSLEHDDIEVYEQLAKLSASVGLELSIILEQCNEGD
                     STPEIQQVANSADQQILTQVAPLVFKFMSHEYDSVTQQCFPFISQYLSILKKIFALGG
                     KPGCAIALMSKKQPLDPQHQEFIISLLNIIFKKMKIDESSDEDSEDEIEEFTETIRSK
                     LKIFQDSIAIINPAIYLENISNHIQLCLAETDWRYLELGIYQMTNLSESIKNNLFGIT
                     KNEIASSQPTMVMFKFMDILLRNSAVFQIDNQYVQILFFELVVRHHSYLSGEKDDIVL
                     LNIFCSNFGMFNKREKVRLRTWYLFTRLLKTTKPKFSVSVLSEIIAKLVPLLQIKVIN
                     LNQDGTESDTTFDNQLYLFEGVGLLIGGNSDSTYNILDEILTPLFTELEKCISAQSQD
                     RAIILQCHHILMAIGTLARGIHGGLVPENQVNNALVSKKLIDRSLIEKFSNIAEVVLV
                     TFSYFNKYENVRDASRFTFSRLIPILNNEMVPFANKLIALFLESDLKMLEMNDFLGFL
                     GQMIHMFRKDEGCYQLFNELLTPVIAKYHAVLEGIEDENTKGPQSWYPDSSNVKDTST
                     NGKNIVLTDTFRDKVIMSKAYFAFLQTLITNSVTSLLLTEKTRQILPSLLTELLTYTP
                     EEVQETSAMKLALNVLNNFIKYFGSGKCTDPNDTHAVGLERLDGLNEFFITKIVPLVF
                     EIPFRPEYKFNVKEGGYRIVATDLSRALKEIYLQSGGGSDVNANPCLKYMVDLYLPQI
                     QFPQQLIMELVEALITSDQKGFEKYYLTLIGKLTS"
     gene            complement(<360264..>360866)
                     /gene="NDAI0D01490"
                     /locus_tag="NDAI_0D01490"
                     /db_xref="GeneID:11494967"
     mRNA            complement(<360264..>360866)
                     /gene="NDAI0D01490"
                     /locus_tag="NDAI_0D01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669658.1"
                     /db_xref="GeneID:11494967"
     CDS             complement(360264..360866)
                     /gene="NDAI0D01490"
                     /locus_tag="NDAI_0D01490"
                     /inference="similar to DNA sequence:INSDC:YJR069C"
                     /note="similar to Saccharomyces cerevisiae HAM1 (YJR069C);
                     ancestral locus Anc_1.520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669706.1"
                     /db_xref="GeneID:11494967"
                     /db_xref="GOA:G0W9K2"
                     /db_xref="InterPro:IPR002637"
                     /db_xref="InterPro:IPR027502"
                     /db_xref="InterPro:IPR029001"
                     /db_xref="UniProtKB/TrEMBL:G0W9K2"
                     /translation="MTSAREIIFVTGNANKLKEVKMILAPSENEPSPSFTIVNEALDL
                     EELQDIDLEAIALAKCKQAVQILGPGRPVFVEDTALRFDEFNGLPGAYIKWFVKSMGL
                     AKIVQMLQPFENKGAEAVTTIVYADGKGQYHTFQGITRGTIVDSRGPTTFGWDSIFQP
                     IEGKGQTYAEMEKKDKNLISQRGRAFAQLKDFLYNSSDNQ"
     gene            complement(<361232..>362197)
                     /gene="NDAI0D01500"
                     /locus_tag="NDAI_0D01500"
                     /db_xref="GeneID:11494968"
     mRNA            complement(<361232..>362197)
                     /gene="NDAI0D01500"
                     /locus_tag="NDAI_0D01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669659.1"
                     /db_xref="GeneID:11494968"
     CDS             complement(361232..362197)
                     /gene="NDAI0D01500"
                     /locus_tag="NDAI_0D01500"
                     /inference="similar to DNA sequence:INSDC:YJR070C"
                     /note="similar to Saccharomyces cerevisiae LIA1 (YJR070C);
                     ancestral locus Anc_1.521"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669707.1"
                     /db_xref="GeneID:11494968"
                     /db_xref="GOA:G0W9K3"
                     /db_xref="InterPro:IPR004155"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR027517"
                     /db_xref="UniProtKB/TrEMBL:G0W9K3"
                     /translation="MSTNFEKHYQKAVEENNLEQLRDILVNKDSVLSNRFRALFNLKC
                     VAEQFKINPSDAKKAVDYMAETFGDKSELLKHEVAYVLGQTKNMDSTDILRKVMLDAD
                     QQPMVRHEAAEALGALGAQVALEDLQKCLKEDPHPAVQQTAELAIARINWEHSPAHES
                     ERLQESLYCSTDPAPPLSLETQMSIPDLQTLLNDQKAPIFERYRAMFRLRDLGSTEAI
                     DALASGFADPSPLFKHEIAYVFGQMGNPLAVPCLVEVLGRMEEAPMVRHEAAEALGAI
                     ATPEVVPVLKQYLNDEVDVVRESAIVALDMYEYENSNQLEYAPTA"
     gap             362539..362558
                     /estimated_length=20
     gene            complement(<363505..>364656)
                     /gene="NDAI0D01510"
                     /locus_tag="NDAI_0D01510"
                     /db_xref="GeneID:11494969"
     mRNA            complement(<363505..>364656)
                     /gene="NDAI0D01510"
                     /locus_tag="NDAI_0D01510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669660.1"
                     /db_xref="GeneID:11494969"
     CDS             complement(363505..364656)
                     /gene="NDAI0D01510"
                     /locus_tag="NDAI_0D01510"
                     /inference="similar to DNA sequence:INSDC:YJR072C"
                     /note="similar to Saccharomyces cerevisiae NPA3 (YJR072C);
                     ancestral locus Anc_1.523"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669708.1"
                     /db_xref="GeneID:11494969"
                     /db_xref="GOA:G0W9K4"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W9K4"
                     /translation="MTMSTVICIGMAGSGKTTFMQRLNSHLRTKKTPPYVINLDPAVL
                     KIPYGANIDIRDSIKYKKVMENYQLGPNGAIVTSLNLFSTKIDQVIKLVEKKKEKYNH
                     CIIDTPGQIECFVWSASGAIITESFASTFPTVIAYIVDTPRNTSPTTFMSNMLYACSI
                     LYKTKLPMIVVFNKNDVTNADFAKDWMTDFESFQRAVRDDQELNGDLGMGSGYMSSLI
                     NSMSLMLEEFYSQLDMVSVSSFTGEGFDDFLTAVDNKVDEYEEYYKAERERILKAKEE
                     KEKLRKDKSINGLMKDLGLNDKKDGNESDASAEVISDIEAGDGDGLVDRDEDEGVERE
                     YTFPGEERTQGEITEKDTPGLQKRYQEALESVAKTASSETAENIARHLK"
     gene            complement(<365141..>365953)
                     /gene="NDAI0D01520"
                     /locus_tag="NDAI_0D01520"
                     /db_xref="GeneID:11494970"
     mRNA            complement(<365141..>365953)
                     /gene="NDAI0D01520"
                     /locus_tag="NDAI_0D01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669661.1"
                     /db_xref="GeneID:11494970"
     CDS             complement(365141..365953)
                     /gene="NDAI0D01520"
                     /locus_tag="NDAI_0D01520"
                     /inference="similar to DNA sequence:INSDC:YKL207W"
                     /note="similar to Saccharomyces cerevisiae YKL207W;
                     ancestral locus Anc_1.524"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669709.1"
                     /db_xref="GeneID:11494970"
                     /db_xref="GOA:G0W9K5"
                     /db_xref="InterPro:IPR002809"
                     /db_xref="InterPro:IPR008568"
                     /db_xref="UniProtKB/TrEMBL:G0W9K5"
                     /translation="MFSFWTLLATGSMGAVAELTLDPQLKYWVLLPISIVMVLTGILR
                     QYITVLIGPKLKTEPRVKLTESQYIIKAQALLGNGSNLSTESFEIRKDYLVKILSEGK
                     YVAKANQSQEGQVPNPFTDPNMSESMMAMAKGNLANFIPQTLIMWWVNHFFAGFVLMK
                     LPFPLTLRFKEMLQSGIMTSDLDVRWVSSISWYFISVVGLNPVYNLLLAENAQDQLGM
                     LQQQGQLDPMMGAPGGPQPADVMKGLANDMTIVQHQSCLDNIESRILKMYAK"
     gene            complement(<366520..>367248)
                     /gene="NDAI0D01530"
                     /locus_tag="NDAI_0D01530"
                     /db_xref="GeneID:11494971"
     mRNA            complement(<366520..>367248)
                     /gene="NDAI0D01530"
                     /locus_tag="NDAI_0D01530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669662.1"
                     /db_xref="GeneID:11494971"
     CDS             complement(366520..367248)
                     /gene="NDAI0D01530"
                     /locus_tag="NDAI_0D01530"
                     /inference="similar to DNA sequence:INSDC:YKL208W"
                     /note="similar to Saccharomyces cerevisiae CBT1 (YKL208W);
                     ancestral locus Anc_1.525"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669710.1"
                     /db_xref="GeneID:11494971"
                     /db_xref="UniProtKB/TrEMBL:G0W9K6"
                     /translation="MPKIPFTTSFKQKNRVLFKGVKVPKFVQWSERNQKNDFQHLERQ
                     IEKDIAFKRYTTYLSEFNTFFIFTWRTKEDYILNKDYYWNLFFRKGFNSGSLNSKIGS
                     LFLSQRLNNTVFQKCLKIDFLKPRTEYRLFLQNNTDVEGLEEVINYTQTNRDLQLHCV
                     GMNVNPHAKSPMLGTLKYIQPLLEESNNLYKNIDYLKLLEIAKMQPSDEPGKVKIKYL
                     LQLLAKSKLSSPKLVDDGRYLIFC"
     gene            368676..368747
                     /gene="NDAI0Dtrna7T"
                     /locus_tag="NDAI_0Dtrna7T"
                     /db_xref="GeneID:11494972"
     tRNA            368676..368747
                     /gene="NDAI0Dtrna7T"
                     /locus_tag="NDAI_0Dtrna7T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACG"
                     /db_xref="GeneID:11494972"
     gene            <369687..>373568
                     /gene="NDAI0D01540"
                     /locus_tag="NDAI_0D01540"
                     /db_xref="GeneID:11494840"
     mRNA            <369687..>373568
                     /gene="NDAI0D01540"
                     /locus_tag="NDAI_0D01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669663.1"
                     /db_xref="GeneID:11494840"
     CDS             369687..373568
                     /gene="NDAI0D01540"
                     /locus_tag="NDAI_0D01540"
                     /inference="similar to DNA sequence:INSDC:YKL209C"
                     /note="similar to Saccharomyces cerevisiae STE6 (YKL209C);
                     ancestral locus Anc_1.527"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669711.1"
                     /db_xref="GeneID:11494840"
                     /db_xref="GOA:G0W9K7"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W9K7"
                     /translation="MKILEVFKRYYKHHIYMHVDLKKDKYLICLIIISTIANGLVPAI
                     TSILTGRVFDLLSNIGQFHSMNEILSELTIRSMSIMALAAACLPVMWISISSWMSLGE
                     RQGFAIRKRLLNEYLVKPMEWYDCHDKLLGDFTQVNRCVEELRSSSAEASAITFQNFV
                     AMLALIGTSFYYSWSLTLIILCSAPLIILFAILFSHMIHKYTELENSETGKAAQLLNW
                     SMNSAQLVKLYCTQAYEIHSFKELVGQCNDLFIKSCFYVSANTSILRFLSLSMFVQGF
                     WFGAIMVKKGKLSIKDVITCFHSCLMLGSTLNNTLQQIVVLQKGDVALKKILDFISFS
                     QRSPSLEPPYEPSVPISNGEISFQNISFAYPTRPHQTVLKDVSITFQPGRSTFIIGKS
                     GSGKSTLANLLLKFYNDYQGSIKIGNTNVKKINKNWLFENITVVEQRCTLFNDTLRNN
                     LLLGISNSNQKVEQDDIEISQRLKDACRIAMLEELIRELPDGLDTIIGAGGVSLSGGQ
                     QQRVAIARAYIKDSSVLILDEAVSALDIIHRELIMKAIKNWRSGKTTIILTHDLSQLD
                     YDDFLYVFEDGEVKESGYQQALLQDEKTIFSKLYDIQMRKHMSYSPSESTIVETPGDE
                     KKRFSSTNTSTSTSYEVDTPISKENKMSFSTGRDSWSENVKLSDVHRTQRKRIYLPEN
                     NKKKCVDPEKALIKIDEKKVMPLGQIIKRMLRTIRQKKLLSFGIFWSLIAGATNPIFS
                     YCFSYLLNGIVPMTNGQYRSQLYLLKWSFIVLGISAADAISNFLKSYILGYCSELWIM
                     DLRNEAMAAIMNKRLDWFSKEENKSSELSALLLNDLRDLRSLVSEFLSAMTTFIVVSL
                     VGLIWALVSGWKLSLVCISMFPLIILVSGIYGSTLQRYETMYKTAVAELENHEYEIMT
                     KIKTIRYLQASKYFIKNYKVLENNLKKIAHKRSIATGFGISITNTIAVCIQSILYYYG
                     LRLVFKGEYSSKKMFETFTLLLFTIISCTSLVSQIPDISRGQRAASWLYRILDESDDN
                     KESVDSGSRSADIIISGNTNSVPLISIKNLRFSYPSAQTVEIYKNITLHVTSSQKTIG
                     IVGESGSGKSTLMYLLTKLYKTPANSIYIDGTDVNEWDTLKLRKQISVVEQNPTLFEG
                     TVRDNLVYGTLNDISEIEIYDVLKYLGIYEFIENLPMGLDSRIDTKLVSGGQAQRLCI
                     ARALLRKPTILILDECTSALDAASAHLINNLVKNGLPTVLTIVITHSKQMMEACNSLA
                     VIKDGRLAEQGNFAELMKNNSELRRIINELD"
     gene            complement(<374109..>374306)
                     /gene="NDAI0D01550"
                     /locus_tag="NDAI_0D01550"
                     /db_xref="GeneID:11494973"
     mRNA            complement(<374109..>374306)
                     /gene="NDAI0D01550"
                     /locus_tag="NDAI_0D01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669664.1"
                     /db_xref="GeneID:11494973"
     CDS             complement(374109..374306)
                     /gene="NDAI0D01550"
                     /locus_tag="NDAI_0D01550"
                     /inference="similar to DNA sequence:INSDC:YIL102C-A"
                     /note="similar to Saccharomyces cerevisiae YIL102C-A;
                     ancestral locus Anc_5.262"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669712.1"
                     /db_xref="GeneID:11494973"
                     /db_xref="GOA:G0W9K8"
                     /db_xref="InterPro:IPR009914"
                     /db_xref="UniProtKB/TrEMBL:G0W9K8"
                     /translation="MNRFALILVIAAFYTLWLFLPIFGWDGKIPFFPIPSDYAIYLPI
                     FLLMTGFTLIGTFLGFLLILN"
     gene            <374653..>375828
                     /gene="NDAI0D01560"
                     /locus_tag="NDAI_0D01560"
                     /db_xref="GeneID:11494974"
     mRNA            <374653..>375828
                     /gene="NDAI0D01560"
                     /locus_tag="NDAI_0D01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669665.1"
                     /db_xref="GeneID:11494974"
     CDS             374653..375828
                     /gene="NDAI0D01560"
                     /locus_tag="NDAI_0D01560"
                     /inference="similar to DNA sequence:INSDC:YHR052W"
                     /note="similar to Saccharomyces cerevisiae CIC1 (YHR052W);
                     ancestral locus Anc_5.278"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669713.1"
                     /db_xref="GeneID:11494974"
                     /db_xref="GOA:G0W9K9"
                     /db_xref="InterPro:IPR016094"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="InterPro:IPR028365"
                     /db_xref="UniProtKB/TrEMBL:G0W9K9"
                     /translation="MARTRSAGSSRKSTPVNTPTKQKKFQSNPKNKQNEDKSLIPQDR
                     IINAITQLNKFTSSSDDASEDKKSQLLEDDELSKSVNLIAVNATSFSGSSKNFKSKLL
                     TIKNSFYKPWKASSTTSIKDFKTLLILKDSDMKNVTEDDVYDKLNEFGITIDEIVCGK
                     DLKTKYKAFEARRAFISEFSLILADDNIVTTLPKLLGGKAYEKIETTPIPIRCYANKE
                     FSLKALTNSIKKVYLTQLPVKLPRGTTMNVHLGNLEWFKPEELATNIENITESLVKNY
                     KIRAIFIKSNKSPVLPLYYNQDVIDEITVSATEKKTKENEKDFVNIDGVDIHLSNFDK
                     ALMEIANPAELGTVFEKQIESVKRKRATLEDSKTKEEEEKNEEKKVEKAPKAKKAKK"
     gene            <376156..>377289
                     /gene="NDAI0D01570"
                     /locus_tag="NDAI_0D01570"
                     /db_xref="GeneID:11494975"
     mRNA            <376156..>377289
                     /gene="NDAI0D01570"
                     /locus_tag="NDAI_0D01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669666.1"
                     /db_xref="GeneID:11494975"
     CDS             376156..377289
                     /gene="NDAI0D01570"
                     /locus_tag="NDAI_0D01570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669714.1"
                     /db_xref="GeneID:11494975"
                     /db_xref="GOA:G0W9L0"
                     /db_xref="InterPro:IPR003710"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G0W9L0"
                     /translation="MSLSSRPVVHLIGLGSMGAIFAADLLNYTNASIIPIFRSKEKLA
                     KFQNEANSELMIHRNYLPSRPILKYKFAKAYCPESTINEPFKNLVVSTKTFQTKSALT
                     PYLKYIDSNTNLLLIQNGLGVLDDLKNDVFIDETRRPQLFQGVITHGGSQISDFTINN
                     SSQGDLKISRLPWNQDRMIQKSCVLKEDRNENELMHLLTSETMVKGFNITHMTYQELL
                     FSQLYKFVFNCCINPVTAILDCSIGEMKPNSTPLLTSIVVETLFVLRKAFSPLFQYES
                     MYNGQEDYPAIDVNGKLSTDYMVGELLKYLEKHKNSSSSMREDAVHLRNTEIDYINGY
                     VVRLANALGLSTESTKVNKTICELLNLRLGLNKVRSLNKIQGT"
     gene            <377632..>378531
                     /gene="NDAI0D01580"
                     /locus_tag="NDAI_0D01580"
                     /db_xref="GeneID:11494976"
     mRNA            <377632..>378531
                     /gene="NDAI0D01580"
                     /locus_tag="NDAI_0D01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669667.1"
                     /db_xref="GeneID:11494976"
     CDS             377632..378531
                     /gene="NDAI0D01580"
                     /locus_tag="NDAI_0D01580"
                     /note="ancestral locus Anc_5.277"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669715.1"
                     /db_xref="GeneID:11494976"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:G0W9L1"
                     /translation="MSQLFSDSGFNQRMTEESRKKLDPLKTLELLIGKINKMSEIWED
                     FTRKSLDEEKVHNFTFQEKLKTLEEIFDLIQGQNASILIDVDLLSRNLLKSDIESNNI
                     FEHNDEYIPSKVTSESRPTSHPYLTFDIDENNNLESDISNMELLEFPTKGFEDLNFPV
                     SSPLENHNINVVSGPSLNCTDEEEDRDKFLNKKIQLAMAVKPNSITELFYEYENVLTP
                     KVKDIQKKYGKKCLKQITNIRTLQRRKALVSEIKKFAKQNRKSIKETLEVAEYIRLKN
                     NRSVPWLYNNISHLLDELKNDYL"
     gene            complement(<378662..>380530)
                     /gene="NDAI0D01590"
                     /locus_tag="NDAI_0D01590"
                     /db_xref="GeneID:11494977"
     mRNA            complement(<378662..>380530)
                     /gene="NDAI0D01590"
                     /locus_tag="NDAI_0D01590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669668.1"
                     /db_xref="GeneID:11494977"
     CDS             complement(378662..380530)
                     /gene="NDAI0D01590"
                     /locus_tag="NDAI_0D01590"
                     /inference="similar to DNA sequence:INSDC:YHR032W"
                     /note="similar to Saccharomyces cerevisiae YHR032W;
                     ancestral locus Anc_5.276"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669716.1"
                     /db_xref="GeneID:11494977"
                     /db_xref="GOA:G0W9L2"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:G0W9L2"
                     /translation="MPKQFVHTTSERRSSVIYSTSIGKGGLFVPSDYIPTESMIGSED
                     TTDDSNQEDQHFIRQDEEEITEYQSLLPENAPSASESQLQTDYGTTENEHPKRISLER
                     RNSLPLLEEERELLIDNKLLNRKDDTEVLHPDNASLESIIESSNDIMNTWNNAIQSGK
                     EIKTSYKRECKVIALNALPLIFTFILQNSLSLASIFSVSHLGTKELGGVTLGSMTANI
                     TGLAAIQGLCTCLDTLCSQAYGANNYHLVGVLVQRCAVITILAFLPIMYIWFSWSEII
                     LSWMIPERELCKLAANYLKVTAFGVPGFILFECGKRFLQCQGIFHASTIILFVCAPLN
                     ALMNYILVWDKRIGIGYLGAPLSVAINYWLMTLGLIIYTTTTTNEANPLKCWNGLIKR
                     RQVFKNWKKMFNLALPGIIMVEAEFLGFEILTIFSSHLGTAPLAAQSIVSTVASLAYQ
                     VPFSISVSTSTRVANFIGASLYKSCITTCKMALLLSFVCSSMNMFIIFEFKDKIAKLF
                     SNESDVVILVVSTLPILACMQVFDAFNASTAGCLRGQGRQKIGGYINLFAFYCVGIPM
                     AYLLAFKFNMGISGLWYGITCALIMMSICQGYAVFHCDWKSIIHAARTRNAENTRV"
     gene            <382637..>383620
                     /gene="NDAI0D01600"
                     /locus_tag="NDAI_0D01600"
                     /db_xref="GeneID:11494978"
     mRNA            <382637..>383620
                     /gene="NDAI0D01600"
                     /locus_tag="NDAI_0D01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669669.1"
                     /db_xref="GeneID:11494978"
     CDS             382637..383620
                     /gene="NDAI0D01600"
                     /locus_tag="NDAI_0D01600"
                     /inference="similar to DNA sequence:INSDC:YHR104W"
                     /note="similar to Saccharomyces cerevisiae GRE3 (YHR104W);
                     ancestral locus Anc_5.409"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669717.1"
                     /db_xref="GeneID:11494978"
                     /db_xref="GOA:G0W9L3"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:G0W9L3"
                     /translation="MSALVTLNNGLKMPLVGLGCWKIPTSTCAQQIYDAIKVGYRLFD
                     GATDYGNEKEVGQGIKRAIDEGLVKREDLFIVSKLWNNFHHPDHVKLNLQRNLKDLGL
                     DYVDLYYIHFPIAFKFVSPDERYPPGMYTGKEDEAKGILTEENVPLIDTYRAMEKLVD
                     EGLIKSIGISNYNGGLVADTLRGCRIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAY
                     SSFGPQSFVDCGQEMAKNTPPLFDHPTIKKIADKYEAVTTSQVLLRWATQRGVAIIPK
                     SSKKERLLENLTIDQKVTLAEEDLREISALNQNLRFNDPWDWNNSKFPIFQ"
     gene            <383939..>386218
                     /gene="NDAI0D01610"
                     /locus_tag="NDAI_0D01610"
                     /db_xref="GeneID:11494979"
     mRNA            <383939..>386218
                     /gene="NDAI0D01610"
                     /locus_tag="NDAI_0D01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669670.1"
                     /db_xref="GeneID:11494979"
     CDS             383939..386218
                     /gene="NDAI0D01610"
                     /locus_tag="NDAI_0D01610"
                     /inference="similar to DNA sequence:INSDC:YHR031C"
                     /note="similar to Saccharomyces cerevisiae RRM3 (YHR031C);
                     ancestral locus Anc_5.275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669718.1"
                     /db_xref="GeneID:11494979"
                     /db_xref="GOA:G0W9L4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003840"
                     /db_xref="InterPro:IPR010285"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028880"
                     /db_xref="UniProtKB/TrEMBL:G0W9L4"
                     /translation="MYKNGNTSNGKSLTGRRTATSSKPNQSFAIYKTKVKQPAVLRQK
                     TLSSFFFKTGSQSPKKASHTHSLTEIVRSSEIESSSQVSHEKEGDVNHPIDLDRFSGQ
                     RPSLLFDSQGSFDEECDPDAEIKKLINVPKLNNFKEVTLSRSPSFQRSTSSLSHHVVE
                     NDTDDDNDLKDITKIKAGSRQLSFTSTQSATLASENTQLNFSQSTQTSILSQSTQVQR
                     SSKRSISPTRTSSFQGLKLSAPKRIKPIVRQKSSLSSTAYGRLTQEFKLTKEQELVID
                     LIIRKRLNVFYTGSAGTGKSVILKTIISKLGSIHGKEAIAITASTGLAATTIGGTTLH
                     KWAGVGLGDRSADQLANSIQRRKDVLNSWKNTRVLIIDEISMIDGLFLTKLETVARTV
                     RRSNRPFGGIQLVLTGDFFQLPPIQKRDSPVLSQFCFESKMWSQCIQRTILLTKVFRQ
                     QDNELVDILNSIRFGEIDQTMAAQVYNLKRKVNYDDGIAPTELYATRREVEISNSRQL
                     KELPGIERRYESDDAGTPELIKLLDSSLMVEKIITLKEDAQVMMLKNKPEVNLVNGSL
                     GKVLFFTTERLYRKMMELYRGVDDDVIIDMKMVSRAIGERTILDNKQFSQDVASRPRK
                     RLPILQELINLAMTETRREEVLPFVRWSVGQGKVHHDIVLRDVFPVDVPGDKVGLQRT
                     QLPIMLCWALSIHKSQGQTIQRLKVDLKNIFEAGQVYVALSRAVSKEQLQVLNFSPSK
                     IRSNDKVKEFYKKLETVTP"
     gene            <386654..>388132
                     /gene="NDAI0D01620"
                     /locus_tag="NDAI_0D01620"
                     /db_xref="GeneID:11494980"
     mRNA            <386654..>388132
                     /gene="NDAI0D01620"
                     /locus_tag="NDAI_0D01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669671.1"
                     /db_xref="GeneID:11494980"
     CDS             386654..388132
                     /gene="NDAI0D01620"
                     /locus_tag="NDAI_0D01620"
                     /inference="similar to DNA sequence:INSDC:YHR030C,YKL161C"
                     /note="similar to Saccharomyces cerevisiae SLT2 (YHR030C)
                     and YKL161C; ancestral locus Anc_5.274"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669719.1"
                     /db_xref="GeneID:11494980"
                     /db_xref="GOA:G0W9L5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0W9L5"
                     /translation="MAEKIDRHSFKVFNQDFTVDKRFQLIKEIGHGAYGVVCSARFAE
                     AVEETTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGSFN
                     GLYLYEELMECDMHQIIKSSQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLL
                     VNADCQLKICDFGLARGFSENPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDIWS
                     TGCILAEFLGGKPIFKGKDYVDQLNRILEVLGTPPDETLRRIGSKNVQDYIHNLGYIP
                     KVPFVNLYPNANLQALDLLEKMLAFDPQRRITVDEALEHPYLSVWHDPSDEPVCSEKF
                     EFSFEVVNDMEELKQMVIDEVHDFRKFVRKPLLEEEEQAKHQAQLQAQQQAQVQMQQQ
                     QQAEQQAQQQIQGSINGSNYSQQMGFQSPIQSQMNDNVVGIDSQGLPRHDTDFPPPPQ
                     ENLLESPANFNIGGTNGNEQDAGDAFLDLEKELEFGLDRKYL"
     gene            <388545..>389444
                     /gene="NDAI0D01630"
                     /locus_tag="NDAI_0D01630"
                     /db_xref="GeneID:11494981"
     mRNA            <388545..>389444
                     /gene="NDAI0D01630"
                     /locus_tag="NDAI_0D01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669672.1"
                     /db_xref="GeneID:11494981"
     CDS             388545..389444
                     /gene="NDAI0D01630"
                     /locus_tag="NDAI_0D01630"
                     /inference="similar to DNA sequence:INSDC:YHR029C"
                     /note="similar to Saccharomyces cerevisiae YHI9 (YHR029C);
                     ancestral locus Anc_5.273"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669720.1"
                     /db_xref="GeneID:11494981"
                     /db_xref="GOA:G0W9L6"
                     /db_xref="InterPro:IPR003719"
                     /db_xref="UniProtKB/TrEMBL:G0W9L6"
                     /translation="MTITVPFKQIDVFTAVPFKGNPVAVVNFLETPEAEVTTQQLQSI
                     AKWTNLSETTFLFAPSNKEYNYKLRIFTPAAELPFAGHPTIGSCRAYLEFTNQLNSGP
                     QTILQECGVGIVPLKFDEEGKISFQAKKTEVEEISRETASDYAKALGIHAIEPPKLLQ
                     VGPAWVVYLVSNAEAVIDLNPDFNFLKQVSDKAGHTGVILAGSKNDGNSGEQYEMRAF
                     YCPTISVLEDPVCGSGCVALLRYLQEIKNYQKTTLVNVTQGIRLCRDGHLRGRIEIDE
                     KTSQISYHVGGDAVTVINGQISI"
     gene            <390386..>390823
                     /gene="NDAI0D01640"
                     /locus_tag="NDAI_0D01640"
                     /db_xref="GeneID:11494982"
     mRNA            <390386..>390823
                     /gene="NDAI0D01640"
                     /locus_tag="NDAI_0D01640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669673.1"
                     /db_xref="GeneID:11494982"
     CDS             390386..390823
                     /gene="NDAI0D01640"
                     /locus_tag="NDAI_0D01640"
                     /inference="similar to DNA sequence:INSDC:YKL160W"
                     /note="similar to Saccharomyces cerevisiae ELF1 (YKL160W);
                     ancestral locus Anc_5.279"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669721.1"
                     /db_xref="GeneID:11494982"
                     /db_xref="InterPro:IPR007808"
                     /db_xref="UniProtKB/TrEMBL:G0W9L7"
                     /translation="MGKRKKSSRGPVKKIVQKLNTKFNCLFCNHDNSVSCTLDKRNSI
                     GSLQCKICGQSFQTRINGLSQPVDVYSDWFDAVEEVNEGKGSESEDEGSSSDYESESD
                     EGAIGTTNGGVAADSDEEEIDSDEERIGNVKRGRGAVVDSDDE"
     gene            complement(<391313..>391789)
                     /gene="NDAI0D01650"
                     /locus_tag="NDAI_0D01650"
                     /db_xref="GeneID:11494983"
     mRNA            complement(<391313..>391789)
                     /gene="NDAI0D01650"
                     /locus_tag="NDAI_0D01650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669674.1"
                     /db_xref="GeneID:11494983"
     CDS             complement(391313..391789)
                     /gene="NDAI0D01650"
                     /locus_tag="NDAI_0D01650"
                     /inference="similar to DNA sequence:INSDC:YHR051W"
                     /note="similar to Saccharomyces cerevisiae COX6 (YHR051W);
                     ancestral locus Anc_5.280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669722.1"
                     /db_xref="GeneID:11494983"
                     /db_xref="GOA:G0W9L8"
                     /db_xref="InterPro:IPR003204"
                     /db_xref="UniProtKB/TrEMBL:G0W9L8"
                     /translation="MLSRYMLRTPILKRTLLTQASKTFVATPLNSKLLLATKAGSQIR
                     KYSSHGDEETFEEFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVVEKALRAAR
                     RVNDLPTAMRVFEALKFKVENEDQYKAYLDELKDVREELGVPLKEELFAEKSETTA"
     gap             392300..392319
                     /estimated_length=20
     gene            complement(<392421..>394082)
                     /gene="NDAI0D01660"
                     /locus_tag="NDAI_0D01660"
                     /db_xref="GeneID:11494984"
     mRNA            complement(<392421..>394082)
                     /gene="NDAI0D01660"
                     /locus_tag="NDAI_0D01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669675.1"
                     /db_xref="GeneID:11494984"
     CDS             complement(392421..394082)
                     /gene="NDAI0D01660"
                     /locus_tag="NDAI_0D01660"
                     /inference="similar to DNA sequence:INSDC:YHR050W"
                     /note="similar to Saccharomyces cerevisiae SMF2 (YHR050W);
                     ancestral locus Anc_5.282"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669723.1"
                     /db_xref="GeneID:11494984"
                     /db_xref="GOA:G0W9L9"
                     /db_xref="InterPro:IPR001046"
                     /db_xref="UniProtKB/TrEMBL:G0W9L9"
                     /translation="MPSKSYTPLPRNEEREEDIETPNEITSTESLSINPFARIPETLS
                     QSHWSTIVAILRKYSGFIGPGLMVSVSYMDPGNYSTAVAAGSAHRYKLLFSILVSNFM
                     AAFWQCLCAKLGAVTGLDLAQNCKKHLPHGLNITLYILAEVAIIATDLAEVVGTAISL
                     NILFGVPLALGVVLTVVDVLIVLMAYKPNGDMKLIRLFEAFVSLLVVLTVGCFTIELF
                     YSDIGSVGEVFSGFLPSRAVFDGDGLYLSLAILGATVMPHSLYLGSGVVQPRLRDYDI
                     KNGNYLPDETDVENNHDNYKPSFDAINETLHYTIAELLISLFTVALFVNCAILIVSGA
                     TLYGTTQDTGEADLFSIYNLLCSTLSKGAGTIFVLALLFSGQSAGIVCTLSGQMVSEG
                     FLNWTVPPAIRRSITRAVAITPCLILVLVAGRSGLSGALNASQVVLSLLLPFVSAPLL
                     YFTCNKSIMRVQINDHNNCLHDKTNALPYDDNDYESDDLNIPLQNMNEGSNIVANDNI
                     KQEPVYKDMSNGLIVKIAAILVWLLISGLNFYMLLSFANGQDVHL"
     gene            complement(<394509..>395246)
                     /gene="NDAI0D01670"
                     /locus_tag="NDAI_0D01670"
                     /db_xref="GeneID:11494985"
     mRNA            complement(<394509..>395246)
                     /gene="NDAI0D01670"
                     /locus_tag="NDAI_0D01670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669676.1"
                     /db_xref="GeneID:11494985"
     CDS             complement(394509..395246)
                     /gene="NDAI0D01670"
                     /locus_tag="NDAI_0D01670"
                     /inference="similar to DNA sequence:INSDC:YHR049W"
                     /note="similar to Saccharomyces cerevisiae FSH1 (YHR049W);
                     ancestral locus Anc_5.283"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669724.1"
                     /db_xref="GeneID:11494985"
                     /db_xref="InterPro:IPR005645"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0W9M0"
                     /translation="MTTTTIPKLLFLHGFLQNGKVFSEKSSGIRKLLKKANIQCDYID
                     GPVSLEKKDLPFETDEERWKATVDAQMNKSWFYHSEISKELDLTDAINTVTSYIKENG
                     PYDGIVGFSQGAALSTIITNKITELVPSHPEFKVSVIISGYSFTEADPEHEGQLRITE
                     RYRDSFTPKKDSKTKIIFIYGTSDQAVPAKRTQYLCNLFKESEGTVGADSERIKVFEH
                     PGGHMVPNKKDIIRPVVEEIISALGSN"
     gene            complement(<395646..>397196)
                     /gene="NDAI0D01680"
                     /locus_tag="NDAI_0D01680"
                     /db_xref="GeneID:11494986"
     mRNA            complement(<395646..>397196)
                     /gene="NDAI0D01680"
                     /locus_tag="NDAI_0D01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669677.1"
                     /db_xref="GeneID:11494986"
     CDS             complement(395646..397196)
                     /gene="NDAI0D01680"
                     /locus_tag="NDAI_0D01680"
                     /inference="similar to DNA sequence:INSDC:YHR048W"
                     /note="similar to Saccharomyces cerevisiae YHR048W;
                     ancestral locus Anc_5.284"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669725.1"
                     /db_xref="GeneID:11494986"
                     /db_xref="GOA:G0W9M1"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G0W9M1"
                     /translation="MSNTSIETGSSVQIESSSSTLSKEKHITHEEDNKDFEISKNPQS
                     SNVSSFEVSFSLEGEPDPEDIARHLSTLHKYYIACVITFTSLVITIISSCWTFVSPKV
                     IERYHISHEVSVLGITFYIFGLGFGPLFLSPISELYGRRLTFIFSMTLSIIWQCLTTW
                     SHNVVGMMFGRFLSGFFGSAFLSIAGGSISDIFDKATITIPMSLYTLSCFYGPVLGPI
                     VSGALYRENYRWVFATLLIASGVCLVLIIFTIPETYKPILLIKKAERMRKERGDERYC
                     APLERTRKESSFVSSVLLSSKRPFLLLFLDPMMGVLCFYTGLVLAIVYLYFVAFPYIF
                     KKLYGFGVMQIACCYLGMMVGMTLAAPTSLIFQKRYEMNVIKNNNIRTPEMRFEPLFY
                     GAFCCPIGLMIFAWTCYQNVHWMGPMIGSAIFGSGVFFVFVGVFNYTVDAYRRYAASG
                     MACNSFVRSTMSGIFPLFGLQMYKGMGINWAGFLLAMVTILMIPVPFLFTKYGAYLRS
                     KSPFAWDD"
     gene            <398406..>399338
                     /gene="NDAI0D01690"
                     /locus_tag="NDAI_0D01690"
                     /db_xref="GeneID:11494987"
     mRNA            <398406..>399338
                     /gene="NDAI0D01690"
                     /locus_tag="NDAI_0D01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669678.1"
                     /db_xref="GeneID:11494987"
     CDS             398406..399338
                     /gene="NDAI0D01690"
                     /locus_tag="NDAI_0D01690"
                     /inference="similar to DNA sequence:INSDC:YHR046C"
                     /note="similar to Saccharomyces cerevisiae INM1 (YHR046C);
                     ancestral locus Anc_5.286"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669726.1"
                     /db_xref="GeneID:11494987"
                     /db_xref="GOA:G0W9M2"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="InterPro:IPR020550"
                     /db_xref="InterPro:IPR020583"
                     /db_xref="UniProtKB/TrEMBL:G0W9M2"
                     /translation="MKVSNNQGKQGSCRTKNQQNKGKMTTSNIDLRSIEKFLCKLATE
                     KVGTIIKTKSGTQQTYDLKTGSRKVDIVTEIDKQVEKLIWDSLKTEYPTFQFIGEESY
                     VKGITKITDDPTFIVDPIDGTTNFVHDFPFSCTSIGLTINKEPVVGVIYNPHLDLLIS
                     ASKGYGVRINGEDFDHVEKLGSMGPLLLNKSVVALQPGSAREGKNFKIKMATFENLLS
                     CDGGFVHGFRNIGSSAMSLAYIAMGYLDAYWDGGCYSWDVCAGWCILNETGGRVVGAN
                     PLEWDIGVDNRTYLAVRGTKRGDEKDQEKYIQDF"
     gene            complement(<399539..>401275)
                     /gene="NDAI0D01700"
                     /locus_tag="NDAI_0D01700"
                     /db_xref="GeneID:11494988"
     mRNA            complement(<399539..>401275)
                     /gene="NDAI0D01700"
                     /locus_tag="NDAI_0D01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669679.1"
                     /db_xref="GeneID:11494988"
     CDS             complement(399539..401275)
                     /gene="NDAI0D01700"
                     /locus_tag="NDAI_0D01700"
                     /inference="similar to DNA sequence:INSDC:YHR045W"
                     /note="similar to Saccharomyces cerevisiae YHR045W;
                     ancestral locus Anc_5.287"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669727.1"
                     /db_xref="GeneID:11494988"
                     /db_xref="UniProtKB/TrEMBL:G0W9M3"
                     /translation="MGFFSCIKLFATLLIGLLIANWILTSYLLDFKRDISKLALNQQS
                     NTSSVRNENETAIYRNFLAPQGFPLTTGLGLSQGYKIRNGNFGDLWNAIMEVSSNNNN
                     TLQFTNSNETFSLPQINGLVSNILNYQNGIFKSLGNVGIVTSISSLQGFTIMLASMVK
                     TITSINSGIPSLLPSVPRKKIENLDVLVIDSSESLKLLNGSEHWYKLVIVCEDKDNEN
                     ITPFENVVFWKQLSHNYSNICNFEYIVPEDNSDDKKEFLNVTSQSDKTTNFSQMNLIS
                     SVAAFIKNFPMNHELSKDDFLTILLPNEKLQNDSNLLIQMWPKLLAILLHGGSIALIK
                     SKGGFEKNMGIPLKTTLLLTDKDIINQQLSYLSQTEKQSTRLCSLFHKIKSSWAKTLI
                     SEGIFTKCGTSPNQQIPRLRCIFLSDSLHSIENISSFKMYSLPKLTYGSYMDSFTTKQ
                     LNYMKSIFGARIVIELYCPNLVLGPIMQTNFYEYRVLPESVDNKLVCFGTLSTTLEGK
                     LVETELSTLNINKKQGMLCIRGFTIGKPVEEERKEIARNLSKDFGGNEGWMPLVGVFG
                     LWGQDGCFYIFK"
     gene            <403497..>404603
                     /gene="NDAI0D01710"
                     /locus_tag="NDAI_0D01710"
                     /db_xref="GeneID:11494989"
     mRNA            <403497..>404603
                     /gene="NDAI0D01710"
                     /locus_tag="NDAI_0D01710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669680.1"
                     /db_xref="GeneID:11494989"
     CDS             403497..404603
                     /gene="NDAI0D01710"
                     /locus_tag="NDAI_0D01710"
                     /inference="similar to DNA sequence:INSDC:YDR309C,YHR061C"
                     /note="similar to Saccharomyces cerevisiae GIC2 (YDR309C)
                     and GIC1 (YHR061C); ancestral locus Anc_5.331"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669728.1"
                     /db_xref="GeneID:11494989"
                     /db_xref="InterPro:IPR000095"
                     /db_xref="UniProtKB/TrEMBL:G0W9M4"
                     /translation="MNQNNQMELPQMKSIWLDEDEEVEKLYGGLQAQKFLADENDEDN
                     LDIMVLNSDKPVLDNKRFKNIPINPQFNITNTITTTSTSSGNSKKKQKKKLFQLFGKS
                     NNNNTQSNNTISLKSISSPFAFQHISHAGEKSETKNLRSKSNTSNNNMTIQEEPQQVQ
                     IHNLPIFQQNLTVPPRPISTSTATTSSSMYSNNTIATGRILSMSTMATTFLEKTPSSN
                     KLNHYSQQLNNMPMDPNHHSRNKSDTSDMSIDFLKNYSFPTLLEDKPIVNFEPSKEEL
                     EDRTNNNNNKNNNNNIAPNSSLNRKSATMKNIRISSSPHLLVSTPELEDKLFTESDIR
                     SIKNHNRRISVDDILRYYNQSGSDASSPILYGYE"
     gene            complement(<404932..>405618)
                     /gene="NDAI0D01720"
                     /locus_tag="NDAI_0D01720"
                     /db_xref="GeneID:11494990"
     mRNA            complement(<404932..>405618)
                     /gene="NDAI0D01720"
                     /locus_tag="NDAI_0D01720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669681.1"
                     /db_xref="GeneID:11494990"
     CDS             complement(404932..405618)
                     /gene="NDAI0D01720"
                     /locus_tag="NDAI_0D01720"
                     /inference="similar to DNA sequence:INSDC:YHR060W"
                     /note="similar to Saccharomyces cerevisiae VMA22
                     (YHR060W); ancestral locus Anc_5.330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669729.1"
                     /db_xref="GeneID:11494990"
                     /db_xref="UniProtKB/TrEMBL:G0W9M5"
                     /translation="MTNSKQEIAKELSTPKLLERKDDDTGNDVNGDGDDPYIHLLNLL
                     SRYDQLLEQLSNSISTGFHNLSRANYHNKDSLNGRYGKDYWDESYVGEITVEITQPPP
                     EQQSLQQGIVHIVRKKLHTDEKADIIVEETDDDDDDTKDKLKNRKEKTNKREEKKDND
                     DTKKKDVSYDPILMFGGALSIPSSLRQCQTNFKGCIPLFSDLISCRMKIDRLVTKLEA
                     DKKANSTCAI"
     gene            complement(<405870..>406268)
                     /gene="NDAI0D01730"
                     /locus_tag="NDAI_0D01730"
                     /db_xref="GeneID:11494991"
     mRNA            complement(<405870..>406268)
                     /gene="NDAI0D01730"
                     /locus_tag="NDAI_0D01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669682.1"
                     /db_xref="GeneID:11494991"
     CDS             complement(405870..406268)
                     /gene="NDAI0D01730"
                     /locus_tag="NDAI_0D01730"
                     /inference="similar to DNA sequence:INSDC:YHR059W"
                     /note="similar to Saccharomyces cerevisiae FYV4 (YHR059W);
                     ancestral locus Anc_5.325"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669730.1"
                     /db_xref="GeneID:11494991"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="InterPro:IPR019083"
                     /db_xref="UniProtKB/TrEMBL:G0W9M6"
                     /translation="MLALRRLTSRRIPLITRSITTSSTSNRLIGSEKLPDVSAFLTKI
                     GRNCTEYTETYENQWDNLLKWDGKMLKEKGIPVRQRKYILNQVENLRQEKMDCIREIK
                     LGKKSFFGGERNRKAFKAKWEAEQRNNNKK"
     gene            <406540..>407469
                     /gene="NDAI0D01740"
                     /locus_tag="NDAI_0D01740"
                     /db_xref="GeneID:11494992"
     mRNA            <406540..>407469
                     /gene="NDAI0D01740"
                     /locus_tag="NDAI_0D01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669683.1"
                     /db_xref="GeneID:11494992"
     CDS             406540..407469
                     /gene="NDAI0D01740"
                     /locus_tag="NDAI_0D01740"
                     /inference="similar to DNA sequence:INSDC:YHR058C"
                     /note="similar to Saccharomyces cerevisiae MED6 (YHR058C);
                     ancestral locus Anc_5.324"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669731.1"
                     /db_xref="GeneID:11494992"
                     /db_xref="GOA:G0W9M7"
                     /db_xref="InterPro:IPR007018"
                     /db_xref="UniProtKB/TrEMBL:G0W9M7"
                     /translation="MNTPLDELQWKSPEWIQAFGLGTENVLDYFSESPFFDKTSNNHV
                     IKMQRQFSQLPPAPNGGETNGNTDPQRDANGNFIPIGASTNIDGSSSSNLTTFKYVDP
                     IRRAILNRYPLHAMLETELMKLKGIEYVLADVSEPDFWLIRKQRRYSREQIEILQDYY
                     IIGANVYQSPTVFNIVQSRLMSTSLHLSKTLEQIYKLTQFEPSQGVRFINPPIPASLS
                     SNVSTGTNPLSGPPSTVNPMNNGHTISNNNPRSVGPQMTANTVTGGQTAVSMASTSQF
                     DNSNNPKSINESMTKEVMNKLIVTSIRSSPEYI"
     gene            complement(<407496..>409190)
                     /gene="NDAI0D01750"
                     /locus_tag="NDAI_0D01750"
                     /db_xref="GeneID:11494993"
     mRNA            complement(<407496..>409190)
                     /gene="NDAI0D01750"
                     /locus_tag="NDAI_0D01750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669684.1"
                     /db_xref="GeneID:11494993"
     CDS             complement(407496..409190)
                     /gene="NDAI0D01750"
                     /locus_tag="NDAI_0D01750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669732.1"
                     /db_xref="GeneID:11494993"
                     /db_xref="GOA:G0W9M8"
                     /db_xref="InterPro:IPR004744"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G0W9M8"
                     /translation="MVTDNSSSELSNTKSHINITTQFNDVEKGETWITTTAVDGKEIE
                     NIPEPIVSTILSPNGQAVILSSEKDKVDKAMQLAMESREIDITTEEDIKLRWKIDLCM
                     FPLMCLLYAVQFMDKTSTGSAAVMGLREDLGMHGDQYSWVGSAFYFGYLFMNLGPVQF
                     IFQRSDKMAKLLALFVVIWGILLALHAVPSVNYPAFIALRVLLGCAESVVTPCFTIIT
                     AQYWKTEEQFTRVCIWFGMNGLGSIILSAIAYGVYVHEDSYSIKGWRLLFVITGILTI
                     FVGGLIYFWIPDDPSKAKFLSKREKLMVVERIRSNQQGFGNQQIKQYQIIEALKDVRT
                     WLYFLFTVSSNIPNGGISNFLSILLHSDFGYSTKDTFLISIPTGAVELIGCPLFGILA
                     IYAANKRVPFWKYRLSWAIFAAILALIASCMLGFANGSKKARLAGAYLWYISPVSYIC
                     VISNISANSSGYTKKWTVSSITLVAYAASNLAGPQTFIASQAPQYHGAKVSMVVCYAC
                     MIIILSALLLINIRENKRRDKMAIEIRNEGGENELLENLEFSDITDFENPNFRYTL"
     gene            <409968..>410579
                     /gene="NDAI0D01760"
                     /locus_tag="NDAI_0D01760"
                     /db_xref="GeneID:11494994"
     mRNA            <409968..>410579
                     /gene="NDAI0D01760"
                     /locus_tag="NDAI_0D01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669685.1"
                     /db_xref="GeneID:11494994"
     CDS             409968..410579
                     /gene="NDAI0D01760"
                     /locus_tag="NDAI_0D01760"
                     /inference="similar to DNA sequence:INSDC:YDR304C,YHR057C"
                     /note="similar to Saccharomyces cerevisiae CPR5 (YDR304C)
                     and CPR2 (YHR057C); ancestral locus Anc_5.323"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669733.1"
                     /db_xref="GeneID:11494994"
                     /db_xref="GOA:G0W9M9"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:G0W9M9"
                     /translation="MKVFSLIALFFVAITSVLAASSSAPDTTITHKVYFDITHGDEKV
                     GRIVMGLYGKTVPKTVENFYQLTISKDPKMGYLQSIFHRVIPNFMIQGGDFTHSSGIG
                     GKSIYGPRFKDENFKIKHDKPGKLSMANAGKDTNGSQFFITTVATPWLDGHHVVFGEV
                     LDGMDIVHYIENVPRDRRDVPLKKVQISASGEITNGANSDELR"
     gene            <411567..>413924
                     /gene="NDAI0D01770"
                     /locus_tag="NDAI_0D01770"
                     /db_xref="GeneID:11494995"
     mRNA            <411567..>413924
                     /gene="NDAI0D01770"
                     /locus_tag="NDAI_0D01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669686.1"
                     /db_xref="GeneID:11494995"
     CDS             411567..413924
                     /gene="NDAI0D01770"
                     /locus_tag="NDAI_0D01770"
                     /inference="similar to DNA sequence:INSDC:YDR303C,YHR056C"
                     /note="similar to Saccharomyces cerevisiae RSC3 (YDR303C)
                     and RSC30 (YHR056C); ancestral locus Anc_5.322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669734.1"
                     /db_xref="GeneID:11494995"
                     /db_xref="GOA:G0W9N0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G0W9N0"
                     /translation="MIGSTTPEPPMRRKRKPPACVRCRKRKIGCDRVHPICGNCFRLK
                     RLDCTYPLKDNVSYSSASSPPQSSTLQQNMSPPNNVVNSNINMQVSSNQIIQNNNPQM
                     LNMINTSTTINSINDFKLPLNMERPLPPMIQQTVQPPAIPYNNLNHIAKKARRSSVHP
                     KEKEKENATKDSNYLKPKKPEVASLDDIIAFNTRQYFLKNKKFQIAKLKEENEKPLRI
                     DDTNSEFDSFISNYDQKTVLNKEIEYLKAKLVDLEREQSKFLRKEVSPDYNMVEPTSD
                     DTEDEADDDATSRENANTISKIHKVPKRVAIETEYNRFYKDQVLNIYALPNYNNESDF
                     GNNPFLQNLKTKPIPIFSTQFLISKDENLWKTTEYSNGMIISNLNKGEITNIESVHEV
                     RLPCDIPSLGRIKGIMKTKEFILPSPFSKLFNMHELLNTMEPFLTVENNYFELSGAAS
                     SELANFGILSIFIFFWSQIFDTSSELTMDKSVIIRQIEYNTRTLNSRLLNCFPTLHIL
                     KYFSVWKYYQLVHVESYMLAADNGEDIYLLSSLSNANATDKDFSSLVPLSKFILTTHT
                     ERHLIRGHLPLIPIQSKLNTLEEIITKLSTGIRFDNLMVLAEELRKGNNNILDVNASL
                     FFEYFKLLHIETVMISMVPVLQFESIIINLLDLSIDALAFTLNERSNNPNLFLFSQWK
                     FVNLIENVSFVLLGIFQRYRVMKHELDTTLWITIYSKLIHFIKSLPLKQSTTIQENIL
                     RYIENSSNEEYNIASYKFHGFRHLEEQSRLEIINKKLNDIGMVID"
     gene            complement(<414158..>414478)
                     /gene="NDAI0D01780"
                     /locus_tag="NDAI_0D01780"
                     /db_xref="GeneID:11494996"
     mRNA            complement(<414158..>414478)
                     /gene="NDAI0D01780"
                     /locus_tag="NDAI_0D01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669687.1"
                     /db_xref="GeneID:11494996"
     CDS             complement(414158..414478)
                     /gene="NDAI0D01780"
                     /locus_tag="NDAI_0D01780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669735.1"
                     /db_xref="GeneID:11494996"
                     /db_xref="UniProtKB/TrEMBL:G0W9N1"
                     /translation="MNKRTMTEYNFSGLPVLPYSVYSKFPPEKYNAYLLYNRKLFEEE
                     TARIEFEKAGGIPGLARTKALRELRYFERCTHGSFCPVYISPLKKSNRMGVKHLYHVA
                     NDSY"
     gene            <415315..>418440
                     /gene="NDAI0D01790"
                     /locus_tag="NDAI_0D01790"
                     /db_xref="GeneID:11494997"
     mRNA            <415315..>418440
                     /gene="NDAI0D01790"
                     /locus_tag="NDAI_0D01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669688.1"
                     /db_xref="GeneID:11494997"
     CDS             415315..418440
                     /gene="NDAI0D01790"
                     /locus_tag="NDAI_0D01790"
                     /inference="similar to DNA sequence:INSDC:YHR027C"
                     /note="similar to Saccharomyces cerevisiae RPN1 (YHR027C);
                     ancestral locus Anc_5.271"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669736.1"
                     /db_xref="GeneID:11494997"
                     /db_xref="GOA:G0W9N2"
                     /db_xref="InterPro:IPR002015"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016643"
                     /db_xref="UniProtKB/TrEMBL:G0W9N2"
                     /translation="MVQETDKTQEQAQNLSNTVNIDESVKKTKKKDGKTEEEELSEED
                     QKLKEDLELLVQRLKEDDSSLYETSLTQLKTLIKTSTSSMTAVPKPLKFLRPSYPDLC
                     AVYDKWTDKDMKSNMADVLSVLAMTYGDKEEHDSLRYRLLSDVPNIESWGHEYIRHLS
                     LEIGEAYFTHVVEREAQIHGYAWDPTKVATPSPPPIDFQKDSIINLALEIVPYYLKHN
                     GEEEAVDLLFEVESVDKLPPFVDENTYQRICQYMIACVPLLPQPEDKTYLNTAFSIYL
                     TQSQLPEALALAIRLGNEELIRSVFDATSDKTMHQQLAYILSTQKISFEYEGIQDIIG
                     NTKLSEHFLYLAKELNLTIPKTPEDIYKSHLDNAKSVFAGGLDSAQQNLATSFVNGLL
                     NLGFCSDKLIVDDDNWVYKTKGDGMTSAVASIGSIYQWNLDGLQQLDKYLYVEENEIK
                     AGALLGIGISACGVHDGDVEPALLLLQEYVNNPNAKLSTASILGLGIAFAGSANEEVL
                     GLLLPIAADTSIPFETAVVACLSLGHIFVGTCNGDITTAIIDNYIERSDSELETEWFR
                     FLALSLGLLYLGKPDQISDIADTLVNFEEQPMTASLDSMLHMCAYVGTGDVLMIQSIL
                     DCLTPEPEDKNANEENENDEDDGTGQINSLSEFLGEKASEGETETGEEHEHEHEHEYE
                     NEHEHEHEHEHEHENENENEENNTNDNNEDADQMDVDQEEHVETTGTTENQTEPTSTN
                     NAEETKPKEGAQDEEKKKSEKEGEKEKGGDNEQVSDSPDGICEDLFGVLSIAMIVLGE
                     DIGKEMSLRHFGHLMHYGNETIRRMVPLAMGLVSIADPQMKVFDTLSRLSHDADLDVA
                     MNSIFAMGLCGVGTNNARLAQLLRQLASYYSREQDALFITRIAQGLLHLGKGTMTMDM
                     YDDSHVLNKVTLASLLTVITGLGTPGFMLKHHQLFYFLNSGVRPKYLLTLNEDNEPIK
                     VNVRVGQAVETVGQAGKPKTITGWITQSTPVLLNHGERAELENDEYISLSKSLEGVVI
                     LKKNPDYHEEE"
     gene            complement(<418841..>419482)
                     /gene="NDAI0D01800"
                     /locus_tag="NDAI_0D01800"
                     /db_xref="GeneID:11494998"
     mRNA            complement(<418841..>419482)
                     /gene="NDAI0D01800"
                     /locus_tag="NDAI_0D01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669689.1"
                     /db_xref="GeneID:11494998"
     CDS             complement(418841..419482)
                     /gene="NDAI0D01800"
                     /locus_tag="NDAI_0D01800"
                     /inference="similar to DNA sequence:INSDC:YHR026W"
                     /note="similar to Saccharomyces cerevisiae PPA1 (YHR026W);
                     ancestral locus Anc_5.270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669737.1"
                     /db_xref="GeneID:11494998"
                     /db_xref="GOA:G0W9N3"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="UniProtKB/TrEMBL:G0W9N3"
                     /translation="MIKSDSENGTSYRKKSYSQWFYYLIITIITIYILYKLFTGHGTD
                     INIGKFLERSSPYMWANLGIALCIGLSVVGAAWGIFITGASIIGAGVRAPRITTKNLI
                     SIIFCEVVAIYGLIISIVFSSKITVASTETLLSKSNLFTGYSLFWGGITVGLSNLVCG
                     VAVGVTGATAAVSDAADSALFVKILVIEIFGSILGLLGLIVGLLMTGKAADFA"
     gene            complement(<419952..>421025)
                     /gene="NDAI0D01810"
                     /locus_tag="NDAI_0D01810"
                     /db_xref="GeneID:11494999"
     mRNA            complement(<419952..>421025)
                     /gene="NDAI0D01810"
                     /locus_tag="NDAI_0D01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669690.1"
                     /db_xref="GeneID:11494999"
     CDS             complement(419952..421025)
                     /gene="NDAI0D01810"
                     /locus_tag="NDAI_0D01810"
                     /inference="similar to DNA sequence:INSDC:YHR025W"
                     /note="similar to Saccharomyces cerevisiae THR1 (YHR025W);
                     ancestral locus Anc_5.269"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669738.1"
                     /db_xref="GeneID:11494999"
                     /db_xref="GOA:G0W9N4"
                     /db_xref="InterPro:IPR000870"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:G0W9N4"
                     /translation="MARSFRIKVPASSANIGPGYDVLGIGLSLFLELNVTIDSSQAHE
                     TNDDPNNCKLTYSEDSEGFDSVPLQSDANLITRTALYVLRCNNIRSFPSGTKVHIHNP
                     IPLGRGLGSSGAAVVGGVVLANEVGKLGFTRQRMLDFCLMIERHPDNITAAMMGGFCG
                     SFLRDLTPQEIERREIPLAEVLPEPSGGENTGLVPPLPPTDIGRHVKYSWNPAIKCIA
                     IIPNFELSTADSRGVLPKAYTTQDLVFNLQRLAVLTASLTMDPPDSELIYPAMQDRVH
                     QPYRKTLIPGLTEILSSVTPTTHPGLLGICLSGAGPTILALATENFDDIAQEIINRFS
                     KHNIQCSWKLLEPAYEGVIVEQQ"
     gene            <422414..>423814
                     /gene="NDAI0D01820"
                     /locus_tag="NDAI_0D01820"
                     /db_xref="GeneID:11495000"
     mRNA            <422414..>423814
                     /gene="NDAI0D01820"
                     /locus_tag="NDAI_0D01820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669691.1"
                     /db_xref="GeneID:11495000"
     CDS             422414..423814
                     /gene="NDAI0D01820"
                     /locus_tag="NDAI_0D01820"
                     /inference="similar to DNA sequence:INSDC:YHR024C"
                     /note="similar to Saccharomyces cerevisiae MAS2 (YHR024C);
                     ancestral locus Anc_5.268"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669739.1"
                     /db_xref="GeneID:11495000"
                     /db_xref="GOA:G0W9N5"
                     /db_xref="InterPro:IPR001431"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:G0W9N5"
                     /translation="MLRTTVKNLYSTIAKETFRQSTLSNGLRVATSNDPGHFSALGLY
                     VGAGPRFENGNLRGSTHILDRLAFKSTEHIDGRTMTETLELLGGNYQCTSSRETMMYQ
                     ASVFNQDVPKMLELMTETVRYPNITQQELDEQKLTTEYEIDEIWTKPDLILPELLHTT
                     AYSGKTLGAPLLCPRELIPSISKYYLNEYRNKFYTPENTVASFVGVPHEKAVEYASKY
                     LGDWESTNPPMTQESAHYTGGETCIPPAPVFGNLPELYYIQIGYEGLPIDHEDIYALA
                     TLQTLLGGGGSFSAGGPGKGMYSRLYTHVLNQYYFIENCVSFNHSYSDSGIFGISIAC
                     LPEAAKQATEIIAQQLYSTFANKNLRLSHDEVSRAKNQLKSSLLMNLESKLIELEDMG
                     RQIQLRNRKVPVAKMIEKIEKLTPEDITRVARMIFTGNVKNPGNGTGRPTIVMQGKRE
                     AFGDVQQMLKHYGLGK"
     gene            complement(<424039..>429711)
                     /gene="NDAI0D01830"
                     /locus_tag="NDAI_0D01830"
                     /db_xref="GeneID:11494868"
     mRNA            complement(<424039..>429711)
                     /gene="NDAI0D01830"
                     /locus_tag="NDAI_0D01830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669692.1"
                     /db_xref="GeneID:11494868"
     CDS             complement(424039..429711)
                     /gene="NDAI0D01830"
                     /locus_tag="NDAI_0D01830"
                     /inference="similar to DNA sequence:INSDC:YHR023W"
                     /note="similar to Saccharomyces cerevisiae MYO1 (YHR023W);
                     ancestral locus Anc_5.267"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669740.1"
                     /db_xref="GeneID:11494868"
                     /db_xref="GOA:G0W9N6"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR027401"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W9N6"
                     /translation="MTDQPSLVWVPDQTQVFRQAELISTEIVKNTRLNQDEEMAIVRL
                     IDSNEEAKFLISETAPINPTTFDKIDNMSELTHLNEPSVLYNLENRYKDDLIYTYSGL
                     FLVAINPYSNIKIYTQEYINLFNGSQKEENKPHIFAVAEEAYQNLLSEKQNQSVLVTG
                     ESGAGKTENTKKILQYLASITSSTTTISNPTSPNKTNFIQEGTFERKILQSNPILESF
                     GNAQTVRNNNSSRFGKFIKIEFDDRGKINGAHIEWYLLEKSRVIEQHPDERNYHIFYQ
                     LLTGLSEQELRKLELYSKSTSDYYYLSRSNSSIPGVNDAQDFQELLDALGTVGFTKNE
                     IDDIFKIISIILHVGNVEFVSEKAQQASFKNDQSILAKLLGVTVEQWSTAILRPKAKA
                     GREWVSQGKDAKQSRFILNSLARTLYERLFAYIVERINHSLDHGSMTTNYIGLLDIAG
                     FEIFKHNSFEQLCINYTNEKLQQFFNHHMFILEQNEYMRENIHWDFVDFGKDLQASIH
                     LIDKRGSPMGILPILDEESILPKSSDDSFFSKLISNWDKKSDRFKRSKLEKCFILKHY
                     AGNVEYNIEGWLSKNKDPLSEYMLNMLSSSSDSLISEFFNNPLTSSSSSASIATMDDK
                     PKNRGSAIRTAAMRHREQLNFLLDQLSTTHPHFVRCIIPNNRKMAKSFDRKLILDQLR
                     CNGVLEGIRIAREGYPNRIFFKEFFQRYKILASSHDLFSNSNSKKNCEILIASLDLEP
                     NLYKIGNTKLFFKAGVLAKLESRKDQKIKQVIIRLNSQVRGKMIRDEVGGKLKRIRAA
                     RVIGSTFRTYNKLMENPWYNLFVKIKPLLDSSSDISKTKTFNDKINSLEQKIEAVEIE
                     RNITKETNELVNKELKELRSILETEKEKLKEKELVLLSTKEKTELLEKQLVDAVKLKD
                     AIEEEKWKLKDEYEAIVEDIKNSKVESQEKESSLKQLEEKYQTLQIEVNTLQEKLTSQ
                     KEAREALLHAKYLQEKELAQLKEKNKLQELEIQKLQNDVNHSGEDLDLKIASLEKSCN
                     SAKTRLGTLADENADLRSQLSNSKKEQSNSARQLNLKMAEIERLKAKIHQNQKSIQEI
                     SEQRDRIVTEQDSIVSELHSTREELSHYKLKCQDMEGELANLKIMNVQIEEGSASQER
                     DDSKIKQLEQRLVEETSLNQYLNKKLSARLANETLLTNDNNMFYNSEISKEQIISMYN
                     DMKIKLADVMKNLEDEIEEKKNLISRLRFTETRLASSSFDSQNSHAQINKLKEIIKNA
                     NIQVELDKELTDVKPDEVNLEKMVLEVQHLKRQLEIQTKAQYDAENVASALHEKFNKI
                     QRADSASDIFKLKYEASEERIKALENKLKHNPLKDRTNLPSGDIFINRDSVTKYEEEV
                     RFHKLENYKLQETIADANNKISHLNHDIRQSQSREELHKEQIVRLKKNLESIEYQKGL
                     LLTTIDQQKKRFDECVQDLHENETQLNEYKLALKQAESDVNSMSSIIEKLKSQNKQKD
                     KTIWERETEKNELDMQLQESLLELKRIQDLNNLLNADLAHLKERLTSTQDTSYYTDEI
                     ERLKSDIAESMNTETSLKKEVATLKYKLDSTSNESESKVSELLKQVAHYSNLVGILSN
                     ERDVSQASHAELSKRYEELIAKVNSLTSTVESLSNEKSNLASRLEELKSAMGKTTDDF
                     SKSLQEKDKISSNVAYLQETLAFQQEQNARNGLLVKQLQESVDTLKNALNQEKEKNIE
                     LYQENQTLIKMDSQLKEKLNSMQSQLSDSSEKDAWLIKIHELEELVNKESSLKYEELK
                     KVQTMDRVIEDLKKKNNRQSEVIDIANKDRKEFEEEIQKHTGHIIELERHIDKQDVDL
                     KKIVRDNAYYQDRVMELEKEISFWKDQFQSLNAEEKDLSDIRTQEVMI"
     gene            <432480..>433610
                     /gene="NDAI0D01840"
                     /locus_tag="NDAI_0D01840"
                     /db_xref="GeneID:11494869"
     mRNA            <432480..>433610
                     /gene="NDAI0D01840"
                     /locus_tag="NDAI_0D01840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669693.1"
                     /db_xref="GeneID:11494869"
     CDS             432480..433610
                     /gene="NDAI0D01840"
                     /locus_tag="NDAI_0D01840"
                     /inference="similar to DNA sequence:INSDC:YHR022C"
                     /note="similar to Saccharomyces cerevisiae YHR022C;
                     ancestral locus Anc_5.266"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669741.1"
                     /db_xref="GeneID:11494869"
                     /db_xref="GOA:G0W9N7"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W9N7"
                     /translation="MSTLLLYDFQKYPKPRCTDLHTARITVMGDNHCGKTSLIFRWLT
                     NAFQQIEDGTYQEDIYHKTLNIETLLNDEYPLSTTNTINSITTDLDYDSISNEPHHTL
                     TDDLLECTTETPPDKHDTLHHFLADIAKSRHVGKQESNYDTNNTEDTEKKKASNSRKN
                     AYQTHKHFLNRPHNIKLQILDSQPLEIADFSELRSKQIQQSDAFILCFDSTNRESFHD
                     IRTYQRKIERARGIDDNIPIILCCTKTDKINERKVSPDEIKDLVYKSGLDIRTDFFEV
                     SSKHGTNVQSLLLTTLVKIENYKYQERNRLKSKKSKSKSNSNHSSRTQLHNPPDDHEL
                     VESKLLLNKNTGSTTTPIESTNGSSTNLLDEKKILNRLIKSY"
     gene            <434593..>435361
                     /gene="NDAI0D01850"
                     /locus_tag="NDAI_0D01850"
                     /db_xref="GeneID:11494870"
     mRNA            join(<434593..434595,435116..>435361)
                     /gene="NDAI0D01850"
                     /locus_tag="NDAI_0D01850"
                     /product="ribosomal protein S27"
                     /transcript_id="XM_003669694.1"
                     /db_xref="GeneID:11494870"
     CDS             join(434593..434595,435116..435361)
                     /gene="NDAI0D01850"
                     /locus_tag="NDAI_0D01850"
                     /inference="similar to DNA sequence:INSDC:YHR021C,YKL156W"
                     /note="similar to Saccharomyces cerevisiae RPS27B
                     (YHR021C) and RPS27A (YKL156W); ancestral locus Anc_5.265"
                     /codon_start=1
                     /product="ribosomal protein S27"
                     /protein_id="XP_003669742.1"
                     /db_xref="GeneID:11494870"
                     /db_xref="GOA:G0W9N8"
                     /db_xref="InterPro:IPR000592"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR023407"
                     /db_xref="UniProtKB/TrEMBL:G0W9N8"
                     /translation="MVLVQDLLHPTAASEARKHKLKTLVQSPRSYFLDVKCPGCLNIT
                     TVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK"
     gene            <437370..>438914
                     /gene="NDAI0D01860"
                     /locus_tag="NDAI_0D01860"
                     /db_xref="GeneID:11494871"
     mRNA            <437370..>438914
                     /gene="NDAI0D01860"
                     /locus_tag="NDAI_0D01860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669695.1"
                     /db_xref="GeneID:11494871"
     CDS             437370..438914
                     /gene="NDAI0D01860"
                     /locus_tag="NDAI_0D01860"
                     /inference="similar to DNA sequence:INSDC:YLL010C,YLR019W"
                     /note="similar to Saccharomyces cerevisiae PSR1 (YLL010C)
                     and PSR2 (YLR019W); ancestral locus Anc_5.202"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669743.1"
                     /db_xref="GeneID:11494871"
                     /db_xref="GOA:G0W9N9"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR011948"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G0W9N9"
                     /translation="MGFVSSLLCCSDEDSQSSSPLQTNHQQLQHQKEKQLQSQKNNNK
                     IIQNEKRTQTSHQDKKNRQTSSSSSISAETKQLTKSSSHPKHRKHNNNSYDNHSMTIV
                     TPTLTINTNTNDAHGSTSINGMHTGNTKIKDNNSNDSSKIKNSDNGQNQMKEDKRRRK
                     KRNTPNNQNIIKKSLEEESVTGKEYPNAKDEEIEEKESFRDKEIEEEEDSKETQLVNV
                     YNSETDTSTGETVPQTMNEVLPSTQEELENGDDINITTNNNNNDDANNDNINNNNSNN
                     IALERNYSAETANTSIGSTTTNSMTTTSYDEDNGEFIDLTLLQPMQYHADGYKTLLSP
                     KDEIKFKHKKCLVLDLDETLVHSSFKYLPNADFNLPVNIDDQIHNVYVIKRPGVDEFL
                     EKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSIHHRLFREACYNYEGNYIKNLSQMG
                     RPLSEIIILDNSPASYIFHPQHAIPISSWFSDSHDNELLDIIPLLEDLSKNPSLDVGK
                     VLDVTI"
     gene            complement(<439775..>441295)
                     /gene="NDAI0D01870"
                     /locus_tag="NDAI_0D01870"
                     /db_xref="GeneID:11494872"
     mRNA            complement(<439775..>441295)
                     /gene="NDAI0D01870"
                     /locus_tag="NDAI_0D01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669696.1"
                     /db_xref="GeneID:11494872"
     CDS             complement(439775..441295)
                     /gene="NDAI0D01870"
                     /locus_tag="NDAI_0D01870"
                     /inference="similar to DNA sequence:INSDC:YLL012W,YLR020C"
                     /note="similar to Saccharomyces cerevisiae YEH1 (YLL012W)
                     and YEH2 (YLR020C); ancestral locus Anc_5.200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669744.1"
                     /db_xref="GeneID:11494872"
                     /db_xref="GOA:G0W9P0"
                     /db_xref="InterPro:IPR006693"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0W9P0"
                     /translation="MVRMTKMPIKLFKKTSRRIVSSLILNLSLSLIFIVALYKIYFIE
                     YYNSMSPFGKFITKNVDKDSSSSARENNNTTKQKKNVIRNNNNNKFKEDLNLYPTLNH
                     YYNQYGIEIEEFQLETKDGFIIDLWHLKSKTNFQCQNNIGQNSPVLMIHGLLQSSGSF
                     ASNGQNSLAYYMFNSGFDVWLGNNRCGFTPNWNPKLIPKKKRWDWDINEMVNYDLPML
                     IDHVLKVTNFEKLSIVCHSQGTTQVFLNLLQDKGKDKNCAPMIDKIENVIALAPALYP
                     GPILNDHPIFKLMSMAIDSPVVFGEKNFINIMMVARKLFLGTAFFGFICYTIFNYLFG
                     WNDLLWDDGLKNRHFQFSPVFVSVKLMQWWISRDPNKKSFIKNYNDFFPQYKKWFSKL
                     GDDDTKQKIIPNFLIFIPGQDKLVDGQRVIKHFRNFENEASYKIWYIEEYSHVDILWA
                     NDVLEKVGRPILQNMRLSHINNNNSVPSTASATATATAAVSPPASQHLKESHDKLN"
     gene            <443013..>446156
                     /gene="NDAI0D01880"
                     /locus_tag="NDAI_0D01880"
                     /db_xref="GeneID:11494873"
     mRNA            <443013..>446156
                     /gene="NDAI0D01880"
                     /locus_tag="NDAI_0D01880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669697.1"
                     /db_xref="GeneID:11494873"
     CDS             443013..446156
                     /gene="NDAI0D01880"
                     /locus_tag="NDAI_0D01880"
                     /inference="similar to DNA sequence:INSDC:YLL013C"
                     /note="similar to Saccharomyces cerevisiae PUF3 (YLL013C);
                     ancestral locus Anc_5.196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669745.1"
                     /db_xref="GeneID:11494873"
                     /db_xref="GOA:G0W9P1"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0W9P1"
                     /translation="MTVLNNIDQWVENNNNNNNNNNNDNTQNPNNYNHQDFLQQAPPL
                     NLNMNINSANTFDSELASIVSSLSVLSNNPINTTNTNNNANISSYTSPNQQIGGFRRS
                     SLNQSDMESDILYLNSNSITANNNNNMINSDFIKRTTLSVGAVPTNFQQYSTTSNTNT
                     NNNNNNNNNTNEMNPQSYYSSTSSSSSPPIQSIQGHPHVSKSINDIQSHFQNHTINSS
                     SSSNNNSDYGNNINKGNNNSNNNTYNNNNNKRLDLLGQYPATIADPMTSYQSTNKNKG
                     NFFEKFGKSLIEGTREIESQGDNNNNSTTIDLNSNRSEVSLATQTTLSNSIDDYDNES
                     SIAGSSEYYPNFIPNQNRFQNNNNNNNNSVWNPANAQSFRPQQNNLDPYYQQQQQQQQ
                     QIHPTYFPTGAFPYPHFPQQQQFSISSPTAYLSQMLSPPSNFNYNNTNTGDMSINQFQ
                     QNIASKNNFEEGSTTSSTTNSSDSPLPTSHHDTTIQVPPSSSSSSQQQQQQQQQQQQP
                     MFPYPVLNPLMYVPPPNQQQNPQDFVDFENAHNYSYHSAGGSGSAGSININTLKNNNT
                     NPYLDTSNHVNNNISAMIPTDNNANIKQKNNHNKKISVFNPKKNNKKYPSTFDQIHNN
                     NNNSPVNSNNNNNNNNNDNTKNNKQQLNKLHMKSNRIKNNTEQEDKNTNATQTSYHRS
                     PILEELRSNPNKINLTLKDIFGHILEFCRDQYGSRFIQHELSICSESEKEIIFNELRN
                     EALILSNDVFGNYVIQKFFEFGSITQRDILVEQFNGKMKELSLQMYACRVIQKALEFI
                     KPEQRLSLVSELSDCILMTIKDQNGNHVIQKAIEYIPLKSLPFILNSLIGHIYHLSTH
                     SYGCRVIQRLLEFGSDKDQYIILNELKDFIPYLIQDQYGNYVIQYILQQHEDNEASKI
                     CPLMLETKQEIIKIVSKNVVEFSKHKFASNVVEKSIIYGNESQRKLIISKIVPRDKEN
                     AENLEDNSPMILMMRDQFANYVVQKLVTISENEDKKLIVIAIRSYLDKLNQSNSLGNR
                     HLASIEKLASLVETVEI"
     gene            complement(<446356..>446688)
                     /gene="NDAI0D01890"
                     /locus_tag="NDAI_0D01890"
                     /db_xref="GeneID:11494874"
     mRNA            complement(<446356..>446688)
                     /gene="NDAI0D01890"
                     /locus_tag="NDAI_0D01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669698.1"
                     /db_xref="GeneID:11494874"
     CDS             complement(446356..446688)
                     /gene="NDAI0D01890"
                     /locus_tag="NDAI_0D01890"
                     /inference="similar to DNA sequence:INSDC:YLL014W"
                     /note="similar to Saccharomyces cerevisiae YLL014W;
                     ancestral locus Anc_5.195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669746.1"
                     /db_xref="GeneID:11494874"
                     /db_xref="GOA:G0W9P2"
                     /db_xref="InterPro:IPR008504"
                     /db_xref="InterPro:IPR029008"
                     /db_xref="UniProtKB/TrEMBL:G0W9P2"
                     /translation="MVTQQEEDAFSKLNSMPNVMENKKTLLFLQDSTTLIFGLCSGIL
                     QLESMNGFYMFVLSYVFVCSLFLMWICHGKPAKYFMSPIQDIFLESFFRELMGFVMAW
                     TFSYALVG"
     gene            <447147..>448310
                     /gene="NDAI0D01900"
                     /locus_tag="NDAI_0D01900"
                     /db_xref="GeneID:11494875"
     mRNA            <447147..>448310
                     /gene="NDAI0D01900"
                     /locus_tag="NDAI_0D01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669699.1"
                     /db_xref="GeneID:11494875"
     CDS             447147..448310
                     /gene="NDAI0D01900"
                     /locus_tag="NDAI_0D01900"
                     /inference="similar to DNA sequence:INSDC:YGR187C"
                     /note="similar to Saccharomyces cerevisiae HGH1 (YGR187C);
                     ancestral locus Anc_5.194"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669747.1"
                     /db_xref="GeneID:11494875"
                     /db_xref="InterPro:IPR007205"
                     /db_xref="InterPro:IPR007206"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0W9P3"
                     /translation="MPTQLEELVSFLHSPQPAVVQIALDNLVGFSSGPNAQIFKYDNY
                     QAIKDLKKLSQEKSKILVQQSITILANLSDDGIMRNLIVSDLEYLKYLTWKICDLENT
                     SADIMCILLSNLAKDDAIKNVFDIIATEENIKVLNKDVFKSKRVIDCLMDCFVMGYDR
                     KLNKFANFDYLAFFFADLSRFKIGRNYFVNEQEYDHVVPISKLLVFTEKYDNKTRREG
                     VASTIKNSLFDSEHHVELLSDENINLLPYILLPITSYKDSEIDEEDMFNLPDELQLLP
                     EDKTRDPINSIICAHLESILLLCSTKSSREYLRSKSVYPLVRELHKSVEDEDIGELCY
                     RIVNTLMRGDPAEQVEEILSKDIEDENEDENDKKAEDEDEDDDDDDDEIVEVV"
     gene            complement(<448480..>450807)
                     /gene="NDAI0D01910"
                     /locus_tag="NDAI_0D01910"
                     /db_xref="GeneID:11494876"
     mRNA            complement(<448480..>450807)
                     /gene="NDAI0D01910"
                     /locus_tag="NDAI_0D01910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669700.1"
                     /db_xref="GeneID:11494876"
     CDS             complement(448480..450807)
                     /gene="NDAI0D01910"
                     /locus_tag="NDAI_0D01910"
                     /inference="similar to DNA sequence:INSDC:YGR186W"
                     /note="similar to Saccharomyces cerevisiae TFG1 (YGR186W);
                     ancestral locus Anc_5.193"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669748.1"
                     /db_xref="GeneID:11494876"
                     /db_xref="GOA:G0W9P4"
                     /db_xref="InterPro:IPR011039"
                     /db_xref="UniProtKB/TrEMBL:G0W9P4"
                     /translation="MNNTSNRNGTGLAGRNRTDTAGGGGGTDKSPFIKRDRLKRNFLR
                     SRFNGKNRPIVKKDDPELIAKREEELLSGTTDTMGSTPDGSVKVKSEGNITANMTNNT
                     KKDDEVEEQFNEFPLRAISKDDLENMRTHLLKFQSKKKINPNESFHLPIRLHRKDTRN
                     LQFQLTRAEIVQRQKEIADYKKTQQQQQGQQQGNFVPTSAGKNQPLLSTAGTPINATI
                     ASTPSTTMTTTTTATAITSDSNTTNLLSTTTPTPTPTPLNATNTQSSAKNPQQQGMPE
                     QPVKLVTQLEEAGIAEDPTKVGMVKYDGQEDLNTTFEPGTTDPLADVAPDGGGRSKRG
                     NSRRKTRQLKVLDENAKKLRFEEFYPWVMEDYDGYNTWVGSYEAGNSDSYVMLSVEDD
                     GSFTMIPADKVYKFTARNKYATLTIEEAEKRMDKKSGEVPRWLMKHLDNIGTTTTRYD
                     RTKRRLKAVSNAGDEDEAHDDNSEIELDYDEEFDDDEEAPIIDGNEQENKESEQRIKR
                     EMLQANAMGLRDDEIIPDDDEDDLFSKKKIDVEGERIKKALQKTELAALYSSDDEEIN
                     PYLSESETEIKEEDEKKIKKEEVDKGSLSKKSSPRKQKSPSANNIPKQPKLKVKSIND
                     CVVVLQGDKKILKNFPQGEWNPNAPKRKRQEPTPEESTTSEIGVKQEINNNPRLATAP
                     SSPTPTIMKQEGENEEPLSKKVKTEFSADNSTAIPLITEADIIAAIGDGKVNVKDFGK
                     TIRKKYPGPENKKLMFAIVKKLCRKVDNEHMELKK"
     gene            <451715..>457948
                     /gene="NDAI0D01920"
                     /locus_tag="NDAI_0D01920"
                     /db_xref="GeneID:11494877"
     mRNA            <451715..>457948
                     /gene="NDAI0D01920"
                     /locus_tag="NDAI_0D01920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669701.1"
                     /db_xref="GeneID:11494877"
     CDS             451715..457948
                     /gene="NDAI0D01920"
                     /locus_tag="NDAI_0D01920"
                     /inference="similar to DNA sequence:INSDC:YGR184C"
                     /note="similar to Saccharomyces cerevisiae UBR1 (YGR184C);
                     ancestral locus Anc_5.190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669749.1"
                     /db_xref="GeneID:11494877"
                     /db_xref="GOA:G0W9P5"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="InterPro:IPR003769"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013993"
                     /db_xref="UniProtKB/TrEMBL:G0W9P5"
                     /translation="MSESTENTYDLKRLLQSIHLLPFFQRPRGPTHRVEMDHILKKLV
                     FNILYFSITDNGKYLKDLFQFKIDYLEHQQQGKKGNKKKNKDKNMSLADAISTPSEFE
                     QDAAGNDNDDNGDTEEDNDVRKFELSLPKTMEDIVQDLDHNSDDDEADVFADDYKAPD
                     DYKDRTFPKLTDFYKLSPSILSFATTTSAKNNSHKGRNCGKKFKVGEPLYRCKECGYD
                     DTCVLCINCFNPDEHENHHVYTDICHDFTSGICDCGDAEAWNTTLHCKADQIPNHSDD
                     QMDIDSDSNEDIFRNPELQEKFKHTLSESFDYFIDLFSQNIEPLTTFTKDINLKLREL
                     TQDEKYVARARFMRALAYKNPYIERQHLPTEAEEGEITFSKAIDPKDYAVIIYNDEFH
                     NYSQATMALRQGVPDNIHIDLLTSKVDSEGRAMLKCSDKMSALIEGFFAVQTNGLSAT
                     LTSWTEYIHQEVCKYIVMWLNHCLSLPLPNFQNVFRESLGEILCSTYEGASTAVDILP
                     IVQEYFPNKLNENDPYRYVDASLFAPNNKIPLGHHKDLPDSSIDSISSVLNVLTKVES
                     RTYSNTRLQHILYLDNRYWKRLRKDLQNVIIPTLASSIKYKPIFSQQVVEIFNHITRS
                     VAYMDREPQLTALRECVVQLFTCPTNAQMIFRDGNFIDIIWSIIDIFVEFCKVENGTL
                     IWQRVQKSNPSKSYTIAFKQGLYIVETLLSKINDPNIILKPKEFISIVTLCKIFNSAW
                     KIKRKEGEHVLHEDQHFIPYLEYTTTIYSIVQTVEKLLEDSKHSIDQNLLLNAIHLMT
                     TFLGHKSLVYKLVFDSHEIIKFTVSNERVAFMHPVHTLFSFLIEKVPLLESNKIIYQD
                     CTDFLKISDFALRSVVLCSQIDVGFWVRNGMSVLHQASYYKNNPELNSYSRDIHLNQL
                     AFLWETDDMPRVIYNMLDRWELLDWFNGEVEYANTVYRDKISLMIQQFISFNYQVLTE
                     RQFFKKFATAEERVLYQIKNAIIYNLYTKPLSYSKLLRLVPDYLIEDTTLFDSALSEV
                     SIFVEPKGLADNGVFKLKESFYSKIDPLKLSNLDNEFESSSVIIKSHLTKNKKDTSGV
                     ILQPQIKSAKHLDENAIHLGNFTRTSIFAKIVYKLLQVSLDTEESVYLNELLHLLHGI
                     FKDDELVNGKDSLPKAYISKPICNLLLSISNIKSSIFSEHITKKADYLLETMLKKRPD
                     EISQSLVDCFGETMVNDYKAKKLNQGVNLAESERERKRRMAKKHQAKLMAKFNNQQSK
                     FMKENEANFEKESSTDVDMMAGEKVLEAEDFTCSLCQDDTSLDLFIIPAYHDHTPIFR
                     PGNVFDANEFAKKWDGFHNDDKNLTYIDDKNLENLRTNGLRGSRKVFVSCNHHIHNNC
                     FKRYIQKKRFVNNAFICPLCQTFSNCIIPVYRSSKASTHITLEDLVTKESSASILSTL
                     FDVSASDIFDKVSQLVDQVVQSHDFFDKRFGKSEHRNDCDVGEILMTHWANTISMLEI
                     SSRADVNTNATFLKDREQKYQTLKNVLIFILLVFKSFGSPNFTNDFYKNVNNTVWNQN
                     QVFQVIVRNILYPKTTRSVRDSIGEAVLAYANQIMIDYASSSQSFQNIVEAHNTIKES
                     GEDYTIDGPLLDTIKSICPNIAFYDEDNVEKFCNVLYTSLLRNLLPTLRRGILLIKVF
                     HEILRESDDEAFVINGISVETLLEEKSSSLPDYIDNLLKLTTNYESLNDMLTTGRIGF
                     EYDKLDPYLKRIPYEYCGIIKLVNLSKYLNTYVTNTKEIKLREEHHHRDNKNRNNRLD
                     FKICLTCGVKIHLRSDRHEMPRHLSKRCFKSFGIFLIPNTSEVCLFLSHPPSTVFISA
                     PYLNSHGEVGRNAMKRGDLTTLNLKRYEHLNKLWINNEIPGYISRVMGDEFRVSILSN
                     GFLFTFDREGRQGGRFGRAFGDGFDSSEEEEGGSDASDVERPYHGNDDDEDDEDDSGF
                     DESDEDNDGHNHGHGIGGLGRVEAGEGGGIRMNFNGQPLNAEAGDFFRLFETFRNNLA
                     GEGGEGPGAGGAAAMTAPFLQFLGPQFRGTGGNNDGEDGPNFFNLGNNEGESDEESDN
                     DAW"
     gene            <458361..>458684
                     /gene="NDAI0D01930"
                     /locus_tag="NDAI_0D01930"
                     /db_xref="GeneID:11494878"
     mRNA            join(<458361..458363,458481..>458684)
                     /gene="NDAI0D01930"
                     /locus_tag="NDAI_0D01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669702.1"
                     /db_xref="GeneID:11494878"
     CDS             join(458361..458363,458481..458684)
                     /gene="NDAI0D01930"
                     /locus_tag="NDAI_0D01930"
                     /inference="similar to DNA sequence:INSDC:YGR183C"
                     /note="similar to Saccharomyces cerevisiae QCR9 (YGR183C);
                     ancestral locus Anc_5.189"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669750.1"
                     /db_xref="GeneID:11494878"
                     /db_xref="GOA:G0W9P6"
                     /db_xref="InterPro:IPR008027"
                     /db_xref="UniProtKB/TrEMBL:G0W9P6"
                     /translation="MSFSSVYKVLFKRNSVFVGTIFVSAFIFQAVFDTSVTSWYENHN
                     KGKLWKDVQARIAAGNGDGDDDDE"
     gene            complement(<459046..>459351)
                     /gene="NDAI0D01940"
                     /locus_tag="NDAI_0D01940"
                     /db_xref="GeneID:11494879"
     mRNA            complement(<459046..>459351)
                     /gene="NDAI0D01940"
                     /locus_tag="NDAI_0D01940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669703.1"
                     /db_xref="GeneID:11494879"
     CDS             complement(459046..459351)
                     /gene="NDAI0D01940"
                     /locus_tag="NDAI_0D01940"
                     /inference="similar to DNA sequence:INSDC:YGR181W"
                     /note="similar to Saccharomyces cerevisiae TIM13
                     (YGR181W); ancestral locus Anc_5.188"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669751.1"
                     /db_xref="GeneID:11494879"
                     /db_xref="GOA:G0W9P7"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="UniProtKB/TrEMBL:G0W9P7"
                     /translation="MGFFSKSSSTSNEGQNQPKVESSPVANQIKTQIAQELAVANATE
                     LVSKLTENCFKKCLMAPYDSKNETCVDQCLTKYMKSWNAVSKAYVARIQEASTTGEI"
     gene            <461836..>462894
                     /gene="NDAI0D01950"
                     /locus_tag="NDAI_0D01950"
                     /db_xref="GeneID:11494880"
     mRNA            <461836..>462894
                     /gene="NDAI0D01950"
                     /locus_tag="NDAI_0D01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669704.1"
                     /db_xref="GeneID:11494880"
     CDS             461836..462894
                     /gene="NDAI0D01950"
                     /locus_tag="NDAI_0D01950"
                     /inference="similar to DNA sequence:INSDC:YGR180C,YJL026W"
                     /note="similar to Saccharomyces cerevisiae RNR4 (YGR180C)
                     and RNR2 (YJL026W); ancestral locus Anc_5.179"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669752.1"
                     /db_xref="GeneID:11494880"
                     /db_xref="GOA:G0W9P8"
                     /db_xref="InterPro:IPR000358"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR012348"
                     /db_xref="UniProtKB/TrEMBL:G0W9P8"
                     /translation="MSNAAQSLEAHQLFLKNFEAERTAMKETEKDEILLMENSRRFVM
                     FPIKYHEIWAAYKKVEAAFWTAEEIELEKDVKDFSKLNDDQKEFIARVLAYLTVSEDI
                     INKHLVEKFSAELQNPEGKSLYGFQIMMENIYDEVYSMIVDALYNGPENVPYFKQVPS
                     TVQHQEKAAFIQRWIHNPDSLYGERLVALSAKEGIFFSGVYAALGWLGNTAGFPGIST
                     ANKFICRDKGAYADFGCLLFAHLKTKPDAKIVEKIITEAVDIELDVMNKAFEVEKFGV
                     DPALIKQYVQFIADSLLSSFGNDKVYNVTNPFEFMAGATQIGKSNFFEKKVSDFTKVT
                     TADKANKSAESIKFNESF"
     gene            <463685..>465130
                     /gene="NDAI0D01960"
                     /locus_tag="NDAI_0D01960"
                     /db_xref="GeneID:11494881"
     mRNA            <463685..>465130
                     /gene="NDAI0D01960"
                     /locus_tag="NDAI_0D01960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669705.1"
                     /db_xref="GeneID:11494881"
     CDS             463685..465130
                     /gene="NDAI0D01960"
                     /locus_tag="NDAI_0D01960"
                     /inference="similar to DNA sequence:INSDC:YGR179C"
                     /note="similar to Saccharomyces cerevisiae OKP1 (YGR179C);
                     ancestral locus Anc_5.181"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669753.1"
                     /db_xref="GeneID:11494881"
                     /db_xref="UniProtKB/TrEMBL:G0W9P9"
                     /translation="MSTQGKHNVLDAIIDDSLDNDDWIKAYTEPKLVRNKNTVSSNSE
                     NKIDLPVRPLKDLLPAVSSITSKPAEAGVKQLFHRDDDGEEEELVPQKGLINNASPRK
                     SSGKQLFVEDLDLSKTASMQSTDLPTIPVNSQNNNNNNNNNNNNKILDELENMSFEIP
                     DPKVSSPRSQPATKPIKSSISNSDSHIEEIPRLPSPLRNVYNKLPSLGGTIFQPAGGK
                     DLFSSPNNNYNDDNEDKKTVRFSPHGHEYIADQDNRNVNKFDWNIDIDETKINAWEFR
                     RLIRKNYIRRIPETANITPWKKPSKDLIHSIMQILEIDTKVAMDDVWEKYNLEVDNVT
                     FGKRKEIKKIHKMKEKLMGDILQKVKQRLRLSAFPVRLNGEDLDSEYIFAKRKYIKER
                     YNTEAESLKKFKLELKQAQKLLSERKALIETKRQNEEQEKEEQRTRNIEEERNKLHPI
                     LRDIDEYEPKKRKTDQYRKDLLDLNLELDKP"
     gene            <465684..>467906
                     /gene="NDAI0D01970"
                     /locus_tag="NDAI_0D01970"
                     /db_xref="GeneID:11494882"
     mRNA            <465684..>467906
                     /gene="NDAI0D01970"
                     /locus_tag="NDAI_0D01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669706.1"
                     /db_xref="GeneID:11494882"
     CDS             465684..467906
                     /gene="NDAI0D01970"
                     /locus_tag="NDAI_0D01970"
                     /inference="similar to DNA sequence:INSDC:YGR178C"
                     /note="similar to Saccharomyces cerevisiae PBP1 (YGR178C);
                     ancestral locus Anc_5.182"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669754.1"
                     /db_xref="GeneID:11494882"
                     /db_xref="InterPro:IPR009604"
                     /db_xref="InterPro:IPR025852"
                     /db_xref="UniProtKB/TrEMBL:G0W9Q0"
                     /translation="MKGNFNNKKSEPGGKSTGFFENGETTKNFNNRFDYLMTNSVGSN
                     VFVTVSSGITYEGLLVSCNLESQDGVDVVLKFPKVVNSSSKVDGDIEKLSNALGSTLI
                     INGSDVAELELKDIDLSLEEKSEHSQTPSTDGNKAKTTSPTASVLAAGSGEFKTDVDI
                     SSRKEFKQRELERWTPDEGSAHFAHNAQTLEEASSTWDQFAVNEAKFGVTNTFDEHFY
                     TTKINKNDPQYRQRLKEAERIAKEIESQGAQGNIHLAEDRGIIIDDSGMDEEDLYSGV
                     DRRGDELLASLKSNAKPITSKVNKYVPPTLRNQPHHMDPAIISSTTSTSKQMGNTSND
                     VKETVVLPPTNQEKVAKKEKSKHREGSKSKISSKEAQIEELKKFSEKFKVPYDVPTDM
                     KDIFKKQASVTTPSGLKTDPSLPPKPSMSTKANTPPVSKSDSKRNVGSSTHENQSGAK
                     GATHSRKRTPGSFFGSKKPTVSSAIKKDLFRRSFNMFIKAKENYDEKMKEKEEQESTV
                     DTTKKTKEDKVMEPFFIEKPYFTAPTWPNTIEKSYKDLFPDQKTLMQKAQVKMQQRAQ
                     MNQMPMASNMNPHLGVGMGAGMMRFQMGGPAPTSPMMNAAGFPGMYMPFQPQPPMFYP
                     PMGAPMMLPTGDMEGAELNGPPSQPVSPRIPPAYMAAAGGAPQTSPMGAFGYPGAAMP
                     FQPMMGASNGVVGGGMPRQYNQHGGNGGHHGRHNNYNSHGGNHHHNPHHNNNRTNNNN
                     "
     gene            <468576..>470192
                     /gene="NDAI0D01980"
                     /locus_tag="NDAI_0D01980"
                     /db_xref="GeneID:11494883"
     mRNA            <468576..>470192
                     /gene="NDAI0D01980"
                     /locus_tag="NDAI_0D01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669707.1"
                     /db_xref="GeneID:11494883"
     CDS             468576..470192
                     /gene="NDAI0D01980"
                     /locus_tag="NDAI_0D01980"
                     /inference="similar to DNA sequence:INSDC:YGR177C"
                     /note="similar to Saccharomyces cerevisiae ATF2 (YGR177C);
                     ancestral locus Anc_5.184"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669755.1"
                     /db_xref="GeneID:11494883"
                     /db_xref="GOA:G0W9Q1"
                     /db_xref="InterPro:IPR010828"
                     /db_xref="UniProtKB/TrEMBL:G0W9Q1"
                     /translation="MTATAVEIVPVLLEESLPVEVSTKLIERGHARRMGHLENYFALL
                     QRQELYTNFQIYGEFNEPVSDSQLRESLREILFKHPILAHTIIPKDQPDFRKWYQSEK
                     YLNTPYPLHDFIRILPELKLSDILINKQQEEYSDILPGILNEFESEKKITSSLLSRAS
                     CLRVPIYDPKRPNWRLLRLSPRQFIYVSNHCCSDAISGVNLFQDIAEHLSSSSTSSSF
                     PREDDKNDNNTIFNYNSDWKFFNKLYDPITDKIEYRPKVKALPKFACSIFVKSYLSYF
                     NWNGLPTMRVDQPLPLLHKQFQFQLLEFTNEELNTIRDKIKTMGCTFTPFLQACWFIA
                     MYKCGKVFNLKSWKEWAIDIAVPSSSRRFLIEEDDNSLKEMYKYGSNVGGFHYSYLIS
                     SFNIDRSENDKFFELVQYYQDGYSKSYENGDHLIGLGIMMMDGIVQRKNIDKMIKDDY
                     LNQTRAGVLFSNAGFFPQDESKKYHVTDLVFNQAQGSMKFSFGLNIASTNVNGLKISV
                     NVAEGTFDETADFAHLCNEFKANIVSFGGL"
     gene            <471241..>472719
                     /gene="NDAI0D01990"
                     /locus_tag="NDAI_0D01990"
                     /db_xref="GeneID:11494884"
     mRNA            <471241..>472719
                     /gene="NDAI0D01990"
                     /locus_tag="NDAI_0D01990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669708.1"
                     /db_xref="GeneID:11494884"
     CDS             471241..472719
                     /gene="NDAI0D01990"
                     /locus_tag="NDAI_0D01990"
                     /inference="similar to DNA sequence:INSDC:YGR175C"
                     /note="similar to Saccharomyces cerevisiae ERG1 (YGR175C);
                     ancestral locus Anc_5.185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669756.1"
                     /db_xref="GeneID:11494884"
                     /db_xref="GOA:G0W9Q2"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR013698"
                     /db_xref="UniProtKB/TrEMBL:G0W9Q2"
                     /translation="MVDPTLIDADNSITYDALVVGAGVIGPCVATALARKGKKVLIVE
                     RDWAMPDRIVGELMQPGGVRALRSLGMIQSINNIDAYPVTGYTVIFNGEKVDIPYPYK
                     ADVKPVEKLPDLVKDGNDKVLEDKTIHIKDYEEGERERGVAFVHGRFLNNLRNITAQE
                     KNVTRLQGDVIEILKNEAKEVIGAKVNIDGRGKVDFKAHLTFVCDGIFSHFRRELSPE
                     HVPTVGSSFVGMSLFDAKTPVPMHGHVILGTKHMPILVYQISPEETRILCAYNSPKLP
                     GDIKTWMANNVQAYIPESLRPSFDKALAQGKFRSMPNSYLSARQNNVTGLCVIGDALN
                     MRHPLGGGGMTVGLNDVVLLVEKIGDMDFSQREKILDELLDYHFQRKSYDSVINVLSI
                     ALYSLFAADNNNLRDLQRGCFKYFQRGGDCVKLPVEFLAGLMPNPFLLTRVFFAVVFY
                     TIYLKFEERGFLGLPFALLEGIMILLTAIKVFTPYLLGELIG"
     gene            <473175..>473615
                     /gene="NDAI0D02000"
                     /locus_tag="NDAI_0D02000"
                     /db_xref="GeneID:11494885"
     mRNA            <473175..>473615
                     /gene="NDAI0D02000"
                     /locus_tag="NDAI_0D02000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669709.1"
                     /db_xref="GeneID:11494885"
     CDS             473175..473615
                     /gene="NDAI0D02000"
                     /locus_tag="NDAI_0D02000"
                     /inference="similar to DNA sequence:INSDC:YGR174C"
                     /note="similar to Saccharomyces cerevisiae CBP4 (YGR174C);
                     ancestral locus Anc_5.186"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669757.1"
                     /db_xref="GeneID:11494885"
                     /db_xref="InterPro:IPR012420"
                     /db_xref="UniProtKB/TrEMBL:G0W9Q3"
                     /translation="MERPLWVRWLKVYAVGGVIIGTGLLLFKYTTPSDQQLIDSLSPQ
                     LRLQYEQEKKLRQAEQQELMKVVQKTAASNDPIWKTGPIQSPWETKTSSLSIDDKFQK
                     ANAEEAQRNELARIKKELNDLQVQSQMKTKEIVDEKTKNWWKFW"
     gene            complement(473800..473870)
                     /gene="NDAI0Dtrna6G"
                     /locus_tag="NDAI_0Dtrna6G"
                     /db_xref="GeneID:11494886"
     tRNA            complement(473800..473870)
                     /gene="NDAI0Dtrna6G"
                     /locus_tag="NDAI_0Dtrna6G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11494886"
     gene            complement(<474318..>475427)
                     /gene="NDAI0D02010"
                     /locus_tag="NDAI_0D02010"
                     /db_xref="GeneID:11494831"
     mRNA            complement(<474318..>475427)
                     /gene="NDAI0D02010"
                     /locus_tag="NDAI_0D02010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669710.1"
                     /db_xref="GeneID:11494831"
     CDS             complement(474318..475427)
                     /gene="NDAI0D02010"
                     /locus_tag="NDAI_0D02010"
                     /inference="similar to DNA sequence:INSDC:YGR173W"
                     /note="similar to Saccharomyces cerevisiae RBG2 (YGR173W);
                     ancestral locus Anc_5.178"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669758.1"
                     /db_xref="GeneID:11494831"
                     /db_xref="GOA:G0W9Q4"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR006074"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W9Q4"
                     /translation="MGVIEKIKAIEEEMARTQKNKATEHHLGLLKGKLARYRQQLLTD
                     EAGAAGGGGGSGFEVAKSGDARVVLIGYPSVGKSSLLGQITSTKSEIAHYAFTTLTSV
                     PGVLKYQGAEIQIVDLPGIIYGASQGKGRGRQVVATARTADLVLMVLDATKSEHQRES
                     LEKELEAVGIRLNKEKPNIYFKKKETGGVKVTFTAPPKKYLTEDGIKMILKDYRIHNA
                     DVLVRDDQCTIDDFIDILNDQHRNYVKCLYVYNKIDAVSLEEVDKLAREPNTVVMSCE
                     MELGIQDVVEEIWYQLNLSRVYTKKRGVRPKFDDPLVVRTNSTIGDLCHSIHRDFKEK
                     FKYALVWGSSAKHSPQKCGLNHKIDDEDVVTLFTK"
     gene            <475851..>476630
                     /gene="NDAI0D02020"
                     /locus_tag="NDAI_0D02020"
                     /db_xref="GeneID:11494887"
     mRNA            <475851..>476630
                     /gene="NDAI0D02020"
                     /locus_tag="NDAI_0D02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669711.1"
                     /db_xref="GeneID:11494887"
     CDS             475851..476630
                     /gene="NDAI0D02020"
                     /locus_tag="NDAI_0D02020"
                     /inference="similar to DNA sequence:INSDC:YGR172C"
                     /note="similar to Saccharomyces cerevisiae YIP1 (YGR172C);
                     ancestral locus Anc_5.177"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669759.1"
                     /db_xref="GeneID:11494887"
                     /db_xref="GOA:G0W9Q5"
                     /db_xref="InterPro:IPR006977"
                     /db_xref="UniProtKB/TrEMBL:G0W9Q5"
                     /translation="MSFYGNQVPPQQQPQNNMNAANAGGFYQPSNQFAFPQGSMSTYQ
                     TSASFMGNDTTSGGAMGVAPDPLPTGILNAFSTKGYPHEAPLLEEIGINFDHILAKTK
                     IVLIPTRSTASVSQEILHDSDLAGPLIFFLLFGLSLLTAGKIHFGYIYGVALFGTVSL
                     HNLSKLMCNMNTGTSLQFFNTASILGYCFLPLCFLSIIGIFHSLNDTMGYVLGCIFVL
                     WSTWSSSGFLNSLLELYNARALIAYPLLIFYSVFALMAIFV"
     gene            <476888..>478627
                     /gene="NDAI0D02030"
                     /locus_tag="NDAI_0D02030"
                     /db_xref="GeneID:11494888"
     mRNA            <476888..>478627
                     /gene="NDAI0D02030"
                     /locus_tag="NDAI_0D02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669712.1"
                     /db_xref="GeneID:11494888"
     CDS             476888..478627
                     /gene="NDAI0D02030"
                     /locus_tag="NDAI_0D02030"
                     /inference="similar to DNA sequence:INSDC:YGR171C"
                     /note="similar to Saccharomyces cerevisiae MSM1 (YGR171C);
                     ancestral locus Anc_5.176"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669760.1"
                     /db_xref="GeneID:11494888"
                     /db_xref="GOA:G0W9Q6"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014758"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="UniProtKB/TrEMBL:G0W9Q6"
                     /translation="MLKSSIFKSNITIQRKCYHLTKPTASHITTPIFYPNAKPHLGHL
                     YSSLLCDVFHRWNQMKNVPSLFTTGTDEHGLKIQMAAEKNGFTNPKFFVDKLYQDFIS
                     LDQHFNIKFTRFIRTTDPDHIKNVEQLWNLCLNNGFIYKGEHNGWYSISDETFYPESK
                     IIKDPHNNDKYINTETNNEVFFQSEENYFFKLSTFQEKLIHLISDPNSKFQIYPESKR
                     KQILKELQNGTPLQDLSISRSSSRLKWGIQVPNDPSQKIYVWFDALCNYITSIGGINA
                     LLITRNTSSGNTTTEPTTIHEGIDSKVWWSNTTHLIGKDIMKFHTVYWPSFLMAAGLP
                     LPKQVVIHNHWISDGLKMSKSLGNVVDPIMMANKYGADIVRWYLLENSKLDEDGDFQE
                     LKLKSLRSLLVSKWGNLINRCCGKKFNISRAVQIFTSTENSQDVLSICDDDPELQTAM
                     KNIISELEELPMLMDTKLVCFEPGAALRKIWSIINFANTFVQIAAPWNKTGIQQDVVI
                     FLCMETSRIIAILTQPIIPDLSKHLLDFMKVSNDRRSLSFAKLKTDDSYGFNMNDKSD
                     DVPIPREVESITV"
     gene            complement(<478943..>482386)
                     /gene="NDAI0D02040"
                     /locus_tag="NDAI_0D02040"
                     /db_xref="GeneID:11494889"
     mRNA            complement(<478943..>482386)
                     /gene="NDAI0D02040"
                     /locus_tag="NDAI_0D02040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669713.1"
                     /db_xref="GeneID:11494889"
     CDS             complement(478943..482386)
                     /gene="NDAI0D02040"
                     /locus_tag="NDAI_0D02040"
                     /inference="similar to DNA sequence:INSDC:YGR170W"
                     /note="similar to Saccharomyces cerevisiae PSD2 (YGR170W);
                     ancestral locus Anc_5.174"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669761.1"
                     /db_xref="GeneID:11494889"
                     /db_xref="GOA:G0W9Q7"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR003817"
                     /db_xref="UniProtKB/TrEMBL:G0W9Q7"
                     /translation="MRLTNRHRNGQKSRKSVLTLKIQVIQARNIDIIKKFDCSPVCFV
                     GTNINSYAKTNKLKNSNTKWNESIKLKLPRNPNSEWLHLAMYDALPPIDQHIYNKPLY
                     PSSMLLNSPSVSTISLNSQISSSRHGNESNTRDNISPTNTNFNREIDSTQSYSKTSNY
                     LYIGEVSISLLDLFQNADSSTSYTFQIAPKWFTLYDKRRGKNKDLPVGDIKLGFLLES
                     SSKHKVTFKAFNEWKSQLIGNLESRKFLHDARSSRTSVHNLKSISEDKIMNDINEGQP
                     YTRSSNDDSLQLTSSSNSQDQINQVESVLDTDHDLISVASSIFEQNDEDEDEDGDYDD
                     DENSDYDTSRFDLGNGNRQLEVVGDEDIDPISESEDINDELEMTELAELYQLEGAALD
                     LRSMVTALDEYDVVYPNNKMYEPPEHKEKRNDISDVYPSYASSYKVADDEDEKATLEE
                     SRSISFDSIGNRFLHLKRRKRIGMGKKSLMPHNRHTTFHVSKKLHATGMIFIKLDKIR
                     NLPQLRNKISRTNYFMDPFIITTFGRRVFKSSWKKHDLNPIFNEYIVFEIYPTEMDYG
                     FHFKVIDKDSFSSNDEIAECSLTWKEMINSQATTPEWSKFELPLIMNDHLLVDNINPL
                     LSIDVKFIPYQQLIKYFWEQSVPMQTYKENYDIIDLMMYLEQLGSFSDEDALDFFRYF
                     GKLAWKGETLTRKQLIEGFQTWNKTANFRHVWKCPSCFRSCHPTRGTRNSKLIIENDL
                     ISHFARCTFSISHRILQPSYVSSSFASKRWFSKMLIKLTYGKYVLGSNNANILVEDRD
                     TGIIIEEKISAHVKLGMRIIYNGKGKESKKFKSLLKSMSIRQGRKFDSPVSVKQIKPF
                     IEFHSLDLSDCLDTEYKTFNEFFYRKLKPGSRLPESNDPRVLISPADSRCTMFSTVHQ
                     SKEIWIKGDKFSIGRLTQNHRLDMFNDKSCSLGIFRLAPQDYHRFHSPCNGKILKPIY
                     VEGNYYTVNPMAVRSELDIFGENVRVIVPIESPEFGTILFIPIGAMMVGSIILTVEES
                     ETVVRGQELGYFKFGGSTIVIVIPSQKVILDSDLLKNSSEGIETLVKVGMSIGHTGDI
                     LELKRKRIKIDDPKQIEQIKRTISVTDENAEQLGNVPWQYHEYRKFIDENVDSSTDDI
                     S"
     gene            <482957..>483229
                     /gene="NDAI0D02050"
                     /locus_tag="NDAI_0D02050"
                     /db_xref="GeneID:11494890"
     mRNA            <482957..>483229
                     /gene="NDAI0D02050"
                     /locus_tag="NDAI_0D02050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669714.1"
                     /db_xref="GeneID:11494890"
     CDS             482957..483229
                     /gene="NDAI0D02050"
                     /locus_tag="NDAI_0D02050"
                     /inference="similar to DNA
                     sequence:INSDC:YGR169C-A,YJR005C-A"
                     /note="similar to Saccharomyces cerevisiae YGR169C-A and
                     YJR005C-A; ancestral locus Anc_5.173"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669762.1"
                     /db_xref="GeneID:11494890"
                     /db_xref="UniProtKB/TrEMBL:G0W9Q8"
                     /translation="MGKRFSESAAKKVAGMAKKAENAKIKARAERERKEAEEASKWTQ
                     GAKSNQRKLEEEQKKQEKLKAKKEREALLAAEEEELEKAGKGKRRN"
     gene            <483598..>484818
                     /gene="NDAI0D02060"
                     /locus_tag="NDAI_0D02060"
                     /db_xref="GeneID:11494891"
     mRNA            <483598..>484818
                     /gene="NDAI0D02060"
                     /locus_tag="NDAI_0D02060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669715.1"
                     /db_xref="GeneID:11494891"
     CDS             483598..484818
                     /gene="NDAI0D02060"
                     /locus_tag="NDAI_0D02060"
                     /inference="similar to DNA sequence:INSDC:YGR169C"
                     /note="similar to Saccharomyces cerevisiae PUS6 (YGR169C);
                     ancestral locus Anc_5.171"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669763.1"
                     /db_xref="GeneID:11494891"
                     /db_xref="GOA:G0W9Q9"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:G0W9Q9"
                     /translation="MTGEVYFANGLRKLRPYYNTRTSFVKGRWLGKPLVDVLTKEFRL
                     YPREHYVSEINKNHFKIIRDDIPLKPTEVFESAIKNKDIIETISHKHEPPVRQWCNEQ
                     EEAEDNKNRIAGFDIVHEDADILVINKPNGIPIHPTGQFYQNTITEILKSHDKPVLPC
                     YRLDKVTSGLLIMAKNKIAAGKVQSKIRARDMSKLYLARVQGKFPNVPERSMIINNTI
                     NDASIMFDDSTIVTTVDSHVYTIEPKKQFPAGLSMSREAITLFYPLSYLPKENQSVVV
                     CKPLTGRTHQIRIHLARLGFPIVNDSMYNEAKATYPERLKFMLDYGNWESSGLSTEHL
                     SKKFAEFVAEVREAHDLKSAGKLNKFRCGECGCWEMDDPPVEDLVLWLHAWKYSDSEG
                     TFSFETKLPLWACA"
     gene            <485170..>485588
                     /gene="NDAI0D02070"
                     /locus_tag="NDAI_0D02070"
                     /db_xref="GeneID:11494892"
     mRNA            join(<485170..485177,485267..485347,485459..>485588)
                     /gene="NDAI0D02070"
                     /locus_tag="NDAI_0D02070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669716.1"
                     /db_xref="GeneID:11494892"
     CDS             join(485170..485177,485267..485347,485459..485588)
                     /gene="NDAI0D02070"
                     /locus_tag="NDAI_0D02070"
                     /inference="similar to DNA sequence:INSDC:YCL005W-A"
                     /note="similar to Saccharomyces cerevisiae VMA9
                     (YCL005W-A); ancestral locus Anc_1.413"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669764.1"
                     /db_xref="GeneID:11494892"
                     /db_xref="GOA:G0W9R0"
                     /db_xref="InterPro:IPR008389"
                     /db_xref="UniProtKB/TrEMBL:G0W9R0"
                     /translation="MSFYTVLGVLFTVIIISVVFWVLAPKENQTVWRSTVTLSLAMMF
                     LMWAITYLTQLHPLIEPRRSDLRPEFVE"
     gene            <486339..>487487
                     /gene="NDAI0D02080"
                     /locus_tag="NDAI_0D02080"
                     /db_xref="GeneID:11494893"
     mRNA            <486339..>487487
                     /gene="NDAI0D02080"
                     /locus_tag="NDAI_0D02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669717.1"
                     /db_xref="GeneID:11494893"
     CDS             486339..487487
                     /gene="NDAI0D02080"
                     /locus_tag="NDAI_0D02080"
                     /inference="similar to DNA sequence:INSDC:YGR168C"
                     /note="similar to Saccharomyces cerevisiae YGR168C;
                     ancestral locus Anc_5.169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669765.1"
                     /db_xref="GeneID:11494893"
                     /db_xref="UniProtKB/TrEMBL:G0W9R1"
                     /translation="MSKNNNKNESRILRNIIPIIINSRATSTLSIILKRIIPTIISAV
                     TVSAIKWKRGNLGSLPIGRRKQVLLIWLRNTGSLIILNALFPILKKYVKYNTIIWSII
                     TAFASVISSNIPAELVSYVLIESIFDHMKIYLKKFDEHFRRRIRQILTCILLPILWDK
                     YKGSNRTEVPSLFKLIFNHRPILSDFLLYYLLWNIKSFYKYIKSLLFDAGPHSRPSSS
                     SSNSSNNTSHFMMYYNNHDELPTVSSTLRPVIHKLGEMYELASNNDNVSKHGALLERI
                     FSSSFVTNIQPCIQWCLWKLLLVHTLRLNSKNCSTIIKSQANIMKSMTLILGIFVLDR
                     NNNTMNIRTEVIRYFLNILLNFRISKLYEPERKVLLFCASLLAFKNNA"
     gene            complement(<487626..>488330)
                     /gene="NDAI0D02090"
                     /locus_tag="NDAI_0D02090"
                     /db_xref="GeneID:11494894"
     mRNA            complement(<487626..>488330)
                     /gene="NDAI0D02090"
                     /locus_tag="NDAI_0D02090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669718.1"
                     /db_xref="GeneID:11494894"
     CDS             complement(487626..488330)
                     /gene="NDAI0D02090"
                     /locus_tag="NDAI_0D02090"
                     /inference="similar to DNA sequence:INSDC:YGR167W"
                     /note="similar to Saccharomyces cerevisiae CLC1 (YGR167W);
                     ancestral locus Anc_5.168"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669766.1"
                     /db_xref="GeneID:11494894"
                     /db_xref="GOA:G0W9R2"
                     /db_xref="InterPro:IPR000996"
                     /db_xref="UniProtKB/TrEMBL:G0W9R2"
                     /translation="MSDKFPALDHDEQIIPDDVSDDNNINNDVEVSNDNENNDETAFL
                     KREAEVLGDEFKTEQDDDLLDPVDAHEEIENFQDQYPDINDVSAGNVDINENIVKNES
                     HLESATKSQQATPSGPSEAVTQWRENRANAIREKDEADYKEKASLQEEATEYILNFYE
                     EYNAKKEKQIEITQKESEEFLQHRDEFFAQDNTTWDRVLQLINLDDADVFAGRDRSKF
                     KEILLKLKGKTEVPGA"
     gene            complement(<488629..>490311)
                     /gene="NDAI0D02100"
                     /locus_tag="NDAI_0D02100"
                     /db_xref="GeneID:11494895"
     mRNA            complement(<488629..>490311)
                     /gene="NDAI0D02100"
                     /locus_tag="NDAI_0D02100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669719.1"
                     /db_xref="GeneID:11494895"
     CDS             complement(488629..490311)
                     /gene="NDAI0D02100"
                     /locus_tag="NDAI_0D02100"
                     /inference="similar to DNA sequence:INSDC:YGR166W"
                     /note="similar to Saccharomyces cerevisiae KRE11
                     (YGR166W); ancestral locus Anc_5.167"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669767.1"
                     /db_xref="GeneID:11494895"
                     /db_xref="InterPro:IPR024662"
                     /db_xref="UniProtKB/TrEMBL:G0W9R3"
                     /translation="MELNIPLDGSIPSANSEAIKTSHSLRKFIIFDENLKVVLRLRKK
                     ANVDLSNIVIDSLTVKINGTRVWHSIGDEVFDLILPESTDDELIWEMKSNISTDHMFR
                     SSVVMNNGSSNNIIVVVKYSYKQAAYSENNISQEKNIATENEEELENGILESFEPTYS
                     WHQSKKSNMKNIQEEPAKGTEKLAITGGGKGLVTRNEVVQLQYPIFSLLNMRLRNASI
                     KSQSSILSSLDFQTSNMSMQLADIYFKNQSEFELFFKDVIFELIDQNGQIKLDHISNF
                     EIPFKATLYDSFSICYKLPLIPRSPSSNNTTLPNINGSSTSGFFSSSASSMLLPSTHR
                     VRVTLIYELNLPHERTKIPIMTKWETDVTLKKQPTVPNNSMLTNTQKRFYGVATSSSR
                     FSIQSTTSLVNNKVNNVKFKFINNNLKVLKGEKFTLRLQIINSSSTALNLVVYYNNTV
                     SNNPSTMTTTSAGNMKGTNNFERFPTPGIKLSLEKQIEMRRLNTQSSQGIILLSNDYN
                     IPVIGPQESYFVDLRLIGIMSGYYSNLSGLKILDLNSNEVIEVGMGASVLVQ"
     gene            complement(<490893..>491954)
                     /gene="NDAI0D02110"
                     /locus_tag="NDAI_0D02110"
                     /db_xref="GeneID:11494896"
     mRNA            complement(<490893..>491954)
                     /gene="NDAI0D02110"
                     /locus_tag="NDAI_0D02110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669720.1"
                     /db_xref="GeneID:11494896"
     CDS             complement(490893..491954)
                     /gene="NDAI0D02110"
                     /locus_tag="NDAI_0D02110"
                     /inference="similar to DNA sequence:INSDC:YGR165W"
                     /note="similar to Saccharomyces cerevisiae MRPS35
                     (YGR165W); ancestral locus Anc_5.166"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669768.1"
                     /db_xref="GeneID:11494896"
                     /db_xref="InterPro:IPR021036"
                     /db_xref="UniProtKB/TrEMBL:G0W9R4"
                     /translation="MLLGAEPLGTRSMVAVNILQQTRNISRRRIAYPFYPFKRLTKQN
                     PKKHDTNLKYAMRQFLGPKNYKGEYVMNKYFSVPRNHVPNYIKPNVERGQTLINPITG
                     KTVIQNTNGKFIEIPQQEQYDGRGNNPNFRFNPDKELQPFPSNPHCKTNYIISDELKG
                     EIVNMISNDGFSTQQVSQKLGIKIPRIEAILKLSQIEKKWEAQNRINSNLKEFSNTMF
                     NMFPIFKPEIKRENLSEIPVPEKTLSSRFVTLSESEPFGPVDAAELLELEPAVKTLEQ
                     LATTGEHSQGHLEVLQNKKLNNKKRIVLGEVREGDRSVFKFVDSKVGQVGFRYGAGNR
                     DSKKDRKVGFNEAGQMVYI"
     gene            <492358..>494430
                     /gene="NDAI0D02120"
                     /locus_tag="NDAI_0D02120"
                     /db_xref="GeneID:11494897"
     mRNA            <492358..>494430
                     /gene="NDAI0D02120"
                     /locus_tag="NDAI_0D02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669721.1"
                     /db_xref="GeneID:11494897"
     CDS             492358..494430
                     /gene="NDAI0D02120"
                     /locus_tag="NDAI_0D02120"
                     /inference="similar to DNA sequence:INSDC:YJL019W"
                     /note="similar to Saccharomyces cerevisiae MPS3 (YJL019W);
                     ancestral locus Anc_5.165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669769.1"
                     /db_xref="GeneID:11494897"
                     /db_xref="InterPro:IPR012919"
                     /db_xref="UniProtKB/TrEMBL:G0W9R5"
                     /translation="MVLSTLEMNHTKDIDEESMELSKEPNGLRSQNYTLNALLHCDEG
                     YNEDLDPDYDSYCSDYVLNNEFEDDELSSNTESSGNGHSYDESDTASSSQESIGDSSL
                     EDVSDMDIEEGGEGFQGYMDILNSLNLRNILIFLFLITSIYMGRWIYFRYRNDEAIFN
                     DGGMLENFNPSSRSPPVSFLNLQKQINTLYHDLNKRDDKITNDFDKSVKIVISQFEKN
                     LRNLLPVDLVDFKSQLDSLKGQVNNLSSIISNWQENEPPSVHDFIKRNRSSPFSMENI
                     TKFQNSLIQELEKSLPNEIPIIMKGNNNNATTENSTAFLIIPELHSYITDLVAQTLNT
                     SRDNLDEISKKWEYNMDTYITEYLTNELKYVNKHDFLAELNSKLESNKLEIFEEMNNK
                     LNDIRFQNDQSAFPQYSNSMLKKLVYDIYNSNMHQWQHDLDFASIFQGTRLLNHMTSN
                     TWKNGNGILPIELLKPSKLLSSTYWQCANENGNSKSGYKCSWAIRFQEPIYLTKISYV
                     HGRFLNNLHMMNSAPRLISLYVRLTNNKDTEELIRRAKKHNQGQTFVKSYDYIKISQH
                     TYSIDDLETRQTFPLPKWYIEMKPLVHSLVFQIDDNYGNEKYTSLKKFLINGLTREDL
                     NILKNNNGALRKSVKTVPDYIHQKVKNPTSQDTSSGNGSPLKIESSKLNPVMQGKVPA
                     FGEDELDV"
     gene            <494918..>496525
                     /gene="NDAI0D02130"
                     /locus_tag="NDAI_0D02130"
                     /db_xref="GeneID:11494898"
     mRNA            <494918..>496525
                     /gene="NDAI0D02130"
                     /locus_tag="NDAI_0D02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669722.1"
                     /db_xref="GeneID:11494898"
     CDS             494918..496525
                     /gene="NDAI0D02130"
                     /locus_tag="NDAI_0D02130"
                     /inference="similar to DNA sequence:INSDC:YJL014W"
                     /note="similar to Saccharomyces cerevisiae CCT3 (YJL014W);
                     ancestral locus Anc_5.163"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669770.1"
                     /db_xref="GeneID:11494898"
                     /db_xref="GOA:G0W9R6"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012719"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:G0W9R6"
                     /translation="MQAPVVFMNTNQERTFGRQAQISNITAAKAVADVIRTCLGPKAM
                     LKMLLDPMGGLVLTNDGHAILREIDVAHPAAKSMLELSRTQDEEVGDGTTTVIILAGD
                     ILAQCAPYLIEKNIHPVIIIQALKKALSDALEVIKQVSKPVDVENDEAMKKLIQASIG
                     TKYVSHWSEKMCELALSAVKIVRVDLGQTIEGTPNFEIDIKRYVRVEKIPGGEVLDSN
                     VLNGVMLNKDVVHPKMSRHIENPRIVLLDCPLEYKKGESQTNIEITNDEDWNRILQIE
                     EEQVQLMCEQILAIKPDVVITEKGVSDLAQHFLLKGGCSVLRRVKKSDNNRIARVIGA
                     TIVNRVEDLKESDVGTQCGVFKVELIGDEYFTFLDDCKEPKACTILLRGGSKDILNEI
                     ERNLDDAMAVTRNVMLSPSLSPGGGATEMAVSLKLAEHAKQLEGIQQWPYQAVADAME
                     CIPRTLIQNAGGDPIRVLSQLRAKHAQGNFTMGIDGDAGKVVDMVDYGIWEPEVIKQQ
                     SIKTAIESACLLLRVDDIVSGVKREEQ"
     gene            complement(<496708..>499785)
                     /gene="NDAI0D02140"
                     /locus_tag="NDAI_0D02140"
                     /db_xref="GeneID:11494899"
     mRNA            complement(<496708..>499785)
                     /gene="NDAI0D02140"
                     /locus_tag="NDAI_0D02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669723.1"
                     /db_xref="GeneID:11494899"
     CDS             complement(496708..499785)
                     /gene="NDAI0D02140"
                     /locus_tag="NDAI_0D02140"
                     /inference="similar to DNA sequence:INSDC:YGR188C,YJL013C"
                     /note="similar to Saccharomyces cerevisiae BUB1 (YGR188C)
                     and MAD3 (YJL013C); ancestral locus Anc_5.162"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669771.1"
                     /db_xref="GeneID:11494899"
                     /db_xref="GOA:G0W9R7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR012572"
                     /db_xref="InterPro:IPR013212"
                     /db_xref="InterPro:IPR015661"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0W9R7"
                     /translation="MNHTLIPSNQLDTNGNQRDPSTDKNGDYFKMNSIAFQQELNDVK
                     LHFERKLLNELEDMDDPLELFLDYLGALSQLIPENNQFLIELIERSLLYLRDIDTYQN
                     DPRYLQLWHKYIDFLDRQQSVDNLEEIFNVLKYMFSLHIGYKLALFYEYFSTYLFQVD
                     RFIEAHYILEVGIKRRARPLNRLLITLHELESKLRNLNPNFNIELPIQLEFLERFREP
                     SFVTRRSTSSFVENAQKTYLVKQEQLVNRPLQWELYREERGFVPRVNKVVEGKVSRIK
                     SALVIADNVETETKPVKLPIFADSQEKISEVDNEKVYKIIENPGRKPEKIDCNFSLLY
                     LDNQEYAVEEILAMSRNYYFTQKKESFAHNDENIDRSISQPPSHQNKRRRKALGEKRP
                     EMYASQPDVSIAPLSTGNLGGDTNVFNAQGTNPSEYVNITKTSILPLNDSNKINVENE
                     NQSVPDNYKVPNSPTVTMVSKNAINEVYSMFNQNYKETDSVADVDDTGKYSLYDNGTH
                     EFTRQNIDDLTEVKNSKPHVTDTAINNNNTTTTATTNNNDTQQTQDYVDDNNTGATTY
                     RSKLSNYMTPIQEKTEHTFQSMNGTQQDSFPRSEPNTTQSSPFLTQPQANHNGMVPND
                     QMSLLPPPANTISKNEHIIEHPLDLKLRHKLLDSINPPLENYSTYYHYNQSLNMSSLL
                     KKIHKESMNENKNPIVDFKKTGDLYCIRAELGEGGYATVYLAESATGNLRALKVEKPA
                     SVWEYYILKQIEDRLNGLNILNSIINANSLHCFTDESYLVLNYANQGTILDLINYQKE
                     KFQNTVDESLCMFITIELIKVLEYVHEIGIIHGDLKPENCMIRFQEGHLGSYNATGLD
                     GWDKKGIYLIDFGRSFDLSLFPSDTKFKADWKTDKQDCYEMQSGKSWTYEADYYGLAG
                     IIHAMLFGSLIDPIQSSNGYFKVKNPLKRYWAKDIWNSAFDVLLNSGTFNEFPLSSTM
                     KSIRQRMEEHLSGSGLGDQLRSIILDLESELSIFKNKTIRGINKSKGKRKPTL"
     gap             501898..502177
                     /estimated_length=280
     gene            complement(<502926..>504308)
                     /gene="NDAI0D02150"
                     /locus_tag="NDAI_0D02150"
                     /db_xref="GeneID:11494900"
     mRNA            complement(<502926..>504308)
                     /gene="NDAI0D02150"
                     /locus_tag="NDAI_0D02150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669724.1"
                     /db_xref="GeneID:11494900"
     CDS             complement(502926..504308)
                     /gene="NDAI0D02150"
                     /locus_tag="NDAI_0D02150"
                     /inference="similar to DNA sequence:INSDC:YGR189C"
                     /note="similar to Saccharomyces cerevisiae CRH1 (YGR189C);
                     ancestral locus Anc_5.159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669772.1"
                     /db_xref="GeneID:11494900"
                     /db_xref="GOA:G0W9R8"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR017168"
                     /db_xref="UniProtKB/TrEMBL:G0W9R8"
                     /translation="MVKINTLLSAFAATTLYSTLGLADSCNPIKSSNCPADKALATSF
                     SEDFNSESKWFSSINNPGKITYGDDGVTLTIEKQLDNPSLKSNFYIMYGRLEVVAKAA
                     PGTGIISSVFLQSDDLDEIDIEWVGGDTTQVQSNYFSKGNVETYDRGAFHPVSSPQTE
                     YHTYAVDWTQEQLTWYVDGVAVRVLPNTSSEGYPETPMYVSIGVWAGGDPSNAPGTIE
                     WAGGLTDYSQLPFSLNVKSIKIADYSTGSELFLIVXXIQAKDGAINDRYAEAQEGFDS
                     LVSGQNTESTSSTSASTSTSSSFSTAASTTSSSSSIHFSSSSSSITSTSKSTSTLSSF
                     TLKSSRSSSTSTSSSTRLTTKIASNATSSTTTKTSLESTSEKKTPTTTSKAITTSKAQ
                     STTQKTSEVKTSESKTPLAPSQSTLLTKEQSASSTSSTPVSIFSANNGQSYKGFSLSS
                     LFISFIIALF"
     gene            complement(504826..504897)
                     /gene="NDAI0Dtrna5W"
                     /locus_tag="NDAI_0Dtrna5W"
                     /db_xref="GeneID:11494960"
     tRNA            complement(join(504826..504862,504826..504897))
                     /gene="NDAI0Dtrna5W"
                     /locus_tag="NDAI_0Dtrna5W"
                     /product="tRNA-Trp"
                     /note="codon recognized: UGG"
                     /db_xref="GeneID:11494960"
     gene            <505202..>506965
                     /gene="NDAI0D02160"
                     /locus_tag="NDAI_0D02160"
                     /db_xref="GeneID:11494829"
     mRNA            <505202..>506965
                     /gene="NDAI0D02160"
                     /locus_tag="NDAI_0D02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669725.1"
                     /db_xref="GeneID:11494829"
     CDS             505202..506965
                     /gene="NDAI0D02160"
                     /locus_tag="NDAI_0D02160"
                     /inference="similar to DNA sequence:INSDC:YGR191W"
                     /note="similar to Saccharomyces cerevisiae HIP1 (YGR191W);
                     ancestral locus Anc_5.158"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669773.1"
                     /db_xref="GeneID:11494829"
                     /db_xref="GOA:G0W9R9"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:G0W9R9"
                     /translation="MSKNPLRNGPLNKIVNGFKSAEDEKSILEGKSSTQSSLLDLTLK
                     KCDNGIEVVNDATSTVSNASVTNVNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALAS
                     GGPASLVIDWVIISTCLFTVINALGEMAAAFPVVGGFNVYITRFVDPSVGFAVNINYL
                     AQWLVLLPLELVAASMTIKYWNDTINSDAWVAIFYAVIAFANMLEVKSFGETEFVLSM
                     VKILAIIGFTILGIVLSCGGGPQGGYLGGKYWHNPGSFVGHTSGTKFKGLCSVFVTAA
                     FSYSGIEMTAVSAAESKDPRRTIPKAAKRTFWLITASYITILTLIGCLVPYDEPRLLS
                     GSSSVDAASSPLVIAIENGGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIG
                     NLPQVLKHIDKKGRPVNAILFTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMA
                     INISHIRFRQAMKKQRKSLDELPYLSQTGVWGSWYGVIVLFLVLIVSFWTSLFPLGGS
                     GADAESFFQGYLSFPILIACYVGHKLVYRKKQIVVALEDMDIDTGRRQVDLTIRRQEM
                     KEEQEHLAKSSFFARFLHVWC"
     gene            complement(<507374..>508372)
                     /gene="NDAI0D02170"
                     /locus_tag="NDAI_0D02170"
                     /db_xref="GeneID:11494902"
     mRNA            complement(<507374..>508372)
                     /gene="NDAI0D02170"
                     /locus_tag="NDAI_0D02170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669726.1"
                     /db_xref="GeneID:11494902"
     CDS             complement(507374..508372)
                     /gene="NDAI0D02170"
                     /locus_tag="NDAI_0D02170"
                     /inference="similar to DNA sequence:INSDC:YGR192C,YJR009C"
                     /note="similar to Saccharomyces cerevisiae TDH3 (YGR192C)
                     and TDH2 (YJR009C); ancestral locus Anc_5.155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669774.1"
                     /db_xref="GeneID:11494902"
                     /db_xref="GOA:G0W9S0"
                     /db_xref="InterPro:IPR006424"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020828"
                     /db_xref="InterPro:IPR020829"
                     /db_xref="InterPro:IPR020830"
                     /db_xref="InterPro:IPR020831"
                     /db_xref="UniProtKB/TrEMBL:G0W9S0"
                     /translation="MVSVAINGFGRIGRLVLRVAMARKNVEVLAINDPFITNDYAAYM
                     FKYDSTHGRYAGEVTHDDKHIIIDGVKIATFQERDPANLPWASLKVDIAIDSTGVFKE
                     LDTCQKHLDAGAKKVVITAPSSTAPMFVMGVNEDKYTSDLKIVSNASCTTNCLAPLAK
                     VINDAFGIEEGLMTTVHSQTATQKTVDGPSHKDWRGGRTASANIIPSSTGAAKAVGKV
                     LPELQGKLTGMAFRVPTVDVSVVDLTVKLNKETTYDEIKKVIKEASEGKMAGILGYTE
                     DAVVSSDFLGDARSSIFDAAAGIQLSPKFVKLVSWYDNEFGYSTRVVDLVEHVAKA"
     gene            complement(<509269..>510492)
                     /gene="NDAI0D02180"
                     /locus_tag="NDAI_0D02180"
                     /db_xref="GeneID:11494903"
     mRNA            complement(<509269..>510492)
                     /gene="NDAI0D02180"
                     /locus_tag="NDAI_0D02180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669727.1"
                     /db_xref="GeneID:11494903"
     CDS             complement(509269..510492)
                     /gene="NDAI0D02180"
                     /locus_tag="NDAI_0D02180"
                     /inference="similar to DNA sequence:INSDC:YGR193C"
                     /note="similar to Saccharomyces cerevisiae PDX1 (YGR193C);
                     ancestral locus Anc_5.153"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669775.1"
                     /db_xref="GeneID:11494903"
                     /db_xref="GOA:G0W9S1"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="UniProtKB/TrEMBL:G0W9S1"
                     /translation="MSLRSLSSLCTHLRLCTRKISYNARLFEATKFGMPAMSPTMEKG
                     GIISWKFKEGDSFSAGDVLLEVETDKAQIDVEAQDDGKLAKIIANDGTKDVNVGEVIA
                     YLAEPDDDLSTLKLPDEGAPEENVQDNTNDKQSNTNEVSAPESSVQEKNNQNEVHKQE
                     STSTDTNVNQVLFPSVSLLMAQNNIQVEDVLGKIKPSGRNGTILKGDVLAYLGKISKD
                     SVANIANYVKKSEKLDLSTIELMLPSKISEREESVGAKIEKKRQPELLHYDLIINVSR
                     GTTSEALNESISSYIQKYYCRSHKEPLMDVKSKNYSPLFEDLIKVEPKNIRFTVDYKL
                     SPLEKESKSKRQDDILNLLANNKEETCIDEFKEQRTSMPYALLLDVTVSPKYDDSKRR
                     AEEFIKYIKQLESEV"
     gene            complement(<510934..>512685)
                     /gene="NDAI0D02190"
                     /locus_tag="NDAI_0D02190"
                     /db_xref="GeneID:11494904"
     mRNA            complement(<510934..>512685)
                     /gene="NDAI0D02190"
                     /locus_tag="NDAI_0D02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669728.1"
                     /db_xref="GeneID:11494904"
     CDS             complement(510934..512685)
                     /gene="NDAI0D02190"
                     /locus_tag="NDAI_0D02190"
                     /inference="similar to DNA sequence:INSDC:YGR194C"
                     /note="similar to Saccharomyces cerevisiae XKS1 (YGR194C);
                     ancestral locus Anc_5.152"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669776.1"
                     /db_xref="GeneID:11494904"
                     /db_xref="GOA:G0W9S2"
                     /db_xref="InterPro:IPR018484"
                     /db_xref="InterPro:IPR018485"
                     /db_xref="UniProtKB/TrEMBL:G0W9S2"
                     /translation="MMEKQAYYLGFDLSTQQLKCLAINQDLKIIHSETVEFEKELPHY
                     NTKKGVYLHEDEVASPVFMWLEAIDLVFMKYVNSGFNLGKVKAISGSAQQHGSVYWTT
                     EADFLLQSLSDNHDKSLLSVLAPNAFSWELSPNWQDHSTGSQCTEFEKKVGGPKQLAS
                     LTGSKAHYRFTGPQIMKFVGKNPEGYERTKTISLVSNFLSSILCGKLVPLEEADACGM
                     NLYDIKEHKFDEGCLSLIDKDTNNIRRKLMDPPTRCPEPICLGNISQYFVKKYGFQSN
                     CSIYPITGDNLATICSLPLKTNDILVSLGTSTTVLLVTDHYNPSPNYHLFIHPTIANN
                     FMGMICYCNGSLAREEIRDELNKSAGLTNSSWDLFDKAVLADDIHTDNELGLYFPLGE
                     IVPSTKATYKRIELDPKTKLISKIVPKFQDIRHDAKNIVESQALSCRIRIYPLLSSDA
                     EHSRETSDNIHTKVKFDGSELPLSEYLNKRPNRAFFVGGASKNDSIVRKFAQVIGAKE
                     ANYRLDTPNSCALGGCFKAIWSHLVVTGRIDDPFSVYLEAHFLWDELDRFYEPDQEAW
                     EMYNKKIEAMSNLEALL"
     gene            complement(<513101..>515776)
                     /gene="NDAI0D02200"
                     /locus_tag="NDAI_0D02200"
                     /db_xref="GeneID:11494905"
     mRNA            complement(<513101..>515776)
                     /gene="NDAI0D02200"
                     /locus_tag="NDAI_0D02200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669729.1"
                     /db_xref="GeneID:11494905"
     CDS             complement(513101..515776)
                     /gene="NDAI0D02200"
                     /locus_tag="NDAI_0D02200"
                     /inference="similar to DNA sequence:INSDC:YGR196C"
                     /note="similar to Saccharomyces cerevisiae FYV8 (YGR196C);
                     ancestral locus Anc_5.145"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669777.1"
                     /db_xref="GeneID:11494905"
                     /db_xref="InterPro:IPR026248"
                     /db_xref="UniProtKB/TrEMBL:G0W9S3"
                     /translation="MAHTLRDIYLSSVIPISLTSITKFIPTGSSYLVTILHNDKNYPT
                     PIYLLSDKLLLDLFIINMSSDNISRKKSYRWASATQTSYDGADWDSSDDDDTGTTKRE
                     IDTGKPRLPSLPKLNYSNEDMEKENNELPTPGIKTNREESSSYLETPTLNRGEDLIPK
                     RNSPVRAVNDDLDNLMLQISKEMTPKIGNESVFVDQPISDDNSKSNTPYFNASASIGD
                     SKSDLNMARHEALETNVKQEEDEEKGDEDDDDDISIPEKGFFSKYIESEEAHETNDGI
                     NNNEVTSIISNEGLPIENSVTTDVAEQDGEVAPEQDKESSDMIYKNEKNETTDIRPRK
                     PSNGDINEFQEGGSAHHQIESDISEGKGEARITEQNSKIEDRKGRLPIEKKTYAYGTG
                     QHQENESVHDEGEDKDDETYDDSDDSYLDRLSYTKSIKYTTRNPSTNFSSRSVSADDE
                     EDEEDEDFKFSNKNRQSIIDSSDDEEGTDSDSSFKVSKSGYFGKMVEQDSEKSDTTDH
                     EVDNNKDSTDDVISLPQTIISSEEEEEQESKKVIDGKEAIVGDIRQSPLVEDSVSEKQ
                     DDSSSILSSEHEKTIEAIDGKDAESTEKGTTETHSSDDDGSIRESVNFESWKPDTDAL
                     RSGFVQDTNKRAPPGFVYDDSGKLIDLTPSSMKSSAVSTYSEMESSWNAFPSGQNGGD
                     DLETIRDTKTLYDNNTIYNVPGLVTNNDNLPPLPNNILTEITAGNIMTRSPTATSDIE
                     KRSVKSNHSEATIVPKPDSEQLARLNGPHKIPTLNLNEVISSKNSHSQKIEILQNYSK
                     ELAEYDTGIQTWINYSLKSNSQSNNDLLLDEYKNNNHVREAYANAEELSKKNTVINTV
                     VSVNQNVTHLRKKVFSHSMKSRGLLSSIGKKIIEK"
     gap             516096..516272
                     /estimated_length=177
     gene            complement(<516469..>518076)
                     /gene="NDAI0D02210"
                     /locus_tag="NDAI_0D02210"
                     /db_xref="GeneID:11494906"
     mRNA            complement(<516469..>518076)
                     /gene="NDAI0D02210"
                     /locus_tag="NDAI_0D02210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669730.1"
                     /db_xref="GeneID:11494906"
     CDS             complement(516469..518076)
                     /gene="NDAI0D02210"
                     /locus_tag="NDAI_0D02210"
                     /inference="similar to DNA sequence:INSDC:YGR197C,YJR015W"
                     /note="similar to Saccharomyces cerevisiae SNG1 (YGR197C)
                     and YJR015W; ancestral locus Anc_5.143"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669778.1"
                     /db_xref="GeneID:11494906"
                     /db_xref="InterPro:IPR022703"
                     /db_xref="UniProtKB/TrEMBL:G0W9S4"
                     /translation="MAEALADNYTTCEANTADSSLNDEEKFLNGNSETMSKDDNDENG
                     SYPEDIESYNPDFQVENGNLSDEETVASSFTQKSQPNTGIPITRTQTGFFSSKLIQHR
                     KKIAWKFILCNLFLAVVCFSILPIYWGATYRTASNYHKLNIIAVIQEDQLNNNNTAIP
                     LMTTVFPTLIHSVPGNWHIYNQSHFQQKFNVQDPSQINAKINHLVHEEHYWISLNVKA
                     NVTAALIDSLLNSTSPSFNSTNFFEVAYESARDPANLKAYILPLAQEVETLYRNYYNE
                     EYLPTLLSTLLNATNNGDNNATSIATQFNSKNWANSGKMLFQYNDLVSFDNRLLMAPL
                     QVGLIYCIILTVFQLSLFGPLHAEMAKVLRPKHMIVYRILISWCTYFFLSLFFCTISA
                     MFQVDFTRAFGKGGFVVYWMTTFLTMMALGGANENVLSLVLIFFPQYLSLWLITWIIT
                     NISVTFYPMALTSYFYRYGYMMPIHNAFDIYKVVLLNVSKRKMGRNYGILVAWVVINT
                     ALFPFVSKIVGWKIKKNMAATASQVKK"
     gene            <518953..>521436
                     /gene="NDAI0D02220"
                     /locus_tag="NDAI_0D02220"
                     /db_xref="GeneID:11494907"
     mRNA            <518953..>521436
                     /gene="NDAI0D02220"
                     /locus_tag="NDAI_0D02220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669731.1"
                     /db_xref="GeneID:11494907"
     CDS             518953..521436
                     /gene="NDAI0D02220"
                     /locus_tag="NDAI_0D02220"
                     /inference="similar to DNA sequence:INSDC:YGR198W"
                     /note="similar to Saccharomyces cerevisiae YPP1 (YGR198W);
                     ancestral locus Anc_5.142"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669779.1"
                     /db_xref="GeneID:11494907"
                     /db_xref="UniProtKB/TrEMBL:G0W9S5"
                     /translation="METKNTGRGRAPIAFALEARMVGANEFYSGIENLDKALHLQFRL
                     HYHTLNKEDALNPSIAKVLLKDCVILYDTLKISISQIVAPEPNEFAQLIVYNLLAILY
                     YHKSQSINENETANENKIKAQKYLLKLSKTLEKRKFSSIYDEFIKLLKLENLYYQGKL
                     LHGSTVKDRHTFYYENILRIFNNNIPTNSMGLIFDYILLIIQDLRINKTIVEPVQILK
                     NLKSESPMACLIAILQLNGKQFDQFYLQIANKFLQNSKFPTANQSNNKNLEQFHLCFQ
                     IYLTNLIANGQTIDKHSIDQWENFVISSMGNTFQSIPVAHSAMILFSLIKNKKESILN
                     FMNVVKYTKKQSELNNNQLTDPLSLISSYLFILQNTTKVDNIDTLFDYNNCINELNQM
                     VINFYTTYKFPYVNHINMTNINTSKITSDSKLKLPHIISTKLSKTWQTLYQIQSTDLS
                     KLLSNELSSHLINAMNLQTSTTNKMDLKFNYAYVLSQQNKIDQCIQFLENEILEFYPF
                     HFKAWHLLALCYSTEEDKEKSYRIVNSAIDAMVSTLEDQGQDQDRKKNNADAKKQFTW
                     LEKWQFIQLKMTQITLVEEIFGALDALDMIEELFTSFNELFNDSTVDEIEQKTVKFTL
                     RKEYLLQMIWIFVSNIYIKLDDHKMDALAAIKEATKIKTEFKNLNIDLAEGYYLLNQN
                     KCNDALQKFENVLYYDECNVDAMVGFATMALPESISPEECDIQDYYRLYPSIEYTKPI
                     QANDNDNDDDDKIFVTDVDRSAGIARLKLLLECATLKSIEAYNSPEVWWYLSLVYEKY
                     KDKEYKQALLNCIKLEEGKPIRSFKFCNY"
     gene            complement(<522299..>523873)
                     /gene="NDAI0D02230"
                     /locus_tag="NDAI_0D02230"
                     /db_xref="GeneID:11494908"
     mRNA            complement(<522299..>523873)
                     /gene="NDAI0D02230"
                     /locus_tag="NDAI_0D02230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669732.1"
                     /db_xref="GeneID:11494908"
     CDS             complement(522299..523873)
                     /gene="NDAI0D02230"
                     /locus_tag="NDAI_0D02230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669780.1"
                     /db_xref="GeneID:11494908"
                     /db_xref="InterPro:IPR022703"
                     /db_xref="UniProtKB/TrEMBL:G0W9S6"
                     /translation="MSSDQLSAEEPPSIENFMGTDIHDSVTVHRELTRNNAEVLARTF
                     TDNIAELTEDHSQVYSEEEEEREKAASIIESKTSDLVPLERTRTTLFSPHLKSERKKI
                     VLRFLWINFVIALFCFTVLPIFWGSLYDSTRYFHKVNYLAVIQDEPVNVRGVTVPAMG
                     SFIPQIIAELPGTWHIYNTTTFQDKFGVNSAGEIDQKVIDEIFDEHYWLAINVKANAT
                     QTLVESFLVPPPLGQVFNSSNFFEVVYESAKDITSVPSSILAPVQALETYFKQIYNSR
                     YLPGLFSQLPSNLSDYNPEALSYATSMSFHYFDYRPFTPRTLYGPLLGGCIYALTITI
                     FQFLIFTPLHIKMAGLLSPKHIILYRLAIAWCCFFFLSLFYCTVSAIFQISFRGTFGR
                     GKFMVYWMTTWLYMLAVGGANENVASIIFTFCPPYFGFWVVFFVIINMSTSFFSMALN
                     NYFFRFGYMLPMHNALDLYRVILADLSRSHMGRNYGILVAWVVLNTALFPFIMKFVGA
                     TIRKRAAASKTSGATH"
     gene            <524453..>526699
                     /gene="NDAI0D02240"
                     /locus_tag="NDAI_0D02240"
                     /db_xref="GeneID:11494909"
     mRNA            <524453..>526699
                     /gene="NDAI0D02240"
                     /locus_tag="NDAI_0D02240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669733.1"
                     /db_xref="GeneID:11494909"
     CDS             524453..526699
                     /gene="NDAI0D02240"
                     /locus_tag="NDAI_0D02240"
                     /inference="similar to DNA sequence:INSDC:YGR199W"
                     /note="similar to Saccharomyces cerevisiae PMT6 (YGR199W);
                     ancestral locus Anc_5.140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669781.1"
                     /db_xref="GeneID:11494909"
                     /db_xref="GOA:G0W9S7"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:G0W9S7"
                     /translation="MSASTGIESHSIENKLRKRASNEDAVITNNIDIGKHSNETYVKT
                     KMYMGKRFDLRGITSIASPALFTILSFYLRFKNIDKNNHVVWDEAHFGKFGSYYITHE
                     FYHDVHPPLGKMLVALSEYLAGFDGHFSFDSNTKYPSEMNFKFMRQFNATFGALCVPL
                     TFFTAKNLGFSWQTTYLVTLMVTLEHSYITLSKFILLDSILLFFTLTTFACLVKIYTL
                     RKKQLTRKWSLWMLLTGISVGCVCSVKWVGLFITIVVGIYTLMDLFSLHHDENLSRVK
                     YYKHWLIRIIDLIIIPFLIYMFCFKIHFALLYKSGTGDASTNTLFQINLENTKIEIGP
                     RNVAFGSEVTIRSHGLSPNLLHSHVQLYPDGSKQRQVTGYAHSDANNNWEFHFADHNY
                     SPNDTIIRDVMDGMDIRLVHKNTRNNLHSHKIPSHVSRGNFEVSGYGNDDDFVDSNDI
                     WTIELVDQLDSSNPNYPKEDPTILHPVSTFFRLRHKKLGCYLASTGLTYPQWGFQQAE
                     IVCKNSWSKRDKATWWNVEDHWNSRLTVAEEYLPPKSKFWTDFVLINFAMASSNSALI
                     PDQDKFDPLASEPWEWPTLHKGLRMCSWSRDSYRYYLMGSPFNTWISTLSLFGFVLLM
                     LRIIFKWGRQTINLTEDQIWKLLITGVFPFFSWIMHFLPFVMMGRVTYVHHYVPALYF
                     AILVFGFVIEQLFVSAHPIIKYPAFIILATGCIWVYIIFAPICQGLHGPLTQYLRLQW
                     LPSWDIII"
     gene            complement(<526907..>529294)
                     /gene="NDAI0D02250"
                     /locus_tag="NDAI_0D02250"
                     /db_xref="GeneID:11494910"
     mRNA            complement(<526907..>529294)
                     /gene="NDAI0D02250"
                     /locus_tag="NDAI_0D02250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669734.1"
                     /db_xref="GeneID:11494910"
     CDS             complement(526907..529294)
                     /gene="NDAI0D02250"
                     /locus_tag="NDAI_0D02250"
                     /inference="similar to DNA sequence:INSDC:YGR200C"
                     /note="similar to Saccharomyces cerevisiae ELP2 (YGR200C);
                     ancestral locus Anc_5.139"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669782.1"
                     /db_xref="GeneID:11494910"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G0W9S8"
                     /translation="MSIKQEAIFIGANRQNQVSSYNKSLNIVAFGACNTIALWDPLDP
                     SNHGVIQTLKGHEADVTCVKFIHGTPFMISASEDHHVKVWKVTDNVWNCVQTIQHYQN
                     TIVALDVLEDLFVVGCADGNVSIWVRENELDTFVMSQEFIVQQGVLPLSFALSNVTDN
                     KYLLAIGGTNVNVFIYSFVFSRTQGVDAIHDCKLAAKLEGHEDWIKSMAFRHQETPGD
                     YLLCSGSQDRYIRLWRIRINDLIEEQDDENDENKLELLNNKQYKFHVADDLKVCINFE
                     ALIMGHDDWISSLQWHETRLQLLASTADTALMVWEPDEASGIWVCGLRLGELSSKGAS
                     TATGSAGGFWSCLWFSSEDNVDYILTNGRTGSWRIWKLTDNNQTCEQELGISGPIKEV
                     TDIAWAPNGKYLLATSLDQTTRLFAPWLYNADKSKRSTITWHEFSRPQIHGYDMICVE
                     PITNTRFISGGDEKILRSFDEPKGVAQILDKFTDIKLDTTAVMPETASVPVLGLSNKA
                     DNPDDSEDEDDDEVNHVGEEKNIATSELVEGMTTPPKEDQLQRHLLWPEIEKLYGHGY
                     EITCVDVSPDGKFIASACRSNTPQHAVIRIFETGNWLEVKPVLEFHTLTITRLEFSHD
                     NKYLLSVCRDRQWAVWERTADGKGFSLKYNNVKPHSRIIWDGDWVPTEFGTAFITGSR
                     DRTIKMWNFDESKDDFILENSFKHTKPVTALSVYDYVVDKKILVAVGLETGEIFVYKY
                     DSEDGFQLVHTLEDSITPAGKITRLRWSTADMDKRMLLGVSSNDSSARIYSIPKV"
     gene            <529722..>530216
                     /gene="NDAI0D02260"
                     /locus_tag="NDAI_0D02260"
                     /db_xref="GeneID:11494911"
     mRNA            <529722..>530216
                     /gene="NDAI0D02260"
                     /locus_tag="NDAI_0D02260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669735.1"
                     /db_xref="GeneID:11494911"
     CDS             529722..530216
                     /gene="NDAI0D02260"
                     /locus_tag="NDAI_0D02260"
                     /inference="similar to DNA sequence:INSDC:YGR203W"
                     /note="similar to Saccharomyces cerevisiae YGR203W;
                     ancestral locus Anc_5.136"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669783.1"
                     /db_xref="GeneID:11494911"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:G0W9S9"
                     /translation="MDGRRSVANIKYVDASELYRWMKQGHNSLGQPFQVIDVRGSDYI
                     GGHIFQSWHYPYKELSHNLILLDELKKRLENERLESKLKEKSATTSDVDEDETVINAV
                     FHCAQSQQRGPSAAMKLLRHLNDGELEHIQIWVLRGGFNHWQDEYGEDDSVTEGYEPS
                     LWGW"
     gene            <530778..>533624
                     /gene="NDAI0D02270"
                     /locus_tag="NDAI_0D02270"
                     /db_xref="GeneID:11494912"
     mRNA            <530778..>533624
                     /gene="NDAI0D02270"
                     /locus_tag="NDAI_0D02270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669736.1"
                     /db_xref="GeneID:11494912"
     CDS             530778..533624
                     /gene="NDAI0D02270"
                     /locus_tag="NDAI_0D02270"
                     /inference="similar to DNA sequence:INSDC:YGR204W"
                     /note="similar to Saccharomyces cerevisiae ADE3 (YGR204W);
                     ancestral locus Anc_5.134"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669784.1"
                     /db_xref="GeneID:11494912"
                     /db_xref="GOA:G0W9T0"
                     /db_xref="InterPro:IPR000559"
                     /db_xref="InterPro:IPR000672"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020628"
                     /db_xref="InterPro:IPR020630"
                     /db_xref="InterPro:IPR020631"
                     /db_xref="InterPro:IPR020867"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W9T0"
                     /translation="MAGQLIDGKATAKVIREEISQEITSLKEQIPTFKPNLAIIQVGT
                     RPDSATYVRMKCKAAEEAGIIANFIHLEESITEHELYKHVVKLNEDPETHGIIVQLPL
                     PSHINEDRITSAVLSSKDVDGFGPMNIGELNKKNGNPDFLPCTPKGVIELLKRFNVTI
                     AGSKSVVVGRSDIVGSPVAELLKSLDSTVTITHSKTKDIPSYLKDADIVVVAIGRPEF
                     VKGEWFKDNKKGCVVIDVGTNYVEDSTKKSGFKCVGDVEFNEALKYVKLITPVPGGVG
                     PMTVAMLMQNTLIAAKRELANNGKLTNFEPLKLNLLKPVPADFEISRAQTPKEITQVA
                     LESGILPSEFEPYGSTKGKVSLDVLDRLQDRENGKYILVTGITPTPLGEGKSTTTVGL
                     AQAFGAHLNKTVFANVRQPSMGPSFGIKGGAAGGGYSQVIPMDDFNLHVTGDIHAISI
                     ANNLLAAAIDTRMFHESTQKDGPLYKRLVPAKKGVRAFTPSMLRRLKKLGIDKTNPDD
                     LTEEEITRFARLDIDPETITWRRVVDCNDRMLRGITIGEAPTERGFTRHTGFDISVAS
                     ECMAILALTNSLADMRERLGKIVIGASKAGEPITCEDIGCAGAMTALLKDAIKPNIMQ
                     TLEGTPVFVHAGPFANISIGASSVLADKMALKLAGVEPTLTESLKKERVGYVITEAGF
                     DFTMGGERFINIKCRSSGLVPDVVVIVATVRALKVHGGGAEVKAGAPLPAEYLTENVD
                     MLRKGCANLAKHISNARQYNLPVIVAINKMSTDTAAEHQVIKEESLKAGAYDAIVSNH
                     WEEGGLGAVDLANGIIEATQKTNNDDFQFLYKTEGQTVEERIETIAQEMYGAKDVEFL
                     PEAQKKIELYTKQGFGNLPICIAKTQYSLSHDAKLKGVPTGFTFPIRDVRASIGAGYL
                     YALAAEIQTIPGLPTHCGFMNIEVNDDGEIEGMF"
     gene            <534004..>534894
                     /gene="NDAI0D02280"
                     /locus_tag="NDAI_0D02280"
                     /db_xref="GeneID:11494913"
     mRNA            <534004..>534894
                     /gene="NDAI0D02280"
                     /locus_tag="NDAI_0D02280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669737.1"
                     /db_xref="GeneID:11494913"
     CDS             534004..534894
                     /gene="NDAI0D02280"
                     /locus_tag="NDAI_0D02280"
                     /inference="similar to DNA sequence:INSDC:YGR205W"
                     /note="similar to Saccharomyces cerevisiae YGR205W;
                     ancestral locus Anc_5.132"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669785.1"
                     /db_xref="GeneID:11494913"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W9T1"
                     /translation="MPQMTVIEHCYEFLDKYIPQWFATGTRDPLFIFFSGPQGSGKSY
                     TSKIIYEHLLKKYSGEGEGNVGKKTIAYVSIDDFYLTHRDQLALNEQYPRNKLLQGRG
                     MPGTHDMSLLNDCLNAIQQRRGNNKDQDKLILPQYDKSKYNGEGDRSENNLVMDAPVD
                     IFILEGWFIGFEPIMKTFEENDLLKGDMADVNAKLFMYSDLMWNNPEINSLAIVFAAD
                     NIDNIYEWRKQQEHASIAKNGSGMTDEQVKAFIDRYYPSYQLYFENLVRGEKLGSVAT
                     LTLGLDINRRVYSSKVRCIE"
     gene            <535405..>535752
                     /gene="NDAI0D02290"
                     /locus_tag="NDAI_0D02290"
                     /db_xref="GeneID:11494914"
     mRNA            <535405..>535752
                     /gene="NDAI0D02290"
                     /locus_tag="NDAI_0D02290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669738.1"
                     /db_xref="GeneID:11494914"
     CDS             535405..535752
                     /gene="NDAI0D02290"
                     /locus_tag="NDAI_0D02290"
                     /inference="similar to DNA sequence:INSDC:YGR206W"
                     /note="similar to Saccharomyces cerevisiae MVB12
                     (YGR206W); ancestral locus Anc_5.127"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669786.1"
                     /db_xref="GeneID:11494914"
                     /db_xref="InterPro:IPR019014"
                     /db_xref="UniProtKB/TrEMBL:G0W9T2"
                     /translation="MSEYKSHELTGNNTKCNTLKVEEILRKIPLYNKYGEDFPKETLQ
                     LMKVPEFKYNELQPTETMFKPWYEECDNLVKTCEQHDKSNESFDNWLYDKYLKTKPPG
                     MMGSTLLSPSKRG"
     gene            complement(<535895..>536707)
                     /gene="NDAI0D02300"
                     /locus_tag="NDAI_0D02300"
                     /db_xref="GeneID:11494915"
     mRNA            complement(<535895..>536707)
                     /gene="NDAI0D02300"
                     /locus_tag="NDAI_0D02300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669739.1"
                     /db_xref="GeneID:11494915"
     CDS             complement(535895..536707)
                     /gene="NDAI0D02300"
                     /locus_tag="NDAI_0D02300"
                     /inference="similar to DNA sequence:INSDC:YGR207C"
                     /note="similar to Saccharomyces cerevisiae YGR207C;
                     ancestral locus Anc_5.126"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669787.1"
                     /db_xref="GeneID:11494915"
                     /db_xref="GOA:G0W9T3"
                     /db_xref="InterPro:IPR000049"
                     /db_xref="InterPro:IPR012255"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014730"
                     /db_xref="UniProtKB/TrEMBL:G0W9T3"
                     /translation="MSKQTLRILTPIKRVLDPQLKPRINEVTKSLDLKNLKFSINPFD
                     DIAIEESLTIRKNLSKAIPVSTHAVTIGSPKSESILRTCLAKGVEKATLIKHDAKDDE
                     ASSSFEPLIIAKILKEMVKKEDIGLVIMGKQAIDDDFNNTGQMLAGLLNWPQITNVTK
                     LEFLDATGDQLKVRAVREIDGGNETLVMKLPGLITVDLGLNTPRYVKLQNMMKAKKKP
                     IEILDLKETFPQVDLTSKLELKAVEEPAVKKQGIILNSVDELITKLKEEKVI"
     gene            <537083..>538024
                     /gene="NDAI0D02310"
                     /locus_tag="NDAI_0D02310"
                     /db_xref="GeneID:11494916"
     mRNA            <537083..>538024
                     /gene="NDAI0D02310"
                     /locus_tag="NDAI_0D02310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669740.1"
                     /db_xref="GeneID:11494916"
     CDS             537083..538024
                     /gene="NDAI0D02310"
                     /locus_tag="NDAI_0D02310"
                     /inference="similar to DNA sequence:INSDC:YGR208W"
                     /note="similar to Saccharomyces cerevisiae SER2 (YGR208W);
                     ancestral locus Anc_5.125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669788.1"
                     /db_xref="GeneID:11494916"
                     /db_xref="GOA:G0W9T4"
                     /db_xref="InterPro:IPR004469"
                     /db_xref="InterPro:IPR006383"
                     /db_xref="InterPro:IPR023190"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G0W9T4"
                     /translation="MTNPESNIVLTCIAHGATIDNATIFKSINGILQNQINESTVIDT
                     KTLSVRAFDIYIHTMIPVSALKTLFVFEDVDVIVQHNDVYRQNKKLFVFDMDSTLIYQ
                     EVIELIASYANVEDQVREITNRAMNNEIDFKESLRERVKLLTGLRIDTLYDKIKLQLR
                     ITNGVKELCQFLKVKGCKLAVLSGGFIQFATFIKDQLEFDFAKANLLEMDSNGNLTGN
                     VLGEIVDGQCKADTLKQLCKEYNVKIEESCMVGDGGNDLPAMGTAGFGIAWNAKPKVQ
                     EVAPCKLNTDSLRDVLYILGYTDDEIKSTTTTTTTTI"
     gene            complement(<538170..>538481)
                     /gene="NDAI0D02320"
                     /locus_tag="NDAI_0D02320"
                     /db_xref="GeneID:11494917"
     mRNA            complement(<538170..>538481)
                     /gene="NDAI0D02320"
                     /locus_tag="NDAI_0D02320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669741.1"
                     /db_xref="GeneID:11494917"
     CDS             complement(538170..538481)
                     /gene="NDAI0D02320"
                     /locus_tag="NDAI_0D02320"
                     /inference="similar to DNA sequence:INSDC:YGR209C,YLR043C"
                     /note="similar to Saccharomyces cerevisiae TRX2 (YGR209C)
                     and TRX1 (YLR043C); ancestral locus Anc_5.124"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669789.1"
                     /db_xref="GeneID:11494917"
                     /db_xref="GOA:G0W9T5"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:G0W9T5"
                     /translation="MVSQIKSADEFEKAINQDKLVVVDFFAVWCGPCKMIAPMIEKFA
                     EQYPQADFVKLDVDELSEVAQKNEVSSMPTLVFFKNGKEITRVIGANPAAIKQAIASN
                     A"
     gene            complement(<539263..>540528)
                     /gene="NDAI0D02330"
                     /locus_tag="NDAI_0D02330"
                     /db_xref="GeneID:11495052"
     mRNA            complement(<539263..>540528)
                     /gene="NDAI0D02330"
                     /locus_tag="NDAI_0D02330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669742.1"
                     /db_xref="GeneID:11495052"
     CDS             complement(539263..540528)
                     /gene="NDAI0D02330"
                     /locus_tag="NDAI_0D02330"
                     /inference="similar to DNA sequence:INSDC:YGR210C"
                     /note="similar to Saccharomyces cerevisiae YGR210C;
                     ancestral locus Anc_5.121"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669790.1"
                     /db_xref="GeneID:11495052"
                     /db_xref="GOA:G0W9T6"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR013646"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W9T6"
                     /translation="MPRDPLIGIVGKPSSGKSTMLNSLTDANAAVGAFPFCTIDPNQA
                     TGYLEVDCACSRFKDTEDKGEKMMSLCKPNYGWCDHGKRHIPIMLLDVAGLVPGAHSG
                     RGLGNKFLDDLRHADALIHVVDVSGTTDSEGKNTRGYDPLYDIEWLQDEIRLWIEGNL
                     KKRWGSIVRRHTATKSSIVDTLQTQFGGYGSLAPMVQRALATLKGLPPLESWDDEWIT
                     KVVKAFMMEKFPTVLALNKMDHPDADKNVSKIMLKYPNTKAVLTSAITEVFLRKLKKQ
                     GFIKYEEGTEFIDTYEDDPENLKPLDEKLLNRIENIRDLVLYRFGSTGVVQVLQAAAG
                     VLDLIPVYTVKNIQTFTGGNGTNVFRDCFLVKKGTTVGKVARYIMGGEVTVAAIETVG
                     GVRVSEESEVLPGKNDILSFKLAPKSTAA"
     gene            <541550..>542992
                     /gene="NDAI0D02340"
                     /locus_tag="NDAI_0D02340"
                     /db_xref="GeneID:11495053"
     mRNA            <541550..>542992
                     /gene="NDAI0D02340"
                     /locus_tag="NDAI_0D02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669743.1"
                     /db_xref="GeneID:11495053"
     CDS             541550..542992
                     /gene="NDAI0D02340"
                     /locus_tag="NDAI_0D02340"
                     /inference="similar to DNA sequence:INSDC:YMR030W"
                     /note="similar to Saccharomyces cerevisiae RSF1 (YMR030W)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669791.1"
                     /db_xref="GeneID:11495053"
                     /db_xref="GOA:G0W9T7"
                     /db_xref="InterPro:IPR027998"
                     /db_xref="UniProtKB/TrEMBL:G0W9T7"
                     /translation="MSDYSNQFSTMSSNADPKTTPSNRIPSNNQQQFRTDDISTFNPN
                     NMSPVFTSQDNNNGNNNMNLNRYQNLSFNNNGQYSQLLNRQQLVQQESPDQSQLQQQS
                     HHYQAQTQAQAQTQAQQQQQQTLPYLWASSNQPKSIFINASSNLPILANKVPEQQPQP
                     QPQQLQLPHQEQIQRYSSSSLTTVHNDVSSLLSQQNNDANNTNVQEDDPQQLMLSQDI
                     SHLTTFPSSLSKRLSLIIPSKTTLKKKSANTFAKFIFAEDRYSDNLICQFYDPNNTNE
                     DSSICNKIIKMSSKSIKRRTQARKCKDHLRLEHDIEINPNNYLHYLNHNSELFKKAYT
                     TKTLANVKPLVESFSMAHDLQKMQNMQAYVELSELFNLAHIPIEVFEHPLFMVWFKRW
                     VSEKELFTPAHDELINLTNTNDAPTSLTDRSANAPVNNNNNGNNSNNNNNNIPHNIDR
                     NELIQHNTNGADDEQEGEEESMTTTVSNDN"
     gene            <543657..>545117
                     /gene="NDAI0D02350"
                     /locus_tag="NDAI_0D02350"
                     /db_xref="GeneID:11495054"
     mRNA            <543657..>545117
                     /gene="NDAI0D02350"
                     /locus_tag="NDAI_0D02350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669744.1"
                     /db_xref="GeneID:11495054"
     CDS             543657..545117
                     /gene="NDAI0D02350"
                     /locus_tag="NDAI_0D02350"
                     /inference="similar to DNA sequence:INSDC:YGR211W"
                     /note="similar to Saccharomyces cerevisiae ZPR1 (YGR211W);
                     ancestral locus Anc_5.120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669792.1"
                     /db_xref="GeneID:11495054"
                     /db_xref="GOA:G0W9T8"
                     /db_xref="InterPro:IPR004457"
                     /db_xref="UniProtKB/TrEMBL:G0W9T8"
                     /translation="MSEQEKKEDTLFQTVGEAAQEIQDETTAPDDGVTATGAEDAMGH
                     PVQEIESLCMNCHKNGTTRLLLTSIPYFREVVLMSFECPHCGLKNSEIQPASTIQEKG
                     AKYLLKVECKEDFNREVIKSETASCKFVELDIEIPPKRGQLTTVEGLLSEMIDDLQSD
                     QEMRKKIDENLYNQIDAVIKKVRSYINCEPNTVPLTFILDDPAGNSWIEYKPGEPQHK
                     WSSTQYVRSDEQNVQVGILTEDQYEQRRRAKLAELSKRERNKPESVKIGTGDTEFLSD
                     ATDIENFSNEVQTFRSSCPSCTTECETHMKPVNIPHFKEVILMSTVCDHCGYKSNEVK
                     TGGAIPEKGRKITLYCDDPADLSRDILKSETCSMTVPELHLDIQEGTLGGRFTTLEGI
                     LKQVYDELESRVFSQTSDSMDEATKERWVSFFGRLKEAIAGKVKFTVIMVDPLAGSYI
                     QNVYAPDADPNMTIEDYERTKEQNDELGLSDIKVDQ"
     gene            <545485..>546897
                     /gene="NDAI0D02360"
                     /locus_tag="NDAI_0D02360"
                     /db_xref="GeneID:11495055"
     mRNA            <545485..>546897
                     /gene="NDAI0D02360"
                     /locus_tag="NDAI_0D02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669745.1"
                     /db_xref="GeneID:11495055"
     CDS             545485..546897
                     /gene="NDAI0D02360"
                     /locus_tag="NDAI_0D02360"
                     /inference="similar to DNA sequence:INSDC:YGR212W"
                     /note="similar to Saccharomyces cerevisiae SLI1 (YGR212W);
                     ancestral locus Anc_5.119"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669793.1"
                     /db_xref="GeneID:11495055"
                     /db_xref="GOA:G0W9T9"
                     /db_xref="InterPro:IPR010828"
                     /db_xref="UniProtKB/TrEMBL:G0W9T9"
                     /translation="MMNPRELSSLENFFYHRSEVNLHSCFYLALLLNALPAKKQLYKA
                     LQDTIATYPQLHQNITKNKEDEYLYVEDIKKTPIEFEDVVEFVAWEKFEEKEINSIFQ
                     TYNFHYRNDRPLWKILVVPSLNTFILLLDHALFDGISAVKIWETFMEKLNKSSEIENI
                     DVTVPLYIPEENHEGTLVASQHPYDIWPVPIAWKVKSFIATKLFNWYPQAIISPNSNL
                     FEFKGYKFPEGFLSQYPKDGVTSFKVRNDNTQKLIKMAPGKLETILKNCKTNAVSLTS
                     YIVAIIIIALRNVTQESYTGNLLKVSIPINTRNICANQVNTPEEMLQLGNFVGSMDFE
                     HPINSDSGIWDIARDVQQFITKNTTVGISDIINNIKLLDGINCEEFVKKKIEFSSNGP
                     ASTFEVTNLGFQSFKGSCMESSSYFIKDAVFNEPQGMSDIFTCSVISTPIGGLRCSLS
                     YPKDIAQEFEPCWDYIKNNF"
     gene            complement(<547014..>548030)
                     /gene="NDAI0D02370"
                     /locus_tag="NDAI_0D02370"
                     /db_xref="GeneID:11495056"
     mRNA            complement(<547014..>548030)
                     /gene="NDAI0D02370"
                     /locus_tag="NDAI_0D02370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669746.1"
                     /db_xref="GeneID:11495056"
     CDS             complement(547014..548030)
                     /gene="NDAI0D02370"
                     /locus_tag="NDAI_0D02370"
                     /inference="similar to DNA sequence:INSDC:YGR213C,YLR046C"
                     /note="similar to Saccharomyces cerevisiae RTA1 (YGR213C)
                     and YLR046C; ancestral locus Anc_5.118"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669794.1"
                     /db_xref="GeneID:11495056"
                     /db_xref="GOA:G0W9U0"
                     /db_xref="InterPro:IPR007568"
                     /db_xref="UniProtKB/TrEMBL:G0W9U0"
                     /translation="MVDTTANTNDDSDFQLYRYNPSMGAAILFIILFAISSVAIIIFI
                     SERALKAKNKLRSWKKISDNAETALRFYKISKLYGAYIPLIVGCIVELIGYIGRAISG
                     NDKEALGPYIMQSVLLLIAPTLYAATIYMLFGRMAHLLFAESLMIMPARFNTLIFVLG
                     DIASLFMQAAGGGLMASADSAKSGSNLVTAGLFVQIAFFGLFIINEFLFIFRVGKLPN
                     PIQSRCASWKSLNMVLIVNSFLILIRSIVRAIEFIEGFDGFIASHEWYLYVFDSLPMY
                     ALTVISIATLKWNNIFRIQEESVNAQIHVGPLLQPVGSTDYVLSNHKSETKGFKESEY
                     EQYN"
     gene            <549978..>551181
                     /gene="NDAI0D02380"
                     /locus_tag="NDAI_0D02380"
                     /db_xref="GeneID:11495057"
     mRNA            join(<549978..550067,550528..>551181)
                     /gene="NDAI0D02380"
                     /locus_tag="NDAI_0D02380"
                     /product="ribosomal protein S0"
                     /transcript_id="XM_003669747.1"
                     /db_xref="GeneID:11495057"
     CDS             join(549978..550067,550528..551181)
                     /gene="NDAI0D02380"
                     /locus_tag="NDAI_0D02380"
                     /inference="similar to DNA sequence:INSDC:YGR214W,YLR048W"
                     /note="similar to Saccharomyces cerevisiae RPS0A (YGR214W)
                     and RPS0B (YLR048W); ancestral locus Anc_5.116"
                     /codon_start=1
                     /product="ribosomal protein S0"
                     /protein_id="XP_003669795.1"
                     /db_xref="GeneID:11495057"
                     /db_xref="GOA:G0W9U1"
                     /db_xref="InterPro:IPR001865"
                     /db_xref="InterPro:IPR005707"
                     /db_xref="InterPro:IPR018130"
                     /db_xref="InterPro:IPR023591"
                     /db_xref="InterPro:IPR027498"
                     /db_xref="UniProtKB/TrEMBL:G0W9U1"
                     /translation="MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNTRPDG
                     VNVINVGKTWEKLVLAARIIAAIPNPEDVVAISSRTYGQRAVLKYAAHTGATPIAGRF
                     TPGNFTNYITRSFKEPRLVIVTDPRSDAQAIKEASYVNVPVIALTDLDSPSEYVDVAI
                     PCNNRGRHSIGLIWYLLAREVLRLRGALTDRTQPWSIMPDLYFYRNPEEAEQTTEEAT
                     EEAGEEEVKEEATEEQAGASEWAEEMPTP"
     gene            <551615..>551932
                     /gene="NDAI0D02390"
                     /locus_tag="NDAI_0D02390"
                     /db_xref="GeneID:11495058"
     mRNA            <551615..>551932
                     /gene="NDAI0D02390"
                     /locus_tag="NDAI_0D02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669748.1"
                     /db_xref="GeneID:11495058"
     CDS             551615..551932
                     /gene="NDAI0D02390"
                     /locus_tag="NDAI_0D02390"
                     /inference="similar to DNA sequence:INSDC:YGR215W"
                     /note="similar to Saccharomyces cerevisiae RSM27
                     (YGR215W); ancestral locus Anc_5.115"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669796.1"
                     /db_xref="GeneID:11495058"
                     /db_xref="InterPro:IPR013219"
                     /db_xref="UniProtKB/TrEMBL:G0W9U2"
                     /translation="MPVLKARLLKVAELSAKIFDENFNPTGARTGAKILSQRLKGPAI
                     ASYYGNPDVLKFKHLKTLYPNFQFTDPEENYRLAKIEAKKRRGKGAPKKTKKGDVKGK
                     GKK"
     gene            complement(<552071..>553939)
                     /gene="NDAI0D02400"
                     /locus_tag="NDAI_0D02400"
                     /db_xref="GeneID:11495059"
     mRNA            complement(<552071..>553939)
                     /gene="NDAI0D02400"
                     /locus_tag="NDAI_0D02400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669749.1"
                     /db_xref="GeneID:11495059"
     CDS             complement(552071..553939)
                     /gene="NDAI0D02400"
                     /locus_tag="NDAI_0D02400"
                     /inference="similar to DNA sequence:INSDC:YGR216C"
                     /note="similar to Saccharomyces cerevisiae GPI1 (YGR216C);
                     ancestral locus Anc_5.114"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669797.1"
                     /db_xref="GeneID:11495059"
                     /db_xref="GOA:G0W9U3"
                     /db_xref="InterPro:IPR007720"
                     /db_xref="UniProtKB/TrEMBL:G0W9U3"
                     /translation="MSNYVFWPRELRDKEKRYESNESIVALAISLEGANTVVLDVLPQ
                     ELFLHDINLKSPYSLVAIRPKGSNMWVFEDEDSFIIEFLAPPLKSMRFFSLEPIPLIL
                     PEKETTDENLLPLAADNFQLLSNHIRYHTTDSRLRATLRLINLFHKHVQELKDLYPTL
                     FTNETIALDYTKVDYMYTWYTSTGLHRFIGCTFLYVSVCICQTAKLVSNSLSTLSIPL
                     VDISATARQIDLRCQQLCYFPLQYVQIKNKISSLWSKEHPSNASEKTDILKEDLPSQY
                     YPEYIRFFNTIWLILNDISFGLILAAIIGQYFDFIISMFHFVVHFFINNILIKGSKTL
                     ANNPFGVKLNEELGVFLSDIFLWIISFFYESFIEPITRENNLGIFLKITIQVTCCIGC
                     SFGISMIVDFFSILFLPIYIFYHISRKLYHWDLSIMLSLFYLFCGKKNNVLRDRIDHN
                     YFQLDQMLVGTVLFIILLFLTPTVLAFYVFYTFLQMTVVSVEIGLESLIALINHFPLF
                     VLMLRLKDPKRIPGGISIVKKVTDIHTNEAYVLQLQNSPIKIGTMFKPYSALMTQMKI
                     NYFSVGTVKKIAGGLPIMMNRNKLYYILYSSLPKTSPSILELYLPLKDALVGKQQE"
     gene            <554265..>560273
                     /gene="NDAI0D02410"
                     /locus_tag="NDAI_0D02410"
                     /db_xref="GeneID:11495060"
     mRNA            <554265..>560273
                     /gene="NDAI0D02410"
                     /locus_tag="NDAI_0D02410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669750.1"
                     /db_xref="GeneID:11495060"
     CDS             554265..560273
                     /gene="NDAI0D02410"
                     /locus_tag="NDAI_0D02410"
                     /inference="similar to DNA sequence:INSDC:YGR217W"
                     /note="similar to Saccharomyces cerevisiae CCH1 (YGR217W);
                     ancestral locus Anc_5.113"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669798.1"
                     /db_xref="GeneID:11495060"
                     /db_xref="GOA:G0W9U4"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR005821"
                     /db_xref="InterPro:IPR027359"
                     /db_xref="UniProtKB/TrEMBL:G0W9U4"
                     /translation="MDGRRSRAFTEPSEAQDIFRDPDDQTNHNGQDAPKPIIIPQLNI
                     IPPHNQSDETLEGSSTQLESKMAKIFRTHIGYNKDTRKHPKLSLRTNSDSQISIQSDG
                     ISPNIHSAFPTLQNIGTKDERLRSPLPSERSNRRPSASSSNPDAPPRSAKVLSLIAPE
                     DMDEFEDLEKEFRNAIDEKGLTWLPQVSPKKPATVDTTSQNGHDELRVSGKWSYNNEQ
                     TPEEGPSRTPNSAGVYGDGSIFVDDIGSKELDTSFKENDIAVSTISLPLPDFEQPLNK
                     PILKTLKLYGNSIAMIPPTNPIRIRLARFHTDRRYKTAYFLLLLFFTILLSYRTYNPR
                     NVDFFYILTNWSDYVILTLFAYFTVNDITKILAFGFWDDSQMFDAQGRNYRTIVNRIG
                     FWKSYKHLRKKYGSNIIDFFIPPKLLNLEEKAKSKKHHLKSSLTKEEFEQEEKLFYSP
                     RAFARSSWNRIDLVSSFSFWLGIFLSIRGYDKRVGIRVFKPLSVLRILRLVNTDTGLS
                     SILRGVKHGIRQLINVGFMLVYFWAFFGILGVQTFKGSFRRQCVWINPENPTDTYQYS
                     NQFCGGYLEPVTKARMPYVFADGSPGPISKGFLCPQYSQCISNSNPYNGRISFDNIVN
                     SMEMVFIIMSANTFTDLMYYTMDSDEMAACLFFLFSIFVLTIWMMNLLIAVLVSSFEL
                     ANEKFKRKKLVAPSYESMPVRFIKGYWKYFQVKAAQTKFPNWASRSLRYYRKIEWTMV
                     VLILTDLIMRSCIDATTTADSLLYFAKVDRAISIVLFLESMFRLLCHFPNIWKFLTNT
                     SYVYDFVISIVTLITSCLAADKRLGRVYYWLSIFQISRFYRVILSFPFVKKLWKQVLK
                     NGIMIWNLSSFYFSLTFLSSIIMALYFEGVIPLDAMQDNLLGMTSLPNSFLSLFVIGS
                     TENWTDILYALQQYSPNISSAFFCSVLLIIWFILSNSVVLNIFIALISQSLEIDEDQK
                     RPLQIKHYLKYVYPQKIQEYTHATLITRIRKKFFSRTSPQETSDFKQFLIRGTAIMNI
                     AQNMDELAKELKESQEDAPLNTVFFWCRKLIAYIPFKKIRLYSDNPFYKKPEVVFTEV
                     NDTNGKTYVLELNEFEDEKLAYLRMHPAFNYSYFIFPPRHRFRKFCQRLVPPSTGKRT
                     DGIRFYEDETDLYSKRRYFHHLERDVFVFLYAIVTVLLVVCSCYVTPIYRRDHHMNVW
                     SWDTSLDCAFIFVFLFEFMVKTVADGWLYSPNAYIRNPWNLIDFLVLVSLIINLVSYL
                     HNEGNVSRIFKGLTALRALRCLTISTTARQTFTLVMFDGIKKIGEAGLISFSLLFPFT
                     VWGLNLFRGRLGKCNDSSMGLNSCFNEYTEEVFQWDIMMPRVYQQPHLYFDSFGSAFR
                     SLYEIISLEGWVDLLEDIMNSTGVGSIPSAFSSASSAAFLVLFNFLSMVFILNLFVSF
                     IITNHAKTTGQAYYTIEEKSWLESLKLLTQVKPKAIPNLLEISNFRKFCYRIAVEKTN
                     FYYAMFLQIVLYVHILMLLTKRYTKSTTKTSADTIYFMISTTIFLIQELLRLCGEGLH
                     LYIKQKWNIIRLIILMDSFVLTIIGFSVPYIWVWFHNMKEVFHLIFFLFLIPQNDMLS
                     ELIETAMASLPPILSLTYTWAILFLVYAIALNQIFGLTRLGPNTTDNLNFRTVIKSLI
                     ALFRCSFGEGWNYIMDDLTVLEPYCYVNDVGNSDCGSLTYAYILLMSWNVLSMYIFMN
                     MFITLIIGNFSYVYRGGGAKSEINRSEIRKFVEAWAKYDSDGTGELDFSYLPRLMHSF
                     DGPLSFTIWEGRLTIKNLVANYMEVNPNDPYDVKVDLEGLNKELSTLDKGKVLQRRLQ
                     YRRFVQEVYYTNAYRGALKFSNLLQQIPLYTAYNPRECLGIDHYVRYLYTMGKVDKYL
                     DNRRNVDVLDMVVTRWKYRFRKNHGANNENHLLTRVTPVDQISEVNFPDSSEEVNQNV
                     LPPLTTPRMDFGVNNFMWSPRNAEHSHNPFENLSTSEEHEADDI"
     gene            complement(560500..560570)
                     /gene="NDAI0Dtrna7G"
                     /locus_tag="NDAI_0Dtrna7G"
                     /db_xref="GeneID:11495061"
     tRNA            complement(560500..560570)
                     /gene="NDAI0Dtrna7G"
                     /locus_tag="NDAI_0Dtrna7G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11495061"
     gene            <560987..>564241
                     /gene="NDAI0D02420"
                     /locus_tag="NDAI_0D02420"
                     /db_xref="GeneID:11494836"
     mRNA            <560987..>564241
                     /gene="NDAI0D02420"
                     /locus_tag="NDAI_0D02420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669751.1"
                     /db_xref="GeneID:11494836"
     CDS             560987..564241
                     /gene="NDAI0D02420"
                     /locus_tag="NDAI_0D02420"
                     /inference="similar to DNA sequence:INSDC:YGR218W"
                     /note="similar to Saccharomyces cerevisiae CRM1 (YGR218W);
                     ancestral locus Anc_5.111"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669799.1"
                     /db_xref="GeneID:11494836"
                     /db_xref="GOA:G0W9U5"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR014877"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0W9U5"
                     /translation="MDAILDFSKELDINALDQVVDTFYKGSGVQQKQAQEVLTKFQEH
                     PDAWQRADQILQFSNNPQAKFIGLSILNKLISTKWKLLPAEQRIGIRNFVVGMIITMC
                     QDDMVFQTQKNLISKSDLTLVQILKQEWPQNWPEFIPELISSSTSSLNVCQNNMVILK
                     LLSEEVFDFSAEQMTQAKALHLKTSMAKEFEQIFKLCFQVLEQGSAPSLVVAALESLL
                     RYLHWIPNRYIFETNLLELLSTKFLGSSDIRAITLKCLTEVSSLRIPPNAPAMKTQTV
                     LYFQNTLQQIALHVIPVSTDLKSTYATANGTDQSFLQDFAMFLTTYLTHHRDLLESDE
                     SLRELLLSAHQYLIELSKIDERELFKMTLDYWNNLVSDLFYEVQKLPLNELNPLMQLS
                     VGTQTISTGAGAMNPDFLKRFPLKKHIYENICSQLRWVIIENMVRPEEVLVVENDEGE
                     IVREFVKESDTIQLYKSEREVLVYLTHLNVEDTEQIMVNKLARQIDGSEWSWHNINTL
                     SWAIGSISGTMNEETEKRFVVTVIKDLLALTEKKRGKDNKAVVASDIMYVVGQYPRFL
                     KAHWNFLKTVVLKLFEFMHETHEGVQDMACDTFIKIVQKCKYHFVVQQPRETEPFIQT
                     IIRDIQSTTSDLQPQQVHTFYKACGIIISEERNIAEKNRLLSDLMALPNMAWDAIVQQ
                     STANPALLLDSETVKIIANIIKTNVAVCSSMGADFYSQLGHIYFNMLQLYRAVSSMIS
                     EQVALDGLIATKTPKVRGLRTIKKEILKLIETYISQAKNLEEVVKDLVDPLLNAVLED
                     YLNNVPDARDAEVLNCMTTVVSKVGHMIPQGVILILQSVFECTLNMINKDFTEYPEHR
                     VEFYELLRVINEKSFGAFLELPPTAFKLFIDAICWAFKHNNRDVEVNGLQIALDLVKN
                     VERMGNTPFANSFYKNFYFTFVSETFYVLTDSDHKSGFSKQCLLLMKLISLVYENKIQ
                     VPIYDESSAPQGTSNQVYLNQYLANMLGNAFPNLTGEQITNFLGALTKQYGDLSKFNG
                     ILRDFLVQIKEIGGDPTDYLFAEEKENALQEQNRIQREKAAMVGGLLKPSELGD"
     gene            complement(<564682..>565497)
                     /gene="NDAI0D02430"
                     /locus_tag="NDAI_0D02430"
                     /db_xref="GeneID:11495062"
     mRNA            complement(<564682..>565497)
                     /gene="NDAI0D02430"
                     /locus_tag="NDAI_0D02430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669752.1"
                     /db_xref="GeneID:11495062"
     CDS             complement(564682..565497)
                     /gene="NDAI0D02430"
                     /locus_tag="NDAI_0D02430"
                     /inference="similar to DNA sequence:INSDC:YGR220C"
                     /note="similar to Saccharomyces cerevisiae MRPL9
                     (YGR220C); ancestral locus Anc_5.110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669800.1"
                     /db_xref="GeneID:11495062"
                     /db_xref="GOA:G0W9U6"
                     /db_xref="InterPro:IPR000597"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR019927"
                     /db_xref="UniProtKB/TrEMBL:G0W9U6"
                     /translation="MLIPPSMTIIATTICKRTISTKASLIAPSIRSTMKSSPPPINHS
                     PIQAFSRKWLPKDCGLIGQKIGMAPFFDPETGDRIAATILEINNVEVIMHRTLESNGY
                     WANQVGYGTKNYLNETRQMLGHFASKLINPKLKIAEFRVKESSGLLPLGTHLKPSFFK
                     VGQFVDLKSVSKGKGFAGVMKKYHFKGLRASHGTSVMHRHGGSYGQNQDPGRILPGKK
                     MPGRMGGKQVTVQNAQILKVDDANNVIWVKGSIPGPKDTFVKIQEAIKKMDKN"
     gene            complement(<565933..>567972)
                     /gene="NDAI0D02440"
                     /locus_tag="NDAI_0D02440"
                     /db_xref="GeneID:11495063"
     mRNA            complement(<565933..>567972)
                     /gene="NDAI0D02440"
                     /locus_tag="NDAI_0D02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669753.1"
                     /db_xref="GeneID:11495063"
     CDS             complement(565933..567972)
                     /gene="NDAI0D02440"
                     /locus_tag="NDAI_0D02440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669801.1"
                     /db_xref="GeneID:11495063"
                     /db_xref="UniProtKB/TrEMBL:G0W9U7"
                     /translation="MLILTDPTSMKPSRTRMFLAKRTTSESTTMGLTIGIPVGVAVLF
                     FSLISTIIIYKKHQKRKNNHNKVPTTTALSIEKQTVINNDDIDLKIPDSTPHLMNISQ
                     FDIVQSPTSSSPTSSSSLIPSNFKYNPSSNGTIASTKEVIETDNSLNFNNDSTITDDF
                     DFVEKNISNKISKVETITTVSKDDSTNNNMISNKDVLYTTISPETKPNNKHKDNINGH
                     TGSDKFNVAFDLLEGNESNISKHSTNNIGTIDSEKITPDLHESKHDTHIYSAAKNSIM
                     EDIEFVNADGALESLKNTGQIDKNTDSFGQIDDNSSNFMIDNNNNIKTDKEAANGHQI
                     PSVDKFDFENAIEFEAASSSNLLHGPILDLVSLKDHSPEDELVESGGRPINETCEDAE
                     EQLVEPIELEKVECQQEDIQFLDEVNHEQIDYDRSQESIEDEIEEKENVIRIASIYEL
                     YLEDFRKSFLSTSSSISSPVLNNHTTKTDIDNTEDTINDDNKENDTSTLFPLQERLDA
                     STPLETTFLSSASSNSNPKGRFLPIINQYPEQQYLIETPKSESNSTFTHAHPEVKTPK
                     GLTPSPPSATDSASIYNLKSIIDKMNDGLGFETSPTDTSRRLPKLKVPIMFRNKDPHS
                     KQRDPNEELKIDPTEDLLNDYSFTSESDELRMIHTAPPSTNILPRTIKGTALINQ"
     gene            <569592..>570470
                     /gene="NDAI0D02450"
                     /locus_tag="NDAI_0D02450"
                     /db_xref="GeneID:11495064"
     mRNA            <569592..>570470
                     /gene="NDAI0D02450"
                     /locus_tag="NDAI_0D02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669754.1"
                     /db_xref="GeneID:11495064"
     CDS             569592..570470
                     /gene="NDAI0D02450"
                     /locus_tag="NDAI_0D02450"
                     /inference="similar to DNA sequence:INSDC:YGR222W"
                     /note="similar to Saccharomyces cerevisiae PET54
                     (YGR222W); ancestral locus Anc_5.106"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669802.1"
                     /db_xref="GeneID:11495064"
                     /db_xref="UniProtKB/TrEMBL:G0W9U8"
                     /translation="MSKNVEIIDNVLKHLKTTGKIVGTTPALKYVIDPGNRSRILKFQ
                     SYNPSLTHDDFVSLIPSNIFSENINGLDDKSKGKKNDDQFLLIKKRDPKYFQFKDQYN
                     LIFRSYNSLREYRRETQMSKLNKIRVNFKLPNSNFESVSILENYQNYIKNLSNAYDSM
                     ESYRENLSTFEKFPLDTPEESTISTEISKLRLLQDKIKAIESKSLLVWHLPTNLTPTQ
                     IRKSFWLYAIKHCFPLYWNNSNSLYYFAFDNVDDAKDFRRNFHGISFNTWSSSSSSSE
                     QGEDESDFKMLIEQFA"
     gene            <570844..>571038
                     /gene="NDAI0D02460"
                     /locus_tag="NDAI_0D02460"
                     /db_xref="GeneID:11495065"
     mRNA            <570844..>571038
                     /gene="NDAI0D02460"
                     /locus_tag="NDAI_0D02460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669755.1"
                     /db_xref="GeneID:11495065"
     CDS             570844..571038
                     /gene="NDAI0D02460"
                     /locus_tag="NDAI_0D02460"
                     /inference="similar to DNA sequence:INSDC:YBL001C"
                     /note="similar to Saccharomyces cerevisiae ECM15
                     (YBL001C); ancestral locus Anc_3.206"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669803.1"
                     /db_xref="GeneID:11495065"
                     /db_xref="InterPro:IPR002767"
                     /db_xref="InterPro:IPR029756"
                     /db_xref="UniProtKB/TrEMBL:G0W9U9"
                     /translation="MSPKLFCLADVCMVPIGTSTASVSDFVASVEIKIRESELKSTLH
                     SAGTTIEGPWDDIMNLIGIS"
     gene            complement(<571412..>572842)
                     /gene="NDAI0D02470"
                     /locus_tag="NDAI_0D02470"
                     /db_xref="GeneID:11495066"
     mRNA            complement(<571412..>572842)
                     /gene="NDAI0D02470"
                     /locus_tag="NDAI_0D02470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669756.1"
                     /db_xref="GeneID:11495066"
     CDS             complement(571412..572842)
                     /gene="NDAI0D02470"
                     /locus_tag="NDAI_0D02470"
                     /inference="similar to DNA sequence:INSDC:YGR223C"
                     /note="similar to Saccharomyces cerevisiae HSV2 (YGR223C);
                     ancestral locus Anc_5.105"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669804.1"
                     /db_xref="GeneID:11495066"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0W9V0"
                     /translation="MNIKHPLDDTKGHTSNKPQFLHVNFNQDDSCFSCALEDGFRIYN
                     TNPLQVKLTKKFTINTNTKTFPSKVNGTGIGYTRMLYRTNYIALLGGGTNPKYPMNKL
                     IIWDDLLRKESMVLKFMSIIKEVYLSRSFIIVQFDKHFEIYNFKQNPKKLFLNKNFEI
                     KLGSNIDFKVSNINASIVQNALAFVPPRTRGQIQIARISSPSNDSARSDDSDVDEDFP
                     TLIIKAHKSDIRLIKLNHQGTMIASCSEKGTIIRIFSTHNGSLIKEFRRGIDSVEIYD
                     MEFSPKGNKLAIISDKQTLHIFQVYDHNNQFNKIHRLEKSNWGNWNKNLNLKYFDSVW
                     SMCSIHLQNPKLLLSKPRNNSISDHHTNNTSGKNNLIDLEFEKDRCKIGWCNNSTQTS
                     RNSVRDGKSSKDYRISDDADDDNDNDNDEEDSLVLVWKDCGIWEKYVILEKDVSTTAA
                     TVSNKDNHYSVNESLRTENHNNNINE"
     gene            complement(<574299..>574784)
                     /gene="NDAI0D02480"
                     /locus_tag="NDAI_0D02480"
                     /db_xref="GeneID:11495067"
     mRNA            complement(<574299..>574784)
                     /gene="NDAI0D02480"
                     /locus_tag="NDAI_0D02480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669757.1"
                     /db_xref="GeneID:11495067"
     CDS             complement(574299..574784)
                     /gene="NDAI0D02480"
                     /locus_tag="NDAI_0D02480"
                     /inference="similar to DNA sequence:INSDC:YBR244W"
                     /note="similar to Saccharomyces cerevisiae GPX2 (YBR244W);
                     ancestral locus Anc_6.160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669805.1"
                     /db_xref="GeneID:11495067"
                     /db_xref="GOA:G0W9V1"
                     /db_xref="InterPro:IPR000889"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029759"
                     /db_xref="InterPro:IPR029760"
                     /db_xref="UniProtKB/TrEMBL:G0W9V1"
                     /translation="MSEFYKLTPKDKKGEDYPFTQLEGKVVLIVNVASKCGFTPQYKE
                     LESLYKKYQDKGLVILGFPCNQFGHQEPGTDEQIGQFCQLNYGVTFPILKKINVNGND
                     MDPVYEFLKSKKSGLLGFKGIKWNFEKFLIDRKGEVVQRYASLTKPSSIEQDIERLLN
                     K"
     gene            <575553..>577499
                     /gene="NDAI0D02490"
                     /locus_tag="NDAI_0D02490"
                     /db_xref="GeneID:11495068"
     mRNA            <575553..>577499
                     /gene="NDAI0D02490"
                     /locus_tag="NDAI_0D02490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669758.1"
                     /db_xref="GeneID:11495068"
     CDS             575553..577499
                     /gene="NDAI0D02490"
                     /locus_tag="NDAI_0D02490"
                     /inference="similar to DNA sequence:INSDC:YGR225W"
                     /note="similar to Saccharomyces cerevisiae AMA1 (YGR225W);
                     ancestral locus Anc_5.104"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669806.1"
                     /db_xref="GeneID:11495068"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0W9V2"
                     /translation="MPYNKCNTQQNPFVKESKEIHSFHKKPLTLSKPPNCTTTPVVTD
                     RFIPFATSKKAYRTYTRNKNYNDDTTDLYMEQSPSPDRLSSPEFFTDLRTTGNYQAIS
                     SSSMDNNDTIDTSLDSISNETRKVNKNKKRRKVPTGNEKYQTFISNSLGFPGTNKVFN
                     FISPTANLNIFKLNNNNKKGQNDPSLKPSFEYLDPLLMVPSMTPNETRYLIATSNVTM
                     ADKAKPFQRASRTVQCHSPYKVLDAPSLRNDFYSNLISWSNRTNNVLVALGCSVYLWS
                     ESFGALQILNQKFLNDRNKDLVTCVSFDSTNSSSNIYDSTYFLVGTKNGSLLLFDQFI
                     SLNFLLDNNFNKKKSNDDNTEDKRLLKPISQFDSTASSCFCCIQWISNSKFLVGDDSG
                     SITFFKINNTNIEFLNKFKAQNQQVCGMLYCSFFLFFSLLVFFTNFYNLFLLLGISIN
                     SNNSLLAVGGNDNSCTLWNIENIYKPEFKFILPHLAAVKAVTFCPWSSSLLATGGGSK
                     DRKIKFWHTKTGILLNEFKTCGQVTSLIWSKSKKQIVATFGFNDTENPTLLKVYSYPK
                     MIEILQVKSPAPLRVLTAVLSPSSTSICIAANDETIRFYKLWSEKDDLIKQLNETGVY
                     GSDIIEYLEGIVSNASTSNNKVIR"
     gene            <577882..>579471
                     /gene="NDAI0D02500"
                     /locus_tag="NDAI_0D02500"
                     /db_xref="GeneID:11495069"
     mRNA            <577882..>579471
                     /gene="NDAI0D02500"
                     /locus_tag="NDAI_0D02500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669759.1"
                     /db_xref="GeneID:11495069"
     CDS             577882..579471
                     /gene="NDAI0D02500"
                     /locus_tag="NDAI_0D02500"
                     /inference="similar to DNA sequence:INSDC:YGR227W"
                     /note="similar to Saccharomyces cerevisiae DIE2 (YGR227W);
                     ancestral locus Anc_5.101"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669807.1"
                     /db_xref="GeneID:11495069"
                     /db_xref="GOA:G0W9V3"
                     /db_xref="InterPro:IPR016900"
                     /db_xref="UniProtKB/TrEMBL:G0W9V3"
                     /translation="MSVNNNEQRHEQQEDDDEVIQILAPGIQRNFKEEITNAFILNFL
                     SYPLILLYFLITFTYVTSKTIPYEFIDEKFHINQTLTYLNGHWTQWDPKITTPPGLYI
                     LGWLNYKIVHIIPFIKSWFSDLTTLRLTNLFGGLIVLPIFILRPIFQLNAVGFWPVSL
                     MCFPLLSTFYYLYYTDVWSTVFILWSLTVALTLPFGDNKWSIWFSSGLALISCLFRQT
                     NIVWTGFIMIIVVERKAIIDKKFDNHTFNNFLKLFIHSIDQFNMLVLPYFVNFVLFAL
                     FLIWNRSITLGDKSNHSAGIHLVQLFYCFTFLTVLSLPLWYSKVFMKLYLIRWRLKLF
                     RTIFELLMIMLVIRYFTKIHPFLLADNRHYTFYLFKKLIGNKHKLIKYFLMAPIYHFS
                     TFVYMGLIKESELNLTLTTQQIFKNSYELPIQLTHISRLALVVCTIFTIVPSPLFEPR
                     YYILPYFFWRIFVSPVPEPILATIPIPKEDEEQRYVVSSTNRQLLEMIWFLLIDLVTL
                     IIFIKYSFSWSDEEFPQRIIW"
     gene            complement(<579785..>581437)
                     /gene="NDAI0D02510"
                     /locus_tag="NDAI_0D02510"
                     /db_xref="GeneID:11495070"
     mRNA            complement(<579785..>581437)
                     /gene="NDAI0D02510"
                     /locus_tag="NDAI_0D02510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669760.1"
                     /db_xref="GeneID:11495070"
     CDS             complement(579785..581437)
                     /gene="NDAI0D02510"
                     /locus_tag="NDAI_0D02510"
                     /inference="similar to DNA sequence:INSDC:YGR229C"
                     /note="similar to Saccharomyces cerevisiae SMI1 (YGR229C);
                     ancestral locus Anc_5.100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669808.1"
                     /db_xref="GeneID:11495070"
                     /db_xref="GOA:G0W9V4"
                     /db_xref="InterPro:IPR009203"
                     /db_xref="InterPro:IPR018958"
                     /db_xref="UniProtKB/TrEMBL:G0W9V4"
                     /translation="MNIFKKKIKEWAYSFSTEDRYAEYDPNTTPSFNMAQRNTSAMGA
                     THNNNGTGHPHMTSSHDDLSNDELNIGMADPTIIPHKPEGYYNDDDLSIHNTKDGVAD
                     ALLAWRHIDSWTDQHNPDLSATLSDPCTLNDIANVEEDLEIFFPPSVKASFRVHDGQE
                     DLESMTGTSGIIYGMPLMTLDQIVAMSQTWRKVAKNMNKIHHSNNQSRSNLPSNNNST
                     SSFHQQQQQQQQQQQAKNQFKLPFIPEQQSFPPNHILTVYAHPNWIPLLTDNAGNHVG
                     VDLAPGPMGKYGQIIIFGREWDTKYVVASNWGEFLLSFANDLEAGNWLLVDDNDDFFA
                     GDGELVYRDKSINGVPQDYLEVLKKRTIKKYQQEQQRENQSQQQQQQQQMNENIHSTY
                     NNNLKTPSIIKENSVYSTRTVTDTDGSSDMKNEDYRVNVLSTPVPDKELPELPHVEKK
                     QEEEEEMEQKPEHKDEVHEDLSRIEDELDNDFENDEAELTKDEELIGEEPSTTNEQQD
                     IVADEQTKEDNEEDRKEQQEQHQEKVDETVDDLTESFENVAL"
     gene            <582516..>583169
                     /gene="NDAI0D02520"
                     /locus_tag="NDAI_0D02520"
                     /db_xref="GeneID:11495071"
     mRNA            <582516..>583169
                     /gene="NDAI0D02520"
                     /locus_tag="NDAI_0D02520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669761.1"
                     /db_xref="GeneID:11495071"
     CDS             582516..583169
                     /gene="NDAI0D02520"
                     /locus_tag="NDAI_0D02520"
                     /inference="similar to DNA sequence:INSDC:YGR230W,YHR152W"
                     /note="similar to Saccharomyces cerevisiae BNS1 (YGR230W)
                     and SPO12 (YHR152W); ancestral locus Anc_5.99"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669809.1"
                     /db_xref="GeneID:11495071"
                     /db_xref="InterPro:IPR007727"
                     /db_xref="UniProtKB/TrEMBL:G0W9V5"
                     /translation="MTTSVNFNSNIKQTPSLASNNTNAANVNSSEFAPIIKSTLEKPH
                     GHQPQYYKHENKPLISSSKSNILLHTFPKDKFHTFKKFSNNNNFDETNKENHYTHLPI
                     GTNTSINSLHKSIFKKHTFNTYNSKISNAQLKKLNSIKMNNKFFSPTDKLLSPCSQKL
                     NDHKSKLFVNKSNPTKLNFALNKRNMKKTNTINNSDNATTNNNDDILMTGSDEDEDY"
     gene            complement(<583429..>584379)
                     /gene="NDAI0D02530"
                     /locus_tag="NDAI_0D02530"
                     /db_xref="GeneID:11495072"
     mRNA            complement(<583429..>584379)
                     /gene="NDAI0D02530"
                     /locus_tag="NDAI_0D02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669762.1"
                     /db_xref="GeneID:11495072"
     CDS             complement(583429..584379)
                     /gene="NDAI0D02530"
                     /locus_tag="NDAI_0D02530"
                     /inference="similar to DNA sequence:INSDC:YGR231C"
                     /note="similar to Saccharomyces cerevisiae PHB2 (YGR231C);
                     ancestral locus Anc_5.98"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669810.1"
                     /db_xref="GeneID:11495072"
                     /db_xref="GOA:G0W9V6"
                     /db_xref="InterPro:IPR000163"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="UniProtKB/TrEMBL:G0W9V6"
                     /translation="MNKGPSDFQKYARVIQQQLSKTNRGPYGSSGPRGGPGGPRGALA
                     GLGGLILLGGSAMLLNSALFNVDGGHRAIVYSRISGVSPRIYPEGTHFAIPWIETPII
                     YDVRAKPRNVASLTGTKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVN
                     EVLKAVVAQFNASQLITQREKVSKLIRENLMGRANRFNILLDDVSITFMTFSPEFTNA
                     VEAKQIAQQDAQRAAFVVDKARQEKQGMVVRAQGEAKSAELIGDAIKKSKDYVELKRL
                     DTAREIARILAKSPNRVVLDNESLLLNTLVDARFDAKKDK"
     gene            <584626..>585336
                     /gene="NDAI0D02540"
                     /locus_tag="NDAI_0D02540"
                     /db_xref="GeneID:11495073"
     mRNA            <584626..>585336
                     /gene="NDAI0D02540"
                     /locus_tag="NDAI_0D02540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669763.1"
                     /db_xref="GeneID:11495073"
     CDS             584626..585336
                     /gene="NDAI0D02540"
                     /locus_tag="NDAI_0D02540"
                     /inference="similar to DNA sequence:INSDC:YGR232W"
                     /note="similar to Saccharomyces cerevisiae NAS6 (YGR232W);
                     ancestral locus Anc_5.97"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669811.1"
                     /db_xref="GeneID:11495073"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G0W9V7"
                     /translation="MAGQETGYPLHQACMNNELSKVQEIVEHMTNPSVEIVAKDSDNR
                     TALHWAISFQNEEIVTYLLSHMKDADVDTLKDDSLWTPIHIASSVGNSNILKQLIEGR
                     NVDLNLQTVQGTTPIHLAVSKKHLQICKFLLENGASVRIKDKQGQLPLHRAASIGSMG
                     LVEMLCKEGRSPVNVKDKQGWTPLFHALAEGHGDVAVLLVNTFNADYDLEDNNGIKAV
                     DVSLNENVKHFFIKHVHE"
     gene            complement(<585458..>589063)
                     /gene="NDAI0D02550"
                     /locus_tag="NDAI_0D02550"
                     /db_xref="GeneID:11495074"
     mRNA            complement(<585458..>589063)
                     /gene="NDAI0D02550"
                     /locus_tag="NDAI_0D02550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669764.1"
                     /db_xref="GeneID:11495074"
     CDS             complement(585458..589063)
                     /gene="NDAI0D02550"
                     /locus_tag="NDAI_0D02550"
                     /inference="similar to DNA sequence:INSDC:YGR233C"
                     /note="similar to Saccharomyces cerevisiae PHO81
                     (YGR233C); ancestral locus Anc_5.96"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669812.1"
                     /db_xref="GeneID:11495074"
                     /db_xref="GOA:G0W9V8"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G0W9V8"
                     /translation="MKFGKYLESRQLELPEYNGYFIDYKALKKLIKQLAITTIIPSPN
                     DSNNISSTNLNVDLDSIDESVLYQTLQENKSTFFFKMDRELEKINNFYKEKELNLTIK
                     FNILQSKFNKLKLKLNELSSSSSFSSSSSLSSASQINLIAFKNLFDTFIAFQRDLNHF
                     EQFIELNRTGFSKALKKWDKRSHSHEKEFYLETVVSIQPIFTRNKVTELNDETLSILT
                     ELNDYSINHTKDHDIAQIMNNETNRKSNTSTTPLVPPTNIDINMHTILPPIFKNNNNS
                     NNSTNNTESLESKLDDWYTELINISKLKDHNKKSNQILSFIPNKIEPSFSNTRLLTLW
                     LTKLFKLLIGSPMDDETLSIFYDKGKSFMNLTYNNNITSNNDSDDDAEILTKKNIFHE
                     ATSCLYDSRLFILQNALSSLSPSKTTTTTTTTTTANERINRLKVLLNAKDIYEKTPLH
                     YAAELGKVSFVKLLLKSSLLDNIDPLDTNLRTPLTLAINNNHIDVMELLLTLGNSNPN
                     PKLYSKITNGTNNSKKNLLVNQFFSPISIACHSNNYEAIKLLLNYIPHQINLSTNFDA
                     KGLGTLHIVCKNGADAKLIKLLLAHGADPNRMDDYNKWTPIFYAIQESHPVTVKELLN
                     NGARLNIQDDEGISPLHLVLWESNVEILNILLPYLLTEYIHQRHHNNNVIAHNTLDDL
                     DPMIDLDDDFDMNIHKEKDLTLDANQEDQDFILPPPVIPLRKYGHNYLDKKTLIKISF
                     QSDYDSIQLYKHKELILSKPGRITMTSNLSDLLPRNIILPVGTKHEDENENENGNNNE
                     EKNEAIFQIDSLSEFSIDFEVFPAFGSRIIAKTTAITSTFNPMLLADSTSSVSLPLFD
                     KKLNNIGKLTFNYQIISPYIEKPLQISKYEPYWKSTTNIKQGQIITSSSLLGDFFNLK
                     IFCLNDGTIVCSPNFFIQIQNSVSFFLNDLTKFQLENLLNYDITDVPQSKIPSVTQLK
                     ELLETKKVIQFDTLLSIIPQWIQLIIEVCFPTKEEMNLIPVKISPQININKFIDNILT
                     ILFNHERELRNMGDNLRSLVFKSSNWQVCSVFNWKQPNFPVLLELKSLRYNDSLKRFE
                     NDSPNCLKSMIVTSQEAREKKEQVQNNDVYLQWDDIKIRNMVKFSKNNNLLGVIIPFD
                     VLNLCPSIITAIKKNGLMLIASLNSRDKFIPIKNDEINGIQENESTVHFNSTTNL"
     gene            <589972..>593856
                     /gene="NDAI0D02560"
                     /locus_tag="NDAI_0D02560"
                     /db_xref="GeneID:11495075"
     mRNA            <589972..>593856
                     /gene="NDAI0D02560"
                     /locus_tag="NDAI_0D02560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669765.1"
                     /db_xref="GeneID:11495075"
     CDS             589972..593856
                     /gene="NDAI0D02560"
                     /locus_tag="NDAI_0D02560"
                     /inference="similar to DNA sequence:INSDC:YHR154W"
                     /note="similar to Saccharomyces cerevisiae RTT107
                     (YHR154W); ancestral locus Anc_5.94"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669813.1"
                     /db_xref="GeneID:11495075"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:G0W9V9"
                     /translation="MERSALENLNILFIDVDFDLDFGPNDSTTYASENKPRWYEESIS
                     NLPRSHYHVLNSDDIPVLWPEFTFNDWKKWFLEKFNHHQEEIHIIVSNTINLPFYKMV
                     TYDLMIPVVSIYWLEQVLARSSALDNANTNNTKLFLKFNNFSPSDGNQLLPFKDEIFY
                     ISKSSVTKLEYIFYSKLIQYMGGTMTDLLSTSVTKIVTNDPNDMVCTTINSMEYHDDH
                     KNITLFKEKSNIMFILPCYIIYIFQKIILFQDHNDDNSNDTIPIEEFKLNSNEDDFKK
                     SLVKSNNLWKQILKLKKNTTSGDGKKSQIFKNLYVTVSKSMSKDFNINLQKFITKLIR
                     YHYGKITTKLTDPRTDTLITSTAMDPTYKDCLSTNAKNKCNFIGTPFWILDMHYQATF
                     RSPLENIFWSPIKHLSSSSSSSLKKKNTRFNISYTGFFGLQRLYIHNLILLLNANPMP
                     QLSTKLTTHLISKFDPIETHDNNKKLKIATARGIKIVSSFWLEDSYVKNNGQLIDESQ
                     ISKYQEFHSKRVLAQIHMNETTYLLSASINDKDEGKNTNNDDGMQTEIQGILQSINEN
                     NEVYSMAENIVKESNVVASVIDKEKETDIEIDDDSLEKLRAVEPITKDANDDGLQTGR
                     VAKFRYEGEKDNSKKQERIVESINEEQQVAEQEHDRINEDEDIIITQELLAPLIEHDE
                     MAVNVHVDVSRQLNIQDGELEVISSSQDSHSNDVISNKVIEGKNETEEQDDQSNDDTN
                     RSHSHSNIVTSSPPNAAVDKPVSNNIMSTNKLKKPSPSTKNELVVNTSLEVETTPPMD
                     DNDNSSTTTPIYSMSYPIHDERKDERDKASTISESVKNIFTETPIPTLAPLTSKDDSN
                     HENSSITDNIVGRQEEMDDKYPIEMENAHITEQEAKWNRLKRTYSISKGKEGNEFEDS
                     DRSMTKRTKKIKSDKKNSEFEDDSEIDRYLFDHLSKAAFLHLPLYDIDAIPTNCLEDI
                     TPFETKVLNRLGIRIYFTINSENMNTLNGIIAPKKSRTIKFLKSYSFQPLRYLLLPNF
                     IYDVLKALRQGKRKDDKKNHHYNKLIEPSGVINGDESDSNNLNVEFVDKYFIPNLDIP
                     AQKIYEMTQLKGKLFERYGITNANIFQDITGGVETISSILRSHGIRHINVLKKNTNFA
                     KSDLMRNVQESNNGSIDMLRLNPRTYGENDEPKEQVNVEYLLIAQKSSQIKAFKRVMT
                     KSQSGTDYNGDGNNNMKDAAQESENDRQHVNEASQNASSEDAMATIKMTRVSMAVDWN
                     WCVNSIFSLSCDFKPDNPHVLYALRSPDEPIN"
     gene            <594851..>596050
                     /gene="NDAI0D02570"
                     /locus_tag="NDAI_0D02570"
                     /db_xref="GeneID:11495076"
     mRNA            <594851..>596050
                     /gene="NDAI0D02570"
                     /locus_tag="NDAI_0D02570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669766.1"
                     /db_xref="GeneID:11495076"
     CDS             594851..596050
                     /gene="NDAI0D02570"
                     /locus_tag="NDAI_0D02570"
                     /inference="similar to DNA sequence:INSDC:YGR234W"
                     /note="similar to Saccharomyces cerevisiae YHB1 (YGR234W);
                     ancestral locus Anc_5.93"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669814.1"
                     /db_xref="GeneID:11495076"
                     /db_xref="GOA:G0W9W0"
                     /db_xref="InterPro:IPR000971"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR009050"
                     /db_xref="InterPro:IPR012292"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:G0W9W0"
                     /translation="MLSEQTRTIVKATVPVLEQQGAVITRCFYKNMLGEHTELLNIFN
                     RVNQKKGAQPTALATTVLAAAKNIDDLTPLLEHVKQIGHKHRALQIKPEHYPIVGEYL
                     LKAIKEVLGDAATPEIINAWGEAYGEIANVFISVEKEMYDEAAWKGWEEFTVVDKELV
                     ADDIYQFTVQPVDSTKVNLKNLPIVAGQYITVNTHPIRQDNHYDALRHYSICSISDQG
                     GLKFGVKLESSQNNNPVGLVSEFLHKDVKVGDKLKLSAPAGDFALNEKLIKQNDIPLV
                     LLSAGVGVTPILSMLEKQISVNPERPIYWIQSAYDDGHLAFKKQVNALLEKAPNHKKS
                     VVLTNTSKPIDAEFLKANVPAHADVYLCGSLGFMQTMIDHFGILEHKADMIHYEPFGP
                     KMSTIKV"
     gene            complement(<596569..>597255)
                     /gene="NDAI0D02580"
                     /locus_tag="NDAI_0D02580"
                     /db_xref="GeneID:11495077"
     mRNA            complement(<596569..>597255)
                     /gene="NDAI0D02580"
                     /locus_tag="NDAI_0D02580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669767.1"
                     /db_xref="GeneID:11495077"
     CDS             complement(596569..597255)
                     /gene="NDAI0D02580"
                     /locus_tag="NDAI_0D02580"
                     /inference="similar to DNA sequence:INSDC:YGR235C"
                     /note="similar to Saccharomyces cerevisiae YGR235C;
                     ancestral locus Anc_5.92"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669815.1"
                     /db_xref="GeneID:11495077"
                     /db_xref="InterPro:IPR019166"
                     /db_xref="UniProtKB/TrEMBL:G0W9W1"
                     /translation="MEINFYREPDLVKEGVIPSADTIDLTAAKNDDTTPQLKIQKKTQ
                     EILGDNNLIDGISIRNPNYLNDYIRSQRTKLAGFVEKTNGKINDATSRYIDKEQNITT
                     TIKDLHTNPEEKLLPGLSYTAVAFMTGSILVSKRNFMLRYTVPMVLGISCFSIVMPCT
                     FNNVKHLTYNLENKYMPNFTRRQDMINDKIRKNAAFIRSSMVKNMDIISKPFYKLQGY
                     LPKWMNDTSK"
     gene            complement(<598007..>600352)
                     /gene="NDAI0D02590"
                     /locus_tag="NDAI_0D02590"
                     /db_xref="GeneID:11495078"
     mRNA            complement(<598007..>600352)
                     /gene="NDAI0D02590"
                     /locus_tag="NDAI_0D02590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669768.1"
                     /db_xref="GeneID:11495078"
     CDS             complement(598007..600352)
                     /gene="NDAI0D02590"
                     /locus_tag="NDAI_0D02590"
                     /inference="similar to DNA sequence:INSDC:YGR237C"
                     /note="similar to Saccharomyces cerevisiae YGR237C;
                     ancestral locus Anc_5.90"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669816.1"
                     /db_xref="GeneID:11495078"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G0W9W2"
                     /translation="MATPKFIKHISFDDLSPSLVDSQATELKKGNYHIGLNNHFIHIP
                     PQYNPLYKTRSTLEDQSSDSEQRETRPIITDVEHQTYKPKSQMQVPTMYSHLFNDKVD
                     MSTSLTRSRSESPMQARRRQRAEMYGAKLPPPPSKPVLRKDSTIHFSGDVDDPSRIED
                     IDIADLDAETEMKMTKITQDNTAKNSGSKHGYTQELFSNLNEVEDRIENRSRRASVDD
                     PDKKRTKSFAGMSDEELAQLENFYISKGRSNKSNLTDYDFGEQASSAHWVGDKGSSNG
                     NIPVLSKTMYDSLTLTYPSRPSVNYRAISMTSQHSDFESYLTRVKEELASKEKESLTA
                     LRTVCCYISGRRFTWSTLDWFVENMAKDGDHLVIMTVVPEFEELVEKSLHSIYKERIN
                     STGSSPSLTRSGASSFKESKNESKVSTGLYIEAIYEEARKKCREILDYYVKRLVNKNK
                     IMRVTIEMVKNNSSKKAVSAIEGLYKPSFQLFSTVSTNIQIKFRNGYVKFPFFIMKHF
                     FIPVFIIPFEFIDPHLLMERDEENQNTTKTSDNYQLKRKDRLKWLDNLIAKTLKNPFS
                     TAAVDSKPVASDDEELSDNSVTGYFPVSKEQKYKIDLFERMGYVRPVSSRALLLQNND
                     IVFDKDGKKITQTSSRTSRRSSRIQFNDGGIYKVKSLIDGADMTHDSGKNYDNINRSS
                     KSNEIRKTKSSASGTLHHHDHLLPTVSPSYGKLPRVQNGHMHLAKVKSSESQKTKHKN
                     VRGTSTSKTSTSKTPTTSKPSEKKKSKKSFGSMFKKVFSSK"
     gene            complement(<600880..>604383)
                     /gene="NDAI0D02600"
                     /locus_tag="NDAI_0D02600"
                     /db_xref="GeneID:11495079"
     mRNA            complement(<600880..>604383)
                     /gene="NDAI0D02600"
                     /locus_tag="NDAI_0D02600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669769.1"
                     /db_xref="GeneID:11495079"
     CDS             complement(600880..604383)
                     /gene="NDAI0D02600"
                     /locus_tag="NDAI_0D02600"
                     /inference="similar to DNA sequence:INSDC:YGR238C,YHR158C"
                     /note="similar to Saccharomyces cerevisiae KEL2 (YGR238C)
                     and KEL1 (YHR158C); ancestral locus Anc_5.88"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669817.1"
                     /db_xref="GeneID:11495079"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:G0W9W3"
                     /translation="MAPFKFGKKSNKDKNKREFSNESNGTLNHSPGSKQVSTPPKTRL
                     PMASAFHPFQKQHPQQQQQQQQQQTQAPVSPPRDQLPSEHNTQQQPFISHNIHPQQQE
                     QQPQQHSRIFMTPTPAGQRNVSAASSTMPMAYSQTLGNNLPSYNEPTDYHKLHPTTIW
                     NRIKLQNSPFPRYRHVASSYVSDDGKIYVIGGLHDQSVYGDTWILSYENNGLSTTITS
                     KTVDISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGSMDDDIYLFNINSYKWTIP
                     KPVGQRPLGRYGHKISIIATSQMKTKLYLFGGQFDDTYFNDLVVFDLSSFRRPDSHWE
                     FIRPKSFIPPPLTNHTMCSYDHKLWVFGGDTLQGLTNQVFMYDPVDNDWCVVETFANN
                     NDVSNIPPPIQEHAAVLYKDLMCVIGGKDESDNYLNDVYFLNLKTLKWFKLPFYKEGV
                     PQGRSGHSVTLLKNDKILIMGGDKFDYANIDSFDFHTSDTNMGKGTILYVLDLSNLEK
                     LCPGIFNNNFENSSPIKFNPTTPPINSYSRNIESTNNNNSTPMNNNGTLPTSIAQNIL
                     TPYAQPQREEEEEETVTKTAIPKSETEAAVAKLSPYAGQNELANMSPEEKVVSSLNHN
                     ATLSPTYPNEKPRISHSSSSDLNATIGERHPLDSPDVERTKEFDTVQEDINVANLPKS
                     ASPVPPPRLPSPSPSDSNAASTLSSPEMSKHSSRSPVKLDDPILVTKGPMNSLAMKGT
                     EGNGNGGSETQFESAIDSDVEIDHPHSETDVSAPGDSYHADDDDQHTDVIPSLDAAHD
                     ETKHIHDDNDDGDEKGEITIDRVVLEKMRNELYELKTSSKENAKIASDHIKELEKELE
                     EVKQNHSFEHDSLEKSLLEDKLHEFENLLSSKFLDVEHLNEIIKQQNKTIETYELEPI
                     YKKKYEELQRDYEFVTEENDTLKKEATRYELDLRNNIISYSSSLDELLSHWKQMTIMK
                     NQKLDDGMKSEVAIEDDNGHHKSVVDKLSNRLDDLIAKSQEMSESKDKLSKEYQSLEL
                     KHSTLSQELLSKENELEKTEKNYKDSLDAVATASKALKISQQEVEKYKLLNKKLQLEL
                     EREQIMSSSSPDDSVTGMSGTTNVSEQPSHSTARETHLNMKISNLEAELFIIKQERDS
                     MKDEMLELKKKLLTMDSTEVA"
     gene            complement(<605080..>605910)
                     /gene="NDAI0D02610"
                     /locus_tag="NDAI_0D02610"
                     /db_xref="GeneID:11495080"
     mRNA            complement(<605080..>605910)
                     /gene="NDAI0D02610"
                     /locus_tag="NDAI_0D02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669770.1"
                     /db_xref="GeneID:11495080"
     CDS             complement(605080..605910)
                     /gene="NDAI0D02610"
                     /locus_tag="NDAI_0D02610"
                     /inference="similar to DNA sequence:INSDC:YGR239C,YHR160C"
                     /note="similar to Saccharomyces cerevisiae PEX21 (YGR239C)
                     and PEX18 (YHR160C); ancestral locus Anc_5.86"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669818.1"
                     /db_xref="GeneID:11495080"
                     /db_xref="UniProtKB/TrEMBL:G0W9W4"
                     /translation="MGTPFCETNPVKRLLSTKDQNYGPFAFNGNRMPNTSHQVPYQVP
                     YNGNGSSLQQQTFERDQVFLNENPQLLQFSPYSNGSNHMSLPVHQNNRTAFNGTSNNN
                     ACNSSNDAGSDWVPEFSSMQINDPLEFSQEYKKLYSNYESSKIPGKSTSNSINNQSAQ
                     FQLRNKSQLHPQMGSSSQQYNNNMQQQQHQQQHSNQNIDSYFDLEFKSVEEELSRRNE
                     DDTLMTDQERTPMFDEEQSEFQKIAMDIIDSCTTPLSTAESTNVNSKLQRSNFFGLMR
                     "
     gene            complement(<606774..>609737)
                     /gene="NDAI0D02620"
                     /locus_tag="NDAI_0D02620"
                     /db_xref="GeneID:11495081"
     mRNA            complement(<606774..>609737)
                     /gene="NDAI0D02620"
                     /locus_tag="NDAI_0D02620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669771.1"
                     /db_xref="GeneID:11495081"
     CDS             complement(606774..609737)
                     /gene="NDAI0D02620"
                     /locus_tag="NDAI_0D02620"
                     /inference="similar to DNA sequence:INSDC:YGR240C"
                     /note="similar to Saccharomyces cerevisiae PFK1 (YGR240C);
                     ancestral locus Anc_5.85"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669819.1"
                     /db_xref="GeneID:11495081"
                     /db_xref="GOA:G0W9W5"
                     /db_xref="InterPro:IPR000023"
                     /db_xref="InterPro:IPR009161"
                     /db_xref="InterPro:IPR015912"
                     /db_xref="InterPro:IPR022953"
                     /db_xref="UniProtKB/TrEMBL:G0W9W5"
                     /translation="MASQGTCYGVAFRSVVTTDDTLFQETIQFYHKLGFSTIKDFNKF
                     KNSDNHLLSVGTSQDSIKEVWLEAFKLSEIDGQGFRVPQQEAANKNQSQGALLKVRQV
                     MSQTPLPNESLNVIYFTAALNQIISKFPSAKKITDYLYILTDPLGNELAFTSFASPMD
                     SNPMTDASCFQDPASATTSAGSETVNASTSAINLLKQSLAGQKKKKIAVMTSGGDSPG
                     MNAAVRAVVRTGIHFGCDVFAVYEGYEGLLRGGKYLRQMAWEDVRGWLSEGGTLIGTA
                     RSMEFKKREGRKRAAGNLIAEGIDALVVCGGDGSLTGADLFRHEWPSLVEDLVKEGTF
                     TEAQVAPYKNLKIVGLVGSIDNDMSGTDSTIGAYSALERICEMVDYIDATAKSHSRAF
                     VIEVMGRHCGWLALMAGIATGADYIFIPERAVPHGKWQEELKQVCQRHRAKGRRNNTI
                     IVAEGALDDQLNPVTADNVKDALIELGLDTKVTILGHVQRGGTAVAHDRWLATLQGVD
                     AVKAILEMTPETPSPLIGILENKIIRMPLVESVKLTQSVAAAIENKDFDKAISLRDTE
                     FIELYENFLSTTVRDDGSEMLPVTERLNIGIVHVGAPSAALNAATRAATLYCLSHGHK
                     PLAIMNGFSGLIQTGEVKELEWIDVENWHNLGGSEIGTNRSVAAEDLGTIAYYFQKIK
                     LDGLIILGGFEGFRSLKQLRDGRSQHPIFNIPMTLIPSTISNNVPGTEYSLGVDTCLN
                     ALVNYTDDIKQSASATRKRVFVVEVQGGHSGYIASFTGLITGAVSVYTPEDKIDLSSI
                     REDLTLLQENFRHDKGENRNGKILIRNEEASSVYSTQLIADIISESSKGSFGVRTAIP
                     GHAQQGGVPSSKDRVVSSRYAVKCIKFIEQWNKKNQTPGSNVDAKILRFTFDSQGEKI
                     STVEHEDDSAAVICVNGSHITFKPIAGLWENETNVELRKGEEIHWTEFNKIGDILSGR
                     LRLRDEVAALSAESN"
     gene            complement(<611020..>611304)
                     /gene="NDAI0D02630"
                     /locus_tag="NDAI_0D02630"
                     /db_xref="GeneID:11495082"
     mRNA            complement(<611020..>611304)
                     /gene="NDAI0D02630"
                     /locus_tag="NDAI_0D02630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669772.1"
                     /db_xref="GeneID:11495082"
     CDS             complement(611020..611304)
                     /gene="NDAI0D02630"
                     /locus_tag="NDAI_0D02630"
                     /inference="similar to DNA sequence:INSDC:YOR189W"
                     /note="similar to Saccharomyces cerevisiae IES4 (YOR189W);
                     ancestral locus Anc_6.98"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669820.1"
                     /db_xref="GeneID:11495082"
                     /db_xref="UniProtKB/TrEMBL:G0W9W6"
                     /translation="MSNTNTTKQAQVKKEESKPVLPWNKADHGVAMKTFTGYNVNLTG
                     WIRKDIQENTRKRKNERKRKRKRKRKRNRKRRRRRRRRRRKNRKVKIRKI"
     gene            complement(<611720..>615286)
                     /gene="NDAI0D02640"
                     /locus_tag="NDAI_0D02640"
                     /db_xref="GeneID:11495083"
     mRNA            complement(<611720..>615286)
                     /gene="NDAI0D02640"
                     /locus_tag="NDAI_0D02640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669773.1"
                     /db_xref="GeneID:11495083"
     CDS             complement(611720..615286)
                     /gene="NDAI0D02640"
                     /locus_tag="NDAI_0D02640"
                     /inference="similar to DNA sequence:INSDC:YOR188W"
                     /note="similar to Saccharomyces cerevisiae MSB1 (YOR188W);
                     ancestral locus Anc_6.97"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669821.1"
                     /db_xref="GeneID:11495083"
                     /db_xref="InterPro:IPR012965"
                     /db_xref="UniProtKB/TrEMBL:G0W9W7"
                     /translation="MPVQQRDKRPDDLMPLPTPPPPPPFPKDSSNHTSSPTSQITNNT
                     SSRTTEKTPHDTKANDDDDEEFEFFHEFKRENVKGVIHLITAEIKNKGLDTEYLMIPF
                     RPEQTNEKLLKFLNQIFPLGNGQPVNEKKQIKIISNTNVFTLFQSLKYIWCRLPNAEI
                     VGWKAYLEFKYREQNLDYPQKAFLELMPQCLDSPNHASIVYDFFDLIVTLASNSKVNK
                     MSARKISKMCAIWAFSGDMNQHFNGNNESQNYDFDYRKPLSSNVPNNSIQDGLNQWIP
                     ASDVMFHLLLSFLKSFVPEDLESSKLPRSLKSLLFNNEYPPKGSTIYKSETILTIPLV
                     TLKTDKFSRKPWQLLERCNNLLDFEDHNSFEAREDYALLKSLFKKKNNVEGISKKMSQ
                     ESRRLMKLMSTKHSTFQAGWTSRKCLENIHELKEHIEVTRIDIDDYFIWTWLSTLSYE
                     QTSQKKQLFGRPIILEFEFDGFKKWVLFQEIDITIDYRINEMANNKKNKNTSSDTAAL
                     EPSEDLKNQPLQKPEKRNITPAYEKFQQEVSENSIKLADSPGMYHTVISKETIQKNSK
                     KHNTNLHSLEQKISKWNPLHNLRKKSNSASSVDQSTSTIENPYPRKNESADSGNVYTN
                     NIDSSFELPVIETDNFKIEFPDLNQVESKPTINNIDTYNNTPPSITHPAFTNTKNLPS
                     STSSSLSRRSPPAQIAEATIHEINGMMEQLMTNNHTPDSEAAAEEVFEKVTKFEQYRP
                     SNFNESISNLNISQHSLVESLSIANQTPTELHPAHMKPLLTKDASYPQNNIQLQPERL
                     GEPSSPQRNPPLRDSEHQNLPKESAQINTNNYFNALGPIPRPSANQSTQVQTNNTKSN
                     LNYEDEQQSNNNTRSNYSSNPSLNRTTQPEPKATNTREQQSVSCPPTQSSPSQPHQMQ
                     NTYKLNTHASPEMSSQGYNSPSFHGQNHPNTQPQTQFYNNVNKQQSPLPPHSYPVDNS
                     IAHGQSPMKPKLYMPASNSAGNMAPTVKPNPNPNNIPTNQSHNNIRPMYDNASPLQKN
                     NMIPANFPMQRNQMPPIQQHNMPQHKANRGRSQVQNTGYSQYVHPMSPVRYNNEMPMA
                     PPTMGYQGPSPQPAAPPQQQNYYNNGQVPVQGYYYNHMPQTSVPTQSGHGRAPNYGKG
                     KQELYGIPIQNGPASKLHSGNMNKRQERKNLYDNIRNGNFGI"
     gene            complement(<615744..>617084)
                     /gene="NDAI0D02650"
                     /locus_tag="NDAI_0D02650"
                     /db_xref="GeneID:11495084"
     mRNA            complement(<615744..>617084)
                     /gene="NDAI0D02650"
                     /locus_tag="NDAI_0D02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669774.1"
                     /db_xref="GeneID:11495084"
     CDS             complement(615744..617084)
                     /gene="NDAI0D02650"
                     /locus_tag="NDAI_0D02650"
                     /inference="similar to DNA sequence:INSDC:YOR187W"
                     /note="similar to Saccharomyces cerevisiae TUF1 (YOR187W);
                     ancestral locus Anc_6.95"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669822.1"
                     /db_xref="GeneID:11495084"
                     /db_xref="GOA:G0W9W8"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004541"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W9W8"
                     /translation="MSLPLLLFSKQAIRQTTSKFIPLAIKSSYTTNVSTTLRRSLATA
                     TTFDRTKPHVNIGTIGHVDHGKTTLTAAITKTLSQHSAEGTKASFLDYSSIDKAPEER
                     ARGITISTAHVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMPQ
                     TREHLLLARQVGVQHIVVFVNKVDTIDDPEMLELVEMEMRELLNEYGFDGDNAPIIMG
                     SALCALEGRQPEIGEKAILKLLDAVDEYIPTPQRDLVKPFLLPIEDIFSISGRGTVVT
                     GRVERGELKRGEELEIVGHNKVPLKTTVTGIEMFRKELDEAMAGDNAGILLRGIRRDQ
                     LKRGMVLAKPGTVKAHTKILASMYILSKEEGGRHSGFGENYRPQMFIRTADVTAVMKF
                     PPEVEDHSKQVMPGDNVEMECELVHPTPVEVGQRFNIREGGKTVGTGLVTRIIE"
     gene            <617583..>618029
                     /gene="NDAI0D02660"
                     /locus_tag="NDAI_0D02660"
                     /db_xref="GeneID:11495085"
     mRNA            <617583..>618029
                     /gene="NDAI0D02660"
                     /locus_tag="NDAI_0D02660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669775.1"
                     /db_xref="GeneID:11495085"
     CDS             617583..618029
                     /gene="NDAI0D02660"
                     /locus_tag="NDAI_0D02660"
                     /inference="similar to DNA sequence:INSDC:YLR295C"
                     /note="similar to Saccharomyces cerevisiae ATP14
                     (YLR295C); ancestral locus Anc_6.92"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669823.1"
                     /db_xref="GeneID:11495085"
                     /db_xref="InterPro:IPR019711"
                     /db_xref="UniProtKB/TrEMBL:G0W9W9"
                     /translation="MMRNNVWVTIRRNLSVGSSKRVIIMVPNMYRTMNFHTTVNRQDV
                     VQDLYLRELKSLRNGKGLPSKEELEASLEAAKQWTAPGTPTKPTLLGQQEEESLLKSY
                     KDQEVETTSVKKPSDVDAEDAETAENEDWLVLDDMEEGDTHAHAAH"
     gene            <618909..>619571
                     /gene="NDAI0D02670"
                     /locus_tag="NDAI_0D02670"
                     /db_xref="GeneID:11495086"
     mRNA            <618909..>619571
                     /gene="NDAI0D02670"
                     /locus_tag="NDAI_0D02670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669776.1"
                     /db_xref="GeneID:11495086"
     CDS             618909..619571
                     /gene="NDAI0D02670"
                     /locus_tag="NDAI_0D02670"
                     /inference="similar to DNA sequence:INSDC:YLR293C,YOR185C"
                     /note="similar to Saccharomyces cerevisiae GSP1 (YLR293C)
                     and GSP2 (YOR185C); ancestral locus Anc_6.90"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669824.1"
                     /db_xref="GeneID:11495086"
                     /db_xref="GOA:G0W9X0"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR002041"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W9X0"
                     /translation="MSAPAQPQAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIA
                     TIGVEVHPLSFYTNYGEIKFDCWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYK
                     NVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNF
                     EKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMDQAQALPLPDEDDA
                     DL"
     gap             619577..619596
                     /estimated_length=20
     gene            <620067..>621227
                     /gene="NDAI0D02680"
                     /locus_tag="NDAI_0D02680"
                     /db_xref="GeneID:11495087"
     mRNA            <620067..>621227
                     /gene="NDAI0D02680"
                     /locus_tag="NDAI_0D02680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669777.1"
                     /db_xref="GeneID:11495087"
     CDS             620067..621227
                     /gene="NDAI0D02680"
                     /locus_tag="NDAI_0D02680"
                     /inference="similar to DNA sequence:INSDC:YLR291C"
                     /note="similar to Saccharomyces cerevisiae GCD7 (YLR291C);
                     ancestral locus Anc_6.88"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669825.1"
                     /db_xref="GeneID:11495087"
                     /db_xref="GOA:G0W9X1"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="InterPro:IPR027363"
                     /db_xref="UniProtKB/TrEMBL:G0W9X1"
                     /translation="MSSLNLAALNSSTTSASEINVIIDSFIAKLKRRQIQGSYAIALE
                     TLQLLKRFISAARWSHVNELISQIRHLANRLEKAQPTAFSCGNVIRRILAILRDEIEE
                     DNNESSASNDPQNATSSSSSTAEPLISSMFNLLQKPEQNLNNSQTKKYKTKTDFRQVA
                     IQGIKDLIDEITNIDEGIQQIAIDLIHDHEILLTPTPDSKTVLKFLIAARERGNRTFT
                     VLVTEGFPTNTSNAHQFAKTLAQHDIETIIIPDSAVFALMSRVGKVIIGARAVFINGG
                     SISSTAGVSSVCECANEFKTPVFAVAGLYKLSPLYPFDQEKFVEFGGSQQILPKTSHN
                     NGTMRLDTINPITDYIPPENINIYITNIGGFNPSFIYRIAWDNYKQVDVQLE"
     gene            complement(<621964..>623154)
                     /gene="NDAI0D02690"
                     /locus_tag="NDAI_0D02690"
                     /db_xref="GeneID:11495088"
     mRNA            complement(<621964..>623154)
                     /gene="NDAI0D02690"
                     /locus_tag="NDAI_0D02690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669778.1"
                     /db_xref="GeneID:11495088"
     CDS             complement(621964..623154)
                     /gene="NDAI0D02690"
                     /locus_tag="NDAI_0D02690"
                     /inference="similar to DNA sequence:INSDC:YOR184W"
                     /note="similar to Saccharomyces cerevisiae SER1 (YOR184W);
                     ancestral locus Anc_6.84"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669826.1"
                     /db_xref="GeneID:11495088"
                     /db_xref="GOA:G0W9X2"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR003248"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020578"
                     /db_xref="InterPro:IPR022278"
                     /db_xref="UniProtKB/TrEMBL:G0W9X2"
                     /translation="MSLEREEPTHFGAGPAQLPTEVLQQAAKDLLNYNNLGLGIGEIS
                     HRSKDATQIIESSKQNLKELMNIPDTHEVFFMQGGGTTGFSSLATNLAAAYVGKTGQI
                     ANAGYLVTGSWSLKSFQEAKRLHVPCEIIFNSKDFNDEGKFVDIPDESLWEDRVKGKK
                     FSYVYLCENETVHGIEWNQLPKCIVDDPNIELVADLSSDILSRKIDVSKYGVIMAGAQ
                     KNIGLAGLTLYIIKKSILTNIEKVDDTLLHEFDIPVTPIAFDYPTVVKNNSAYNTIPI
                     FTLHVMNLVFEHLIKKGGVEAQEKENDAKAKILYDILDAYPNFYNLPVKPNARSRMNV
                     VFTLKKEGLDEKFLKDAAERKLTGLKGHRSVGGFRASIYNALTLASVEKLVQFIKDFA
                     VENQ"
     gene            <623924..>624607
                     /gene="NDAI0D02700"
                     /locus_tag="NDAI_0D02700"
                     /db_xref="GeneID:11495089"
     mRNA            join(<623924..623926,624419..>624607)
                     /gene="NDAI0D02700"
                     /locus_tag="NDAI_0D02700"
                     /product="ribosomal protein S30"
                     /transcript_id="XM_003669779.1"
                     /db_xref="GeneID:11495089"
     CDS             join(623924..623926,624419..624607)
                     /gene="NDAI0D02700"
                     /locus_tag="NDAI_0D02700"
                     /inference="similar to DNA
                     sequence:INSDC:YLR287C-A,YOR182C"
                     /note="similar to Saccharomyces cerevisiae RPS30A
                     (YLR287C-A) and RPS30B (YOR182C); ancestral locus
                     Anc_6.83"
                     /codon_start=1
                     /product="ribosomal protein S30"
                     /protein_id="XP_003669827.1"
                     /db_xref="GeneID:11495089"
                     /db_xref="GOA:G0W9X3"
                     /db_xref="InterPro:IPR006846"
                     /db_xref="UniProtKB/TrEMBL:G0W9X3"
                     /translation="MAKVHGSLARAGKVKSQTPKVEKTEKPKQPKGRAYKRLLYTRRF
                     VNVTLTNGKRKMNPSPNAS"
     gene            complement(<625203..>627188)
                     /gene="NDAI0D02710"
                     /locus_tag="NDAI_0D02710"
                     /db_xref="GeneID:11495090"
     mRNA            complement(<625203..>627188)
                     /gene="NDAI0D02710"
                     /locus_tag="NDAI_0D02710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669780.1"
                     /db_xref="GeneID:11495090"
     CDS             complement(625203..627188)
                     /gene="NDAI0D02710"
                     /locus_tag="NDAI_0D02710"
                     /inference="similar to DNA sequence:INSDC:YOR181W"
                     /note="similar to Saccharomyces cerevisiae LAS17
                     (YOR181W); ancestral locus Anc_6.81"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669828.1"
                     /db_xref="GeneID:11495090"
                     /db_xref="GOA:G0W9X4"
                     /db_xref="InterPro:IPR000697"
                     /db_xref="InterPro:IPR003124"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR028297"
                     /db_xref="UniProtKB/TrEMBL:G0W9X4"
                     /translation="MGVLNSQDKDIIKRALPKSSNKIIDITVARLYIAYPDKSEWKYT
                     GLSGAIALVDDTVGNTFFLKLVDINGHRGVLWDQELYVNFEYYQDRTFFHTFELEECF
                     AGLLFVDIHEAAHFLKRVQKREKYASRKTLMNKNAIALTKKIKKEQASTVVHGPRGEA
                     LIGNQRQRYQYQEAEPIPITKNKAPPPPPPSAPTPGESDIEQDEEEEMYTAPTSEWNS
                     GPTTNESTPAAVAPETTAHPKHKVPPLPEQFAHPQGQAPSPPAPGGSNNPFPFPVPAG
                     APQLSAGSTPFPIPIPQPSVGFFNQQSPPPPPMNNSFYNQQQQQHRPVPQPPSQNGFQ
                     NASRPMPLPPRQTGFNHSGPPAPPPRRGPAPPPPPHRHTTTTFQGGIANPIAPNYTAS
                     VKMNANGARIVPPPPPARRGPAPPPPPRASRIPQQQGQSPQLQMGYQLPFQNQNTNYT
                     NANANANVNMGIPPLSPPVQQQAYQSNVPSPPLTTFNTQGNQQIPVAPPFPNNNISNV
                     GPGMLPPPTAGMPAPPPPSFLTNATSNAAAPPPPPPAPAIPIASTTEGAGGSSINEAT
                     GDPGRDALLASIRGAGGINALKKVDKSQLDKPSVLLQEAKGETPSMNNNGAAPGGPPG
                     GPSGGGAGGSLADALAAALNKRKNKIGGADDDHGDDW"
     gene            <627963..>628799
                     /gene="NDAI0D02720"
                     /locus_tag="NDAI_0D02720"
                     /db_xref="GeneID:11495091"
     mRNA            <627963..>628799
                     /gene="NDAI0D02720"
                     /locus_tag="NDAI_0D02720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669781.1"
                     /db_xref="GeneID:11495091"
     CDS             627963..628799
                     /gene="NDAI0D02720"
                     /locus_tag="NDAI_0D02720"
                     /inference="similar to DNA sequence:INSDC:YLR284C,YOR180C"
                     /note="similar to Saccharomyces cerevisiae ECI1 (YLR284C)
                     and DCI1 (YOR180C); ancestral locus Anc_6.78"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669829.1"
                     /db_xref="GeneID:11495091"
                     /db_xref="GOA:G0W9X5"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:G0W9X5"
                     /translation="MEEKRVIYRIEGPVFIITLNDPRHLNSLTFDDFVEIALLLEKAD
                     NDPKIFITALQSTADFFSSGGKFSTVLDSRPANDNEINGASKVSQMIGVISSPNVFVA
                     DTFRKHRKLLVCCLNGPAVGLSACLVMLCDIVYCKNDSVYLLFPFTNLGFSAEVGSSV
                     TLAKKIGINKTNEHLIFSKPLTYEDLKGKVLNYNYVMKDTDEFNKKVVLDLQKKLKGT
                     NISLNNLKAMKTQIRDNSGYGTSLLQSQALETMATFPFWMEGEPFKRFQQMQKKERKH
                     KL"
     gene            <629970..>633647
                     /gene="NDAI0D02730"
                     /locus_tag="NDAI_0D02730"
                     /db_xref="GeneID:11495092"
     mRNA            <629970..>633647
                     /gene="NDAI0D02730"
                     /locus_tag="NDAI_0D02730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669782.1"
                     /db_xref="GeneID:11495092"
     CDS             629970..633647
                     /gene="NDAI0D02730"
                     /locus_tag="NDAI_0D02730"
                     /inference="similar to DNA sequence:INSDC:YLR278C"
                     /note="similar to Saccharomyces cerevisiae YLR278C;
                     ancestral locus Anc_6.75"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669830.1"
                     /db_xref="GeneID:11495092"
                     /db_xref="GOA:G0W9X6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G0W9X6"
                     /translation="MGRPKKEISEEKIERFQKELEDAGDNPDALLQDKKGRSRSCLLC
                     RRRKQKCDHKLPSCTACLKAAVKCVQPARYISKSSSNGDSVSSRKNSPSMSQTPPGSF
                     VGVGIIDSRVDQSSSNGNSNSSHGINDGKDEYTVLLEKKLKYLEKLVELTPGSAAYNK
                     KIAQYKKITHLLGNIGDLASATNNEANISTTVTNNSNNKNTVGVLPPPPSSLPSNIGT
                     IGNPNSSQIAAPAPRLATIQPPTSTTTQIGTILYSNISNTIANNGSNTAASLIQARPL
                     SSSIPALSSDSLDSIDFSKCIFAKYNLKEFLSYDPAFEFDEQLSRSFLDTFFTRLQFK
                     YPLLDENEIYSFHEAYINNRIYRYPPNEFHFNCGRMWLVYSISACLHMTTGKYKGQPP
                     VRYFSTAIRHITRCGSQLTSMEKVELLTLLVLYILRTDRDSMVLYEIIGDVMKICQLD
                     LKLNRRNDHDDTVLANKKLRIFWCVYLLERMICVAVGKSYIIKESDIDLPLFDESSFN
                     TSQHQKEPPLYQPHEKGTTTTHHKGVHFINQSLKLRRIESQFVEELGILPDKNFNVTT
                     NTAALTTNHHDKFVLREQLPLVRDIFQSLEVWRAECSTDHIRNFENETLKLYYYRSVR
                     LLIQPYLEILTPKDRLFRECQAAAGQICQLYKIFHQKTVTGHSTPAVHTVFVAGVTLI
                     YCMWLARNYDDERRKKLGDASKHTRPLVNASLFSTMDDLRACSVCLYVMTERSNFARI
                     FRDTFDQLMNATVGNLIERCGPDSAELIYMKAHFRGKNELTNSEMHSKDNGYNEGMNQ
                     NNDNNNNMIQNSTMRSGMPPAIKRTFGKRQAEEHLGFVENSQVDLKEQEIFKKKQGLL
                     EKTSVPRGLSHLLSSNENETTYVSSNHDGNMPNKKRKIIYNVDNNEAEQYIVKKPTNG
                     TEFDWQAQRQALLQQQVAQQNLQAYLSSLNYSIGQDVPIDSNTMFRTDNRSDVEINNP
                     TISDGFFDAMQKGNMMNHSNTLKIKLPTNPNLTGAIVNNNTSYSGLSVLGTNNTTHNY
                     NDNIHTTNDQKKSKIERETSILFSNGTHDMINNISTWTNDSVVNLLNSEAKNQMIDIY
                     PSSAPNPNEHQNSNQIHSISMMNHDGNNGDNFMSNHNNTNRSSTNRQDVYSQNVKGGT
                     FLSFTQTGSENVNVALSTSPANMTYQNNNSDSINSTGRLNYNGQNGGMNTTVSTGESN
                     LISSGPVEDFWTVNDDYGFLT"
     gene            <635735..>638659
                     /gene="NDAI0D02740"
                     /locus_tag="NDAI_0D02740"
                     /db_xref="GeneID:11495093"
     mRNA            <635735..>638659
                     /gene="NDAI0D02740"
                     /locus_tag="NDAI_0D02740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669783.1"
                     /db_xref="GeneID:11495093"
     CDS             635735..638659
                     /gene="NDAI0D02740"
                     /locus_tag="NDAI_0D02740"
                     /inference="similar to DNA sequence:INSDC:YLR273C,YOR178C"
                     /note="similar to Saccharomyces cerevisiae PIG1 (YLR273C)
                     and GAC1 (YOR178C); ancestral locus Anc_6.70"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669831.1"
                     /db_xref="GeneID:11495093"
                     /db_xref="InterPro:IPR005036"
                     /db_xref="UniProtKB/TrEMBL:G0W9X7"
                     /translation="MKKLKSSLKLSTISKSHSDTSIPKNVRFAPQLTTIKRFDYRDEP
                     IIISTENSPLGSPRLHDDDDDNTRSAGSRRRGNEYSFDLENDIELETEKFWFNNRSLL
                     PDLLKNEKMFNYYNDLNDFHLDDFYNSDIGTDPDDLLDDDDVYDDDYDDDELDGRRSS
                     DYKFIRPHHRRSLLLDVMENDDGHNMVNNAHNHHSLIDNNHGNHFTYHSPTDDLLHSS
                     GAHGESLSLYVNPRSFDSINWNIKSSNVVPFQNNCYVSKESLESSLFQFLQGQNIRLH
                     SLDQDPKDSYKIVGLIYVNNLNFEKFSEVKFTFNHWKDMHYVSAVYNKSITSNIDEFK
                     FIIDLNSLKFFLQVKNLLSSKVDQNNLSIELCCRYDVNNETYYDNNNYQNYHISLIAT
                     FQNASIDQTPKISNKENITPNKDFFYSSLSVEPNQPRSLTNFNNTTFIPNTPSISTTS
                     SQRTFSDNTDYYNTSPLKHLYHNDTTPFVKRPARSNEVIENIDNLIDNKMITYYNKNS
                     GLNTGMSTSFDNQAGSSLPVSQSSTLNSSSHNSNDTLLSDTSSSSSFNSLQYPLKSTS
                     TSYTNTESFTLPSSSATSTVSPSTDPHITNNFDYSDLYEPNDTLLTDANLYNYSFNSV
                     NLKNPNNNPLNDNDNEDSCFNYSSPFLSTYNNNGNTPVNDGTIIGGIIPENYNDQSRD
                     NSADLNFFDDSQSIGTNTTIDDTNNNIYSQTLNDTNTSRIFIHDKNNNSTDTLLGFSV
                     PLEPPNISKESSLNLTNSRDNLTIFTEPTSNSNSNLNSIPNSATISNTASITKSKTNS
                     NTIILNLDPEHEQKQKMKQNLNLNIPHNDTNTNTITDKALSTVSYHPIPDFDTERSKL
                     SVKKSGLKDLTYQAFLESYCFYNPKQEQSTTEEQERQQEEENDFEEHNKMQNEFINTP
                     IALAGSLDNINSDHNNDNNTDTNTNNSNIQSYSSTDTSLHSNSFLSTTPPILSQGHDR
                     WL"
     gene            <639802..>644349
                     /gene="NDAI0D02750"
                     /locus_tag="NDAI_0D02750"
                     /db_xref="GeneID:11495094"
     mRNA            <639802..>644349
                     /gene="NDAI0D02750"
                     /locus_tag="NDAI_0D02750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669784.1"
                     /db_xref="GeneID:11495094"
     CDS             639802..644349
                     /gene="NDAI0D02750"
                     /locus_tag="NDAI_0D02750"
                     /inference="similar to DNA sequence:INSDC:YKL101W"
                     /note="similar to Saccharomyces cerevisiae HSL1 (YKL101W);
                     ancestral locus Anc_2.479"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669832.1"
                     /db_xref="GeneID:11495094"
                     /db_xref="GOA:G0W9X8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0W9X8"
                     /translation="MTSVVSRNKYHDTNIAAQNAAKAAMSRKINNENINPKINNNILS
                     SKKSTQHLERVVQSVNDATKRLSQQDSQFTTNTNTKSSKRKSRDTVGPWKLGKTLGKG
                     SSGRVRLAKNVETGQLAAIKIVPKRNKFVMKNSNSNISFMSATSSASNSASLVSNIGL
                     KDKNSNTNNNDTNNNYNNNNNNNNNSNNNNNIQNNTYGIEREIVIMKLISHPNVMGLY
                     EVWENKSELYLILEYVDGGELFDYLVSRGKLPEAEAIHYFKQIIQGVSYCHSFNICHR
                     DLKPENLLIDKKKKSIKIADFGMAALELPKKLLQTSCGSPHYASPEIVMGKSYHGGPS
                     DVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKYQMPKNLSDEAKDLISRILVVSP
                     SKRLTTVEILNHPLILKYEKSSKKKHMVKGKSNSDLHLLDSISPENITLNSRMDIDES
                     ILKNLQILWHGTSRDIIIAKLLQKPISEEKLFYSLLLQYKQRHSAKPVVKPAERESLP
                     TATIISSLSHTPMKQKNLPSVAPNVKSNQKEESNVEDSYTVEDVEGNAPMVTQKSQFS
                     LHPFKNEVPSMVPAIPIFTASNSRSFKLSPSMASFKSRVPSTCSSSNLLLIKSPSKRA
                     LNTSTPLASPKRTLQPSVSIKSLRTSSSKKSLYVKKVRRTLQNSESKRSLYSLQSISK
                     RSINLKEFIAEDIALPTNTNIPVSSSNRSLESNNNDFEILCEQILFGNALNKIMEEEE
                     EEEGKRRKRFGTGALSNIEQVTYSEQNIREENAQDNDTITNFGSINETITSSIGTHIA
                     KSSDIDGLSPGMKPAFPFHNNSTQVKNNTVSENNKSDRLVLKNITNTYGPNEHEKSTE
                     MHSKNKPVSALPSIEKNGHQMSNYNPLRMTSEPNAPAVPHSLDPRRNFSQPSREQNSN
                     IFASLLKNTKRKPSLPNNFQKNVRKQDDWKTGRESIFVVDPQIGIANSQHLSKTSTRN
                     SKDVDTTAPSILAQSSIIQKPLLSLPSGLLNQSMTFKNLNDFLSDDSNNPDLLYNSRR
                     SSQLLQSTPIHHNQMGSVIHRDPTSQKLHTVIMEKEEGPSFVPTPHNLDIETASADMN
                     EFSDLSYAMEIPTNTFTAQAVKITNNTDINQYGFGSDMKSTRIHTPIANHSGVNIFED
                     PIIETSSSETSSSETDSQDNPYKKVVSIDTVNTAHIVTSPRANVRISLYANNNINQSF
                     PRETTEQIISKFKLTPEKTKTDNLLDKRFSDLLTREEKDDISGSVLSMFKDLDEGDED
                     VQREKQSDILRLNKKNNLKNESAEKNRITMLFDDEERREEGAEIYKEMGSMDHNEPEV
                     TKPSDRNTTKHVSVVPDVAVQMEDVMDNEHIINDSNKTIEDKRPKKKSVVKPQTDFVK
                     KTEPVPIAHKQSWFSKLFGGFKTNTSKSKLTEHHVTNIPFDDVHMLSLGEFGKKGIDF
                     QLKELDRKGNKERVEYDCRFSKGNFKFKLSIGTINNKSTVITIKKKGKNYSPESEATF
                     INFNRDVNALLKSMEKKNQSS"
     gene            complement(<644561..>645328)
                     /gene="NDAI0D02760"
                     /locus_tag="NDAI_0D02760"
                     /db_xref="GeneID:11495095"
     mRNA            complement(<644561..>645328)
                     /gene="NDAI0D02760"
                     /locus_tag="NDAI_0D02760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669785.1"
                     /db_xref="GeneID:11495095"
     CDS             complement(644561..645328)
                     /gene="NDAI0D02760"
                     /locus_tag="NDAI_0D02760"
                     /inference="similar to DNA sequence:INSDC:YKL099C"
                     /note="similar to Saccharomyces cerevisiae UTP11
                     (YKL099C); ancestral locus Anc_2.482"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669833.1"
                     /db_xref="GeneID:11495095"
                     /db_xref="GOA:G0W9X9"
                     /db_xref="InterPro:IPR007144"
                     /db_xref="UniProtKB/TrEMBL:G0W9X9"
                     /translation="MAKLVHDVQKKQHRERSQLNSRSRLGFLEKHKDYVKRAQDYHRK
                     ENTLKILRSKVKERNPDEYYHAMHSRRVDAKGLLVTSRRGEDEDESLSTDQVKLLKTQ
                     DSNYVRTLRQVELKKLENKSKTLMFSASGNHTVFVDNRDDFKSFNAEEHFGTTTELLT
                     RNENRLTKEQLIHSALMNPSGNIASSSAIMPRESLNKKKLKKFKIVKQHLERENQLKE
                     VQSRMDMQREVMKKGSKKKIIDTRGKVSFKWKKQRKR"
     gene            <645660..>646748
                     /gene="NDAI0D02770"
                     /locus_tag="NDAI_0D02770"
                     /db_xref="GeneID:11495096"
     mRNA            <645660..>646748
                     /gene="NDAI0D02770"
                     /locus_tag="NDAI_0D02770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669786.1"
                     /db_xref="GeneID:11495096"
     CDS             645660..646748
                     /gene="NDAI0D02770"
                     /locus_tag="NDAI_0D02770"
                     /inference="similar to DNA sequence:INSDC:YKL098W"
                     /note="similar to Saccharomyces cerevisiae YKL098W;
                     ancestral locus Anc_2.483"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669834.1"
                     /db_xref="GeneID:11495096"
                     /db_xref="UniProtKB/TrEMBL:G0W9Y0"
                     /translation="MDANYKLVDFQTCFRYSVAAKRSFLCICQVGDKKPEDIIKMTIE
                     NDYSCGQKAASCTVVSKISDLQTSYEEKDLSAESDDDKIVISIIPNMNTLPSSDQLNL
                     VRIMNAIKVSNEKNPKAQTHVIIGIITWDKATYRREEKGSRRAILGKDLAILQPCIKL
                     DDWLKHKFWLACSEPKVSTHGKTVPVCSNSSQDTASISPGSSIDSGTESSGSAGTIQL
                     LHEVHSSYSDVYLQPVVRKYILDIIVHIRMHRLSYRAKGGGAHMDSLKDVIQLSKLIS
                     INGGKKYIIPRYIKQAAAWYFPMHLNLINKPERDNSILYGSKIRLVNELLDKIIKVKS
                     YEVEELENPLFLESLVVQDVLKKVIPPV"
     gene            complement(646905..646977)
                     /gene="NDAI0Dtrna3A"
                     /locus_tag="NDAI_0Dtrna3A"
                     /db_xref="GeneID:11495097"
     tRNA            complement(646905..646977)
                     /gene="NDAI0Dtrna3A"
                     /locus_tag="NDAI_0Dtrna3A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:11495097"
     gene            complement(<647453..>647866)
                     /gene="NDAI0D02780"
                     /locus_tag="NDAI_0D02780"
                     /db_xref="GeneID:11494818"
     mRNA            complement(<647453..>647866)
                     /gene="NDAI0D02780"
                     /locus_tag="NDAI_0D02780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669787.1"
                     /db_xref="GeneID:11494818"
     CDS             complement(647453..647866)
                     /gene="NDAI0D02780"
                     /locus_tag="NDAI_0D02780"
                     /inference="similar to DNA sequence:INSDC:YGL041W-A"
                     /note="similar to Saccharomyces cerevisiae YGL041W-A;
                     ancestral locus Anc_4.68"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669835.1"
                     /db_xref="GeneID:11494818"
                     /db_xref="UniProtKB/TrEMBL:G0W9Y1"
                     /translation="MNVSKALRVSRILKPSIIHRQIPRRAYAKSWDKLQEQSNDKVDA
                     HIKVNTLLNDITSKPNLAAKLETIQNIMIKRNLVSTEDTSKPKVWQMIKILTNKELRS
                     AMEDFKKELAKSNVQLGPEQLKSLMVVLGMEKGSK"
     gene            complement(<648422..>649348)
                     /gene="NDAI0D02790"
                     /locus_tag="NDAI_0D02790"
                     /db_xref="GeneID:11495098"
     mRNA            complement(<648422..>649348)
                     /gene="NDAI0D02790"
                     /locus_tag="NDAI_0D02790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669788.1"
                     /db_xref="GeneID:11495098"
     CDS             complement(648422..649348)
                     /gene="NDAI0D02790"
                     /locus_tag="NDAI_0D02790"
                     /inference="similar to DNA sequence:INSDC:YGL043W"
                     /note="similar to Saccharomyces cerevisiae DST1 (YGL043W);
                     ancestral locus Anc_4.67"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669836.1"
                     /db_xref="GeneID:11495098"
                     /db_xref="GOA:G0W9Y2"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR003618"
                     /db_xref="InterPro:IPR006289"
                     /db_xref="InterPro:IPR016492"
                     /db_xref="InterPro:IPR017923"
                     /db_xref="UniProtKB/TrEMBL:G0W9Y2"
                     /translation="MKPMEAKEVAVLVKNLEKSKHNDSTVLEILLKLNREVVPTEKLL
                     RETKVGVEVNKFKKSSNEQIAKVVKKMISSWKDTINKNKKLRLQQQKEAEAAKLNSNQ
                     NGSNTTTQVPDSNLSSPQKQNRYVSTKPRNSKNDGVNTTIYGVKLRDSVIRALYDALA
                     KGSEHPPNSILHTVKSIESEMFKLNNCTENEKAYKEKYRIIYSNIISKNNADLKNKIA
                     NNDISPEYLVTCDPKELAPEHLKQKLEEIKKQNLFNAQGATIERSVTDRFTCGKCKEK
                     KVSYYQLQTRSADEPLTTFCTCEACGNRWKFS"
     gene            <649804..>650751
                     /gene="NDAI0D02800"
                     /locus_tag="NDAI_0D02800"
                     /db_xref="GeneID:11495099"
     mRNA            <649804..>650751
                     /gene="NDAI0D02800"
                     /locus_tag="NDAI_0D02800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669789.1"
                     /db_xref="GeneID:11495099"
     CDS             649804..650751
                     /gene="NDAI0D02800"
                     /locus_tag="NDAI_0D02800"
                     /inference="similar to DNA sequence:INSDC:YGL044C"
                     /note="similar to Saccharomyces cerevisiae RNA15
                     (YGL044C); ancestral locus Anc_4.66"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669837.1"
                     /db_xref="GeneID:11495099"
                     /db_xref="GOA:G0W9Y3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G0W9Y3"
                     /translation="MNNFNPNMNMNMNMNRNNMMPMPMMHSNPDGNVGGSSGSQHYNQ
                     PSRIVYLGSIPYDQTEEQILDLCNNVGPVVNLKMMFDQQTGRSKGYAFIEFKDLETSA
                     SAIRNLNGYQLGSRFLRCGYSSNNDISSTGISSNDQSMGNVDDGSNVLFSDLPSGIDV
                     NINMTTPAMMISSELSKKSKEDQLNLLQKLKEWTSENKDLAVELFNEYPQLSFVIAEI
                     LLTNGICKVDDLAQLVAAQNDSNENEQSNNNNSTSNAFAQKSNDLLSNDPELLETQKE
                     LLRKVLQLSDGEIAILPENERMSMWDIKQRALKGEFGNI"
     gene            complement(<650919..>651677)
                     /gene="NDAI0D02810"
                     /locus_tag="NDAI_0D02810"
                     /db_xref="GeneID:11495100"
     mRNA            complement(<650919..>651677)
                     /gene="NDAI0D02810"
                     /locus_tag="NDAI_0D02810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669790.1"
                     /db_xref="GeneID:11495100"
     CDS             complement(650919..651677)
                     /gene="NDAI0D02810"
                     /locus_tag="NDAI_0D02810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669838.1"
                     /db_xref="GeneID:11495100"
                     /db_xref="GOA:G0W9Y4"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G0W9Y4"
                     /translation="MRIELIPREDTDKLTNIPFWSKTLDLIIQCQTLFFWLGGIFFFL
                     GLFFIILQYHSEISNFIKGTMLRLRRLFYFQKLKIKLRKWSVKKKVSIIDLECQDLDP
                     AKYSHFTINRCELSTRKVSIDMDKKIPIDRFVEMSTKDDRIPINECCIICLERVKVVP
                     STNDLEKQQNGTEQTTDMIPSKVVKLPCEHYFHKCCIKDWFSTIRKGMKSSTHSFAIG
                     PTYFCPLCRLDLHRCQQICDSFSISMKNLTVLPK"
     gene            complement(<652324..>653028)
                     /gene="NDAI0D02820"
                     /locus_tag="NDAI_0D02820"
                     /db_xref="GeneID:11495101"
     mRNA            complement(<652324..>653028)
                     /gene="NDAI0D02820"
                     /locus_tag="NDAI_0D02820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669791.1"
                     /db_xref="GeneID:11495101"
     CDS             complement(652324..653028)
                     /gene="NDAI0D02820"
                     /locus_tag="NDAI_0D02820"
                     /inference="similar to DNA sequence:INSDC:YGR158C"
                     /note="similar to Saccharomyces cerevisiae MTR3 (YGR158C);
                     ancestral locus Anc_4.63"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669839.1"
                     /db_xref="GeneID:11495101"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:G0W9Y5"
                     /translation="MNVQDRRRLLGPGNAKPIAFASSLEPETEPLKAEEVAKKDGIPS
                     LSIKSDIIENCNGSTLIESDEFSIVTSVYGPKSIRGSFTSQGTISIQLKNGIVEKYQT
                     NELKEVASWLVGIFNSVVNLEKYPKSGIDIFVNLVIDKTNDISKLIPFIVMSTCLALV
                     DSGIEMIDLTTAAEIDGNVISFTKGGEEIVGFWKDNGDAVFNDEDFTSILGRCKEQYI
                     NYKSLMVNYLLQGKKK"
     gene            complement(<653428..>655320)
                     /gene="NDAI0D02830"
                     /locus_tag="NDAI_0D02830"
                     /db_xref="GeneID:11495102"
     mRNA            complement(<653428..>655320)
                     /gene="NDAI0D02830"
                     /locus_tag="NDAI_0D02830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669792.1"
                     /db_xref="GeneID:11495102"
     CDS             complement(653428..655320)
                     /gene="NDAI0D02830"
                     /locus_tag="NDAI_0D02830"
                     /inference="similar to DNA sequence:INSDC:YGL045W"
                     /note="similar to Saccharomyces cerevisiae RIM8 (YGL045W);
                     ancestral locus Anc_4.62"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669840.1"
                     /db_xref="GeneID:11495102"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:G0W9Y6"
                     /translation="MALLDILKKSKSSNCKIKNGANVVYHHTHSHSGLLSGNNVKLFY
                     IKLDEPHRLWKPNEYIKGEVILDIKKDLTNIALRFSLISEIKVKLKSTGPTTNKKIEK
                     LVEKSSFLYGSEGIQQETNNNAIPHADPINGLTKGEHRFPFRIKIPNGKHIFSSIKFE
                     KGSIDYYLQCSLESLGINQHEKPISRCEQGFSVLVPLDVTNLPDIKTKTVVLQSYSML
                     SHRNGSQSNKLLTPEDASSSFTKFTNHSTNSKSSKSSSSSKVSKSSKELSLKTNEQQS
                     HLNPNKIDKTVQISVDIGKSGYILGDLIPIHIAIQHYKECHHSAGLILTLVRICRIGN
                     QNTSMETFRKDICQNIAPLYIDPETLQSNSTLYLKVPLDTLSTFTSFNKFFSFQYYVE
                     VMVNLSRKNMVYTESNRIIGSGADDDDDSNGFIFNGNNNNNDNNNASTSNGNNNNGNT
                     IRNKVTQGVENNINHIQKKVLKIVTQTENGKNNGSDNILNNQNDIESNIIYKDMVNVE
                     KLKRLRNVTGMSIEIVVGTTKQPTQNITTQSTEASNLQTSTRNEYSSETNDLSESIVC
                     HCHHSINGTQIPDWDVNEWLTSPMIDNPAPEYTPKEGTNEANLEDKQELERLRLQELE
                     SQPDDY"
     gene            complement(<656261..>657541)
                     /gene="NDAI0D02840"
                     /locus_tag="NDAI_0D02840"
                     /db_xref="GeneID:11495255"
     mRNA            complement(<656261..>657541)
                     /gene="NDAI0D02840"
                     /locus_tag="NDAI_0D02840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669793.1"
                     /db_xref="GeneID:11495255"
     CDS             complement(656261..657541)
                     /gene="NDAI0D02840"
                     /locus_tag="NDAI_0D02840"
                     /inference="similar to DNA sequence:INSDC:YGR159C"
                     /note="similar to Saccharomyces cerevisiae NSR1 (YGR159C);
                     ancestral locus Anc_4.61"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669841.1"
                     /db_xref="GeneID:11495255"
                     /db_xref="GOA:G0W9Y7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G0W9Y7"
                     /translation="MGKSTTKKDSKKVQKQKKEEKAAATSSSESSSSDSSSSSSESSS
                     DSSDSESSDSESEKEEEKKEEKKDSSDSSSSSSDSESEKEEEKKESSKSDSESSSSSS
                     DSDSGSDSSSDSESESDKEEKKESSKSDSESSSSSESDSESSDKKRKSEDVEEEESES
                     KKQKTSGGEPATIFVGRLSWSIDDEWLKKEFEHIGGVVGARVIYERGTDRSRGYGYVD
                     FEDKSYAEKAIQEMQGKEIDGRPINVDMSTSKPAGGNDRAKKFGDVPSEPSDTLFLGN
                     LSFNADKDNIYETFSKYGEIISVRIPTHPETEQPKGFGYVQFSNIEDAKKALEGLQGE
                     YIDNRAVRLDYSTPRPANPEGGFNRGGDRGGRGGRGGFNRGGDRGGRGGRGGFNRGGR
                     GGSRGGFRSTGSNNAPLGRGRDTASFAGSKKTFD"
     gene            659236..659309
                     /gene="NDAI0Dtrna4V"
                     /locus_tag="NDAI_0Dtrna4V"
                     /db_xref="GeneID:11495256"
     tRNA            659236..659309
                     /gene="NDAI0Dtrna4V"
                     /locus_tag="NDAI_0Dtrna4V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:11495256"
     gene            <659572..>660789
                     /gene="NDAI0D02850"
                     /locus_tag="NDAI_0D02850"
                     /db_xref="GeneID:11494825"
     mRNA            <659572..>660789
                     /gene="NDAI0D02850"
                     /locus_tag="NDAI_0D02850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669794.1"
                     /db_xref="GeneID:11494825"
     CDS             659572..660789
                     /gene="NDAI0D02850"
                     /locus_tag="NDAI_0D02850"
                     /inference="similar to DNA sequence:INSDC:YGL048C"
                     /note="similar to Saccharomyces cerevisiae RPT6 (YGL048C);
                     ancestral locus Anc_4.57"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669842.1"
                     /db_xref="GeneID:11494825"
                     /db_xref="GOA:G0W9Y8"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W9Y8"
                     /translation="MSTASVSNPTLRTYESGIKPYFDQQIQETELKIRSKTENLRRLE
                     AQRNALNDKVRFIKDELRLLQEPGSYVGEVIKVVSDKKVLVKVQPEGKYIVDVAKDID
                     IKNLKPSQRVCLKSDSYMLHKVLENKSDPLVSLMMVEKVPDSTYDMVGGLTKQIKEIK
                     EVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELV
                     QKYIGEGSRMVRELFVMARQHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQRTMLELL
                     NQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILRIHSRK
                     MNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMNK
                     NQETAISVAKLFK"
     gene            <661592..>664459
                     /gene="NDAI0D02860"
                     /locus_tag="NDAI_0D02860"
                     /db_xref="GeneID:11495257"
     mRNA            <661592..>664459
                     /gene="NDAI0D02860"
                     /locus_tag="NDAI_0D02860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669795.1"
                     /db_xref="GeneID:11495257"
     CDS             661592..664459
                     /gene="NDAI0D02860"
                     /locus_tag="NDAI_0D02860"
                     /inference="similar to DNA sequence:INSDC:YGL049C,YGR162W"
                     /note="similar to Saccharomyces cerevisiae TIF4632
                     (YGL049C) and TIF4631 (YGR162W); ancestral locus Anc_4.56"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669843.1"
                     /db_xref="GeneID:11495257"
                     /db_xref="GOA:G0W9Y9"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR022745"
                     /db_xref="UniProtKB/TrEMBL:G0W9Y9"
                     /translation="MTDQDGKQNEPQQEQQPLTSQPLSQGTVTSQTTSNTTNSYPTKS
                     VNSYQKYNQVNGPGNEQQPTYSYGTNNNNYNGKPHRSNSNTSSNMNGNYYKQYQPVNG
                     NGYTSKANRYNNPKNPATAQYYNNKYNNIPYNATQEQLNALQWKSYYGSQMMYMPQQM
                     MSMANAQQMPMSPPSISATLATPTPVPSTPFQPKRKIEITTKSGERLDLKEIHQRKVN
                     SNGSSIEPSDLSKESTPTSITQNEPVENPFLTSKKADTNENNTTTTTNNDTSPIPASS
                     VDASNENDSKSNIEEEEKPSAEETRKLFLEQVRLRKESLERKKKGLDSPAFTPAPALT
                     TPVSTATIETHPESEIPKEIETDVKEDIKEGIKEDVREEEDALETPDPSMPSMTFTEL
                     LEKLKKVDPIKDIYAFNYSKDVTSPDIKYKSTHVKYTYGPEFLLQFKDKINVTPDDEW
                     KASTQSKIVIPPPRGYRGGNENTVRFGGNNNMTSSATGGRNDMRNPSMRNMDSNARIN
                     SRTSSKRNKSMRRAIAGGDDRRSNTGRSSYTPRRDRERTDTERYEDRHYNNSYRMEEK
                     PKEEVAPFVPSANRWIPKSRVKKTEKKFAPDGVTELLEKSEVESKMKSLLNKLTLEKF
                     DTISNDILAITEQSKWEKNGETLNLVIEQIFLKACDEPHWSSMYAQLCGKVVKELDPE
                     IKDETNEGKTGPKLVLHYLVARCHTEFQKGWTDKLPTNEDGSPLEPEMMSDEYYQAAS
                     AKRRGLGLVRFIGFLYRLNLLTGKMMFECFRRLIKDLSDNPSEEILESVVELLMTVGK
                     QFEHDTFRAGNATLEGCVLLDSLFQIIQNLIDTDTQISSRIKFKLLDVKELREKKHWN
                     SDKQESGPKTIQQIHQEEEKARQLKMNSRTNSRRMNTSSSSNSHRQSYRKDYQSSSKD
                     RFASGKTPSSRYTSKQPIKEKRPSAPAPSNMFDALMDAGEE"
     gene            complement(<664810..>665673)
                     /gene="NDAI0D02870"
                     /locus_tag="NDAI_0D02870"
                     /db_xref="GeneID:11495258"
     mRNA            complement(<664810..>665673)
                     /gene="NDAI0D02870"
                     /locus_tag="NDAI_0D02870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669796.1"
                     /db_xref="GeneID:11495258"
     CDS             complement(664810..665673)
                     /gene="NDAI0D02870"
                     /locus_tag="NDAI_0D02870"
                     /inference="similar to DNA sequence:INSDC:YGL050W"
                     /note="similar to Saccharomyces cerevisiae TYW3 (YGL050W);
                     ancestral locus Anc_4.55"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669844.1"
                     /db_xref="GeneID:11495258"
                     /db_xref="InterPro:IPR003827"
                     /db_xref="UniProtKB/TrEMBL:G0W9Z0"
                     /translation="MSVQNAFDQKKKSILHDLASIQPDLSPKGTVDELCLPIIHLINS
                     HPDMVTTSSCSGRISVFAEGLKDHKNNVKVGGKGQGGAWLHVSHDEDNVLNWIDSVTG
                     LDFSQNNNTLSARDLLANTRYILYKYEPFIIHVKCRNFEMAAKLYNTAMACGFRESGI
                     GSNFLVAIRINIKMDIPIGYIDESENMKLFVSQDYIHILDKLTLIKFSENRRKMDDLY
                     KKFNEELIEKDNVNSKESNKETKEERRERKRREGLKRQLEMKSESAQDTNQEQLDKKV
                     VESIESVELTD"
     gene            complement(666019..666090)
                     /gene="NDAI0Dtrna6D"
                     /locus_tag="NDAI_0Dtrna6D"
                     /db_xref="GeneID:11495259"
     tRNA            complement(666019..666090)
                     /gene="NDAI0Dtrna6D"
                     /locus_tag="NDAI_0Dtrna6D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:11495259"
     gap             667026..667045
                     /estimated_length=20
     gene            668917..669016
                     /gene="NDAI0Dtrna9L"
                     /locus_tag="NDAI_0Dtrna9L"
                     /db_xref="GeneID:11494901"
     tRNA            join(668917..668955,668972..669016)
                     /gene="NDAI0Dtrna9L"
                     /locus_tag="NDAI_0Dtrna9L"
                     /product="tRNA-Leu"
                     /note="codon recognized: CUA"
                     /db_xref="GeneID:11494901"
     gene            <669487..>670830
                     /gene="NDAI0D02880"
                     /locus_tag="NDAI_0D02880"
                     /db_xref="GeneID:11494842"
     mRNA            <669487..>670830
                     /gene="NDAI0D02880"
                     /locus_tag="NDAI_0D02880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669797.1"
                     /db_xref="GeneID:11494842"
     CDS             669487..670830
                     /gene="NDAI0D02880"
                     /locus_tag="NDAI_0D02880"
                     /inference="similar to DNA sequence:INSDC:YLR303W"
                     /note="similar to Saccharomyces cerevisiae MET17
                     (YLR303W); ancestral locus Anc_4.53"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669845.1"
                     /db_xref="GeneID:11494842"
                     /db_xref="GOA:G0W9Z1"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR006235"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G0W9Z1"
                     /translation="MPSHFDTIQLHAGQENPDDNANRPRAVPIYATTSYVFNDSEHGS
                     NLFGLKVPGYVYSRFQNPTQNVLEERMAALEGGVAAVAVASGQAAQTLAICGLAHSGD
                     NIISTSFLYGGTYNQFKVAFKRLGIEARFVTGDNPDDFEKLIDDKTKAVYLESIGNPK
                     YNVPDFEKIVEIAHKHGVPVVVDNTFGAGGFFCQPIKYGADIVTHSATKWIGGHGTTI
                     AGMIVDSGKFPWADYPEKFPQFSKPAEGYHGTIFNEAYGNLAYIVHVRVELLRDLGPA
                     ISPFAAFLLIQGIETLSLRGERHGQNALKLAQWLEQSPYVSWVSYPGLPSHPYHENAK
                     KYLSNGFGGVLSFGVKDIPGQTKEELAAKPFSASGAQVVDSLKLASNLANVGDSKTLV
                     IAPYFTTHEQLDDDEKLLSGVTKDLIRVSVGTEFIDDIIADFQQSFEKVFAGKKL"
     gap             673103..673122
                     /estimated_length=20
     gene            673684..673757
                     /gene="NDAI0Dtrna7I"
                     /locus_tag="NDAI_0Dtrna7I"
                     /db_xref="GeneID:11495260"
     tRNA            673684..673757
                     /gene="NDAI0Dtrna7I"
                     /locus_tag="NDAI_0Dtrna7I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:11495260"
     gene            complement(<676087..>678438)
                     /gene="NDAI0D02890"
                     /locus_tag="NDAI_0D02890"
                     /db_xref="GeneID:11494837"
     mRNA            complement(<676087..>678438)
                     /gene="NDAI0D02890"
                     /locus_tag="NDAI_0D02890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669798.1"
                     /db_xref="GeneID:11494837"
     CDS             complement(676087..678438)
                     /gene="NDAI0D02890"
                     /locus_tag="NDAI_0D02890"
                     /inference="similar to DNA sequence:INSDC:YLR304C"
                     /note="similar to Saccharomyces cerevisiae ACO1 (YLR304C);
                     ancestral locus Anc_4.51"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669846.1"
                     /db_xref="GeneID:11494837"
                     /db_xref="GOA:G0W9Z2"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR006248"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR015931"
                     /db_xref="InterPro:IPR015932"
                     /db_xref="InterPro:IPR015937"
                     /db_xref="InterPro:IPR018136"
                     /db_xref="UniProtKB/TrEMBL:G0W9Z2"
                     /translation="MLSARSSILRNPVLKRGLATATNLTRDSKVHQNLLEDHSFINYK
                     QNVENLKIVKERLNNRPLTYAEKILYSHLDNPQEQDIERGVSYLKLRPDRVACQDATA
                     QMAILQFMSAGLPEVAKPVTVHCDHLIQAQIGGEKDLKRAIDINKEVYDFLTTATAKY
                     NMGFWGPGSGIIHQIVLENYAFPGALIIGTDSHTPNAGGLGQLAIGVGGADAVDVMAD
                     LPWELKAPKILGVKLTGKMNGWTSPKDIILKLAGITTVKGGTGKIVEYFGPGVDTFSA
                     TGMGTICNMGAEIGATTSVFPFNKSMVDYLKATRRGEIADFAQLYQKDFLSADKGCEY
                     DEIVELDLTTLEPYVNGPFTPDLATPISKMKDVAVASGWPLDIRVGLIGSCTNSSYED
                     MSRSASIIKDAASHGLKAKTIFTVTPGSEQIRATIERDGQLQTFKEFGGIVLANACGP
                     CIGQWDRQDIKKGEKNTIVSSYNRNFTSRNDGNPQTHAFVASPELVTAFAIAGDLRFN
                     PITDKLKDKDGNEFLLKPPFGNGLPEDGYDPGEDTYTAPPADRAAVAVSIAPTSERLQ
                     VLKAFEPWNGKDALDMPILIKALGKTTTDHISMAGPWLKYRGHLENISNNYMIGAINA
                     ENKKANSIRNVYTGEYKGVPDTARDYRDQGIKWVVIGDENFGEGSSREHAALEPRFLG
                     GFAIITRSFARIHETNLKKQGLLPLNFKNPADYDKINPDDRIDIVGLDKLAPGVDVTM
                     KVHPKDGQVWEAPLTHTFNSEQIEWFKSGSALNKIKKDRTGSL"
     gene            complement(<679279..>685068)
                     /gene="NDAI0D02900"
                     /locus_tag="NDAI_0D02900"
                     /db_xref="GeneID:11495261"
     mRNA            complement(<679279..>685068)
                     /gene="NDAI0D02900"
                     /locus_tag="NDAI_0D02900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669799.1"
                     /db_xref="GeneID:11495261"
     CDS             complement(679279..685068)
                     /gene="NDAI0D02900"
                     /locus_tag="NDAI_0D02900"
                     /inference="similar to DNA sequence:INSDC:YLR305C"
                     /note="similar to Saccharomyces cerevisiae STT4 (YLR305C);
                     ancestral locus Anc_4.50"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669847.1"
                     /db_xref="GeneID:11495261"
                     /db_xref="GOA:G0W9Z3"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR001263"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015433"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="UniProtKB/TrEMBL:G0W9Z3"
                     /translation="MRFYRTTKRTSSLRARALEKLAQLSLNKDDVKQDESLPPINGKG
                     EADARISSRNTLGLIMRSLPISYSTDTSRLFTIPLTLNEWELLSSISQVIPDSLSTAE
                     ELLDNLISPYFLESSRQRISDVLYAKFKLDNLKNPNELLTFQLTKFLIAVSSKHPKLI
                     DRCSKLIDGYLSAVKQLYSSKQSSLLSLLGFMNGFIQGKNSPELATFVWKRLSSFFIE
                     EQFTSQLESILSSSSTYVNDVIVQYFEAKNEICGSLYIQLLSKLQSSFICDILDIPPR
                     FRDLSSYLLEMQHLTYQITQEDNDSDDKTQIVDEFTYKIRKHKEVLTSICEFSLRYCQ
                     NDNDVDLSTDSRAIFSFDARGYFINCLCLVPFIADPDSELFQDFIRIVADSMDTFVFS
                     EIITDSLIISIISAASLLNYFTEENSLTLLRIFPLLVSSQYISTSTIIEISKIFTIGL
                     QPLNEDSIVSTIYSLNNLLIATDDGSANPILRERKLTITSGGTMSFSGVRRSGTVESL
                     QTLRSAASSPYRKKTIKKQTSHVLASGGSTTYHGRLFKNCVTATTTIASHYNKQSIRL
                     LAFSILSQKITAVSEELDEIIPDAIAKLSTYMTVTEFSQVLKFFKAILSRQEDGTLFD
                     GIINAKTILSTHFLSEQYNSELYRIYLRDLLETIISCGEVEKLEHHRPHTEISRVAEQ
                     ISSYLGPLAALLPKPGEKPLDLSQDEQTTNMLRNVWFNMVIHGFHYKSKLVNKYKIQL
                     LTIAYNSPPLASDFPANNKEMSLEMNTILRRGSSNANVKEQKQAIVDYFNVNAVQSRT
                     ISLSKIMFLAATTLLETLRCEAGDCSKVLLYFSDPSITTTSLEKPINILAVAMIAKFS
                     QLVQSGDFKLFNSKTIALQLNNLLLCLAHRNPTLQESAFHYSDLFIRRIPSSLCHHQS
                     LYTLLDLLTALFDSVVDCETNKFEPHYKFILKHSRVEILLPGSSMWRTSALSKLHKIA
                     KQWVQIILNKSAQDTKILLQTYVSDLNTYNIMANVDYGISFAMELAGMVLSADVELSK
                     LEFRGPERPNTVAKFISQHSWRSKYLVDTAMVSSQQDIVDELGLLSNTIRGKLDTGIK
                     VVSKDVTNFLDMSAALLILGNYRSGSLLYDIVHIPFEVFTSESLKSATNVWLSIIKER
                     RDLAHLLLVDVTYCWLESIKNNVGVYSRKYDLIEEEYQIMTYKPYNKKAINREANFVS
                     QSMQPHRHVIKFFLSHFEGTLYQSKHLLAVFTKCALLGVSNLKKASLHPFSRMIRNEL
                     LIFAILVLIVNDRQGTKLIKDLCREIVYGGLTWFYEKRNWPFGSNELKIKADLSTMKN
                     LYDKLNSVTVIMKKYCNKEFTLLMVFLESEIEQVQTWLTPLDKIDKTSSYTVTLESVK
                     TAFTIDPRLAVSLSQRYPGNDIESGLVTLINQDPLRCVNCPIAIDPFIINNYRKRILP
                     TAAMDSKLKDKMHIVLYWKPVSPLKSINLFLPQWNSDSFLLQYSVFSLESHDVNVTFF
                     YVPQIVQCLRYDKTGYVERLIFDTAKINILFSHQIIWNLFANCYKDDEGTVPDDIKPT
                     LDRVRERMVSSFDADTLDFYKKEFGYFNEVTSISGKLKPYIKKSKAEKKHKIDEEMNK
                     IVVKPGVYLPSNPDGVVIDIDRKSGKPLQSHAKAPFMATFKIRKDIENEDTGITENVE
                     KWQGAIFKVGDDCRQDVLALQLISMFKTIWSSIGLDVYVFPYRVTATAPGCGVIDVLP
                     NSISRDMLGREAVNGLYEYFITKFGSESTIEFQNARNNFVKSLAGYSVISYLLQFKDR
                     HNGNIMYDDKGHCLHTDFGFIFDIVPGGVKFEAVPFKLTKEMVKVMGGSSQAAAYQDF
                     EELCIKAYLSARPHMDSILECVKPMLESGLPCFKGEKTIKNLRNRFQPERDQHEAALF
                     MRGLIKKSYESLFTKGYDEFQRLTNGIPY"
     gene            <685459..>686028
                     /gene="NDAI0D02910"
                     /locus_tag="NDAI_0D02910"
                     /db_xref="GeneID:11495262"
     mRNA            <685459..>686028
                     /gene="NDAI0D02910"
                     /locus_tag="NDAI_0D02910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669800.1"
                     /db_xref="GeneID:11495262"
     CDS             685459..686028
                     /gene="NDAI0D02910"
                     /locus_tag="NDAI_0D02910"
                     /inference="similar to DNA sequence:INSDC:YLR306W"
                     /note="similar to Saccharomyces cerevisiae UBC12
                     (YLR306W); ancestral locus Anc_4.49"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669848.1"
                     /db_xref="GeneID:11495262"
                     /db_xref="GOA:G0W9Z4"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:G0W9Z4"
                     /translation="MLKLRQLQEQKKKALENKNKAQPTTTQLSSARIRLQRDLDDLDL
                     PPTVTMNILSSPIDPGSRSPPLLEITAYPDEGFYKGGHFTFKLEFNDAYPIEPPTVIC
                     TSKLYHPNIDIDGKVCLNILREDWSPALDVQSIIIGLLFLLLEPNAKDPLNKDAAMML
                     STDTARFASLVNRSMAGYSIHGESYDYVL"
     gene            <686752..>687672
                     /gene="NDAI0D02920"
                     /locus_tag="NDAI_0D02920"
                     /db_xref="GeneID:11495263"
     mRNA            <686752..>687672
                     /gene="NDAI0D02920"
                     /locus_tag="NDAI_0D02920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669801.1"
                     /db_xref="GeneID:11495263"
     CDS             686752..687672
                     /gene="NDAI0D02920"
                     /locus_tag="NDAI_0D02920"
                     /inference="similar to DNA sequence:INSDC:YLR308W"
                     /note="similar to Saccharomyces cerevisiae CDA2 (YLR308W);
                     ancestral locus Anc_4.47"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669849.1"
                     /db_xref="GeneID:11495263"
                     /db_xref="GOA:G0W9Z5"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="InterPro:IPR011330"
                     /db_xref="UniProtKB/TrEMBL:G0W9Z5"
                     /translation="MKSSLILLSFSLAALTVSAGEASDPDVITSKASDIEFVGEQYRQ
                     LPFPRWLTEFTGMTRWPDLDPPYIPLDFIDMDKIPDFKPYRQGLCGVNPRDACSFDCD
                     NCIAHDDVYTCPKLSQTFDDGPSPATLRLLNKLKHNTTFFALGINTVNHPDIYRKTME
                     AGHLMGSHTWSHAYLPSLSNEQIIAQIQWSIWAMNATGHHFPKWFRPPYGGIDNRVRA
                     ITRQFGLQAALWNHDTFDWKLVSNDPIRTEEQIYEEVRKWKSQGGGLILEHDGSHRPV
                     DVALNVIDILGPDQMTVAQCVNGPDYIRNF"
     gene            complement(<687858..>690740)
                     /gene="NDAI0D02930"
                     /locus_tag="NDAI_0D02930"
                     /db_xref="GeneID:11495264"
     mRNA            complement(<687858..>690740)
                     /gene="NDAI0D02930"
                     /locus_tag="NDAI_0D02930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669802.1"
                     /db_xref="GeneID:11495264"
     CDS             complement(687858..690740)
                     /gene="NDAI0D02930"
                     /locus_tag="NDAI_0D02930"
                     /inference="similar to DNA sequence:INSDC:YLR309C"
                     /note="similar to Saccharomyces cerevisiae IMH1 (YLR309C);
                     ancestral locus Anc_4.46"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669850.1"
                     /db_xref="GeneID:11495264"
                     /db_xref="GOA:G0W9Z6"
                     /db_xref="InterPro:IPR000237"
                     /db_xref="InterPro:IPR029687"
                     /db_xref="UniProtKB/TrEMBL:G0W9Z6"
                     /translation="MFKQLSQIGKNLSDELQKGLSEELAPLPQATDPTDSANMTNGNS
                     TTDGLQPTGVGNDSDGTQDLPKDIQAKLRKFEKYELKYPALLNAYKNEKIRNEKIEKI
                     LTENTPLANLDDVDSLPAFFQNINTKHTIYNDEIKRLTKENNESRERLSDRTEIEELE
                     KKFNSERENLQREIDEAKEQRQNVERQKDTSSADEVDRLKTLLEEKETMYLSEIKILE
                     DKLAAAQKEKDDKQNKLEKVEKQYDEEQAQLLESQAREVTTLKTQLDESNKRLGDITS
                     KMKPLEEQLVEKAKTIQELQEQLNKSTSAIELPTKTVTETEITTLKTTPMSKNQKKRN
                     RKKNKKQNNAPTVATKEEEQAEKNPQPSTEEDNADTSGLLERYNTLLKDFEAFQSEHK
                     DCKDWEEKYNETKSHLEELKDVSEKLAELEEEKNNLGAELSKTKEALTAKNTEVEEQR
                     EMMREIGNDLVAAKDQIKESSLGKNEEIARWTAQVENLKNENEKIISENKTKQSELEK
                     NTAALTDEIEKLKTKYMDASKRLKDNEARMNEALSKIQNENNRLSNQMRDYNSVKTNV
                     LQKEKTISYLENQIKGYTEEKIKTEKSIDMLKRENGILTNRLDLLKKENQTLHDNVKK
                     NSNSYENYLKENGKLSERLSILQDKYDALQNIKSNSNEQTDSIKRQCEELNVKLREAS
                     KRIISLEDELNDYTTIIQDKTRETDTMRRLLSESQNDEKTRQHQLTEKVTQLTNEKEK
                     LDSELSLQTARINREINDWKHITNDLKSEVHALKLREQQLLSEITTLNSLNDTMKRKS
                     VATHEDSGELEKLTSNLKEALSKADGKIQELQNSNEQLMHLNNDVNKKLERITKNYRT
                     LSNQLNALREGKEISARESRSNSVASSVSNHLTVGEPRKSSSTNDLAGSKRENELEQT
                     EKVAYMKNVLLGFLEHREQRSQLLPVISMLLQLDSNDEKRLLMSLR"
     gene            complement(<691155..>696308)
                     /gene="NDAI0D02940"
                     /locus_tag="NDAI_0D02940"
                     /db_xref="GeneID:11495265"
     mRNA            complement(<691155..>696308)
                     /gene="NDAI0D02940"
                     /locus_tag="NDAI_0D02940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669803.1"
                     /db_xref="GeneID:11495265"
     CDS             complement(691155..696308)
                     /gene="NDAI0D02940"
                     /locus_tag="NDAI_0D02940"
                     /inference="similar to DNA
                     sequence:INSDC:Scer_YGOB_SDC25,YLR310C"
                     /note="similar to Saccharomyces cerevisiae SDC25
                     (Scer_YGOB_SDC25) and CDC25 (YLR310C); ancestral locus
                     Anc_4.45"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669851.1"
                     /db_xref="GeneID:11495265"
                     /db_xref="GOA:G0W9Z7"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR019804"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:G0W9Z7"
                     /translation="MNEQSSNFQKWKSKILRQNNSRENISANAVNYNKNRRPSNLRTS
                     ISSTCSSNKDNENENEHDPTSIAHATSQSSSSSSLKNSTDKGRKRSSSSFSSFAELLS
                     LNNKNNNSKSGKSSGSPSSRSANPSPSTSSVGLSNLRQRPKNNTRGQSDGHLVSHSSK
                     SSSSSSSSSSLESATKASINPLDIVISLYDFFPENRNSTTYTNSQLSFPKNELIYVLE
                     KNFSGWWDGIIISSQNDVKRGWFPQNYVTSIKNSVKIKLNENLNPNTTTSNPEEIARN
                     IIKNNNPDKTKPTSSSTTSPATPRSLSVPNKKNAIIKRDRSSLPYSSKLTETKSTVNS
                     KKNSFSAPTPSTLSSKRPSDAAILTPNLPPSHPSRSSLSLEPQQEPPSSSPSHESIGR
                     ITFKDIDPFQNNDNKNNETGVEQERNDIKPRPQSTEYRKRNVSLYHSVPQEKVYTTDE
                     IQTVLATLKIPIPMIWDPVIDTNGTEIVNNRNGCDLKIFYYNDTFDIYTKDLPLLQPA
                     SILPKSSIPTLSISSTDHIFEKRNSQKVQDLKKDFKKIAESLSSRNGGEAVNNSIPTS
                     SSIMQNLQYNRRQTISPSPLNIASGTYGGCRSSNKKQNGNNSSHGHFATITPTPIASL
                     DNLFYDHENDIKTCTQLKNYTLRQLELTRQSFEGSNRYEYWENFNKTMSYMTYIQMVC
                     RLLQAQIKSKNMIKLFQKSLKALVNSLTKIQINSCLHFNFMTMEARKQECLKPLYIHV
                     PISKNDSSNSDSNFDFPEQKRPRDHDDGDKTFSPRVVSNSIEIEYLELLTITNSLFRL
                     LQEAMSDYSNKADDESDGNSGGNSMDTLPQLFPRFFKNSFNGTSWKNIFLTPNSNDAN
                     IPPYPKLMLDSLATASGVKLNSEDLSSHLNASWYPKFNSSISGSTLVASANGNNLIPE
                     RTLRRGTVTTNIFRQSTSSASPTTHVLTSSRSPSHNNIQESRFINTKIPLNRETLQMM
                     SKLQAELYGKIHPFTSYSPLMNNDVPERKKKLMINLKTYEEFNQTILIIELLENLDLT
                     IFLNLEKLVKMEDERVSNPEDNMEADLDENNEYDLQMDEETKEFLAHSFSTTSTILRD
                     FFHIKQQLHNGFINLIICTQNTTLDDPFVFASMKGNSPIGHNEPFNRLDEYSAAMKFM
                     KNLIKRDYETNGSKFVDVSDELAIACNDFIDIAALSCGIVEQLIESRENILNYVARMM
                     QSHIASKLLDGEANENESEEVNDWSQESFNENENEEVDERTFDANRNLVPWYLLPDFE
                     NELVYTAKHRVKGGTKDALIEHLTSTEFVDHWYNVTMLLTFRSIFTTREFLFALICRY
                     NIYPPEGLSFGEYNKWATKKAIPVKINVVRIMTIFLEQYWAPGYFEEGLDTIMTFAKM
                     VECEHIEGAEHLARQIHLTLEESKKYNAEYEKRIESTVEEVFSGAKVKDKKAMRQQPI
                     LKFHTFKILNVFRPALQSSPSRSSSPFKIPNKKVTYLDFTPVLLAQQSALLEHELFTE
                     ITIFECLDRVWGKKYCDMGGSPHITKFISVANNLTNMISTTIIRERDIKQRAKLIDHF
                     IQVAEASKALNNYSSMTAIISGLYSSPIFRLKKTWELVPENSKNLLKELNELMDSKKN
                     FINYRQSLKSVKDVPCIPFFGVYLSDLTFTHSGNPDFLPGSANMINFNKRAKLIDIIE
                     EIISYKKLRYTSFKRNDDIIDFIYSTIEDLPHIEKQYELSLIIEPRTKK"
     gene            <697810..>699504
                     /gene="NDAI0D02950"
                     /locus_tag="NDAI_0D02950"
                     /db_xref="GeneID:11495266"
     mRNA            <697810..>699504
                     /gene="NDAI0D02950"
                     /locus_tag="NDAI_0D02950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669804.1"
                     /db_xref="GeneID:11495266"
     CDS             697810..699504
                     /gene="NDAI0D02950"
                     /locus_tag="NDAI_0D02950"
                     /inference="similar to DNA sequence:INSDC:YLL018C"
                     /note="similar to Saccharomyces cerevisiae DPS1 (YLL018C);
                     ancestral locus Anc_4.44"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669852.1"
                     /db_xref="GeneID:11495266"
                     /db_xref="GOA:G0W9Z8"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004523"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:G0W9Z8"
                     /translation="MSQEEQAKAASATVSASPSQSPAPVGEVILGEDGQPLSKKALKK
                     LQKEQEKQKKKHERALQLQQEKEQREKEALLNDTAKDNYGKGALVQSTVRTGEKRIKF
                     NELDEANDDGKEVLFRARVHNTRQQGATLAFLTLRQQHDLIQGLVKVNNEDGSISKQM
                     VKWVGSLNLESIVLVRGIVKKVDEPIKSATVQSLEVHITKIYTISETPETLPILLEDA
                     SRSEAEAEKAGLPIVNLDTRLDARVIDLRTVTNQAIFKIQSGVCQLFREFLSNLKFTE
                     VHTPKLLGAPSEGGSSVFEVSYFKGKAYLAQSPQFNKQQLIVADFEKVFEIGPVFRAE
                     NSNTHRHMTEFTGLDMEMAFEEHYHEVLDVLSDLFVFIFSELKKRFSKEIEIVRKQYP
                     VEDFKLPKDGKMVRIKYKEGIEMLRAAGKEIGDFDDLSTENEKFLGKLVREKYDTDFY
                     ILDKFPLAIRPFYTMPDAEDPRYSNSYDFFMRGEEILSGAQRIHDHELLQERMKVHGL
                     SSEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPKRLRP"
     gene            <699963..>700286
                     /gene="NDAI0D02960"
                     /locus_tag="NDAI_0D02960"
                     /db_xref="GeneID:11495267"
     mRNA            <699963..>700286
                     /gene="NDAI0D02960"
                     /locus_tag="NDAI_0D02960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669805.1"
                     /db_xref="GeneID:11495267"
     CDS             699963..700286
                     /gene="NDAI0D02960"
                     /locus_tag="NDAI_0D02960"
                     /inference="similar to DNA sequence:INSDC:YLL018C-A"
                     /note="similar to Saccharomyces cerevisiae COX19
                     (YLL018C-A); ancestral locus Anc_4.43"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669853.1"
                     /db_xref="GeneID:11495267"
                     /db_xref="UniProtKB/TrEMBL:G0W9Z9"
                     /translation="MSGNPGSSLRALSPTPPERGSFPLDHDNECYDAMVKYLNCMKLV
                     KGENAPNCRLLAKSYLKCRMDHQLMDRDEWEHLGLPKDQPPQQQQVKSDSSQAGLASQ
                     AHSRK"
     gene            <701299..>704058
                     /gene="NDAI0D02970"
                     /locus_tag="NDAI_0D02970"
                     /db_xref="GeneID:11495268"
     mRNA            <701299..>704058
                     /gene="NDAI0D02970"
                     /locus_tag="NDAI_0D02970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669806.1"
                     /db_xref="GeneID:11495268"
     CDS             701299..704058
                     /gene="NDAI0D02970"
                     /locus_tag="NDAI_0D02970"
                     /inference="similar to DNA sequence:INSDC:YLL019C"
                     /note="similar to Saccharomyces cerevisiae KNS1 (YLL019C);
                     ancestral locus Anc_4.42"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669854.1"
                     /db_xref="GeneID:11495268"
                     /db_xref="GOA:G0WA00"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G0WA00"
                     /translation="MSHNIQTITPNRKRTRHSNSNSNSNPNPNPNQDYNLNNNFDNIH
                     NNNNYNNNNSTASINSKYMNIMNTNNYNKNNNNNSILDEMLARQNSYLQDNFKDAAGE
                     GGGYNLIDPNIQNFKNINLNQNTITTTTTTTQIQNEHYIDNDNFNDNDIEMIDPKQNG
                     NIILTDNDKNDREEYQEDNDDDGDDDVIFIKEQPVQFTSPLIPSFNNISSENYITTQS
                     KKFKKQRTISLPQLPLSKLVYDSKNANFISRKQNDDELLHLVGSSAKTLDGNKSIHLN
                     VVHSMSPFTNKAQSPSSISLYSNSQDYDNTYEEANNDDNESPLSDLDLRHAHNLRNIA
                     TTNNNYNNSTTKSIKKILLLRYKKLTTSSKNKKKKQQQQQQQQQQQQQQQEQQHQKQI
                     LLSASTSAPSSPTTSISTTSSKTNNNNSNNNNNNDIMKKQYMTNNTYPHKHHRLKKIS
                     NYFKTDKDGHYIYQENDIFGSNGRFKSIGLLGQGTFGKVLKCIDAAPSSSSSSVPSSI
                     PLYHTTSNINSVDIRRRKKLVAIKIIRAVDRYREAAKTELRVLQTIMENDPHGQYQCL
                     ILNEAFDYKNHIFVLSLIYSENQSTILCATNGIARFPGSHIQAIARQLIRSMAFLHDL
                     GIIHTDLKPENILLCDEEYIEKDLPIEILACLSKRRREASGGRRKILKSPEIKIIDFG
                     SAVFYNEYHPPVISTRHYRAPEIVLGLGWSFPCDIWSIACVLVELIIGESLYPIHENL
                     EHMAMMQRINGATFPKKLIEKMFYKVDHKLGNLPSDLNTTVVKHFNRSTYQLVWPEVN
                     KKTGNIVTKEKSIRRVKDSCERLDIFISKFLKLDYGEDFEINWDLSIERNWEIIQKIS
                     AWNGTEKTQNVDKETFLFWYWFIDLLRKMFEFDPTKRITAMEALDHEWFNLGILDEGI
                     STYGN"
     gene            complement(<704549..>709024)
                     /gene="NDAI0D02980"
                     /locus_tag="NDAI_0D02980"
                     /db_xref="GeneID:11495269"
     mRNA            complement(<704549..>709024)
                     /gene="NDAI0D02980"
                     /locus_tag="NDAI_0D02980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669807.1"
                     /db_xref="GeneID:11495269"
     CDS             complement(704549..709024)
                     /gene="NDAI0D02980"
                     /locus_tag="NDAI_0D02980"
                     /inference="similar to DNA sequence:INSDC:YLL021W,YLR313C"
                     /note="similar to Saccharomyces cerevisiae SPA2 (YLL021W)
                     and SPH1 (YLR313C); ancestral locus Anc_4.39"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669855.1"
                     /db_xref="GeneID:11495269"
                     /db_xref="InterPro:IPR013724"
                     /db_xref="UniProtKB/TrEMBL:G0WA01"
                     /translation="MQEQSNPSSPNLSSSMTPNTATKTSNITFTKDQQNDIYQYYVSL
                     NDFFKVTGLTRPNRSASTRAQKARAKLLKLSSSQFYELSTDVSDELQRRIDENNTTIS
                     SNGSTSKTNSFLAPRSNFHLKRNQARQKLANLSQTRFNDLVDDILFEIKRRGYHIKPV
                     EEEEKPSKAEELQLKPPLSHAHSQSQSQSALPTTSIQSSLIIPQKASIDWSSEDDEDD
                     AAKIGHSGDEDNATVDNNDLNETINTTSNDTVNTVENSNPFMKALENEMALNSKIDET
                     FTNEKFNNEVQSTTNDNTTRSSIDDDASSVNKIDLSKNVLPTIITETPTITTGSTDPT
                     PKEDNVFSKGLPVTPSAVLSPEEIEDNSNRLIELQLKIKSLTNELSLIRHENNTLKNK
                     DHNTSKLINEQFVQKELINLNSELSKLSIENENLKQNISELELKLKSQSSRSSSNDHT
                     QINLLNEMAIEPFTSKDGYIPIDLINTLYSHINSFDISLKQNTSGQLNMGTQLFKELS
                     KITNLISHIISTVELPQFNDQIVVLKASLSHMITSTRYYSIFGHLLPKITMYSAISEI
                     IFALCNLIKIAKIRPSNNNKAINHLKTSASETITKDTLSTNPLGSKEIGDINNNVTTN
                     KTLPLSNADNISNTPLTPITPNFEKPGFNATGDITEFYEDSPVKPLKIAQKPHNSPLL
                     NSRSNSRQPSNAGFFPIKPDSKASSSKNFNSLSSLNLSTIGTTPTPSLKTQDRSLNDS
                     VDNLDKKDLNVSQSDVNKTPTSFLPANSSASSSSVPPIIEDEAMSTNPIVTNPTHTMD
                     NNVKKLLSQLNDGNNSNNKNMAVPNASVIPPSKVSKAEKQDNHVDNAHKETNDNVLPI
                     IELKQPVPDIPIRKNRGINNRLKSVPGSPVKANFSENDSSNVETVRDDSISTDAQNDL
                     NEEHTIIENVLTEMEPNKKDEQEEVQPNQEVKHDIQPDNDQPNTSETANDISKNSEPA
                     RVPAVEAKSANKTSVVALESSAKVPIKSESQNNEPVNHDLLNEAATQKELFNEAPIKK
                     EVPNEAPTEGESFDKTLIQKESSAKHLTEEVIGSLEQGNEPKIPHDDHTSTSPIDLHN
                     EPIDLEGPALQPKISEQHGDNAENEDGVVHKDNIPDIIPHSSPLPKEVEDVLEKSPRQ
                     VPNKIESNTARSIDLSSLSSSSKSSVESVRSTEKEGPLVEEQIQRPQKAEETNAVAES
                     QDEEISIEEVPQIEKEENILSVSPFKEDIHKEEKSVETSEEESEEESEGEGEEEETND
                     ENDSYEFVPLDHKVKDENVAKIGTDFDSDTSSEEEDDDEEDAPEDEDDDEDDEEEEDD
                     EDEDEEDFDVDAFDIENPDNTLSELLLYLEHQTVQVISTIQSLLSSIKEPEATKGDLR
                     TESNAINQVINQMVDATSISMNQSRNANLKKHGIWVVQSLEDCGRRMTVLCQLNRDGV
                     LIKMEKSDGDYADKHFKQRLAGIVFDVAKCTKELVKTVEEASLKEEIDYLNSRLN"
     gene            <709442..>710632
                     /gene="NDAI0D02990"
                     /locus_tag="NDAI_0D02990"
                     /db_xref="GeneID:11495270"
     mRNA            <709442..>710632
                     /gene="NDAI0D02990"
                     /locus_tag="NDAI_0D02990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669808.1"
                     /db_xref="GeneID:11495270"
     CDS             709442..710632
                     /gene="NDAI0D02990"
                     /locus_tag="NDAI_0D02990"
                     /inference="similar to DNA sequence:INSDC:YLL022C"
                     /note="similar to Saccharomyces cerevisiae HIF1 (YLL022C);
                     ancestral locus Anc_4.37"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669856.1"
                     /db_xref="GeneID:11495270"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G0WA02"
                     /translation="MHMSAMEKELKDLIIRGTKYTANKDFTKAAEIYAKILDSLIKGR
                     ELDDVDFNKEDLIVARYMVSMAQCLFEMALENTDLFGGLGNGIGNADEDDDNEDDNDD
                     GSPSSHSGSDIDGEDSDNEGKPTLNKTFFQFDHEEEEEEEEDDDTEEEKKGTRKENKQ
                     FNESNIESEEESALESEEAEEEEDINDGDNSIMKCKHFSDYLTGDFLMHSSHLAEKAY
                     ELYNKSGSYCQESIDASKIIGDINLEWESFETAVDCYKTALKTYQRVYNKMDYKLLWS
                     VCEAMKYCEEVTGAKPSRERLKYLKQISIDEDNDDAELGLWAENEYLESSIPRAGPPS
                     SEPSSSSSSFASFVSKNNKNKKRKTQWLPSVSSPSTANDLSGLVRKKTKKNPQKPSKT
                     LRNP"
     gene            <710869..>711720
                     /gene="NDAI0D03000"
                     /locus_tag="NDAI_0D03000"
                     /db_xref="GeneID:11495271"
     mRNA            <710869..>711720
                     /gene="NDAI0D03000"
                     /locus_tag="NDAI_0D03000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669809.1"
                     /db_xref="GeneID:11495271"
     CDS             710869..711720
                     /gene="NDAI0D03000"
                     /locus_tag="NDAI_0D03000"
                     /inference="similar to DNA sequence:INSDC:YLL023C"
                     /note="similar to Saccharomyces cerevisiae YLL023C;
                     ancestral locus Anc_4.36"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669857.1"
                     /db_xref="GeneID:11495271"
                     /db_xref="GOA:G0WA03"
                     /db_xref="InterPro:IPR005344"
                     /db_xref="UniProtKB/TrEMBL:G0WA03"
                     /translation="MTANSVNSNNKKNDVASKLAAKNNTFSKRFVRLTKSLQFYWFLG
                     HAITLFASFIYFFTFSFKQSWYRIAFFGALQSFGVLIYQQQFLSKSTTSKPAASEEVQ
                     ILEYENILYFILALTWISTPKLSIALVPYIAFSTLHFSSYLQSTLLPKLFPGATADKV
                     SSYISKFHECYNEKSMYWVASGELLIECILILRALLFFPKSWIVLIIYSLFLKVKFEL
                     SKYSTTVFAQWRVIFDGIISHPMVPPQIKKAYNFIKLNLISLSNFKLIRYLNIPIPIQ
                     DEKKKEN"
     gene            complement(<712188..>714524)
                     /gene="NDAI0D03010"
                     /locus_tag="NDAI_0D03010"
                     /db_xref="GeneID:11495272"
     mRNA            complement(<712188..>714524)
                     /gene="NDAI0D03010"
                     /locus_tag="NDAI_0D03010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669810.1"
                     /db_xref="GeneID:11495272"
     CDS             complement(712188..714524)
                     /gene="NDAI0D03010"
                     /locus_tag="NDAI_0D03010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669858.1"
                     /db_xref="GeneID:11495272"
                     /db_xref="GOA:G0WA04"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:G0WA04"
                     /translation="MKVSSAGNGCKAGMSDMTLKTRSLQVAMKLMSVKKGTYELYLSK
                     YGELDNKIMNTYLDASKEALLNDFVANDKYTTHPFLFMNEMYAELLIRGKLTPRIIVE
                     EIYKRYGIPLKNELQTKVLQRLRGRCKRMRLTYKFEDGKLFFTSPHNKKKLIWCPPTL
                     LHYVIACVHENWDCDDYTLRKHRDENEIQSILAAKYHNISKFLIHDVVAACPDCKPLS
                     SKKFNITRVNVLPLTRYSFQRLQVKILSAADYSCVCPKDNCTKNAILYIGDYHSGAVW
                     LFALDGEEDATDILLVLEMFLNVVLITPKHIQVDNQKIFRDENIAKFLADNNIEVVFE
                     YRSKFLETVEDTIKEVITTWIGEHKGHSINQRPNTTSTVTDGANIEANNAQPATSDNS
                     SLTSQQTSNNNNINYATNNTNNNVGMNTINNVGMNTNNNVNDNNNNNSMMMDMGGNTN
                     QYMGMGYNHMTLGVPSNMGLNMNIGAMGNMNMNVDNNPSNMNMLLNQDHHSGYQQQQF
                     QQGYQQAYQQQQEFQQPPHHSLALPQLRQPMQPISSQVIEQQQEESQPDEQAQDAEPV
                     SNDTPPWCCKLREISMKLNLVPDPILKNTPFDTLYSLPTTAENLFDPKEDAAPEQIDM
                     KYLEPFFEGYEGPPPPSVHRKELCQNGDDAFAESPGVTDVEDRTVVDDPTVDDNDDES
                     DEEGIETEDTCIDRTIPSDEKKPNKISKKNRVAKKLNVVQNGLLKKVFTTNNHTGNTT
                     TSGSASSSNTVQQPPRIKELVHKSAAKDIVLPLRHAGT"
     gene            <714796..>715974
                     /gene="NDAI0D03020"
                     /locus_tag="NDAI_0D03020"
                     /db_xref="GeneID:11495273"
     mRNA            <714796..>715974
                     /gene="NDAI0D03020"
                     /locus_tag="NDAI_0D03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669811.1"
                     /db_xref="GeneID:11495273"
     CDS             714796..715974
                     /gene="NDAI0D03020"
                     /locus_tag="NDAI_0D03020"
                     /inference="similar to DNA sequence:INSDC:YML062C"
                     /note="similar to Saccharomyces cerevisiae MFT1 (YML062C);
                     ancestral locus Anc_4.324"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669859.1"
                     /db_xref="GeneID:11495273"
                     /db_xref="UniProtKB/TrEMBL:G0WA05"
                     /translation="MSLTAQEINNIELKVEYNEQDTASTKYLDTLSKISTLTSSILHG
                     TLTDDTELNNVEDLELEMELRYMELANSVEVRKINFENFETSNSKNFEQMAEKQLPAL
                     KKFNQLTLDRLLKVQRLYEAVAMINLEIEDLSAGRTKLILKKSDWIDELGEELTETLI
                     KRKYLTFEKGYEAREDDPLLRAYDDFSKGPKELRRTNESLKEEISRLTEEVKVYKNKW
                     LQNAEIFTRVTSVLKDELKKRLDHDSLETKEQQEEFDDYEDEEETARYKRQREIENSD
                     QEERDDENEQEDLQDIENENIPMSDNEGVDEEPIIDAIIQDDEATEMRNSLHESESEK
                     NSDQEKGDENVISGDENNDDHSLELIGENDEVKDDPMDDEDNTNSRVEEKGTEEHEDE
                     "
     gene            complement(<716438..>717205)
                     /gene="NDAI0D03030"
                     /locus_tag="NDAI_0D03030"
                     /db_xref="GeneID:11495274"
     mRNA            complement(<716438..>717205)
                     /gene="NDAI0D03030"
                     /locus_tag="NDAI_0D03030"
                     /product="ribosomal protein S1"
                     /transcript_id="XM_003669812.1"
                     /db_xref="GeneID:11495274"
     CDS             complement(716438..717205)
                     /gene="NDAI0D03030"
                     /locus_tag="NDAI_0D03030"
                     /inference="similar to DNA sequence:INSDC:YLR441C,YML063W"
                     /note="similar to Saccharomyces cerevisiae RPS1A (YLR441C)
                     and RPS1B (YML063W); ancestral locus Anc_4.325"
                     /codon_start=1
                     /product="ribosomal protein S1"
                     /protein_id="XP_003669860.1"
                     /db_xref="GeneID:11495274"
                     /db_xref="GOA:G0WH87"
                     /db_xref="InterPro:IPR001593"
                     /db_xref="InterPro:IPR018281"
                     /db_xref="InterPro:IPR027500"
                     /db_xref="UniProtKB/TrEMBL:G0WH87"
                     /translation="MAVGKNKRLSKGKKGLKKKVVDPFTRKEWFDIKAPSTFENRNVG
                     KTLVNKSTGLKSAADALKGRVVEVCLADLQGSEDHSFRKVKLRVDEVQGKNLLTNFHG
                     MDFTTDKLRSMVRKWQTLIEANVTVKTADDYVLRVFAIAFTRKQANQVKRTAYAQSSH
                     IRAIRKVISEILTREVQNCTLAQLTSKLIPEVINKEIENATKDIFPLQNVHIRKVKLL
                     KQPKFDLGSLMALHGEASGEEKGKKVSGFKDEVLETV"
     gene            <717810..>718454
                     /gene="NDAI0D03040"
                     /locus_tag="NDAI_0D03040"
                     /db_xref="GeneID:11495275"
     mRNA            <717810..>718454
                     /gene="NDAI0D03040"
                     /locus_tag="NDAI_0D03040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669813.1"
                     /db_xref="GeneID:11495275"
     CDS             717810..718454
                     /gene="NDAI0D03040"
                     /locus_tag="NDAI_0D03040"
                     /inference="similar to DNA sequence:INSDC:YML064C"
                     /note="similar to Saccharomyces cerevisiae TEM1 (YML064C);
                     ancestral locus Anc_4.326"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669861.1"
                     /db_xref="GeneID:11495275"
                     /db_xref="GOA:G0WA07"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR017231"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WA07"
                     /translation="MSNSSSPEHEPIPAVRNQVDLQVGLVGDAQVGKTSLMVKYVQNI
                     FDEEYTQTLGVNYLKRKVRLHSTDIIYSLMDLGGQREFINMLPIAAVGSSAIIFLFDL
                     TRPETLNSIKDWYRQVNGLNDVAIPILVGTKYDLFIGLDSNYQNHISNSAIEYSKIMN
                     SPLVFCSTAEGINIQKIFKIALAKIFNLTLVIPEITTVGDPLLIYKNLGNATNK"
     gene            complement(<718700..>721393)
                     /gene="NDAI0D03050"
                     /locus_tag="NDAI_0D03050"
                     /db_xref="GeneID:11495276"
     mRNA            complement(<718700..>721393)
                     /gene="NDAI0D03050"
                     /locus_tag="NDAI_0D03050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669814.1"
                     /db_xref="GeneID:11495276"
     CDS             complement(718700..721393)
                     /gene="NDAI0D03050"
                     /locus_tag="NDAI_0D03050"
                     /inference="similar to DNA sequence:INSDC:YLR442C,YML065W"
                     /note="similar to Saccharomyces cerevisiae SIR3 (YLR442C)
                     and ORC1 (YML065W); ancestral locus Anc_4.327"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669862.1"
                     /db_xref="GeneID:11495276"
                     /db_xref="GOA:G0WA08"
                     /db_xref="InterPro:IPR001025"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WA08"
                     /translation="MAESWDDLKGWEIIITDENGNILDENQRRRRRRGKEEKVYLERK
                     SDNLRIGRGDSVVMNNKKTDTWAVYMIHEIRLNTLNNLVEIWSFNYLRWFELDAIQFF
                     KAFDKDQLKGTPTIEDLNRIIAENVNKSELYLTLELSEILLVDFISMANIMSQEDWDK
                     SENNPKKDFVVRYISYPSTEKFREINFCEEKEIMLRFKPKVAMDYIKSRARPILGRFE
                     NGDPTGEKRRKRFSPEERIKTFTAINDGYKESDSDASNSDSDAGSGSDVNNSSTDEMN
                     ETEDESGSFSNSDIEIENEDELVSDHDDEDVDFGLPRMKSMSKKPVPGRKRGRPPKEG
                     GTRKYPHRLTVQGLTIPKTSEGTPVIRKFTKRNVNRAKKKYTPFSKRFRSIAAIPDLR
                     KVSSFKESSDKSDLAHHNLEDKLKTSNGHKVVETIFSKVKRQLYSSHGKEEIVKSKNF
                     DEYLPARENKFASIYLSIYSALESESATTLYVAGTPGVGKTLTIKEVIKDLISSANQH
                     ELPKFKFVEINGLKMVKATDSYEVLWNKISGERLTWAASMESLEFYFNKVPQNKKFAT
                     VVLLDELDALVNKSQDIMYNFFNWTTYTNAKLIVIAVANTMDLPERQLGSKVSSRIGF
                     TRIMFTGYTHEELKNIIDFRLKGLNGSYFYVDSQTGSAIQLESTEETDPLPAGMKKIR
                     LQMSPDAIEIASRKVASVSGDARRALKICKRAAEIAETNYMVKHGYSYDATINSDETA
                     KEGKSEDTDQEEVQTIHIRHIMQALNESLNSHTVDYISHLPFTSKLFLYALLNLTKKN
                     GLYEQNLGDVIDEIKLLLDINGTNKFIVGINETLYGNSQKDAIEQLRIVSWDFTINHL
                     VEADVLIKVNMKNERSSCIKLNISSDEIRRAIDQDIYIKDL"
     gene            <723016..>726927
                     /gene="NDAI0D03060"
                     /locus_tag="NDAI_0D03060"
                     /db_xref="GeneID:11495277"
     mRNA            <723016..>726927
                     /gene="NDAI0D03060"
                     /locus_tag="NDAI_0D03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669815.1"
                     /db_xref="GeneID:11495277"
     CDS             723016..726927
                     /gene="NDAI0D03060"
                     /locus_tag="NDAI_0D03060"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669863.1"
                     /db_xref="GeneID:11495277"
                     /db_xref="GOA:G0WA09"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013103"
                     /db_xref="UniProtKB/TrEMBL:G0WA09"
                     /translation="MLKILSNGQQARGSVPLFTILQRAMTLAMQATDITIIMRKLRDL
                     HFEGKEPAFIFNANVQSIISQIDTKELTQYEPLIKDCILNALTGPYSTINKEFRTSQS
                     PYSISDIYTRISAEYDYITTTQSARPKCSYCHIVGHTRDQCFKAVAPSTANPIPKAKS
                     NTRTPRSSPTHRKQSAKSSKITNNITVDRTTEHDHYWLRPDSLPINEDQHFILDSGAS
                     VTVVKNGSILHDLHQTASPPVISSSQNIPMRCTGQGTLRLKLYHSKTIDIPAYVIPEL
                     EHNLLSTNSLEHHDIFVDAKHGTLESRDGNTLAQFVRFNSLPWLTFHHVVIPPHARIN
                     NLIQKFPLDVVHRLLGHVNVKSLQQSIKNKTFDHFTIEDIDWTGISTFQCITCLQGKS
                     RKHNHTVGSRLKYQKNYEPFQYIHTDVFGPVSVDKPYPSWFVAFTDEATRFRWVFPLE
                     NKTADLMLHVITALVNTIKRQFNSKVLCFQFDHGREYDNKLLQNYLESNGIQSIFNSV
                     ADSASNGVAERMNLTLLNDCRTLLKAAQLPDNLWFYAIQFSTVIRNSVYNESIKSSPR
                     AIAGLSGLDVKTILPFGQPVIAHRTKTSSKLHSRGEPGFALTPSTHSYGYLIYIPRTQ
                     TIIDTANYAVVKQNVSTSHSADQNASIIDPLLDAFNDHVHDTDSPLQTPSSVSDTHVS
                     SSDESPGPTDRTQSVDTSTYNSDPDYVYQTDTDYDTQSDESNSDDSSLDQYLDPIPDS
                     FSSTHNSKPSTDSTPSGGTPSRSNILHSGKIDKLPFYGNSLPTSTGLGGSNKPRISTH
                     QQDLIRRIEERKRQRSDDIETDSKDDNSHRNKKSKQTVNYIKATNHSINAIKSIPLQT
                     STFYPQAITYNNNETEKQLFQEAYEKEISQLKKMGTWDETAIEEELVDKNKIINSMFI
                     FTIKRDGTHKCRLVARGDQQKDGTYNTDMTANTVHHYALMTCLSNCLSNSYDIIQLDI
                     SSAYLYADIDETLYIRAPPHMNMKNKVFQLQKSLYGLKQSGANWYKLIKGFLTDKLNM
                     TEVLGWPCVFMKRKDKQVLIICLFVDDMILFTNSNKMATDAIELLKTRFATKVINDGK
                     DNTINKYDILGMEIEYVKNQSMKFGMEKSLEEKLPTLGIDLSKLRKVPGTPGLIIEKE
                     DIKVTKQEYNQKVKWMQQIIGLASYVGYKYRFDLLYYINVLARHTLYPSGTVIQLAKE
                     LIQYLWNTRGRKLIWLKSNNSNTHNKLNIICDASFANQENFKSQYGHIIKLNDNIIAG
                     TSSKSTITCSSSTEAELYSVSQAIPQFELLTALSKRIEDKL"
     gene            <728348..>729493
                     /gene="NDAI0D03070"
                     /locus_tag="NDAI_0D03070"
                     /db_xref="GeneID:11495278"
     mRNA            <728348..>729493
                     /gene="NDAI0D03070"
                     /locus_tag="NDAI_0D03070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669816.1"
                     /db_xref="GeneID:11495278"
     CDS             728348..729493
                     /gene="NDAI0D03070"
                     /locus_tag="NDAI_0D03070"
                     /inference="similar to DNA sequence:INSDC:YML066C"
                     /note="similar to Saccharomyces cerevisiae SMA2 (YML066C);
                     ancestral locus Anc_4.329"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669864.1"
                     /db_xref="GeneID:11495278"
                     /db_xref="UniProtKB/TrEMBL:G0WA10"
                     /translation="MLIFKRFIVWAILLGLTSIQFLLYLPSFTCTFSPLSSFCSPQFN
                     FGIVGTSIAAKEFIGSVREFLKLLSYLTLDMGWSNELIDPEIYKDENLIDTFQDSNVY
                     KVNYLGFCKKNDIEDKKIYCVSNGLAGMDILGILIRDIGLQLGELSSAHVNDTRQLGD
                     SMVFTYHLTLNSLRKLFKNDKKKDKGFSKILLGDQKNADGPKNYRRGIDIAYTLMLFN
                     KVLTITYLTEFSISFICVAIVVAFGMVLLWGKHHRFIPLFLKIFGSLLMLLSTITFCC
                     NIIYLLILKAWEVNTSETTSVTGWEMLKVSIGSGFMINGVRYVLQWVFLPVLFLTANH
                     YGVKATNDDKTKENDNGNRSGSSSYLMTDVEEQMKEVNNPFVSAKMI"
     gene            <729819..>730880
                     /gene="NDAI0D03080"
                     /locus_tag="NDAI_0D03080"
                     /db_xref="GeneID:11495279"
     mRNA            <729819..>730880
                     /gene="NDAI0D03080"
                     /locus_tag="NDAI_0D03080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669817.1"
                     /db_xref="GeneID:11495279"
     CDS             729819..730880
                     /gene="NDAI0D03080"
                     /locus_tag="NDAI_0D03080"
                     /inference="similar to DNA sequence:INSDC:YML067C"
                     /note="similar to Saccharomyces cerevisiae ERV41
                     (YML067C); ancestral locus Anc_4.330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669865.1"
                     /db_xref="GeneID:11495279"
                     /db_xref="InterPro:IPR012936"
                     /db_xref="UniProtKB/TrEMBL:G0WA11"
                     /translation="MAASLKVFDAFPKIEDQNKKKSTKGGITSILTYVLIIFIAWSEF
                     GSYFGGFVDQQYIVDGMLRETVPINLDLYVNVPCEWVHVNVRDQTLDRKFASQELKFE
                     EMPFFIPFDVRLNDNPEIVTPELDEILGEAIPAEFREKLDTRMFFDENNPDKSHLPDF
                     NGCHIFGSVNVNQVAGELQVTAKGHGYADYHRAPLEKVNFAHVINEFSFGEFFPYIDN
                     PLDNSAKFNMDDPLTAYVYDTSVIPMIYRKMGAEVDTFQYSVAEHQYKSKESSSSNSF
                     RVPGIFFQYNFENLSIVVSDRRLGFIQFIVRLVAILSFAVYIASWLFILADMFIVIIM
                     GPKWSLRYQPSEQSHGLLE"
     gene            complement(<731042..>732406)
                     /gene="NDAI0D03090"
                     /locus_tag="NDAI_0D03090"
                     /db_xref="GeneID:11495280"
     mRNA            complement(<731042..>732406)
                     /gene="NDAI0D03090"
                     /locus_tag="NDAI_0D03090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669818.1"
                     /db_xref="GeneID:11495280"
     CDS             complement(731042..732406)
                     /gene="NDAI0D03090"
                     /locus_tag="NDAI_0D03090"
                     /inference="similar to DNA sequence:INSDC:YML068W"
                     /note="similar to Saccharomyces cerevisiae ITT1 (YML068W);
                     ancestral locus Anc_4.332"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669866.1"
                     /db_xref="GeneID:11495280"
                     /db_xref="GOA:G0WA12"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002867"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G0WA12"
                     /translation="MTYSNGIQEELQLLKDMYPELKVDEGSKKFITCELPFEMFFSTD
                     LTVVYEESGLNFTKLAGDSIFLKIDIAKYPQLQGSIELKFHSKWMSEVDKAKILEYIY
                     EEFDDMTRPSSPVYEPSTPILMLIFGFLIDEVSFKLFPNYERKCATKEEFEAFQEIYH
                     IIQKDEMAHKNFDCCICVDVKKGDKMIQLPCGEHFLCLYCTKTYYTQMIEEGNIVNVR
                     CPECTFEEVNLENVKSYSKLKETLLTPKIPFEFFDGILTPDICERYEKLFYEQAATKI
                     SKHSPLACTNCPSCKRPCIKDDLDDYMIQCSKCKFTFCFDCLHSWHGYNNRCGRKTTI
                     PREILEECSNLGPSDEERRRELQAKYGKRILEAEVNEYVAEKLLDLAIAEKGSNLQRC
                     PKCRTVIQRSEGCNKMKCTICGTTFCYICTQILDPDDPYEHFRELSSPCYGLLFQGMI
                     SEDD"
     gene            complement(<732730..>734361)
                     /gene="NDAI0D03100"
                     /locus_tag="NDAI_0D03100"
                     /db_xref="GeneID:11495281"
     mRNA            complement(<732730..>734361)
                     /gene="NDAI0D03100"
                     /locus_tag="NDAI_0D03100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669819.1"
                     /db_xref="GeneID:11495281"
     CDS             complement(732730..734361)
                     /gene="NDAI0D03100"
                     /locus_tag="NDAI_0D03100"
                     /inference="similar to DNA sequence:INSDC:YML069W"
                     /note="similar to Saccharomyces cerevisiae POB3 (YML069W);
                     ancestral locus Anc_4.333"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669867.1"
                     /db_xref="GeneID:11495281"
                     /db_xref="GOA:G0WA13"
                     /db_xref="InterPro:IPR000969"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013719"
                     /db_xref="InterPro:IPR024954"
                     /db_xref="UniProtKB/TrEMBL:G0WA13"
                     /translation="MSADFDRIYLNQSKFNGRFRIADSGLGWKASASGGSASNKAKAP
                     FLLPATELSTIQWSRACRGYELKINTKNQGVVQLDGFSQDDFNLIKSEFHHRFSIQIE
                     HKEHSLRGWNWGKTDLARNELIFALNGKPTFEVPYSHINNTNLTSKNEVGIEFNIQNE
                     EYQPAGDELVEMRFYIPGTLTTGDEEGEVPKKEEEKEGEGEDVDMEKEEKSLAEAFYG
                     ELREKADIGEVAGDAIVSFQDVFFATPRGRYDIDIYKNSIRLRGKTYEYKLQHRQIQR
                     IVSLPKADDIHHLIVLAIEPPLRQGQTTYPFLVLQFQKDEETEVQLNLEDDDYEANYK
                     DKLKKSYDAKTHVVISHVLKGLTDRRVIVPGSYTSKFDQCAVSCSYKANEGYLYPLDN
                     AFFFLTKPTLYIPFSDVSSVNISRAGQSSTSSRTFDLEVVLRLNRGSTTFGNISKEEQ
                     QLLEQFLKSKNLRVKNEEKETQERLQNALGSDSDEGDINMGSAGEDDESEDVDFHASS
                     GEEDVAEEFDSDAPVSDDEEGSGSDERPTKKPKVE"
     gene            complement(<734830..>736578)
                     /gene="NDAI0D03110"
                     /locus_tag="NDAI_0D03110"
                     /db_xref="GeneID:11495282"
     mRNA            complement(<734830..>736578)
                     /gene="NDAI0D03110"
                     /locus_tag="NDAI_0D03110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669820.1"
                     /db_xref="GeneID:11495282"
     CDS             complement(734830..736578)
                     /gene="NDAI0D03110"
                     /locus_tag="NDAI_0D03110"
                     /inference="similar to DNA sequence:INSDC:YML070W"
                     /note="similar to Saccharomyces cerevisiae DAK1 (YML070W);
                     ancestral locus Anc_4.334"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669868.1"
                     /db_xref="GeneID:11495282"
                     /db_xref="GOA:G0WA14"
                     /db_xref="InterPro:IPR004006"
                     /db_xref="InterPro:IPR004007"
                     /db_xref="InterPro:IPR012734"
                     /db_xref="UniProtKB/TrEMBL:G0WA14"
                     /translation="MKSFEVSDPITSSLKGFVLANPSITLVPEEKFLYRTTDKNKIAL
                     ISGGGSGHEPTHAGFIGEGMLSGAVCGDVFASPSTKQILNGIQLIAENSKGVLLIVKN
                     YTGDVLHFGLSAERARALGIDCRVVVVGEDVAVGREKGGMVGRRALAGTVLVHKIVGA
                     FAEKYSEKYGLDGTESVAYIVNDAMVTIGSSLDHCKVPGRKFESELNEKQMELGMGIH
                     NEPGVKVLEPIPSTEDLISNHMLPKLLDSTDKDRAFVDFKKDDEVVLLINNLGGVSNL
                     IISSIASITTDFLAEQYNIKPVKTIVGTVMTSFNGNGFSITLLNASKVNKELSSKFSE
                     VTSVINLLNDFTDAPGWPIADFENKMAPSVNHEILHNDVKVKEVGTYDYESFSKWMKA
                     GAEQIIKSEPHITKLDSQVGDGDCGYTLVAGVNGITENLDKLSKTSLSVATAQISDII
                     EGSMGGTSGGLYSILISGFSHGLIQVLKNKGDPVTAEATAEAFEIALETLFKYTKARK
                     GSSTLVDALAPFIEEFAKSKDFKKAVQAAAEGAKSTGTFEAKFGRASYVGDSSNVADP
                     GAVGFTEFLKGIESAF"
     gene            complement(737925..737996)
                     /gene="NDAI0Dtrna5R"
                     /locus_tag="NDAI_0Dtrna5R"
                     /db_xref="GeneID:11495283"
     tRNA            complement(737925..737996)
                     /gene="NDAI0Dtrna5R"
                     /locus_tag="NDAI_0Dtrna5R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGA"
                     /db_xref="GeneID:11495283"
     gap             739755..739774
                     /estimated_length=20
     gene            740419..740490
                     /gene="NDAI0Dtrna6R"
                     /locus_tag="NDAI_0Dtrna6R"
                     /db_xref="GeneID:11494828"
     tRNA            740419..740490
                     /gene="NDAI0Dtrna6R"
                     /locus_tag="NDAI_0Dtrna6R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGA"
                     /db_xref="GeneID:11494828"
     gene            <740699..>742075
                     /gene="NDAI0D03120"
                     /locus_tag="NDAI_0D03120"
                     /db_xref="GeneID:11494833"
     mRNA            <740699..>742075
                     /gene="NDAI0D03120"
                     /locus_tag="NDAI_0D03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669821.1"
                     /db_xref="GeneID:11494833"
     CDS             740699..742075
                     /gene="NDAI0D03120"
                     /locus_tag="NDAI_0D03120"
                     /inference="similar to DNA sequence:INSDC:YML071C"
                     /note="similar to Saccharomyces cerevisiae COG8 (YML071C);
                     ancestral locus Anc_4.339"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669869.1"
                     /db_xref="GeneID:11494833"
                     /db_xref="GOA:G0WA15"
                     /db_xref="InterPro:IPR007255"
                     /db_xref="UniProtKB/TrEMBL:G0WA15"
                     /translation="MDVILNDLLDGSVDKLTNDEKEYCLTALRDILQSDNKSYDTYFS
                     SRASSGTITEEIAEIDAEISNLERKMRDLLVSNKNAIVNEVLRNEDTKQLGSIRSDLE
                     QLWELDNIVTNTKKLNSTGVQETTSDDLSIEELLGQSQSKKEDKDDEFHTALKKLRNR
                     MSKAQEKNTVTGNLASVLDNLTNITDLMELPYLARTCIRTGHYQEAVMLYTHTNSLRV
                     KYPDSTIIEEICQNVLKEINTTMLTGLVKLLSTSSTVNSMKKILKYLAAIPPFDVKES
                     SAFLNVFLPVRYKFIQGEISAYSIGTDVSNDSLMEMMVKRKIEVLREHIYVSLNVFCK
                     SFSFATEEINFPLIPQLSNIKDKNGNTLSTYNKPVATNPLMLQFVRQCLSFLLKELTA
                     VDLKYKLSDSVCLQLVYCSFRLFDLNANFHKLFLNQVYESGLFKKEQLINAIKKRSEL
                     ASVYSYGS"
     gene            <742587..>747074
                     /gene="NDAI0D03130"
                     /locus_tag="NDAI_0D03130"
                     /db_xref="GeneID:11495284"
     mRNA            <742587..>747074
                     /gene="NDAI0D03130"
                     /locus_tag="NDAI_0D03130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669822.1"
                     /db_xref="GeneID:11495284"
     CDS             742587..747074
                     /gene="NDAI0D03130"
                     /locus_tag="NDAI_0D03130"
                     /inference="similar to DNA sequence:INSDC:YML072C"
                     /note="similar to Saccharomyces cerevisiae TCB3 (YML072C);
                     ancestral locus Anc_4.340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669870.1"
                     /db_xref="GeneID:11495284"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR017147"
                     /db_xref="UniProtKB/TrEMBL:G0WA16"
                     /translation="MVGNNTQEKLNDEHVSPTPKLSPTERNLRQKREDANKKSSETPE
                     KRQSAHSKTDITTEDAPHIPPKKDILVASAVNSAKKLPNPNPEGTVGSIPLEKVHPKD
                     LRKVPSRKPNKFDTSITSPGILDDLNPREKAELEEKINGEDAAGLFPWRLIGAFFPSG
                     KGSPKTMDVKIVKAYILENFYNDWYNNCAIIVGTCFTSWLFAYWGFSWWSLGFIFLGT
                     ASVYNAEFRRFNRNIRDDLKRTTVQETISGKVETTLWLNSFLSKFWVIYMPVLSSQVK
                     EAVNPILASVVPGYGIDALSLEEFTLGSKAPAIRGIKSYTKTGKNSLEMDWSFAFTPN
                     DESDMTQIEVEEKVNPKIALGVTLGKSIVSKTLSVLVEDINVAGKMRVRLEFGKIFPN
                     IKIVSIQLLEPPLMDFVLKPLGGDTLGIDVMSFLPGLKSFVKSMVNSNVGPMLYAPNH
                     MDINVEEIMAAQSNDAIGVLAVTLKSAEGLKGSDFITNTVDPYIVLKTEKTPNNEIKD
                     IRSSIKSDIKDPRWNETKYLLLPTLNQKLTFSCFDFNDVRKDTLIGDIEIDLGSLLSE
                     PNQENQTAEFMVGDKPKGLLHYSLRWVPVIEPKSEEKKPDNQAEEISDADEGEEAGDS
                     DVGIMKFNLQKVKYLDTSTSVTGNLSPSAKLYIDGQLKKSYRALRRINEPSWNEETEI
                     LIGSKSTSKITIKIFDERIGGSEVLCEYSSNVEDLLDTFGLGQESVKGSPQGEIYFTS
                     LWKPLATSEKFVSTTATTGPIGCIKIDVVKAKVTSNLSGLGDIDPYFSVQLNRHTKYK
                     SKYYSNCVEPVFHEAAYIPVTSENQHITVSLIDYQSVGSDRPIGSVQLPVSSYVKKNK
                     ETGEYEDNSKTAAPTIFSLKNKKNDQTDDTMSMAVSFIPTMSVYSPDEIKDVEKLEAD
                     LKRKREDFEAEQAELKLKMEQEPDKWEEVTVKDPFEDDVKKLHRKNKLTLEQIIARNS
                     GILSLDILGGRLAKESVFLEVLADDVSYPMFVLRGKGNKVNPERDSLFIRDLKHSKLH
                     FRLSRKNVAKDPDDVISTDSFGTLDLLNSSYGNPKEITFSGSSLKFKMFFEPSQCELS
                     SSESIENTGYLKLKFISADNLMSADRNGKSDPFVVAYVDRKKEYKTQIIKKTLSPVWN
                     ETAKIPIPARDRNQLILNVFDWDRAGDNDDLGAVKIDLTELEPEKTYDWNLQLSTQGT
                     IKLQGKFLPEYIRPTVEISQGKLSDKPMKAIGTVGGTGLGAAKQVSGAAMGIAGAGLG
                     VATGGLQKGGRLFGIGSDKNKKSRKSTESSPRIRNSLEYDTSVPNNSYTPRPSVEPAS
                     SNAEERASTKSNNLSRNTSSNMSNVGGKKSRASSFARTLAPNGTYNGNVNILSSEKLG
                     KNIQIIISLTQAGRMKHLYKTRVQKANDNGTNVFNEACAFKASPEATLVIGAVAHHKL
                     SKDKSLGIAQVNLGDPQIQKDENLALKLNDGHVIIKLDYAKEALENIPDVPQIPEQYQ
                     Q"
     gene            <747753..>748726
                     /gene="NDAI0D03140"
                     /locus_tag="NDAI_0D03140"
                     /db_xref="GeneID:11495285"
     mRNA            join(<747753..747767,748211..>748726)
                     /gene="NDAI0D03140"
                     /locus_tag="NDAI_0D03140"
                     /product="ribosomal protein L6"
                     /transcript_id="XM_003669823.1"
                     /db_xref="GeneID:11495285"
     CDS             join(747753..747767,748211..748726)
                     /gene="NDAI0D03140"
                     /locus_tag="NDAI_0D03140"
                     /inference="similar to DNA sequence:INSDC:YLR448W,YML073C"
                     /note="similar to Saccharomyces cerevisiae RPL6B (YLR448W)
                     and RPL6A (YML073C); ancestral locus Anc_4.341"
                     /codon_start=1
                     /product="ribosomal protein L6"
                     /protein_id="XP_003669871.1"
                     /db_xref="GeneID:11495285"
                     /db_xref="GOA:G0WA17"
                     /db_xref="InterPro:IPR000915"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:G0WA17"
                     /translation="MSAQKAPKWYPSEDVATAKKTRKASRPQKLRASLVPGTVLILLA
                     GRFRGKRVVYLKHLEDNTLLVSGPFKVNGVPLRRVNARYVIATSTNVSVEGVNVEKFN
                     VEYFTKEKLSKKEKKEANLFPEQQNREVSATRVEDQKSVDKALLAEIKKTPLLKQYLA
                     SSFSLKNGDKPHLLKF"
     gene            <749402..>752968
                     /gene="NDAI0D03150"
                     /locus_tag="NDAI_0D03150"
                     /db_xref="GeneID:11495286"
     mRNA            <749402..>752968
                     /gene="NDAI0D03150"
                     /locus_tag="NDAI_0D03150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669824.1"
                     /db_xref="GeneID:11495286"
     CDS             749402..752968
                     /gene="NDAI0D03150"
                     /locus_tag="NDAI_0D03150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669872.1"
                     /db_xref="GeneID:11495286"
                     /db_xref="GOA:G0WA18"
                     /db_xref="InterPro:IPR003100"
                     /db_xref="InterPro:IPR003165"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:G0WA18"
                     /translation="MVDNSLIGNLESLTIRNSDSVSPTGLSQETSRPTTRNESSYRLH
                     ENESESKKNTVRGKKKKKNKSKESSDDASKNGTIRRKSPKKKDKEVAVENKKFISLNE
                     TSSGDGEEIACETKKKKSLIADTTLRSNIQEKENVDLIGQSGGLSDDFKNFNIPDKAF
                     DLVHLQKGQNKVEEPLGEYKVKGRQDYGKKGTTVDILTNHVLLALGKDTEESDNKTNL
                     DPWWRDAMIFSYHVDFKASQPKYPTQKPSTGSFQTKKYEILESLFEEDETLFKYKDRI
                     AFNGEDTLYSHVRLEEFTLFEGCWAVSNKKKKHAYIPHLPHKSNPPEDDLPSKVTLKS
                     NATIPLKDIYDGTISRNTQEQESKMAGTEKHVLLALMGAKFLQMTDPVFQVNGNKFFI
                     FNEHTKAKPFQLGGYLMHGFTVSLRYAFGSVLLNAINVTLPFIKHSKYLPGDPRFQDN
                     HKAPYTLMDWLIECYQQTDPNNVAKRPAFNGKVTSNDLNLFISKNTELQNLTKGLKVY
                     CNHIQYDVDSYGQKKPSAKMKPKQIKGFSIESARVYKFKVKPSDLDNNIAKTNYERDI
                     SITTETYFLKKYKMVLKYPDMKMAYLDKGGYVPLECLTIVPGQKLKGKVYDENTVIEF
                     AALRPTDKFKMISALALPLITKALKPEEETKQPPCDSYYQFLRIPSRIIDAPAIKFQN
                     SQICYTDKPFNASVVDKTIPNQETKGNWNLQGHRFISTPKDLITLRVFFITESSPPSK
                     TGQEIFLTVKKFIVDVAEHGMKFRAEKPVLIQNFHAPRQEPDANSMTRGHGMRGKGGR
                     FNRSRPSAYKISDGENKLCEELSNAKENSYFLFILACGDDSLTYNRLKYLADLKYGVI
                     NSCLVWDKFKKKSAQYNVNACMKMNLKLQGINHCLEEKDLNLLKDSNGLPFMVLGADV
                     THYPEKDQNSIASLVASFDNHFAQFPGNYLLQSSPGEEMISGIGNLIGDRLKLYKKYN
                     NGKLPSKILFYRDGVSESQFSQVVQIEVRALKESLRRIGSNLRGSPYNPAITTVAVVK
                     RNQVRFMPLFKNGINEQGETCAVQSMDNVMPGTVVDRGITSTAHFDFFLQSQQSLKGT
                     GVPGHYWCIYDENEFTSDLLQYITHCFCYLFGRSSTSIKVASPIYYADLLCERAAQLF
                     KANFAIVKNEYEKNSRHKTPILPANNLLPPVNENIKDIMYYI"
     gene            <753435..>754598
                     /gene="NDAI0D03160"
                     /locus_tag="NDAI_0D03160"
                     /db_xref="GeneID:11495287"
     mRNA            <753435..>754598
                     /gene="NDAI0D03160"
                     /locus_tag="NDAI_0D03160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669825.1"
                     /db_xref="GeneID:11495287"
     CDS             753435..754598
                     /gene="NDAI0D03160"
                     /locus_tag="NDAI_0D03160"
                     /inference="similar to DNA sequence:INSDC:YLR449W,YML074C"
                     /note="similar to Saccharomyces cerevisiae FPR4 (YLR449W)
                     and FPR3 (YML074C); ancestral locus Anc_4.342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669873.1"
                     /db_xref="GeneID:11495287"
                     /db_xref="GOA:G0WA19"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /db_xref="InterPro:IPR026257"
                     /db_xref="UniProtKB/TrEMBL:G0WA19"
                     /translation="MTDMLPLATYNLNIEPYTPTPAIDIDMPVTIRITMAALNPEAYD
                     KDKTPSTLRVIKRNPDYNDGDIDDVLNGDFDEDEMDDASSEEEEEEEKETKKSKTKKS
                     KKEEESEEDSEDEDDIDDEFEEFVLVTLSPKSQFQQALDITIAPEEDVQFVVTGSYSI
                     SLSGNYVKHPFDTPMMDDEDEHEDEEDYDSEEDDEEYSSAEDDLDDISDEEVKIEEIE
                     ENEEEIKKESKKETKNKKRKQEEEAKAEAESNKSKRVKKVDFKKDLEEGPTKKKDEKP
                     KAKVLEGGIMIEDRVVGKGPQVKKGSKIGMRYIGKLKNGKVFDKNTNGKPFSFKLGHG
                     EVIKGWDIGVAGMAVGGERRIIIPAPYAYGKQALPGIPANSQLTFDVKLVSMK"
     gene            <755733..>758954
                     /gene="NDAI0D03170"
                     /locus_tag="NDAI_0D03170"
                     /db_xref="GeneID:11495288"
     mRNA            <755733..>758954
                     /gene="NDAI0D03170"
                     /locus_tag="NDAI_0D03170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669826.1"
                     /db_xref="GeneID:11495288"
     CDS             755733..758954
                     /gene="NDAI0D03170"
                     /locus_tag="NDAI_0D03170"
                     /inference="similar to DNA sequence:INSDC:YLR450W,YML075C"
                     /note="similar to Saccharomyces cerevisiae HMG2 (YLR450W)
                     and HMG1 (YML075C); ancestral locus Anc_4.343"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669874.1"
                     /db_xref="GeneID:11495288"
                     /db_xref="GOA:G0WA20"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR002202"
                     /db_xref="InterPro:IPR004554"
                     /db_xref="InterPro:IPR009023"
                     /db_xref="InterPro:IPR009029"
                     /db_xref="InterPro:IPR023074"
                     /db_xref="InterPro:IPR023076"
                     /db_xref="InterPro:IPR023282"
                     /db_xref="InterPro:IPR025583"
                     /db_xref="UniProtKB/TrEMBL:G0WA20"
                     /translation="MALLFKEMNHVAKPFAYLARFSARNPIHVILTTLIISTAAYLSV
                     IQYYFSGWQLDSNSIFSSNTRDQEQFFQECTHYVKEPSSRAWGLVSNGVAKDTFTRQH
                     YYLFDMNFQTDNHSIPLPELENTYFQRGNEKYVLSSQLDLPTILESSDGTQWRLKASN
                     NYLIEIQRFFVFLYKSCTTHIHESDPFDLFIIVMAYVTMMYTLVGLFTDMKKKGSNVW
                     LSLATIFNSIFALFLALYTTECIIEAPVNIFSLVEGLPFIFVIIGFKYKVKMAAYALN
                     KVEKIGISKKMTTDKIIFDAASHVGGRLMQDHFLCVIAFVGCSIYASHLEALTNFCIL
                     CSFILSYELILTGTFFAAILSLKLEIYLIHRSTIIKQTLEEDGVVPTTADIISSAESK
                     SETSIFQSNTTVAFAKLAIILLFVIIHFYNFGTKWASYTFSSFYMNKGPKLLPDFIKN
                     ARASDMFNEGDVVSIAPIQYYQPSKSYHQVEDLLLSVLSYISVAIRDRFVSKMVFFAL
                     IFSATINIYLLNAARLHTLFTANELYKKTSSITSLNLTSKATTPLKSLSPLPVPVPKT
                     ISEKLTERKSFNTISNVSTYVIPECSTDGEESDSSDSSDIQRSIEDLEKDLNDGKVKT
                     LKNKEIAALVVNSKVPLYALEKQLGDTTRAVAVRRKALSILADAPVLDSERLPYKNFD
                     YDRVFGACCENVIGYMPLPVGVIGPLIIDGVPYHIPMATTEGCLVASAMRGCKAINSG
                     GGATTVLTKDGMTRGPVVRFPTLKRSGACKIWLDSEEGQEKIKKAFNSTSRFARLQHI
                     QTALAGDLLFIRFRTTTGDAMGMNMISKGVEFSLNQMVEEFGWDDMEIVSVSGNYCVD
                     KKPAAINWIEGRGKSIVAEATIPRDVVKKVLKSEVSALVELNIAKNLIGSAMAGSVGG
                     FNAHAANLVTAVFLALGQDPAQNVESSNCITLMKEVDGDLRISVSMPSIEVGTIGGGT
                     VLEPQGAMLDLLGVRGPHPTSPGENARQLARIVACAVLAGELSLCSALAAGHLVQSHM
                     THNRAKKPEPAPHVSQPITAEKPKLRKEDLARLEEGSKICIKS"
     gene            <759984..>762953
                     /gene="NDAI0D03180"
                     /locus_tag="NDAI_0D03180"
                     /db_xref="GeneID:11495289"
     mRNA            <759984..>762953
                     /gene="NDAI0D03180"
                     /locus_tag="NDAI_0D03180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669827.1"
                     /db_xref="GeneID:11495289"
     CDS             759984..762953
                     /gene="NDAI0D03180"
                     /locus_tag="NDAI_0D03180"
                     /inference="similar to DNA sequence:INSDC:YML076C"
                     /note="similar to Saccharomyces cerevisiae WAR1 (YML076C);
                     ancestral locus Anc_4.344"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669875.1"
                     /db_xref="GeneID:11495289"
                     /db_xref="GOA:G0WA21"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G0WA21"
                     /translation="MRGTDMSHSTAADGSDRFSSESDKYIKKSETKNSKQDDTEEVET
                     FGLDISTSTLIEGIDENDPRHSTPSKMETTENGKIKRNTFACVRCHSLKQKCVPSDTN
                     DIYRRPCERCLRTGKLCKFDLSKRTRKRRLKSDPTSRSSTPLTLLSSGDTTALNASIG
                     NVASSQLPNTLNIEVQQAKRQKQYPNPTIAASIQPILPGIQQSLPDLWLNIKQPPAVA
                     SSSNSTKPLQGSDNNNANSYTNNRSISPGFNNSTNSVVSSDIAISKPMAGTNLASNAI
                     LSTSKMHPPMDNDMDTAPISTLQSRPTIPSAVPQNIKANKPFNSHLITHEFKTKLQSL
                     LRYQKAKIIELSRNFTAWSNEWNELVQRSIYPPTIKDPVTIGILNYEEASLRLSLYKK
                     MTSETRVPFGRLPFGRLDEDTTVKQLQREKPVLLSVIMSCVSVVMSTAQTNRDTIMKL
                     DGFVINLITNEIFKSNNKSIEMIEALSTLCLWYNFLEWSSKTRYHLFNYICCCLTKDL
                     GPTFVNRSFGMFSDEDPCKYKPDFKTPLELNKDGARLTIWVYVSSLNISIFLRQSIQS
                     RWNNETEQACNALLQSPSQSSSFYNGDDDQILILFAKLNHILEKIHIYLHEMDQPWDY
                     AGKEKEFTDKFTTGLIKKFENELDEIFQQIPPTGQRILIFYYSVEAYLHQYKISRFVS
                     KSHEHKFTKLPIEISDAFRRCYECCTSLLREFLKLSPELIAALPLFHMSRIMYTVGLL
                     LLKLRYAVIALPLFHHLLPITEATGDLVNKVDEVLKDTSELYPYNTFLYKIQYVVALF
                     SQTYANKLRDLADSYEKAERENKPTPYTVNQFNPLLLRSSSDEIKSALLNTPILTTEP
                     NFSPVENIGPIQNNGKMNIASRQSMRSESALFDGINTRSNNTNLAPNQELKISPFSSA
                     TALSTTHLSNPSMINNDKILAGPPYGKNLSLIPEVNPSPSASSDNLNEYLTDINSLAW
                     GFNALNDEFWTDLFITE"
     gene            complement(<763215..>763694)
                     /gene="NDAI0D03190"
                     /locus_tag="NDAI_0D03190"
                     /db_xref="GeneID:11495290"
     mRNA            complement(<763215..>763694)
                     /gene="NDAI0D03190"
                     /locus_tag="NDAI_0D03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669828.1"
                     /db_xref="GeneID:11495290"
     CDS             complement(763215..763694)
                     /gene="NDAI0D03190"
                     /locus_tag="NDAI_0D03190"
                     /inference="similar to DNA sequence:INSDC:YML077W"
                     /note="similar to Saccharomyces cerevisiae BET5 (YML077W);
                     ancestral locus Anc_4.345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669876.1"
                     /db_xref="GeneID:11495290"
                     /db_xref="GOA:G0WA22"
                     /db_xref="InterPro:IPR007233"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:G0WA22"
                     /translation="MAIYSFWIFDKHCNCIFDREWTLTTNSTSGTTNSKQNQETAKLL
                     YGMIYSLRSITQKLSRGLNKNEMRSISTGKYRVHTYCTASGLWFVLLSDFKQQSYSQV
                     LEYIYSSIYVTYVANNLFSPYDFAENEDEMRGQGFRKITNRRFIDSLENFLSPLVGQ"
     gene            complement(<764129..>765436)
                     /gene="NDAI0D03200"
                     /locus_tag="NDAI_0D03200"
                     /db_xref="GeneID:11495291"
     mRNA            complement(<764129..>765436)
                     /gene="NDAI0D03200"
                     /locus_tag="NDAI_0D03200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669829.1"
                     /db_xref="GeneID:11495291"
     CDS             complement(764129..765436)
                     /gene="NDAI0D03200"
                     /locus_tag="NDAI_0D03200"
                     /inference="similar to DNA sequence:INSDC:YJR125C"
                     /note="similar to Saccharomyces cerevisiae ENT3 (YJR125C);
                     ancestral locus Anc_4.346"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669877.1"
                     /db_xref="GeneID:11495291"
                     /db_xref="InterPro:IPR001026"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:G0WA23"
                     /translation="MSLEDTLSNMTLYDAKKYFRKAQNVVFNYTEMESKVREATNNEP
                     WGASSTLMEQIAQGTYNVRERYEIVGMIFRRFTEKAGSEWRQIYKALQLLDYLIKHGS
                     EPFIDDVRSSLKLIQMLETFHYIDSEGRDQGINVRNRAKLLVELLQDDSNIRQERKKA
                     RETSKKYKGVAGGSAATTMNGSLTANTRAGFTVSGSQGISVSADFDSDDSDNEERFKS
                     SPYNDRSSARGRFKDDGEQPSSELTTANKLLDTSGDNIVNATVEGDDDDEDDFDDFQS
                     APPVPSQSNAPIAQNNISSLLDIDGTSFNANATPYQPQLHIQPVVVPAISSATNTKKD
                     DPFGSLFSSAKASSASIPKPVKPITNHTANLAPSTSTNIAASSIAATVGAADDEDDLF
                     GDMTSSTAANTNNATTNSTSTGTTNSTNNNGSNTVEEVDLLMF"
     gene            complement(<765769..>766308)
                     /gene="NDAI0D03210"
                     /locus_tag="NDAI_0D03210"
                     /db_xref="GeneID:11495292"
     mRNA            complement(<765769..>766308)
                     /gene="NDAI0D03210"
                     /locus_tag="NDAI_0D03210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669830.1"
                     /db_xref="GeneID:11495292"
     CDS             complement(765769..766308)
                     /gene="NDAI0D03210"
                     /locus_tag="NDAI_0D03210"
                     /inference="similar to DNA sequence:INSDC:YML078W"
                     /note="similar to Saccharomyces cerevisiae CPR3 (YML078W);
                     ancestral locus Anc_4.347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669878.1"
                     /db_xref="GeneID:11495292"
                     /db_xref="GOA:G0WA24"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:G0WA24"
                     /translation="MFKQSILRQTRLFSTSPTNLGSKVFFKTNKGRIEFELYDDIVPK
                     TAKNFFTLCTRDTGATYINTPFHRIIPGFMIQGGDTDHMKGFGGKSIYGNKFPDENFI
                     KKHTKPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVTKGMDVVKKIEACGS
                     STGTPKEEIIIEDAGEVKE"
     gene            complement(<766715..>767368)
                     /gene="NDAI0D03220"
                     /locus_tag="NDAI_0D03220"
                     /db_xref="GeneID:11495293"
     mRNA            complement(<766715..>767368)
                     /gene="NDAI0D03220"
                     /locus_tag="NDAI_0D03220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669831.1"
                     /db_xref="GeneID:11495293"
     CDS             complement(766715..767368)
                     /gene="NDAI0D03220"
                     /locus_tag="NDAI_0D03220"
                     /inference="similar to DNA sequence:INSDC:YML079W"
                     /note="similar to Saccharomyces cerevisiae YML079W;
                     ancestral locus Anc_4.349"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669879.1"
                     /db_xref="GeneID:11495293"
                     /db_xref="InterPro:IPR009327"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:G0WA25"
                     /translation="MNEEKICLESATIDSVREYPIDNLASFVQVPASEPPTKLKELID
                     TWGLIKHGEGGYFKETDRSPFVMDAPTKITKKGSWEEEETTKLVLLKRNYSTLIYYLL
                     TPDSPIGKMHKNRNRIIHILQRGKGQYVLIYPNGQVKSFRVGFDYANGEVSQWVVPGG
                     VYKASFLVPNEEFHNGLLISEVVVPGFDFEDHLFMSGYDEMVNLLGEEKAASLKFLL"
     gene            complement(<767603..>768892)
                     /gene="NDAI0D03230"
                     /locus_tag="NDAI_0D03230"
                     /db_xref="GeneID:11495294"
     mRNA            complement(<767603..>768892)
                     /gene="NDAI0D03230"
                     /locus_tag="NDAI_0D03230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669832.1"
                     /db_xref="GeneID:11495294"
     CDS             complement(767603..768892)
                     /gene="NDAI0D03230"
                     /locus_tag="NDAI_0D03230"
                     /inference="similar to DNA sequence:INSDC:YML080W"
                     /note="similar to Saccharomyces cerevisiae DUS1 (YML080W);
                     ancestral locus Anc_4.350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669880.1"
                     /db_xref="GeneID:11495294"
                     /db_xref="GOA:G0WA26"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:G0WA26"
                     /translation="MNKLKGRQLFEKIGCPTKIVAPMVDQSELAWRILSRRYGATLTY
                     TPMLHAKLFATSEKYRKDMWSEYDGDADLDRPLVVQFCANDPEYLLKAAKLIENKCDA
                     VDLNLGCPQGIARKGHYGSFLMEEWDLIHKLIKTLHDNLNVPVTAKIRVFPEREKTLE
                     YAKMVLDAGAQFLTVHGRLREQKGQKTGLADWEIIKYLRDNLPSDTVFFANGNVLYPE
                     DISRCLTYMHCDGVMSAEGNLYNPGIFVNIPNDATCEELKKAFPRVDKITREYFEIVK
                     KYQGSQASRIAMKSHFFKILRPFLPNHVDIRTELAKLNAKSSFDVWEENVVKPVEDIV
                     KKIFNEADIDEKDKIINGEMELWGGCYKKIPYWRCQPYFRPVNGVTGDKRLVEKLKSD
                     LEREAVKESCDSDNSKKRKSDMGLENSTKKELKVAPV"
     gene            complement(<769306..>773394)
                     /gene="NDAI0D03240"
                     /locus_tag="NDAI_0D03240"
                     /db_xref="GeneID:11495295"
     mRNA            complement(<769306..>773394)
                     /gene="NDAI0D03240"
                     /locus_tag="NDAI_0D03240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669833.1"
                     /db_xref="GeneID:11495295"
     CDS             complement(769306..773394)
                     /gene="NDAI0D03240"
                     /locus_tag="NDAI_0D03240"
                     /inference="similar to DNA sequence:INSDC:YJR127C,YML081W"
                     /note="similar to Saccharomyces cerevisiae RSF2 (YJR127C)
                     and YML081W; ancestral locus Anc_4.351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669881.1"
                     /db_xref="GeneID:11495295"
                     /db_xref="GOA:G0WA27"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0WA27"
                     /translation="MSPIDDKQKKTVLSITGKEEQDREQEQITSGTDTASMTGSGDSS
                     QTATPTPGLIPIPKKSRRIKTNKPRPFVCSTCTRGFVRQEHLKRHQRSHTNEKPFLCV
                     FCGRCFARRDLVLRHQHKLHAALIGTSMDSYTNSSNNNGIPVPFQGPLPDSAEDKINK
                     NIIQIKGNKATILPTPRNPLAKTAAQLKREARETEARNKHEYRRTSNEWHPDVTSTTS
                     SLKSTPSPATYIPSGSVGPPPVHFEEQQQQQQQPIDYYSHPLRQEHKIGREPSPALLQ
                     DGTSRSKRHASFSASSAFTYAPDNPTEKNTRNISNNNNGSGSESMNDVPHQVGFSTPQ
                     LTAQQLIDKALESGVDFEALELPPFFSLDDPNSYGDSKFNINDIQFSLSNDASNIPGN
                     TNNIQPNNQPSVLHVNSSVYNISTGVQSQMNISSRGPPPMTPNNGDIYGFAPYLSDFL
                     TMSSSFGGSGGFSKSNSVNSNLAYFNYQNIPYQPEHDVHQFSIPESNLPQMVHDNTTA
                     RYPQHPEIGRPASEQPTKQASSQEVYYMSQSHEFDRPKTAQGALEISNGTSLLKSNLT
                     NNPDYQQHLSTKMVEISNIHPDEHWLTDFIAHPLDMDFKTSGDHFNEIGFLDNAIGQA
                     PTPPSVDPKPLSNVLPKLIETKDNLRDIHTNQGEKIALAVNTHPNLNTQNNHASSATG
                     HKLDDVKKLTYNVSSLFNSRQFDLFQKSVASSKNLKDISNGSNAKYTRNKNLKICFFT
                     EELRNSIINDNKSLANFFPTVDELNDYVQLYQREFHYYFPILHLYSVEPSMENYPLLL
                     SIAMCGAIYGFHSIHAKILSNISWIHVREYLEQKNNCYETTPLWIIQSLILLTFIGIF
                     SNDVNVIKNMKPQLMTLIQLVKITKLNLPLENFVKPPIESDHVMEFQDNPSKLAKIKG
                     QYKTEEQIEKNFNYFILAQSRIRTCHVVLLLSNFFSSVSGRDCCFHSLDLKCGIPCYH
                     EVLYLAEDSEIWSFYLNKFNIELDSKFSLIELSNGDGSYENCLMYLSNGSQFLYENTK
                     ISFKTLLSLLISIHEKIFIERNVIKQNLYNDPHISNSSHASIQLNDIKWRMTSRPIVA
                     SMLKYWEALYIKNGGILVPNKDNIPMIRSNPSMRLIIPLHLFAKIRKCIDLSTILELI
                     WLQEWNLMNENLKSFLYDWESLHEATTYSVSIIGFWIDTISITENSQNIKTPILSVTC
                     IFTSILILSEYLKLIENWASDVINNRKDVDSTSLKIPDRTLWLKAFKLMKKIERQLLS
                     KGANFQGYAEFLNLPEGSKLLDDNFVENVMRIESPIHDTIKFLKTMKMSIRCLYMGVR
                     ILGDSPVWPISLTFANALQSRALYILKEGDTEQRIQPDNVQN"
     gene            <774111..>774308
                     /gene="NDAI0D03250"
                     /locus_tag="NDAI_0D03250"
                     /db_xref="GeneID:11495296"
     mRNA            <774111..>774308
                     /gene="NDAI0D03250"
                     /locus_tag="NDAI_0D03250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669834.1"
                     /db_xref="GeneID:11495296"
     CDS             774111..774308
                     /gene="NDAI0D03250"
                     /locus_tag="NDAI_0D03250"
                     /inference="similar to DNA sequence:INSDC:YML081C-A"
                     /note="similar to Saccharomyces cerevisiae ATP18
                     (YML081C-A); ancestral locus Anc_4.353"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669882.1"
                     /db_xref="GeneID:11495296"
                     /db_xref="GOA:G0WA28"
                     /db_xref="InterPro:IPR006995"
                     /db_xref="UniProtKB/TrEMBL:G0WA28"
                     /translation="MIKRFPTPVLKQNWPFFVAGAITYWGVSKITTASENSDEWINDP
                     RNPRFAKGGKIVDLNKDKAHE"
     gene            complement(<774579..>776669)
                     /gene="NDAI0D03260"
                     /locus_tag="NDAI_0D03260"
                     /db_xref="GeneID:11495297"
     mRNA            complement(<774579..>776669)
                     /gene="NDAI0D03260"
                     /locus_tag="NDAI_0D03260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669835.1"
                     /db_xref="GeneID:11495297"
     CDS             complement(774579..776669)
                     /gene="NDAI0D03260"
                     /locus_tag="NDAI_0D03260"
                     /inference="similar to DNA sequence:INSDC:YJR130C,YML082W"
                     /note="similar to Saccharomyces cerevisiae STR2 (YJR130C)
                     and YML082W; ancestral locus Anc_4.354"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669883.1"
                     /db_xref="GeneID:11495297"
                     /db_xref="GOA:G0WA29"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G0WA29"
                     /translation="MINRSTTAPPTSSLTWDDIKDIHPRIKLAKSVKRLCEILSDRYA
                     KENETCICFPSYTVAKRCREYIAVKVTRASTTTTPPKVRILQLATSKPKDSNEMAFKR
                     ECKIAVVFTKREFEPLMMEYWRLSGEIISEYLAEYVLHELFMLEKSTRTTIPHSIGEE
                     NDNDDEKEFIESRYGRNFNFTFTDRAKSLIKKRITKNVMDSDYDHDHDDENENYHFND
                     RNNGNNMSTFLDTHINGNNNNSNSQGFDDREDEEEPTPYIHSTIPAEPIDMDETLPLA
                     NDERTHTNNTNGTVSRTVSDIDTNHISTSNMRSNSFDTDNGSGGNSIPLNPETDVYLF
                     TSGMAALFTAHRLLLHFDSQRVDRLRYSITDDSTPSPNGTFNNRLIGYGSPYKETVMF
                     GFPSVDTLEVLQKFNHTHFLSDNDEENSAMSKLKEILHSGEQILAVFIEAPSNPLLKM
                     GDLIELKRLSDMYGFFIIVDETIAGFVNIDAIIHADIICSSLTKVFTGDSNVIAGSMV
                     LNPMSKIYDFAKRFLSFPDGFEDCLWCEDILYLEKNSRDFLSKTTRINNTTEYLVNTV
                     LSPYVGKKEANGKLFKKIYYPTTTSKETKMCYDAIKCKTYGGYGGVFSITFHDIEKAK
                     LFFNNLKLSKTISLGSNYTTVCPYTVLKHGDELEKVSEYGLDETLIRVCVGLENKTSL
                     KENFSRAIEKTMNN"
     gene            <778452..>780017
                     /gene="NDAI0D03270"
                     /locus_tag="NDAI_0D03270"
                     /db_xref="GeneID:11495298"
     mRNA            <778452..>780017
                     /gene="NDAI0D03270"
                     /locus_tag="NDAI_0D03270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669836.1"
                     /db_xref="GeneID:11495298"
     CDS             778452..780017
                     /gene="NDAI0D03270"
                     /locus_tag="NDAI_0D03270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669884.1"
                     /db_xref="GeneID:11495298"
                     /db_xref="GOA:G0WA30"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G0WA30"
                     /translation="MRWAGNANELNAAYAADGYARVKGMSCIITTFGVGELSALNGIA
                     GSYAEHVGVLHVVGTPSTTSQAKNLLLHHTLGNGDFTVFHRMSSNLSETTAMITDVTT
                     APAEIDRCIRTTYIAQRPVYLGIPANYFDLKVPAALLNTPIDLELHPNEPEAEKEALD
                     MILELIKDSKNPAILVDACASRHDVKAETNKLIELTQFPHFVTPMGKGAINEQHPRYG
                     GVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRN
                     ATFPGVQMKFVLDKLNAIIPEVVTGYKPTAVPARAPANKAVSGTTPLKQAWMWNQLSK
                     FLKEGDVVIVETGTPGFGINETTFPKNVIGISQVLWGSIGYATGCTLGATMAAEELDP
                     HKRVILFTGDGSLQLTVQEISTMIRWNLRPYLFILNNNGYTIEKLIHGPTAQYNEIQS
                     WDHLKLLETFGAKDYENHRVATTGEWTKLTENKDFNKNSRIRVIEVMLPVMDAPESLI
                     KQGELTAKINAKN"
     gene            complement(<780755..>781162)
                     /gene="NDAI0D03280"
                     /locus_tag="NDAI_0D03280"
                     /db_xref="GeneID:11495299"
     mRNA            complement(<780755..>781162)
                     /gene="NDAI0D03280"
                     /locus_tag="NDAI_0D03280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669837.1"
                     /db_xref="GeneID:11495299"
     CDS             complement(780755..781162)
                     /gene="NDAI0D03280"
                     /locus_tag="NDAI_0D03280"
                     /inference="similar to DNA sequence:INSDC:YHR191C"
                     /note="similar to Saccharomyces cerevisiae CTF8 (YHR191C);
                     ancestral locus Anc_4.356"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669885.1"
                     /db_xref="GeneID:11495299"
                     /db_xref="InterPro:IPR018607"
                     /db_xref="UniProtKB/TrEMBL:G0WA31"
                     /translation="MPAVEITTSHLQTLLHETQDGARQITIPTPLGHTMLEIQGDLEM
                     PKTVPTDAPDSRYSKYNDGEIDIVRFGLLNLDQEKKLATLFIGTKQRLLGKIVKLDTP
                     LGLLKFDNSSKKVQLVDVINYKIIFSDRPLPIH"
     gene            <781566..>782471
                     /gene="NDAI0D03290"
                     /locus_tag="NDAI_0D03290"
                     /db_xref="GeneID:11498589"
     mRNA            <781566..>782471
                     /gene="NDAI0D03290"
                     /locus_tag="NDAI_0D03290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669838.1"
                     /db_xref="GeneID:11498589"
     CDS             781566..782471
                     /gene="NDAI0D03290"
                     /locus_tag="NDAI_0D03290"
                     /inference="similar to DNA sequence:INSDC:YHR192W"
                     /note="similar to Saccharomyces cerevisiae YHR192W;
                     ancestral locus Anc_4.357"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669886.1"
                     /db_xref="GeneID:11498589"
                     /db_xref="InterPro:IPR019273"
                     /db_xref="UniProtKB/TrEMBL:G0WA32"
                     /translation="MLRTISTILSKVNNTITNSKKTLIQRYTEDLSHITSQIHALESS
                     LQRRQAVLDHFQSQLTFYGLSAIVCLASAAYYYSSSYSENEGNTEWVWITVLVLGVIL
                     LGFLKWVSYKLEGWYKERQDKKLSKLRATHSKKLESLKRETQFHETNSIIQRFSSGSN
                     QDDDAMVLMDEQLSAKYDEFNQLKNELNKLQKDNEFVNNKEKSDVWFDKVIGILAGGN
                     DLNNTIRPIVCSNCKRHTGAYRLLNKPLQYVCPVCGCKLDETIKNQHEEREPSAVDTI
                     DTKDTNDSNKKTKKSKKKNGSLKKV"
     gene            complement(<782538..>783062)
                     /gene="NDAI0D03300"
                     /locus_tag="NDAI_0D03300"
                     /db_xref="GeneID:11498590"
     mRNA            complement(<782538..>783062)
                     /gene="NDAI0D03300"
                     /locus_tag="NDAI_0D03300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669839.1"
                     /db_xref="GeneID:11498590"
     CDS             complement(782538..783062)
                     /gene="NDAI0D03300"
                     /locus_tag="NDAI_0D03300"
                     /inference="similar to DNA sequence:INSDC:YHR193C"
                     /note="similar to Saccharomyces cerevisiae EGD2 (YHR193C);
                     ancestral locus Anc_4.358"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669887.1"
                     /db_xref="GeneID:11498590"
                     /db_xref="InterPro:IPR002715"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR016641"
                     /db_xref="UniProtKB/TrEMBL:G0WA33"
                     /translation="MSIPANSNVTILNKNEKKARELIGKLGLRLVPGIIRVAFRKKNN
                     EIVAIEKPEVYRSVGGNYVVFGEAKVDDFTQKLAAAQQQAASSGILPSNEDIATKSPQ
                     DIQADMEAAATGALDEAIAAVEEDDAEVDAGDLSKEDIDLVIQQTNVTKNKAIKALKE
                     HNGDIVNAIMSLSK"
     gene            <783655..>785517
                     /gene="NDAI0D03310"
                     /locus_tag="NDAI_0D03310"
                     /db_xref="GeneID:11498591"
     mRNA            <783655..>785517
                     /gene="NDAI0D03310"
                     /locus_tag="NDAI_0D03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669840.1"
                     /db_xref="GeneID:11498591"
     CDS             783655..785517
                     /gene="NDAI0D03310"
                     /locus_tag="NDAI_0D03310"
                     /inference="similar to DNA sequence:INSDC:YHR194W"
                     /note="similar to Saccharomyces cerevisiae MDM31
                     (YHR194W); ancestral locus Anc_4.359"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669888.1"
                     /db_xref="GeneID:11498591"
                     /db_xref="GOA:G0WA34"
                     /db_xref="InterPro:IPR012571"
                     /db_xref="UniProtKB/TrEMBL:G0WA34"
                     /translation="MIPLFSKGKIDKLSLYLRRNLHDIRHTFIRRPIVTTTLYYNNNN
                     RPGLSSTSPQLHNNISYTFLHSRIRYIHTPKSKGNDSPHDTSNTLQHLIAEKNRRLSQ
                     ATNIFQKLKINIRWILKKSYKPFNADDISAVISWVLVSNVIIFILWTTTFVSLIIYLL
                     NSISLQDYLVKSIGNLITRGTPNLSVIFEDAIVPDWSSGKIIFKNVFVSRRPKLLKGF
                     QKGSQEDAVQRANLALTEKNLLFLSPESSSSANENDWNYTQFDLTIDKVEISLNFTKW
                     LNGKGCLDEVSINGLRGIVDRTHIRWKDNDDPRDFRNVYQLGDFEISKFSMNDGLFTL
                     YQPNGFRPFQVSIFNCDLPQLRKHWLFYDILKATNVSGTYDNSMFTIHRTLQNTNTQQ
                     EATNDNNNNNDSHHGDSPPWRKITRLRVDNLDVEHLNRGIEGPFGWIRQGQVDMVGDV
                     LLPDKEADKSEIKAILAEIGDRFLNEAKKLSSSSTTRSSRDTENTTIDPEQYFIMKFF
                     LKLKNVKAEVPLFPSELNYINGTLIRPIVGYINSRRTYIPIECKVIKNVADFEGSWTI
                     YDSYLMKDLSAEVYDAFAKYVADQQQRKKRFKRISFWSLQMLIQLVLMSVGTIA"
     gene            <785846..>787219
                     /gene="NDAI0D03320"
                     /locus_tag="NDAI_0D03320"
                     /db_xref="GeneID:11498592"
     mRNA            <785846..>787219
                     /gene="NDAI0D03320"
                     /locus_tag="NDAI_0D03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669841.1"
                     /db_xref="GeneID:11498592"
     CDS             785846..787219
                     /gene="NDAI0D03320"
                     /locus_tag="NDAI_0D03320"
                     /inference="similar to DNA sequence:INSDC:YHR195W"
                     /note="similar to Saccharomyces cerevisiae NVJ1 (YHR195W);
                     ancestral locus Anc_4.360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669889.1"
                     /db_xref="GeneID:11498592"
                     /db_xref="UniProtKB/TrEMBL:G0WA35"
                     /translation="MTRRPVIQSIFSLGGSLAMVKGLKRVLRKYDLPENWLTPTQGNS
                     TQENINKTNELISILQEVSNAMHSRDDISFSKQLEEAGDGITWKKVGLFVLKESINMD
                     TKIAAGIIFTILFLPLLSALLSNSIGKKLRKKKNDNVDFATQTEQSHHYGPAERALLQ
                     FGKSKSEPILLEDNDIHPILSNLAGEKIEEGNQSEEEEKGITGGKEDEGKDEEQQEEG
                     DDYGQGESEENVEIISPEVDDDLNEEGNHIQVEDDENTNSFENVTSFSNNIEDINSFL
                     RPIEEEEGNVNDNKNKADNEQNEVEADQVEGAQTSIKEDNNGEDRNETDTTYDMAIRT
                     IDFGETPSPNSLTHDVENETSTTNNSSYKLSHPNNADVALIHLEPDTTALERNTLTFP
                     EEIPDLNEAEALVGGEEKSKDLRVSSNGSLSSHSNSPHIHVSPTKSMHPDAQVNKEQA
                     YSQPFTY"
     gene            <788215..>790557
                     /gene="NDAI0D03330"
                     /locus_tag="NDAI_0D03330"
                     /db_xref="GeneID:11498593"
     mRNA            <788215..>790557
                     /gene="NDAI0D03330"
                     /locus_tag="NDAI_0D03330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669842.1"
                     /db_xref="GeneID:11498593"
     CDS             788215..790557
                     /gene="NDAI0D03330"
                     /locus_tag="NDAI_0D03330"
                     /inference="similar to DNA sequence:INSDC:YHR197W"
                     /note="similar to Saccharomyces cerevisiae RIX1 (YHR197W);
                     ancestral locus Anc_4.365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669890.1"
                     /db_xref="GeneID:11498593"
                     /db_xref="UniProtKB/TrEMBL:G0WA36"
                     /translation="MSHEAYPLVDLVKQLDQASGYEFQTLLKTLTSPVYINEQILKSE
                     LGLLNTKILKLLRSSDDFDVWKGCHTAVVICSYNPLVLCSHASQLLAAIYSKLEQKVG
                     YYQSTISTMQGKTLLETLISSLSIIMDLMRNKPTVSREGLVPKLRAIIPTLITLSQDE
                     PQLCLPVLQTLLKRNSTTFKPFVNKYRIVLSNLIVNHYHSFDKDTQTLICNNFAYLHL
                     IKIQNAQSKGTDIDEAQSHHKSFSDDTWTSGLLNILYQFKPIIELCGELLDFKQDQDL
                     QRIIESLPHSNVKSDDSDDDNESVHDFLPVLKLDMNAPLTLWQISNRLNLLVGLMNSF
                     ISLPTPFAIRIPIGGINAICETLLSMTTKYIPLKRELRRDQELNSIIHDIFPQIQLNG
                     IHLWTNLIRSCNKCCIPLGSKILSNVELFIPLKNKSNLIDFERCYALKNEFGDVFKLI
                     NIVLPLMGHQFNEIDPIIKLINVALYLSEDKSLIDSIFNQQKELQSAAMKNNNNNSNN
                     KKKNKRDQNVGALSDLYTHPEEFVITTSKEWYDETNQFFIMILNSLVLSSTQQTRIIK
                     YSVSIALYLKSINDEIPRSFIDLIRCIVLHPGYEKVSILPIAVNILKDVNDEMFDLLC
                     HPRLPTNMVYRVRNNNANVVEDEDEDEDDGRMIVDEETAANEADNVSLSLKMTEEKEK
                     VVIMPHVERKVDIIEDETKIFKKRDIEDVQPEIEETTKRVKIVKEEEKVNNEVPVQVI
                     DEKAFTSNIEDKDNGEDDNDDDSEFEIPVIDISDDEDEEE"
     gene            complement(<790702..>791718)
                     /gene="NDAI0D03340"
                     /locus_tag="NDAI_0D03340"
                     /db_xref="GeneID:11498594"
     mRNA            complement(<790702..>791718)
                     /gene="NDAI0D03340"
                     /locus_tag="NDAI_0D03340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669843.1"
                     /db_xref="GeneID:11498594"
     CDS             complement(790702..791718)
                     /gene="NDAI0D03340"
                     /locus_tag="NDAI_0D03340"
                     /inference="similar to DNA sequence:INSDC:YHR199C"
                     /note="similar to Saccharomyces cerevisiae YHR199C;
                     ancestral locus Anc_4.369"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669891.1"
                     /db_xref="GeneID:11498594"
                     /db_xref="GOA:G0WA37"
                     /db_xref="InterPro:IPR016087"
                     /db_xref="UniProtKB/TrEMBL:G0WA37"
                     /translation="MTIMTFTKLISKTSLRQVTKISNAKAIGQVTKSSRLTSLMLSNK
                     PFQRKFSSTTGRSQQQQQQTEPPAIKNSNVIRNSAIVTLTLAAAFLAYKFEDLNFSIS
                     ETEQYVDVDPQISPFPKKITPSKYPFDLKYSLLGVGVRSVTVVTFKVYALGIYVADKD
                     KYMIPKLFNSNYLSKAFIDTFDSTKSHAENLRLALMDPVKSTILINELLDNGINLMAK
                     ISPMRNTNFNHLRDGMIRTIKKHPEAEKNKEALDKGILDLRKAFNRKGALDKDDDLYV
                     QLLNDGALQLTFHSKKRDEFFKLGRCEDPIIGRYLFSQYVSGPAPLSIMTRDAVVKGI
                     CDLV"
     gap             792237..792289
                     /estimated_length=53
     gene            <793016..>793867
                     /gene="NDAI0D03350"
                     /locus_tag="NDAI_0D03350"
                     /db_xref="GeneID:11498595"
     mRNA            <793016..>793867
                     /gene="NDAI0D03350"
                     /locus_tag="NDAI_0D03350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669844.1"
                     /db_xref="GeneID:11498595"
     CDS             793016..793867
                     /gene="NDAI0D03350"
                     /locus_tag="NDAI_0D03350"
                     /inference="similar to DNA sequence:INSDC:YHR200W"
                     /note="similar to Saccharomyces cerevisiae RPN10
                     (YHR200W); ancestral locus Anc_4.372"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669892.1"
                     /db_xref="GeneID:11498595"
                     /db_xref="GOA:G0WA38"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR027040"
                     /db_xref="UniProtKB/TrEMBL:G0WA38"
                     /translation="MVLEATVLIVDNSEYSRNGDYPRTRFEAQIDAVEFIFQAKRNSN
                     PENTLALLSSAGSNPTVLSTFTSEFGKILSGLHDTSIGGSIQFTTAIQIAALTLKHRQ
                     NQIQHQRIVMFVCSPITEPKDELIKLAKKLKKNKIAIDIINFGEIDTNNELLMEFISV
                     ANNVSDESSNLVTIAPSNSRLLYESIASSAVILESGVTGNDLMMGAGGAGGMDGGFMD
                     FGVDPSMDPELAMALRLSMEEEQQRQERVRQQEQQQQQQQQQQQQQQQEQQSSEDQPS
                     NQEEQPK"
     gene            complement(<794215..>795303)
                     /gene="NDAI0D03360"
                     /locus_tag="NDAI_0D03360"
                     /db_xref="GeneID:11495104"
     mRNA            complement(<794215..>795303)
                     /gene="NDAI0D03360"
                     /locus_tag="NDAI_0D03360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669845.1"
                     /db_xref="GeneID:11495104"
     CDS             complement(794215..795303)
                     /gene="NDAI0D03360"
                     /locus_tag="NDAI_0D03360"
                     /inference="similar to DNA sequence:INSDC:YJR139C"
                     /note="similar to Saccharomyces cerevisiae HOM6 (YJR139C);
                     ancestral locus Anc_4.374"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669893.1"
                     /db_xref="GeneID:11495104"
                     /db_xref="GOA:G0WA39"
                     /db_xref="InterPro:IPR001342"
                     /db_xref="InterPro:IPR005106"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR019811"
                     /db_xref="InterPro:IPR022697"
                     /db_xref="UniProtKB/TrEMBL:G0WA39"
                     /translation="MPASKSVNVAVIGAGVVGSSLLNQLIALNTNIKYNLIALAEAEK
                     SLYSHNYEPLQTSHTWDWATALQNATEKTLPLPDLITFLSKSPKPVILIDNTSSAYIA
                     SFYPKIVENGISIATPNKKAFSSDLKTWNQLFAGNETDGLVYHEATVGAGLPIISFLR
                     EIIATGDEVEKIEGIFSGTLSYIFNEFSTIAPNDVKFSDVVKVAKKLGYTEPDPRDDL
                     NGLDVARKVTIVARISGLEVENPTSFPVQSLIPKALESIETADEFLEKLSQYDDELSK
                     LKEEAAKEGKVLRFIGKVDVKTNTVSVGIEKYDASHPFAALKGSDNVISIKTKRYHNP
                     VVIQGAGAGADVTAAGVLGDVIKAAQRL"
     gene            complement(<796099..>797292)
                     /gene="NDAI0D03370"
                     /locus_tag="NDAI_0D03370"
                     /db_xref="GeneID:11495105"
     mRNA            complement(<796099..>797292)
                     /gene="NDAI0D03370"
                     /locus_tag="NDAI_0D03370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669846.1"
                     /db_xref="GeneID:11495105"
     CDS             complement(796099..797292)
                     /gene="NDAI0D03370"
                     /locus_tag="NDAI_0D03370"
                     /inference="similar to DNA sequence:INSDC:YHR201C"
                     /note="similar to Saccharomyces cerevisiae PPX1 (YHR201C);
                     ancestral locus Anc_4.377"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669894.1"
                     /db_xref="GeneID:11495105"
                     /db_xref="GOA:G0WA40"
                     /db_xref="InterPro:IPR001667"
                     /db_xref="InterPro:IPR004097"
                     /db_xref="UniProtKB/TrEMBL:G0WA40"
                     /translation="MSTNIFTVRQFLEQLKNVHLPKIIGSTMNLNIVYGNESADFDSI
                     TSAISYAYFSYIHHGYQKGINPIIPIINIPRLELKLRKDVMIALDKMSINEDTLFFMD
                     DLDKWEDIHKGKVSARLVDHNDQPKQQYGVDKVTGIIDHHFDQKNFLDAKPRIIRPTG
                     SCTSLVFNYWYDMLGKSLEKIIDIIPLCLGGILLDTSNLKHKVEDPDLEAMAHLKEGL
                     IQYNETSLSNIDIDSYYKELNHAKKDIRDFSVKDILCKDYKQFEFKTKNNVPIVIGVA
                     SIVKSLDWLYKNISPDSSFKKQCVEFRNERKLTVLVLMTKKSDENGFKRELGIIPDPS
                     FKPENVNKLVDMITGQLALVNDTISTMTDTEEDPYLVFDQQNVQATRKQVVPFVKEAI
                     EQLTV"
     gene            <797548..>798432
                     /gene="NDAI0D03380"
                     /locus_tag="NDAI_0D03380"
                     /db_xref="GeneID:11495106"
     mRNA            <797548..>798432
                     /gene="NDAI0D03380"
                     /locus_tag="NDAI_0D03380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669847.1"
                     /db_xref="GeneID:11495106"
     CDS             797548..798432
                     /gene="NDAI0D03380"
                     /locus_tag="NDAI_0D03380"
                     /inference="similar to DNA sequence:INSDC:YJR144W"
                     /note="similar to Saccharomyces cerevisiae MGM101
                     (YJR144W); ancestral locus Anc_4.380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669895.1"
                     /db_xref="GeneID:11495106"
                     /db_xref="GOA:G0WA41"
                     /db_xref="InterPro:IPR009446"
                     /db_xref="UniProtKB/TrEMBL:G0WA41"
                     /translation="MMYHLTHRSIFLKRSFPLATRLITTTTSTSSSTSTATAPATATA
                     TISSNSTVRKPTTTYRSSSASQPSSTTATKTATKAVFSKTLNQSLGNIPLESTTTTAT
                     KGLPDLPEIITKEESNTTNNDVDWTKSWHGIGSKPFNATIQTELMKELDPKDIEIKPD
                     GLIYLPEIKYRRILTKVFGAGGWGLVPRSETIVTSSLVTREYALICHGQLVSVARGEQ
                     DYFNEGGIPTATEGCKSNALMRCCKDLGIGSELWDPVFIKKFKTTFCMDKFVEHVVTK
                     KKKKIWLRKDRQVEYPFK"
     gene            <798851..>800683
                     /gene="NDAI0D03390"
                     /locus_tag="NDAI_0D03390"
                     /db_xref="GeneID:11495107"
     mRNA            <798851..>800683
                     /gene="NDAI0D03390"
                     /locus_tag="NDAI_0D03390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669848.1"
                     /db_xref="GeneID:11495107"
     CDS             798851..800683
                     /gene="NDAI0D03390"
                     /locus_tag="NDAI_0D03390"
                     /inference="similar to DNA sequence:INSDC:YHR202W"
                     /note="similar to Saccharomyces cerevisiae YHR202W;
                     ancestral locus Anc_4.381"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669896.1"
                     /db_xref="GeneID:11495107"
                     /db_xref="GOA:G0WA42"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006179"
                     /db_xref="InterPro:IPR008334"
                     /db_xref="InterPro:IPR014485"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G0WA42"
                     /translation="MKHIVHELLGVITISSLICNLARSAIIPEKVFDAIPLEVKENIN
                     NPSTEVKLRGLEVGELNFLHTTDSHGWIGSHIVQPDFDADWGDFITFVEHFKHNRIGK
                     ENDILIIDTGDKHDGNGLCDATVPNGIASTELFNEMDYDLLTLGNHELYNPEKTVLEY
                     YSTVMSRKFKGKYISSNVEFIKANGDIVPFGNKYLHLETPKRGIKILALSFIFHFQRA
                     NSRARVTSPIEEITTKDWFQEMLIKHPENDLDMLLVFGHLPVTDNVNHEMEQVHQYLR
                     KYYPNIIIQYFGGHSHIRDFVILDEKSACLQSGKYAETVGFLSIDGVKTDTPTFFRRY
                     IDFNKRSFKHHSNAKIFKSLRGDLVSSKLKNLRRSLGLNRVIGYVSKTYYMIARSLDS
                     KENIYHFLTNKVLPRLRSDTFDTNSISRFVIMNTGAVRYDLHKGPFTKDSEYIVMPFT
                     NDWKYLEIPLNIAEQVKNFLNERPSIMNLGPPQAVRINQNQIADRPESCPLVNDPSYR
                     EGFITRDDFGCDGDDTPHNSQIFHKLPSVVQYKIFTXXXXXXXHLIFYSFIQPDILQA
                     VNSLVKENGMDGLYSDEDCQFYGGKSTQILLREYIQESSEKYTI"
     gap             800485..800503
                     /estimated_length=19
     gene            complement(<801186..>802395)
                     /gene="NDAI0D03400"
                     /locus_tag="NDAI_0D03400"
                     /db_xref="GeneID:11495108"
     mRNA            complement(join(<801186..801957,802382..>802395))
                     /gene="NDAI0D03400"
                     /locus_tag="NDAI_0D03400"
                     /product="ribosomal protein S4"
                     /transcript_id="XM_003669849.1"
                     /db_xref="GeneID:11495108"
     CDS             complement(join(801186..801957,802382..802395))
                     /gene="NDAI0D03400"
                     /locus_tag="NDAI_0D03400"
                     /inference="similar to DNA sequence:INSDC:YHR203C,YJR145C"
                     /note="similar to Saccharomyces cerevisiae RPS4B (YHR203C)
                     and RPS4A (YJR145C); ancestral locus Anc_4.382"
                     /codon_start=1
                     /product="ribosomal protein S4"
                     /protein_id="XP_003669897.1"
                     /db_xref="GeneID:11495108"
                     /db_xref="GOA:G0WA43"
                     /db_xref="InterPro:IPR000876"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR013843"
                     /db_xref="InterPro:IPR013845"
                     /db_xref="InterPro:IPR018199"
                     /db_xref="UniProtKB/TrEMBL:G0WA43"
                     /translation="MARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPL
                     IVFLRNRLKYALNGREVKAILMQRHVKVDGKVRTDTTYPTGFMDVITLEATNENFRLV
                     YDVKGRFAVHRITDEEASYKLAKVKKVQLGKKGVPYVVTHDGRTIRYPDPNIKVNDTV
                     KVDLASGKITDYIKFDAGKLVYVTGGRNLGRIGTIVHKERHDGGFDLVHIKDSLDNTF
                     VTRLNNVFIIGEPGKPYISLPKGKGIKLTIAEERDRRRAQQGL"
     gene            <803168..>805624
                     /gene="NDAI0D03410"
                     /locus_tag="NDAI_0D03410"
                     /db_xref="GeneID:11495109"
     mRNA            <803168..>805624
                     /gene="NDAI0D03410"
                     /locus_tag="NDAI_0D03410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669850.1"
                     /db_xref="GeneID:11495109"
     CDS             803168..805624
                     /gene="NDAI0D03410"
                     /locus_tag="NDAI_0D03410"
                     /inference="similar to DNA sequence:INSDC:YHR204W"
                     /note="similar to Saccharomyces cerevisiae MNL1 (YHR204W);
                     ancestral locus Anc_4.383"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669898.1"
                     /db_xref="GeneID:11495109"
                     /db_xref="GOA:G0WA44"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="UniProtKB/TrEMBL:G0WA44"
                     /translation="MHLQIYRHITAALLATLPIIATIVPLISCRPTSYDAFSFTRSEL
                     NTYKEEVRDLFQFGLSKYLEVGYPYDEVRPISCEPKTRNFNDLTDLPTNDVLGNFTAT
                     LIDSLTTVAVMGDKNQFYNLVELVRVTFPNKFEIDATVQVFETTIRILGSLISSHLYA
                     TDARKSCNLLDMGYDGILLDLAKDIGERLLPVYLTESGLPVSRINLKAGFERYSRLQM
                     NENNLAGMATPMLEFGMLSLLTGDRKYMEVTRFTFDRLWKQFRARTGLLPVSLDPHDF
                     TIYSFATGVGASADSFYEYALKGAILFDDEELMNIWEESYKSLNANSKLDWFYGNVNT
                     MGVNQVLPWIDSLSAFFPGLQVLAGDVDDSMMKHLLFLKQWDYFGGIPERWEFEKPMV
                     NIVNRDVRGGFRKETKEQGSGGGGGGVVLPLPWYPLRPEFIESTYYLYRATKDPFYLN
                     IGYRILQDFKYRFKFSCGFAGIENLLTDQRQDRMETFVLSETLKYLYLLFDEDNEINH
                     SRDNVIFSTEAHPMWVTPQMRHDYEKNGFFNDDKYCRNLQKCKKSFETIVNPFKSRNE
                     IMRQTPRAAAGSIDIWPKLENKRICPVKFVWSDNKFGEQNDISLPYSDILTNYNRLFE
                     IDYRYSDVLIKPPHLINYTSIELESGFYEIWAKKNNGDNNANMKNICKPKPTSESFEI
                     LFDIDGPYDFFKFENGDVHCNSLKTRRKWRVEKIHVGDYDVFGRIVNSTQFVNANRQD
                     LTDKMCDQYLSRCPSTLYRLSVIDGYSIPEGGRVTIDRSQLMAANNDPELRNVYAQFG
                     YNTDNQLLLHCIPFTNVYLI"
     gene            <806856..>809261
                     /gene="NDAI0D03420"
                     /locus_tag="NDAI_0D03420"
                     /db_xref="GeneID:11495110"
     mRNA            <806856..>809261
                     /gene="NDAI0D03420"
                     /locus_tag="NDAI_0D03420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669851.1"
                     /db_xref="GeneID:11495110"
     CDS             806856..809261
                     /gene="NDAI0D03420"
                     /locus_tag="NDAI_0D03420"
                     /inference="similar to DNA sequence:INSDC:YHR205W"
                     /note="similar to Saccharomyces cerevisiae SCH9 (YHR205W);
                     ancestral locus Anc_4.384"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669899.1"
                     /db_xref="GeneID:11495110"
                     /db_xref="GOA:G0WA45"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:G0WA45"
                     /translation="MNFFGSKSSSNSQQGTINGSSNNNNNNNNSTSKRIPPNAFFPNF
                     STHMATPTTAISQNSYAMGTTGITSENVLSRMKSMNEPTTHPDHHHQHQYQNLSSSSK
                     PSIITSSVSDSNTVSSFSSSEAIRQAAAGGIITTATATATATATATATAPSTSSSSRL
                     QPISNNNINNQNAIPTAGPGTDIPRGKLEVTIVEAKNLFTISNDSQPYVVCTFESSEF
                     ISNGPESVNNNNPHSNTKRTNNGLPVIKEYLKKKPVYTHRSSSQLNRLTDDDTNNNNN
                     NNNNSTTVTNQQQQQEDNKQQHQELLTNCSNPIWHHKTTFDVLGAHSELDISVYDAAH
                     DDMFLGQVRLRPKIHTTNYASQDQWHTLQSRVLNEKVTGELLIKWEYTSTKKRHYGPN
                     DFEVLRLLGKGTFGQVYQVKKKDTQRIYAMKVLSKKVIVKKNEVDHTIGERNILVTTA
                     SNASPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRFTEDRAKFYIAELVLAL
                     EYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKDRTNTFCGTTEYLAPELLL
                     DESGYTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRS
                     FVKGLLNRNPKHRLGAIDDGRELRAHPFFADIDWKLLKEKKIPPPFKPHLVSETDTSN
                     FDPEFTQTSTSYMNKHQPLAATPLSPAMQAKFAGFTYVDESAMEDHYASTYNNRKFLQ
                     SSYYMEPGSFIPGNPNLPPDEDVIDDHEEEENYGPTKNDDGTDFDGDQHMDDEFVSGN
                     FEI"
     gene            <809977..>811770
                     /gene="NDAI0D03430"
                     /locus_tag="NDAI_0D03430"
                     /db_xref="GeneID:11495111"
     mRNA            <809977..>811770
                     /gene="NDAI0D03430"
                     /locus_tag="NDAI_0D03430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669852.1"
                     /db_xref="GeneID:11495111"
     CDS             809977..811770
                     /gene="NDAI0D03430"
                     /locus_tag="NDAI_0D03430"
                     /inference="similar to DNA sequence:INSDC:YHR206W,YJR147W"
                     /note="similar to Saccharomyces cerevisiae SKN7 (YHR206W)
                     and HMS2 (YJR147W); ancestral locus Anc_4.385"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669900.1"
                     /db_xref="GeneID:11495111"
                     /db_xref="GOA:G0WA46"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014402"
                     /db_xref="InterPro:IPR027718"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:G0WA46"
                     /translation="MNGIPFSNNNNYGISTTLPAIDQNNNNNTDQMSQEDQERQSKQL
                     QQLPLLPPAATLGTANNNVSSSSGTPTGSHGSKAANNDFVRKLYKILETNTFPNLVRW
                     TPEGTSFVVLDTGKFTTQILPTHFKHSNFSSFVRQLNKYDFHKVKRKSDEPGRKKYGE
                     LSWEFTHPSFKRHDEAGLENIKRKIANSRKPDEVQPVTVSTKTSDILKVAPSKMQFDK
                     LKSDFENMERTMNDMMTKYTRTQDELTRLTNRYNTLVESLFTFKTVNENVVNNFTTLC
                     STLSQKGIELPPSLYDSNKLNQLATYNPLQQQQLARSSSLSLNAPSIQSILAREPVSI
                     QTPTDKQIQHQPAPHNQQIRNNHNTTAATTPLLQNTLPLISTPAGGILPLQEENINTT
                     GHSVSSISKSDVDIKQENSQSPTATEELRKGYHVLLVEDDAVSIQLCSKFLRKSGCTV
                     EVVTDGLAAISILEAFRYDLVLMDIVMPNLDGATATSIIRNFDKETPIIAMTGNIEDQ
                     DLITYLQHGMTDILAKPFTRDDLLSMLIRHLSKRIPLCERQQSEPPIQDPSQEKVRQQ
                     LIANGPSPHNEPLKKYHHLTPTYCRMYRTIT"
     gene            complement(<812487..>814187)
                     /gene="NDAI0D03440"
                     /locus_tag="NDAI_0D03440"
                     /db_xref="GeneID:11495112"
     mRNA            complement(<812487..>814187)
                     /gene="NDAI0D03440"
                     /locus_tag="NDAI_0D03440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669853.1"
                     /db_xref="GeneID:11495112"
     CDS             complement(812487..814187)
                     /gene="NDAI0D03440"
                     /locus_tag="NDAI_0D03440"
                     /inference="similar to DNA sequence:INSDC:YHR207C"
                     /note="similar to Saccharomyces cerevisiae SET5 (YHR207C);
                     ancestral locus Anc_4.386"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669901.1"
                     /db_xref="GeneID:11495112"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:G0WA47"
                     /translation="MPLTIKTLSLNDLGEQQKLPPNSKIPNHQTICDHVVRLWKEEPS
                     MEYEPLSILHTRLKQRNPHWILSQDTLQEILLKHNLYQSSSISDPNILPLYADQIQYQ
                     SSSSANINDIITSIKKFPSCLTIEEKEPMGRCLIATDHIEANKLIFQEPTPLITIPPM
                     DKLGLIERGKICSHCGNTLHSLSTHFIMMNGLDCDSCGTIWCSKKCKLANSHIHSILK
                     HQKSGKKKMMNNNNVAVDSKAWNEFEKLCIKFNQRDIFSVGFIWATIVSMEKPDLKSE
                     LETKWNSLCSLSQRIRSNAADSTNIGGTFDKSNGGGGTSAGTVIDTRDTINETEKVKS
                     REEEHKNEDMEHIWKSAFKLFQSALPKVGDTIDFEQFLCEIGRFNLNQIEGQIYYLNS
                     FLNHNCEPNVRFEIDSKLCLKIFSRKPINKGEQLFTTYVSPLHGVNLRRRELRVNYGI
                     FCKCNRCENEFLKSKQSRQDNNNIDNRILSDTPAIMKSPERLTLKIRRESNTAAAAST
                     TAGARRKSSLRNKRPDLTELLKNGKEFDLEIPTNFKIGSRRRTSVRFDENVSFAVEEE
                     "
     gene            <814473..>815351
                     /gene="NDAI0D03450"
                     /locus_tag="NDAI_0D03450"
                     /db_xref="GeneID:11495113"
     mRNA            <814473..>815351
                     /gene="NDAI0D03450"
                     /locus_tag="NDAI_0D03450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669854.1"
                     /db_xref="GeneID:11495113"
     CDS             814473..815351
                     /gene="NDAI0D03450"
                     /locus_tag="NDAI_0D03450"
                     /inference="similar to DNA sequence:INSDC:YER182W"
                     /note="similar to Saccharomyces cerevisiae YER182W;
                     ancestral locus Anc_4.387"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669902.1"
                     /db_xref="GeneID:11495113"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:G0WA48"
                     /translation="MSSKIKVVQNVYSRMAISRMSRVMRRRMVTPYTTSAMMRRSITT
                     TNNSSSTSPEMPTFTTNGSKNTKEPKSKWVPITIFSGSFLIGWYLTQHMTFTDVMAYW
                     KYDKLPQDSEQVQRYRFEIMNRLEKLPIMKQIRENNNELGYYEVFPKDSVPGHKSVKE
                     GNQLINKTLLTPGGIAIPPKFFYNPEKKEVVGIYHLGMKLTGYPFIVHGGILATVMED
                     LMREGIQIIKQKNGEKTNELTISYKMPTFANQFVIVRTTQVDDIGKDSVNMKVDLMDQ
                     NGQNVLVKGSGSFKTI"
     gene            complement(<815523..>816302)
                     /gene="NDAI0D03460"
                     /locus_tag="NDAI_0D03460"
                     /db_xref="GeneID:11495114"
     mRNA            complement(<815523..>816302)
                     /gene="NDAI0D03460"
                     /locus_tag="NDAI_0D03460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669855.1"
                     /db_xref="GeneID:11495114"
     CDS             complement(815523..816302)
                     /gene="NDAI0D03460"
                     /locus_tag="NDAI_0D03460"
                     /inference="similar to DNA sequence:INSDC:YER183C"
                     /note="similar to Saccharomyces cerevisiae FAU1 (YER183C);
                     ancestral locus Anc_4.388"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669903.1"
                     /db_xref="GeneID:11495114"
                     /db_xref="InterPro:IPR002698"
                     /db_xref="InterPro:IPR024185"
                     /db_xref="UniProtKB/TrEMBL:G0WA49"
                     /translation="MPVPMPMPMPNTATTKAAKQALRKQFNVSLSQVSKTSVDIQSAI
                     IVDSLAPILKPYHSIACFMSMDHSEVNTQGIIKWIFEQGKSLYLPRCTNTRDTHQVKL
                     RTQTKDLTKDHPHLTFHKMKSYEEVLNLQPQGKYKLREPMPENVSSSSSSASASALYL
                     PPQLDVILVPSVIFGINGDKPGARLGHGAGFYDDFFKRYQYYNPDKKMPLLIGIGLKE
                     QIIDNNATSSSTNVQIPIDDHDYFMDCIVSGDGQVYWINKG"
     gene            <816979..>818178
                     /gene="NDAI0D03470"
                     /locus_tag="NDAI_0D03470"
                     /db_xref="GeneID:11495115"
     mRNA            <816979..>818178
                     /gene="NDAI0D03470"
                     /locus_tag="NDAI_0D03470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669856.1"
                     /db_xref="GeneID:11495115"
     CDS             816979..818178
                     /gene="NDAI0D03470"
                     /locus_tag="NDAI_0D03470"
                     /inference="similar to DNA sequence:INSDC:YJR148W,YHR208W"
                     /note="similar to Saccharomyces cerevisiae BAT2 (YJR148W)
                     and BAT1 (YHR208W); ancestral locus Anc_4.389"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669904.1"
                     /db_xref="GeneID:11495115"
                     /db_xref="GOA:G0WA50"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="InterPro:IPR005786"
                     /db_xref="InterPro:IPR018300"
                     /db_xref="UniProtKB/TrEMBL:G0WA50"
                     /translation="MLGRQTLKLRPTLGSQFSHITRSLATAPLDASRLQVTPISHPST
                     PKPNDQLVFGKTFTDHMLTVEWTKENGWDAPQIKPYANLSLPPSACVFHYAFELFEGL
                     KAYRTPDNKITMFRPDMNMARMNKSAARICLPTFQSEELVKLMGKLIEQDKHLVPQGQ
                     GYSLYIRPTLIGTTAALGVSTPDKALLFVICSPVGPYYKTGFKAVRLEATDYATRAWP
                     GGVGDKKLGANYAPCILPQLQAAERGYQQNLWLFGPEKNITEVGTMNVFFVFQNKATG
                     KKELVTAPLDGTILEGVTRDSVLALAREKLDPNEWEVNERYYSITEVAEKAQKGELLE
                     AFGSGTAAVVSPIKEIGWNGQAIHVPLLPGEQSGPLTKDVAKWIADIQYGKEKHGNWS
                     KVVADLN"
     gene            complement(<818292..>820418)
                     /gene="NDAI0D03480"
                     /locus_tag="NDAI_0D03480"
                     /db_xref="GeneID:11495116"
     mRNA            complement(<818292..>820418)
                     /gene="NDAI0D03480"
                     /locus_tag="NDAI_0D03480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669857.1"
                     /db_xref="GeneID:11495116"
     CDS             complement(818292..820418)
                     /gene="NDAI0D03480"
                     /locus_tag="NDAI_0D03480"
                     /note="ancestral locus Anc_4.121"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669905.1"
                     /db_xref="GeneID:11495116"
                     /db_xref="GOA:G0WA51"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G0WA51"
                     /translation="MSIENRTTARVIKRKRLIKSCKYCYTHKLKCNKEKPCSKCIAVG
                     LIDECIYGFDKGELQNHDSTSHSESTTPSPKLPLSSNSGKVRKIKTTNKTSSPLKSKY
                     LYPFFTNSVNDENISSVASNDTEELSSKMSKNAITTFDRFVPHLFAITLEDIINLIPD
                     SLEVALSQIDTYFETIHPIIPVLDRSLVRQKLIGIYNSIQSGTDLSISNLLLIMSIFF
                     CSSYSIVASSIIPDLLLCNKYYQSHKYLLELSVFPTRPTLESLQSFLIVNFIQDPNMT
                     EAIGYSVMLVRIAQQLGVEKKLMEHSTKQEDNIQEEEYQHLKLLWSYLLYIEGSASVV
                     YGLPFMSEKFNPDWPMEKIPTCLESIPLEFTIGRLIINAAFYDIMEHKKYVEMKEDHE
                     KLRCVYAKIERLNNQLSGRNFPHSNYFINTLKVFLYRLYLKYFGLLGLYSAGSKNNDN
                     DNDKRKNCAQQQQQLKKNNKNDITWILKSEQVYPDSVIEGSLLLLFSTLKRLIEKDTD
                     KFLWYTRGSTVMQYLFIILKDIYENPKKIYLIEGDDDVKDSLFCNSMDKDVHDVIKRA
                     PVFYRYLLIEQAMNLLELKLAPLWKKDDIYKFMLVRTVKEKVWEIHSNFISSNESLRD
                     ELNSSTIFIESRQNIKNLETSVNFEEYLKQWEIDRKKLDTRIPNGNDIDTDGDVNVPT
                     GHIVGSSLEAEQILIDWLSEFDVKTT"
     gene            <820778..>822079
                     /gene="NDAI0D03490"
                     /locus_tag="NDAI_0D03490"
                     /db_xref="GeneID:11495117"
     mRNA            <820778..>822079
                     /gene="NDAI0D03490"
                     /locus_tag="NDAI_0D03490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669858.1"
                     /db_xref="GeneID:11495117"
     CDS             820778..822079
                     /gene="NDAI0D03490"
                     /locus_tag="NDAI_0D03490"
                     /inference="similar to DNA sequence:INSDC:YGL004C"
                     /note="similar to Saccharomyces cerevisiae RPN14
                     (YGL004C); ancestral locus Anc_4.119"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669906.1"
                     /db_xref="GeneID:11495117"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0WA52"
                     /translation="MTNMKHTIPVFHIQPDFHEVIEDLQNPPRTDDKRNQTAVDEDAF
                     YINMDRTLNEVKEYRIRVSNKGTRFQPVHDRQNTFNHSSQNGRLYNAELDGQQSEFLI
                     PDWTWQNNIDYQPSILNNKTFTSIDVIQNNSAVKFAVGDNVGNISVFDDTMNLTCQLD
                     DAHFDEISNLKIFPSGEVLLSASIDMQLKIWSLKDGSNPRTFLGHKGKVTDTVLIERG
                     RNFLSSSRDGSIRLWECSTGTTIRTFTRKENPNDAILSMGLLSNDNPLTNEPASMNGN
                     SLDFGTKGKTVISSHKSGVLTLHDVFTKESLLQMPSIFMEPCNSVIVNPQDNNYVYAG
                     YENGSILIWDIRSNTVPLEEVVINKGIAINALKYYDNKLAISSGTDTSLLLDLDSSGS
                     QFQNYIPTFLVNDDCQVTSFATDSKKIYIVGNNSFWASFKL"
     gene            <822591..>823430
                     /gene="NDAI0D03500"
                     /locus_tag="NDAI_0D03500"
                     /db_xref="GeneID:11495118"
     mRNA            <822591..>823430
                     /gene="NDAI0D03500"
                     /locus_tag="NDAI_0D03500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669859.1"
                     /db_xref="GeneID:11495118"
     CDS             822591..823430
                     /gene="NDAI0D03500"
                     /locus_tag="NDAI_0D03500"
                     /inference="similar to DNA sequence:INSDC:YGL005C"
                     /note="similar to Saccharomyces cerevisiae COG7 (YGL005C);
                     ancestral locus Anc_4.118"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669907.1"
                     /db_xref="GeneID:11495118"
                     /db_xref="UniProtKB/TrEMBL:G0WA53"
                     /translation="MSQENKKEASTSQDDELLEMFFDEGFVPQAYIDIFISTLNANKP
                     NQIQTASSALLARLDFYTKYLTKELETTIWDLEKLSEALPATLSSNWPAIEDHDPTSF
                     GASKLEYYIDTLGSAVRGLETDMDKVDSKLDALNSNYEKNSNNLMQKLKGLETIKSRL
                     NNVLQTFNELKIILDISSDEKDKDVNRRKIATTSLDDFTISLRTLEDTIISALNESLD
                     SEKSNEINDELLKRIDQLNDLLPLFNGFDKFNTVYSQFSTNIKHGVKEYLSTKDIDAE
                     LGS"
     gene            complement(<823745..>827416)
                     /gene="NDAI0D03510"
                     /locus_tag="NDAI_0D03510"
                     /db_xref="GeneID:11495119"
     mRNA            complement(<823745..>827416)
                     /gene="NDAI0D03510"
                     /locus_tag="NDAI_0D03510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669860.1"
                     /db_xref="GeneID:11495119"
     CDS             complement(823745..827416)
                     /gene="NDAI0D03510"
                     /locus_tag="NDAI_0D03510"
                     /inference="similar to DNA sequence:INSDC:YGL006W"
                     /note="similar to Saccharomyces cerevisiae PMC1 (YGL006W);
                     ancestral locus Anc_4.117"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669908.1"
                     /db_xref="GeneID:11495119"
                     /db_xref="GOA:G0WA54"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR006408"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:G0WA54"
                     /translation="MSSRNYLTVPGQDSQDADSDEQASAQDYLLDNDSLSQEREQEQE
                     AEAQDTEDEYPLTTKQLSELHDPKSMRSYISLFQNDKLNIFKYLNTSLQTGIKTPTRN
                     NSNIKWNYSNTKRYKLYSDNRIPERIPKTFLQLVWEAFNDKTMLLLTGAAIVSFTLGL
                     YEALGQPPEYDPEGNKIKKVDWIEGVAIMIAVVVVVLVGAVNDYQKELQFAKLNKKKE
                     NRKVIVVRNAQEEMVSIHDLLVGDIIKLQTGDVIPADSVLVRGECEIDESSVTGESDT
                     IKKVRLSSALRKFASINETNKKNNNNNNNNGSLHELDIGSVTPEGVHLPDCMLISGSK
                     ILSGLGTAVVTAVGVNSIHGRTMMSLKVETEETPLQERLSQLADSISVYGCVAAIILF
                     LVLFVRFLFYVFAPNGRFHDLDPAQKGNKFMNIFITAVTIIVVAVPEGLPLAVTLALA
                     FATTRMTKDGNLVRNLRACETMGSATAVCSDKTGTLTENRMSIVKGFIGEDQFDETMN
                     NRENLPHSKDMFNEKCTEDLQKDLLSNIVLNSTAFENNKYVHPDIERESGISLDSINE
                     SNNQQTSSPSKWNILSWFRSGHCKKANNDKDDDDDDDLMKHAMEGRQEPYIGSKTETA
                     LLAMAKRSLNLKFGSLQDLRDDPEERFGVDEIIQVIPFESSRKWGGIVVKYKASGLIR
                     FFIKGAAEIVSNCCHSKRNSDDCLILIDEKVSDVINKNIKSLASNALRAISLGHRDFK
                     DCSEWPPKEVQDDENSNRANPEKLLSLKVNNKNSDDGLILDGIVGIQDPLREGVKNSV
                     QQCQKAGVIVRMVTGDNVLTARAIARNCNILSEEAYNDPDSAMEGPKFRKLTKDERIK
                     LLPKLRVLARSSPEDKRVLVETLKGMGEVVAVTGDGTNDAPALKLADVGFSMGISGTE
                     VAREASDIILMTDDFGAIVDAIKWGRCVSISIKKFIQFQLIVNITAVILTFVSAVASE
                     DETSVLTAVQLLWVNLIMDTLAALALATDKPDPNIMDRKPKGRSSPLIYPSTWKMILS
                     QSFLQLIITFTLHFHGKEIFFKGKESITGHEQQQLNAMTFNTFVWLQFFTLFVSRKLD
                     EGDGIKNWRKRISKANLNFFQDLLRNYYFLVIMALIGGCQVLIMFFGGAPFSIAHQTK
                     EMWATAILCGTLSIPIGLIVRICPDELAKKFFPTKLFSKCKYIFGLEFLRERTKSSDE
                     EALLDRDGSPNSSGSSAFF"
     gene            <831794..>834523
                     /gene="NDAI0D03520"
                     /locus_tag="NDAI_0D03520"
                     /db_xref="GeneID:11495120"
     mRNA            <831794..>834523
                     /gene="NDAI0D03520"
                     /locus_tag="NDAI_0D03520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669861.1"
                     /db_xref="GeneID:11495120"
     CDS             831794..834523
                     /gene="NDAI0D03520"
                     /locus_tag="NDAI_0D03520"
                     /inference="similar to DNA sequence:INSDC:YGL008C"
                     /note="similar to Saccharomyces cerevisiae PMA1 (YGL008C);
                     ancestral locus Anc_4.115"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669909.1"
                     /db_xref="GeneID:11495120"
                     /db_xref="GOA:G0WA55"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006534"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:G0WA55"
                     /translation="MSDISDSEQVSEKPPQVVESSSSEEEESDDDDIDALIEELQSNH
                     GLGDDDDDSDEHAAAGEARVVPEELLQTDPSYGLTADEVSRRRKKYGLNQMSEDNESL
                     VVKFVMFFVGPIQFVMEAAAILAAGLSDWVDFGVICGLLLLNAGVGFVQEFQAGSIVE
                     ELKKTLANSAIVIRDGQLTEVPANEVVPGDILQLEDGTIIPADGRIVTEDCFVQIDQS
                     AITGESLAVDKHYGDQTFSSSTVKRGEAFMVITATGDNTFVGRAAALVNKAAGGQGHF
                     TEVLNGIGIILLVLVIVTLLLVWTASFYRTDGIVRILRYTLGITIVGVPVGLPAVVTT
                     TMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSAD
                     DLMLTACLAASRKKKGLDAIDKAFLKSLAQYPQAKNALTKYKVLEFHPFDPVSKKVTA
                     VVESPEGERIICVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVARK
                     RGEGHWEILGVMPCMDPPRDDTAETVTEARRLGLRVKMLTGDAVGIAKETCRQLGLGT
                     NIYNAERLGLSGGGDMPGSELADFVENADGFAEVFPQHKYRVVEILQNRGYLVAMTGD
                     GVNDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYV
                     VYRIALSIHLEIFFGLWIAILNNSLNIDLIVFIAIFADVATLAIAYDNAPYSQTPVKW
                     DLPRLWGMSVVLGVILAIGSWIALTTMFLPKGGIIQNFGAIDGIMFLQISLTENWLIF
                     ITRAVGPFWSSIPSWQLAGAVFGVDIIATMFTLFGWWSQNWTDIVTVVRVWIWSIGVF
                     CVMGGAYYEMSTSDAFDRLMNGKSLKEEKKSNRSIEDFLAAMQRVSTQHEKET"
     gene            <836124..>838553
                     /gene="NDAI0D03530"
                     /locus_tag="NDAI_0D03530"
                     /db_xref="GeneID:11495121"
     mRNA            <836124..>838553
                     /gene="NDAI0D03530"
                     /locus_tag="NDAI_0D03530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669862.1"
                     /db_xref="GeneID:11495121"
     CDS             836124..838553
                     /gene="NDAI0D03530"
                     /locus_tag="NDAI_0D03530"
                     /inference="similar to DNA sequence:INSDC:YGL014W"
                     /note="similar to Saccharomyces cerevisiae PUF4 (YGL014W);
                     ancestral locus Anc_4.114"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669910.1"
                     /db_xref="GeneID:11495121"
                     /db_xref="GOA:G0WA56"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0WA56"
                     /translation="MSARATKEATATDVSSSDPIVSDTITSALEQLQLDVMEEQPGKV
                     VAEQMHVNNNPSSSTLPLNPSPSNPFPPPHMMNVGFVPYSQMMQHPPQHGPGLFPHPD
                     LQDSSLSHVGPIMFNNSNDSSLFPSGSLASIPSFIPESHMIPNDPLWSATNQPGASSI
                     AIEESGTLGDGLPKPKGPGAATISSRRQTFHAISTHDLIDATNEKTAVVNPPPTLENE
                     TAVPVSVPSTTSSNPKTRTQSISFEKTVGHPQFFPATTKVKGIEAKTSDKGINKFGTV
                     DNTYAAYPYGGPLAQPNPMLHKHHAPMGSTPPFPSAFPGNYDFNAPFHSFSPVMGNMN
                     PHALHPQSHIPMPHSPILMHGPMMDGKHKGEPMLNSNNPMNSPLPPHQHFPMMQHTPN
                     GTPPPPWLYGTPPPFNHMGPPPPHGMHVPGGRGHLVSGGRGNNRGGKHTSGRNRNSKH
                     GFNNHHHHHHNNNTNVDANNQRKLEEMSRYADATLDQFAGNIYSLCKDQHGCRFLQKQ
                     LDILGTEAADKIFEETKYHTIELMTDSFGNYLIQKLIERVSTEQRTELAKIASPQFVE
                     IALDPHGTRALQKLIECIDTDDEAKIIVASLSGSIVQLSKDLNGNHVVQKCLQKLHPK
                     DFQFIFDATCQNSVDIATHRHGCCVLQRCFDHGTKEQCETLCDELLKHVDKLTLDPFG
                     NYVVQYIITKETEKDKFDYTHKIVHLLKPKIAELSVHKFGSNVIEKLLRTPVATENMI
                     LELLNHKADIPNLLNDSYGNYVLQTALDISYEHNTYLYNKLSSIVAPLLVGPIRNTPH
                     GKRIMNILHIE"
     gene            complement(<838966..>842289)
                     /gene="NDAI0D03540"
                     /locus_tag="NDAI_0D03540"
                     /db_xref="GeneID:11495122"
     mRNA            complement(<838966..>842289)
                     /gene="NDAI0D03540"
                     /locus_tag="NDAI_0D03540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669863.1"
                     /db_xref="GeneID:11495122"
     CDS             complement(838966..842289)
                     /gene="NDAI0D03540"
                     /locus_tag="NDAI_0D03540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669911.1"
                     /db_xref="GeneID:11495122"
                     /db_xref="GOA:G0WA57"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G0WA57"
                     /translation="MNPPFGMESLLNGEETMDGMNNLKLSPSQDTKIKKPAAKVSKAC
                     DNCRKRKIKCTGKMPCPTCEAYQCPCIYSAPKPRKKRTSKRHIRSGGSDYHDDITSIE
                     SNNNSVSQISNNDINNLNNINNNNNVISNSSNENSLRNMESNQTQNRNQCFPELGTIK
                     APFAAFDGNLPFKRGPSSPENSSKNDCKEVAPIIQGDNGFYQDDEVLQEELSILQTMV
                     RQLEKLHKSDSHRNNTIANIKLQINDLIDSWTPDVDFTRLSDVPEDDILSLESHLMKN
                     KYTEQVCITNFSIWSNGKRNADDNTPLNPTRQPLIDDFFGLYSAFQAFSLQGIGYSFQ
                     KFFVHDTSNPLISKHIKATLYILLRFFDMCFQHLNDGCVSIANPLENYLRRKNLMAPT
                     PTPTPSGNSSVSVGSPNTANEKSLVVLLINRFPQPFIENLTKITIKQLMETVDKDFEM
                     FKLVLDMFEAHRSGFESFMVNEAPKKVKDNGAYELTTELIETFHRFCESEELILALTY
                     SYYNSTLYRQIENNDGLEYLEILVSLLGHQLWCEEFYGFQKVLSVALNQAVKMGLQRW
                     EFYIGLDEQTALRRRKVWWKLYSFEKVFISKMGCQPTIDDSKMNCLLPKSFISAGFLT
                     NADFICKINKVSKPDHFDSMPISDLAEYGTYAVLQVVSVFFSDVLYNERYTSIRNVAK
                     PPSIKTHYLSEISNELISFKERMEGVRRHTSLLFDITNSVINTSPATNTPLSKEDKNH
                     ARNYVLCFEYHSGRVLAAVDNLISRLNLPRDLDVVQKASISLQEDIYASWTSITSVIL
                     KLEDSYSVCQAFKFYGATCICLLTSRHYYDSLIRLDDLFSIVRIFKECQGFGLGARRG
                     NCTLLEDNRLVKSYRKSSALCAILCRIMLLRYMTKKRICISDLLKLFEEKAPDLAMFP
                     EVILDTRSEIYQNLLEPVLASGFHLNINKMLENNPILDYGKCKQDSAQSISPNMNCGD
                     NAFGKTVVQVPMVSNIPNGPLSGNSESYRSSVTSIRDYPSFPSLKSDGTYTPTYSPLA
                     PYLKQGTPQLPEIEGQVKPQPQDQLPLSDHTNIPNIINLPEIPGGYNLGTLDEFVNNT
                     DLSDLYNVLWSDLYSDAVL"
     gene            complement(<843265..>846621)
                     /gene="NDAI0D03550"
                     /locus_tag="NDAI_0D03550"
                     /db_xref="GeneID:11495123"
     mRNA            complement(<843265..>846621)
                     /gene="NDAI0D03550"
                     /locus_tag="NDAI_0D03550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669864.1"
                     /db_xref="GeneID:11495123"
     CDS             complement(843265..846621)
                     /gene="NDAI0D03550"
                     /locus_tag="NDAI_0D03550"
                     /inference="similar to DNA sequence:INSDC:YBL005W,YGL013C"
                     /note="similar to Saccharomyces cerevisiae PDR3 (YBL005W)
                     and PDR1 (YGL013C); ancestral locus Anc_4.113"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669912.1"
                     /db_xref="GeneID:11495123"
                     /db_xref="GOA:G0WA58"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G0WA58"
                     /translation="MLEPMNSNSNNMNGSSTLQQQPPMIPKIASTPVTTVKATSTSLH
                     VPTKEKKIRKPSNKVTKACDNCRRRKIKCTGKTPCATCEAYQCLCIYSTQRGRKNGNS
                     NNSNNSTSNNNNSNNENTNVINNIENSKMPGYKSLSPIVLNELQNNLKLKQNTKNKNN
                     IPGKGIPNSRTCNPYITQQFVSNDEMPLPVMTLVDGDPGPYEDDKKFQNQLITLQSVQ
                     SQLELMGPSISPEIDQSIKNINIQIKNLIENWNPEINFDKLNTIPNNDLWSVETHLMK
                     NKYTDQVHLNNFSIWSDSQMKGKERGTVAFSKEPLIDEIFGLYSPYQAFSIQGIGYCF
                     RTYLKPKQLEPSLSTHTKETLYIVLRLFDMSFHQINENCISIASPLESYLRRRSLMPS
                     PMTPLSAASTYNNNTTSSVGSPNTATEKSLVAILINRLPQPFVQNMTSLTNNHLLNTM
                     NDDFAMFKLILKMCEAHRNGFEKLMMNSIPGQTPPARFTQMKPDALESYSCFCEEEEI
                     LLALAYSYYNSTLYHIMQSGDVLVYLELLVSLLEHQLWSSEFYGFEKVTCVAVNHAMR
                     LGLPRWEYYVGLDEATAERRRRIWWKLYCFEKIIILETGTNLFIDERKMNCLLTSDFR
                     EAGFLNSVEFIEKVDKIPRSKVFDKMNIKELKSYGECAMLQIASNLYSELLYNERYTS
                     IKNISKPEYIKEIYMNEIIEEVEKFKRRLEAVKSHTSFLFNLSVANTNTGAAALADKI
                     EACSFVQRFEDIKCSMLGAVDVLVTRLSSSHPSLRVISIGSKILAEIYSSWRTLTGLL
                     LAVDNDFYTCTSIQRYGAASVLLLTSRYFTGNHITLNDLFNMVHIFKRCNTCVAATQS
                     NNGFTQSNTIRAQRMTVSFVAILCRIIILRYLQETEISREELFTAFEGQSSDLAVIAQ
                     MILDAKSKVYSFLLEPVQKSGFHLTLKKILDYDLENPQKRRNSKKNYNAASKTKTTRA
                     NSNSNMPIHNLLNGTTGANITGPPLSQQQQLQDQQQLSSPQQLQKQQQIHQQNFCGMS
                     TPEALPSIKSLTNANAGNISSFPSYPNTQPPSQLDAISENDNSELMNLMGNNCGAAFN
                     LGTLDEFVNNADIDDLYNVLWGDLYTDAVL"
     gene            complement(<848282..>848800)
                     /gene="NDAI0D03560"
                     /locus_tag="NDAI_0D03560"
                     /db_xref="GeneID:11495124"
     mRNA            complement(<848282..>848800)
                     /gene="NDAI0D03560"
                     /locus_tag="NDAI_0D03560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669865.1"
                     /db_xref="GeneID:11495124"
     CDS             complement(848282..848800)
                     /gene="NDAI0D03560"
                     /locus_tag="NDAI_0D03560"
                     /inference="similar to DNA sequence:INSDC:YGL011C"
                     /note="similar to Saccharomyces cerevisiae SCL1 (YGL011C);
                     ancestral locus Anc_4.110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669913.1"
                     /db_xref="GeneID:11495124"
                     /db_xref="GOA:G0WA59"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G0WA59"
                     /translation="MVANGPIPDARNAATRAKAEAAEFRYKYGYDMPCDVLAKRMANL
                     SQIYTQRAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYKATATGPKQQEITTNL
                     ENYFKKKETSYLEEDSWEKVVEFAIAHLIDSLGTEFTKKDLEVGIALKDIFFVLNSEQ
                     IEERLVAIAEQD"
     gene            <849977..>850486
                     /gene="NDAI0D03570"
                     /locus_tag="NDAI_0D03570"
                     /db_xref="GeneID:11495125"
     mRNA            <849977..>850486
                     /gene="NDAI0D03570"
                     /locus_tag="NDAI_0D03570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669866.1"
                     /db_xref="GeneID:11495125"
     CDS             849977..850486
                     /gene="NDAI0D03570"
                     /locus_tag="NDAI_0D03570"
                     /inference="similar to DNA sequence:INSDC:YGL010W"
                     /note="similar to Saccharomyces cerevisiae YGL010W;
                     ancestral locus Anc_4.109"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669914.1"
                     /db_xref="GeneID:11495125"
                     /db_xref="InterPro:IPR009305"
                     /db_xref="UniProtKB/TrEMBL:G0WA60"
                     /translation="MSDKYAKLRKELLFYKYYHHNRINVLIHSIFVPTILFSACCFLN
                     RIELFKGITVTNLFSIGYTLYYIHLYLPTGLLAGLIFIIVNIGLKKRWIHLSLPTEIT
                     LFIIGWLVQFIGHGVFERRKPAVLDNLIQSLVLAPYFILFEFLFKLGFLPEVRSKLEE
                     ELKNIERKK"
     gene            complement(<850717..>853074)
                     /gene="NDAI0D03580"
                     /locus_tag="NDAI_0D03580"
                     /db_xref="GeneID:11495126"
     mRNA            complement(<850717..>853074)
                     /gene="NDAI0D03580"
                     /locus_tag="NDAI_0D03580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669867.1"
                     /db_xref="GeneID:11495126"
     CDS             complement(850717..853074)
                     /gene="NDAI0D03580"
                     /locus_tag="NDAI_0D03580"
                     /inference="similar to DNA sequence:INSDC:YGL009C"
                     /note="similar to Saccharomyces cerevisiae LEU1 (YGL009C);
                     ancestral locus Anc_4.107"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669915.1"
                     /db_xref="GeneID:11495126"
                     /db_xref="GOA:G0WA61"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR004430"
                     /db_xref="InterPro:IPR004431"
                     /db_xref="InterPro:IPR012235"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR015931"
                     /db_xref="InterPro:IPR015932"
                     /db_xref="InterPro:IPR015937"
                     /db_xref="InterPro:IPR018136"
                     /db_xref="UniProtKB/TrEMBL:G0WA61"
                     /translation="MTFSSFRETSGPRTLYDKVFDAHVVHKDDDGSYLLYIDRHIIHE
                     VTSPQAFEGLENADRKVRRRDCTLATVDHNIPTESRKDFESIDTFIKQADSRLQVKTL
                     EKNVKTHNVPYFGMTDPRQGIVHTIGPEQGFTLPGTTVVCGDSHTSTHGAFGSLAFGI
                     GTSEVEHVLATQTIIQARSKNMRINVPGKLNPGVTSKDLILHIIGQIGTAGGTGCVIE
                     FAGEAIESLSMEARMSMCNMSIEAGARAGMIKPDETTFKYTKGRPLAPKGAEWVKAIK
                     YWKTLHSDEGAHFDYDITIKAEDVMPTITWGTSPQDALPISGSVPDPAKENDPIRKAG
                     MERALKYMGLEPNTPLKSIKIDKVFIGSCTNARIEDLRNASAVVKGHKLADNVIQAMV
                     VPGSGLVKAQAEREGLDKIFEEAGFEWREAGCSMCLGMNPDILQPHERCASTSNRNFE
                     GRQGALARTHLMSPAMAAAAGIYGHFVDIRDHKYRDNDIPAVAVTSESESESESLEGK
                     AYEHDEPIQPSEATEEVANDELKDIPAATTAVKKSQAPTASGMKPFVKLDGLAAPLDK
                     ANVDTDAIIPKQFLKTIKRTGLKNGLFYELRFVKDEQGKDKETDFVLNVNPWRKAEVL
                     VVTGDNFGCGSSREHAPWALKDFGIKSIIAPSFGDIFYNNSFKNGLLPIRIEQSVILE
                     KLIPIAQKGGNLVIDLPNQNISDSEGTVLVEHFDIEPFRKHCLVNGLDDIGLTLQKET
                     FITEYETRRRDIYSFLEGGSSLLRFDNIPKKKFNATTFSIVHEKW"
     gene            complement(<853792..>856818)
                     /gene="NDAI0D03590"
                     /locus_tag="NDAI_0D03590"
                     /db_xref="GeneID:11495127"
     mRNA            complement(<853792..>856818)
                     /gene="NDAI0D03590"
                     /locus_tag="NDAI_0D03590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669868.1"
                     /db_xref="GeneID:11495127"
     CDS             complement(853792..856818)
                     /gene="NDAI0D03590"
                     /locus_tag="NDAI_0D03590"
                     /inference="similar to DNA sequence:INSDC:YGL016W"
                     /note="similar to Saccharomyces cerevisiae KAP122
                     (YGL016W); ancestral locus Anc_4.105"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669916.1"
                     /db_xref="GeneID:11495127"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0WA62"
                     /translation="MNTNTSSKEFTWKLLKANLLFLLKYGLMYANNPNQRTVLMMIIK
                     KLMSNLSFLFNNINESGSQSEPIPNTIDTWNNPINTIIFLFSQYPNNVPNWDMVASSN
                     QINEIFRYAIDSNIPYDQLLNFVRSSPIYNELLLTFTEIIVEDLLKLQAKRHAVTKIH
                     KIVHEHLYITTTALIVSNLSSQQMITDDTIFASINAWINYISSIRHISSDGTMDLTEI
                     FQKLLDLMYHSSEHTDKYLIAEKVLTIFANVFANDPLLMSFPLREQVEALFLGISRSG
                     NGDIAQNKWMLQYMNYLVTNEMTSELKDLTVCIVDFLQINTLDVCNKLFTTISTDKFS
                     ESVSEQYIKVLLQMTNFPLVPVLQEFFSVRMVDFWLELAECYSTLSNDTLKSNANEIS
                     TDIFQQVINIYLPKISLLNEQKILQEDNDSSSLHEFDDFRKAVADLTQTLWMILGHAN
                     LTNVLIIGIGSADASTSDNIGNLYQIESMSYLLGVLLADGSDSVSPWICNVLKQNSFT
                     IENNLLLFRHSMTKLNTNINTLDSTLSLTFARTSCALIGRLAGYFTSEPAKLSTCLEA
                     LFQGLETCTVTSGSPINGKLETIIVKTIVQLCETCRQQLSSFLEHFFNVLMSVMRPNS
                     NVSNFTRSNLVKSVGYIIQCRVENGAQEQGKYILQLIDMIGSLIENNLNSPVLPSEQQ
                     YDYMHCLLDCILELGSSMLQSDDSENTQLLQRLPEFQQFWQNDPFYIRNKIMAMIEKA
                     LAAPEFNNRSGIIEVSCLILGRTLTVPDDEPHFLRYSMQEIINFILAHIGTCELTISL
                     PYFVYLLEKLFKHFKDILTSEDFDFLFEKIILPGYTQYISRDPDLLQTTINLLNTILD
                     CKPSLVIFSKHWTTFIFPELLKLLSAKERFTTIAVGKFWTKVINNKKYTQQDLQVSRQ
                     QIGAIGQDLVYQTMNGLYHTQRSDLNCYTDLIRTLVAKFPMDCKGWLIVALPQVCNKP
                     EIHERFINKLLVTRGNRAASSVILNWWLECTSLPGY"
     gene            complement(<857574..>859187)
                     /gene="NDAI0D03600"
                     /locus_tag="NDAI_0D03600"
                     /db_xref="GeneID:11495128"
     mRNA            complement(<857574..>859187)
                     /gene="NDAI0D03600"
                     /locus_tag="NDAI_0D03600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669869.1"
                     /db_xref="GeneID:11495128"
     CDS             complement(857574..859187)
                     /gene="NDAI0D03600"
                     /locus_tag="NDAI_0D03600"
                     /inference="similar to DNA sequence:INSDC:YGL017W"
                     /note="similar to Saccharomyces cerevisiae ATE1 (YGL017W);
                     ancestral locus Anc_4.104"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669917.1"
                     /db_xref="GeneID:11495128"
                     /db_xref="GOA:G0WA63"
                     /db_xref="InterPro:IPR007471"
                     /db_xref="InterPro:IPR007472"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR017137"
                     /db_xref="UniProtKB/TrEMBL:G0WA63"
                     /translation="MDPGISDRLIITAPMYFSHPAEDCGYCKGEKKDPRYFFALESFF
                     EKYRTDVLKDKLQIEHSSIGFQAMKMNVRQYERLCNLGFRRSGDFIYRTEMLRNCCRL
                     YTIRTSLKQFKITKEFKSAINKFTKRITTTEQLEKLRKKSEANKNKPYDFIEKLNEAE
                     MISTNFQTVYEPAVFSEEKYLLFARYQEAVHKDFDHSPKGFERFLCHCPFTNTGTEEQ
                     WKQLNEARIHDIRIASQKEVSGPVHECYYYDDKLIALSVLDILPTGISSVYFIWDPDY
                     RDWSLGKISALRELALVERESKKYYYLGLYADDCPKMNYKGAYGGELLDICNGKFVPL
                     EFLKVNGMISESKFFTINDDSMRNGDIYIEDEINLPFPSCVDKREPSLRAALPENIET
                     TNTKDFDINRAEVVYGVDGSAYGGIEELVKLFAEQDIEYTIEPSNVLNLVPKDEYIEQ
                     SARYALFPSVSPGLMPLWQLMYFMEHEGGNRIDGVFAELLVVEFSPFTGIRRLENILD
                     ESKQVKTAVCNLIRILGPSFAAEVLLVCQ"
     gene            <859564..>860136
                     /gene="NDAI0D03610"
                     /locus_tag="NDAI_0D03610"
                     /db_xref="GeneID:11495129"
     mRNA            <859564..>860136
                     /gene="NDAI0D03610"
                     /locus_tag="NDAI_0D03610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669870.1"
                     /db_xref="GeneID:11495129"
     CDS             859564..860136
                     /gene="NDAI0D03610"
                     /locus_tag="NDAI_0D03610"
                     /inference="similar to DNA sequence:INSDC:YGL018C"
                     /note="similar to Saccharomyces cerevisiae JAC1 (YGL018C);
                     ancestral locus Anc_4.103"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669918.1"
                     /db_xref="GeneID:11495129"
                     /db_xref="GOA:G0WA64"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR004640"
                     /db_xref="InterPro:IPR009073"
                     /db_xref="UniProtKB/TrEMBL:G0WA64"
                     /translation="MSLSLRRFFIQKRTLTTFYELFPKTFPDKKPIWSIDQTKLRKEY
                     RALQAQHHPDMVKEGEIDKQSTLLNKAYHVLKEPLRRSQYMIKLLHDIDLTQDSVKEK
                     ITNSDPDILMKVIDIHEQLMEIEDENDVNKVRQENQERIDAIEKKLTDAFERKDFDTA
                     IKLTVELKYWSNVAYAIKEWAPGKEIHLNH"
     gap             860321..860340
                     /estimated_length=20
     gene            complement(<860440..>861261)
                     /gene="NDAI0D03620"
                     /locus_tag="NDAI_0D03620"
                     /db_xref="GeneID:11495130"
     mRNA            complement(<860440..>861261)
                     /gene="NDAI0D03620"
                     /locus_tag="NDAI_0D03620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669871.1"
                     /db_xref="GeneID:11495130"
     CDS             complement(860440..861261)
                     /gene="NDAI0D03620"
                     /locus_tag="NDAI_0D03620"
                     /inference="similar to DNA sequence:INSDC:YGL019W"
                     /note="similar to Saccharomyces cerevisiae CKB1 (YGL019W);
                     ancestral locus Anc_4.102"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669919.1"
                     /db_xref="GeneID:11495130"
                     /db_xref="GOA:G0WA65"
                     /db_xref="InterPro:IPR000704"
                     /db_xref="InterPro:IPR016149"
                     /db_xref="InterPro:IPR016150"
                     /db_xref="UniProtKB/TrEMBL:G0WA65"
                     /translation="MSTEYIEAPSHSALSDEDSGTYDEWIPSFCSRFGHEYFCEVPHE
                     FIEDDFNLTSLAQEVPHYRKALDMILDLEDISDDEEDEEEEEEDQDMLGENGSQNSSS
                     KRKPPIVNRSIIEHAAEQLYGLIHARYILTKQGLQSMAEKFDHKEFGICPRYHCSGMQ
                     LLPCGLSDTIGKYTVRLYCPSCQDIYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEE
                     YVERKTKETYELKVFGFRINDRAVSGQRMKWLRQYPSTDEEWADFAKCEFETPSV"
     gene            <861736..>862452
                     /gene="NDAI0D03630"
                     /locus_tag="NDAI_0D03630"
                     /db_xref="GeneID:11495131"
     mRNA            <861736..>862452
                     /gene="NDAI0D03630"
                     /locus_tag="NDAI_0D03630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669872.1"
                     /db_xref="GeneID:11495131"
     CDS             861736..862452
                     /gene="NDAI0D03630"
                     /locus_tag="NDAI_0D03630"
                     /inference="similar to DNA sequence:INSDC:YGL020C"
                     /note="similar to Saccharomyces cerevisiae GET1 (YGL020C);
                     ancestral locus Anc_4.101"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669920.1"
                     /db_xref="GeneID:11495131"
                     /db_xref="GOA:G0WA66"
                     /db_xref="InterPro:IPR027538"
                     /db_xref="InterPro:IPR028945"
                     /db_xref="UniProtKB/TrEMBL:G0WA66"
                     /translation="MSACNWVIATSLVFVTINKFLQYSTSYHASWMSKIIQHSVHKKS
                     YDDYHKKLQERLELQEENTTISAQDNYAKWTKNNRKLEKLNEEIKALGIQLKSQQSSI
                     EKQMKKFKLVTLTAPFIILKLWKGKFPVYYLPHSDMFPKIIGGVMSQGWLYLALLPLQ
                     ILRGSSKVETQGEESMAIQVSVSLGIWLWALMTVISTVEFLINQLVFTKEVKKPVVIE
                     EEKINIKAPNAIEEDKIALD"
     gene            complement(<862667..>864763)
                     /gene="NDAI0D03640"
                     /locus_tag="NDAI_0D03640"
                     /db_xref="GeneID:11495132"
     mRNA            complement(<862667..>864763)
                     /gene="NDAI0D03640"
                     /locus_tag="NDAI_0D03640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669873.1"
                     /db_xref="GeneID:11495132"
     CDS             complement(862667..864763)
                     /gene="NDAI0D03640"
                     /locus_tag="NDAI_0D03640"
                     /inference="similar to DNA sequence:INSDC:YGL022W"
                     /note="similar to Saccharomyces cerevisiae STT3 (YGL022W);
                     ancestral locus Anc_4.98"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669921.1"
                     /db_xref="GeneID:11495132"
                     /db_xref="GOA:G0WA67"
                     /db_xref="InterPro:IPR003674"
                     /db_xref="UniProtKB/TrEMBL:G0WA67"
                     /translation="MSIFGAAVSARLFSVIRFESIIHEFDPWFNFRATKYLINNSFYD
                     FLNWFDDRTWYPLGRVTGGTLYPGLMTTSALIWHTLRKIGLPIDIRNICVLFAPAFSG
                     VTAIATYYLTKEIKDSSAGVLAAAFIAIVPGYISRSVAGAYDNEAIAITLLMVTFMFW
                     IKGQKTGSILYSSFAALFYFYMVSAWGGYVFITNLIPFHIFLLILMGRFTSKLYVAYN
                     TWFIIGTVASMQIPFVGFLPIRSNDHMAALGVFGLLQIVALGDFVKSKLPPRKFKIVM
                     IVSLLIILAIGIAGLFLLTYMGLIAPWTGRFYSLWDTSYAKIHIPIIASVSEHQPVAW
                     PAFFFDTHFLIWLFPAGVFLLFMDLKDEHVFIIAYSVLCSYFAGVMVRLMLTLTPVIC
                     ITAAVALSKVFDVYLDFSSAIDPQRRNLTSLLSRLIVSGTFIFYLYLFVFHCTWVTQT
                     AYSSPSVVLPSTSPDGSMALIDDFREAYYWLRMNTDEDAKVAAWWDYGYQIGGMADRT
                     TLVDNNTWNNTHIAIVGKAMASPEEKAYEILKEHDVDYVLVIFGGLIGFGGDDLNKFL
                     WMIRISEGIWPDEIKERDFFTPEGEYRVDSRASKTMKESIMYKMSFKDFPILFNGGQA
                     VDKVRQQAISLEDVGTLDYFDEVFTSENWMVRIYQLKEDDPEGRSLKEVGDFERAKGK
                     LTKKRKITKPDLTLRV"
     gene            <866072..>869002
                     /gene="NDAI0D03650"
                     /locus_tag="NDAI_0D03650"
                     /db_xref="GeneID:11495133"
     mRNA            <866072..>869002
                     /gene="NDAI0D03650"
                     /locus_tag="NDAI_0D03650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669874.1"
                     /db_xref="GeneID:11495133"
     CDS             866072..869002
                     /gene="NDAI0D03650"
                     /locus_tag="NDAI_0D03650"
                     /inference="similar to DNA sequence:INSDC:YGL023C"
                     /note="similar to Saccharomyces cerevisiae PIB2 (YGL023C);
                     ancestral locus Anc_4.97"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669922.1"
                     /db_xref="GeneID:11495133"
                     /db_xref="GOA:G0WA68"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:G0WA68"
                     /translation="MSSIHSQPSDGSLTSKMNMIQGDKHLQPAPLPPLPPPPQQQQQQ
                     QSNNNTIIITNNQRRGSQKLNVVPLTIKEEDEETDSTTTGQQRGITSNRQNSNERNNG
                     LIQPHRQQPMRNNSTTAILRKKSSLSLNNRRNNNNSNNPVEESPISIKSTKSIPLNRS
                     NSSITFEKQKIVPRSRTHSEQSILSSLSLKSLIHNQPQYNNNNNNANIDNNATSLKSY
                     KSLIDMSKQIQSPAMFSLRRNTSTTTTTTNTNNNNINGINNNNNNNNNNSAATSIINN
                     NTNNTNTTDDDNNNNTNASIYSDKTEIGSKVPLIENKRTNLDSMKKNTYNNNVQTDTS
                     SSSNNNNNNKPLTISTLMSEQNNNMKDNNEKVISDDAEHTVVDDNNESDDAEAMAQKN
                     LTTQALRKLSILKISKVSSPNDGDDTNEIDTNESNNNSNIRDSFVNMTKSTSSNDIDN
                     NNNNRINKTNDTNINHNANKNDNMNVQEPLINDNFTTKPDLSRRCSESSTSSSSLSES
                     PLSFSKHVSNYNLPKKTPSDARLPNSKTTSNNDIITKKTTSFIRGSSNTNIRMENNNT
                     NVSSSSNMVPDSHSHSHSHSNIIRTTTPVRKLNRMANVSVLHTSNNNPTTTTNNNTSN
                     NNNNNTGTGIQQKRLLRHSSKNNLRNHNLPMQQQPARGQSPSLLSPVQNKRHIKQISN
                     PKKPLYVPAVLRNVSETNITNEDLNSLLPSSLLPQQPLPPPSTSASSSSQDKIMNNNS
                     KFNSPQPYISNDLMPHGTTSDHHNSNRKNINPLMTITNENGITLPTTSSRSSIRSATS
                     SMIESYKSKVTSFLFPDSSITRQEDEPSHDHWIPDSKRSECLKCHKKFTLCERKHHCR
                     HCGEIFCSEHLRHWLYLDHQANFIISTKIDLFENVNMNNTNNNNNSNNGGGVLCKVCD
                     FCLEKYENVSNENSKIQLNGNSSVHHDNTTNENEQQRNGNVADSNNSKQIKNANEMNS
                     RKKN"
     gene            <869405..>870319
                     /gene="NDAI0D03660"
                     /locus_tag="NDAI_0D03660"
                     /db_xref="GeneID:11495134"
     mRNA            <869405..>870319
                     /gene="NDAI0D03660"
                     /locus_tag="NDAI_0D03660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669875.1"
                     /db_xref="GeneID:11495134"
     CDS             869405..870319
                     /gene="NDAI0D03660"
                     /locus_tag="NDAI_0D03660"
                     /note="ancestral locus Anc_4.94"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669923.1"
                     /db_xref="GeneID:11495134"
                     /db_xref="UniProtKB/TrEMBL:G0WA69"
                     /translation="MNITDEERQRRRREKFSNATTLKIKNDLLKDTSLLSRTTTDSNS
                     NINSLINDPMTRLNYLDQLEGLSNSHNGTDTTISLEHGLRKLREVIIKIYYENYKDGN
                     FVTFVKKVYFLSYKYFISSCKINELGGTILSFLYEHRYELDVPKEYIDVYHFYTSHFQ
                     KNLGKFMQEIAFNPNSSLVGNDRIIMRMALTYVKYSSCPSFWFQSLESYSEDSLVYEF
                     LTTSGIKKNMQIRCIDLASKCYNQLSLDFFKERWLGNTVLDPVGLRQLNDIYLLETRN
                     NGHQTIIFRKKNATPKAKQRIHNGIDKC"
     gene            <871909..>872898
                     /gene="NDAI0D03670"
                     /locus_tag="NDAI_0D03670"
                     /db_xref="GeneID:11495135"
     mRNA            <871909..>872898
                     /gene="NDAI0D03670"
                     /locus_tag="NDAI_0D03670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669876.1"
                     /db_xref="GeneID:11495135"
     CDS             871909..872898
                     /gene="NDAI0D03670"
                     /locus_tag="NDAI_0D03670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669924.1"
                     /db_xref="GeneID:11495135"
                     /db_xref="UniProtKB/TrEMBL:G0WA70"
                     /translation="MTRDQEDVGGKEVGTPFFSLQKSTTQQGIPLRRPFGKRNICQRW
                     EVLKGLVSGSTNITQEANMLTDNDWIMDEPFTFGISNDYSLAVIYRDYIMKHYLVSPE
                     YFVNHMGSDFPIDDIIREGNQHTLVVVGNRLEIQTAYLSCDIDEKGKHGLNDCPFFVP
                     NVKDLLVSMERVQAIIYKSDNYKKLQEMPFSPFQKSHSFDFLPPSPYSGLPIQAIFFH
                     CTELEAETYRELLVVYRNRVIRQHDPPTVERVMRLFLNPPYEIYVRPSFITGKDQESA
                     DEFSHQEHSSDVTCEERKTYQYYTALKGKNWLDMIKREKELEETFLDACGLRL"
     gene            <873415..>874572
                     /gene="NDAI0D03680"
                     /locus_tag="NDAI_0D03680"
                     /db_xref="GeneID:11495136"
     mRNA            <873415..>874572
                     /gene="NDAI0D03680"
                     /locus_tag="NDAI_0D03680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669877.1"
                     /db_xref="GeneID:11495136"
     CDS             873415..874572
                     /gene="NDAI0D03680"
                     /locus_tag="NDAI_0D03680"
                     /inference="similar to DNA sequence:INSDC:YGL025C"
                     /note="similar to Saccharomyces cerevisiae PGD1 (YGL025C);
                     ancestral locus Anc_4.93"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669925.1"
                     /db_xref="GeneID:11495136"
                     /db_xref="GOA:G0WA71"
                     /db_xref="InterPro:IPR020998"
                     /db_xref="UniProtKB/TrEMBL:G0WA71"
                     /translation="MQTSSESELSKLLTPKLTLDQLEDRLAGDIDNLDTTDLSDDSLP
                     KQVIANSLIETEKSILPLRLVFNKLIQTMATLDTMPEKSQQEMFLSIRNQLLDLYTKI
                     QEISTDFQHLQPLFGTIEEYSEKNNTKKFHMLETLKPIVEPAPATAKATKGDASHSKK
                     KSVAGTPGSVGNTPVGTTPGSSTGTVAANVPANINANTTNTSTTSAASTTQTTSSTAK
                     KPRKPRQNKKAAAKAQQQQQQQLLQQQQQQQIPKQQGIATNPMMNMNAMNATPMMNSV
                     SPSNVMGTPLNNGISPMGAVMAGGFYSQPPGSQSQQFDQQMNNGDHNTNNNNFQNMNN
                     ITPANILSMNTVGDPQSRMASSSQQYPTNNNNNNTLDLNNLDLSSLNMDFL"
     gene            <874927..>877362
                     /gene="NDAI0D03690"
                     /locus_tag="NDAI_0D03690"
                     /db_xref="GeneID:11495137"
     mRNA            <874927..>877362
                     /gene="NDAI0D03690"
                     /locus_tag="NDAI_0D03690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669878.1"
                     /db_xref="GeneID:11495137"
     CDS             874927..877362
                     /gene="NDAI0D03690"
                     /locus_tag="NDAI_0D03690"
                     /inference="similar to DNA sequence:INSDC:YGL027C"
                     /note="similar to Saccharomyces cerevisiae CWH41
                     (YGL027C); ancestral locus Anc_4.90"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669926.1"
                     /db_xref="GeneID:11495137"
                     /db_xref="GOA:G0WA72"
                     /db_xref="InterPro:IPR004888"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="UniProtKB/TrEMBL:G0WA72"
                     /translation="MVGINILTFCWLLFQSVAGSDDFENDVYEKSINQTLLWGPYRSN
                     CYFGITPRYIDESPFVMGLMWFDSHLTNGISSMRHFVDENDRMKKYGWNAFDPRIGGE
                     EVIIDEENNVNLSLSFVKSHDGLNWALRVKGKPLDLNKKSTTSIVLYMQQQGDANTNE
                     LLKTRDEEHFVLKGKSTQLGKYDISIKDNEGRYYKDPTLKSMKIAEGADCSQMSHLSL
                     NVPDHESWKARDIFQTIIGDSIKDIVQEQGSMDNFDNRLTPSLYQIRNIYNLPPGNFH
                     YVQKTFDLSDTEGFEFDMIFNSAQSKQRIESYNEISSLITSALNEINIKFDKIFTIDS
                     EEKRNFALETLSNLLGGIGYFHGTQIIDRTTVFDEDQFQEIKLINGKEEGPYSLFTSV
                     PSRSKFPRGFYWDEGFHLLQIMEYDLDLAFEIMASWVDLIDEDGWVAREVILGDEARS
                     RVPAEFTVQSPKIANPPTLLLAFSEMLQRVTGNVDNFHCDESTEDDTIGDFTQDGNRL
                     ENNPDLIKEYARKVYPKLLKHYNWFRRTQKGVIDEYSDIFEEEGIWDSIHKDEVFKWV
                     GRTATHCLPSGLDDYPRAPTPDIAELHVDALSWVGIMTRSMKQIANILNQENDEKLYA
                     QIESNIIENLETLHWNPKSGSYCDITIDEEYGDSREFICHDGYISLLPFALKLIPKDS
                     PNLDKVVSLIADEDKLFSPFGILSLSKQDEYFGRGENYWRGPIWMNINYLVLDALKYY
                     YPEITSTQKSKRTPAAKLCNELSNRLIKNVYRVWKHSGYCYENYSPIDGHGMGTEHFT
                     GWTALIVNILGRS"
     gene            <878340..>879875
                     /gene="NDAI0D03700"
                     /locus_tag="NDAI_0D03700"
                     /db_xref="GeneID:11495138"
     mRNA            <878340..>879875
                     /gene="NDAI0D03700"
                     /locus_tag="NDAI_0D03700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669879.1"
                     /db_xref="GeneID:11495138"
     CDS             878340..879875
                     /gene="NDAI0D03700"
                     /locus_tag="NDAI_0D03700"
                     /inference="similar to DNA sequence:INSDC:YGL028C"
                     /note="similar to Saccharomyces cerevisiae SCW11
                     (YGL028C); ancestral locus Anc_4.89"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669927.1"
                     /db_xref="GeneID:11495138"
                     /db_xref="GOA:G0WA73"
                     /db_xref="InterPro:IPR000490"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G0WA73"
                     /translation="MFSQIYLSTAFLLLLSFTNALPIFHRKQIVTRIHTASTTNTVTD
                     VYSTTTELIIAPMVEFIISGDVTLTTTLIPEGANPTAEPTTTITKILKKYITLASQTN
                     TLPTMTTTPLKAAATPSASSNHQHNSNNAQVSAQVTISNVNEVTTADVQSTEIKNQIT
                     ITSQLENNQQNNLQPTSTTQSQQPQTTTTQQTTSTTSTNAEEQVQQPTTTTSTTQENQ
                     QPVTTTTTQGDIQTTANSASNGNSGSALTSVPRALAYSPYNADGTCKSGDAVYSDLQA
                     MKEKGVSKIRVYGTDCNSFETIQPACNQLGIKINQGLWISSEGVDSIDSAVQMLITYG
                     QTNGWDVFDFITVGNEAIISGYCSVSELIAKISSVKVQLMAAGYTGQITTSEPPVTFE
                     NNPELCTTSEIDFVGINPHSYFDVNSNAESAGSFVKGQLELIQTTCGTSNVVITETGY
                     PSQGIQNGGNIPSVENQIIAVQKILDEMNQDVTILTYINDYWKAAGPYGIEQSFGISD
                     ILP"
     gene            881856..881947
                     /gene="NDAI0Dtrna3F"
                     /locus_tag="NDAI_0Dtrna3F"
                     /db_xref="GeneID:11494830"
     tRNA            join(881856..881893,881911..881947)
                     /gene="NDAI0Dtrna3F"
                     /locus_tag="NDAI_0Dtrna3F"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /db_xref="GeneID:11494830"
     gene            complement(<882153..>882647)
                     /gene="NDAI0D03710"
                     /locus_tag="NDAI_0D03710"
                     /db_xref="GeneID:11494819"
     mRNA            complement(join(<882153..882467,882645..>882647))
                     /gene="NDAI0D03710"
                     /locus_tag="NDAI_0D03710"
                     /product="ribosomal protein L30"
                     /transcript_id="XM_003669880.1"
                     /db_xref="GeneID:11494819"
     CDS             complement(join(882153..882467,882645..882647))
                     /gene="NDAI0D03710"
                     /locus_tag="NDAI_0D03710"
                     /inference="similar to DNA sequence:INSDC:YGL030W"
                     /note="similar to Saccharomyces cerevisiae RPL30
                     (YGL030W); ancestral locus Anc_4.85"
                     /codon_start=1
                     /product="ribosomal protein L30"
                     /protein_id="XP_003669928.1"
                     /db_xref="GeneID:11494819"
                     /db_xref="GOA:G0WA74"
                     /db_xref="InterPro:IPR000231"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR022991"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:G0WA74"
                     /translation="MAPVKTQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIII
                     AANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILT
                     TLA"
     gene            <883565..>884035
                     /gene="NDAI0D03720"
                     /locus_tag="NDAI_0D03720"
                     /db_xref="GeneID:11495140"
     mRNA            <883565..>884035
                     /gene="NDAI0D03720"
                     /locus_tag="NDAI_0D03720"
                     /product="ribosomal protein L24"
                     /transcript_id="XM_003669881.1"
                     /db_xref="GeneID:11495140"
     CDS             883565..884035
                     /gene="NDAI0D03720"
                     /locus_tag="NDAI_0D03720"
                     /inference="similar to DNA sequence:INSDC:YGL031C,YGR148C"
                     /note="similar to Saccharomyces cerevisiae RPL24A
                     (YGL031C) and RPL24B (YGR148C); ancestral locus Anc_4.84"
                     /codon_start=1
                     /product="ribosomal protein L24"
                     /protein_id="XP_003669929.1"
                     /db_xref="GeneID:11495140"
                     /db_xref="InterPro:IPR000988"
                     /db_xref="InterPro:IPR023441"
                     /db_xref="InterPro:IPR023442"
                     /db_xref="UniProtKB/TrEMBL:G0WA75"
                     /translation="MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRK
                     NPRRVAWTVLYRRHHKKGITEEVAKKRSRKAVKAQRPIVGASLDLIKERRSLKPRSKK
                     GSREEKKKRLIRKEKRTDKAARKTEKAKLAAAGGSKVSKQQAKGAFQKVAATSR"
     gene            <885094..>885354
                     /gene="NDAI0D03730"
                     /locus_tag="NDAI_0D03730"
                     /db_xref="GeneID:11495141"
     mRNA            <885094..>885354
                     /gene="NDAI0D03730"
                     /locus_tag="NDAI_0D03730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669882.1"
                     /db_xref="GeneID:11495141"
     CDS             885094..885354
                     /gene="NDAI0D03730"
                     /locus_tag="NDAI_0D03730"
                     /inference="similar to DNA sequence:INSDC:YGL032C"
                     /note="similar to Saccharomyces cerevisiae AGA2 (YGL032C);
                     ancestral locus Anc_4.83"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669930.1"
                     /db_xref="GeneID:11495141"
                     /db_xref="InterPro:IPR014404"
                     /db_xref="UniProtKB/TrEMBL:G0WA76"
                     /translation="MQLSILLPLISLIAPALAQTVSVSCETVPTGATVETTPYSSSTT
                     NIVQNGVTKIGVFEYYKSVTYVSNCDPNTSSKGALIVTQTIF"
     gene            complement(<885740..>886183)
                     /gene="NDAI0D03740"
                     /locus_tag="NDAI_0D03740"
                     /db_xref="GeneID:11495142"
     mRNA            complement(<885740..>886183)
                     /gene="NDAI0D03740"
                     /locus_tag="NDAI_0D03740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669883.1"
                     /db_xref="GeneID:11495142"
     CDS             complement(885740..886183)
                     /gene="NDAI0D03740"
                     /locus_tag="NDAI_0D03740"
                     /inference="similar to DNA sequence:INSDC:YGL033W"
                     /note="similar to Saccharomyces cerevisiae HOP2 (YGL033W);
                     ancestral locus Anc_4.81"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669931.1"
                     /db_xref="GeneID:11495142"
                     /db_xref="InterPro:IPR010776"
                     /db_xref="UniProtKB/TrEMBL:G0WA77"
                     /translation="MPIEDNIDPSKYSFEIISDLRSQLMELERKRNLLQDNLNNIHKY
                     PSNARLLDIIQERKEEMKTLTKRLHHLEEEENPENEKIIEELIESRRLAEKELAIRTR
                     MSLALLGVIKESVNPKSLHEFLVCFFDKFIFKKTCASLKYTNIHY"
     gene            <888448..>889929
                     /gene="NDAI0D03750"
                     /locus_tag="NDAI_0D03750"
                     /db_xref="GeneID:11495143"
     mRNA            <888448..>889929
                     /gene="NDAI0D03750"
                     /locus_tag="NDAI_0D03750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669884.1"
                     /db_xref="GeneID:11495143"
     CDS             888448..889929
                     /gene="NDAI0D03750"
                     /locus_tag="NDAI_0D03750"
                     /inference="similar to DNA sequence:INSDC:YGL035C"
                     /note="similar to Saccharomyces cerevisiae MIG1 (YGL035C);
                     ancestral locus Anc_4.80"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669932.1"
                     /db_xref="GeneID:11495143"
                     /db_xref="GOA:G0WA78"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0WA78"
                     /translation="MNMNNMQNNNIVPGTQTTDDASTLKSPKPRSRSSKGPDAPRPHV
                     CPVCQRAFHRLEHQTRHLRTHTGEKPNVCDFPGCIKRFSRSDELTRHKRIHTNPNPKG
                     KRGRKKKVVQQQIDADGTSSIDDTNNVETNTISPVSQGQISPHPTPQYPISNNISQRQ
                     LPNPNTNPTQTQNPRPILTSYGSSNGSSLNNSNNSSRLRLNVLSSLQMMTPLNSGIPK
                     SSFMDTPEYGSNRTNARNSGQSPLLSSMTSSLGIELPRPKSLTDFVAVSNNLNNSNNG
                     SYHFNQRNQVDPLMKVKRPNSVLSLNALLRKDNESDDEYGQETTIKNEDLLREPNDED
                     DDDDYLQIRSRKRSKTATPILSLSRSTSGTNLRSDVFMNMANNNSNTSIHTNFSNELN
                     SRLLHVQQQQQLQQQNQQFQNKVSGFTTPTPSTPLLMSPSLSNQMPSSGGTMPNVPTS
                     SSSTRLDTATINNNDTNSNNNSGNNSTALPPLRSLQLQFPTGP"
     gene            <891701..>892234
                     /gene="NDAI0D03760"
                     /locus_tag="NDAI_0D03760"
                     /db_xref="GeneID:11495144"
     mRNA            <891701..>892234
                     /gene="NDAI0D03760"
                     /locus_tag="NDAI_0D03760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669885.1"
                     /db_xref="GeneID:11495144"
     CDS             891701..892234
                     /gene="NDAI0D03760"
                     /locus_tag="NDAI_0D03760"
                     /inference="similar to DNA sequence:INSDC:YGR146C"
                     /note="similar to Saccharomyces cerevisiae YGR146C;
                     ancestral locus Anc_4.79"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669933.1"
                     /db_xref="GeneID:11495144"
                     /db_xref="InterPro:IPR024368"
                     /db_xref="UniProtKB/TrEMBL:G0WA79"
                     /translation="MSPFNDYCIVCEKLIVSTPSSFVNQLSNDHGNSNSNNNASSSNS
                     SISLSTLVESERLYCSESCRLKDANAQQQQQRSVLSLPPINNDEISTFALNSANKPNI
                     IINTTENKNTQSNNNIHDNTNIASSNNNGYNNNENGSLSVPTNYTVNTPLNGANLEES
                     DSLITSPLLLPKKITKT"
     gene            complement(<892761..>894716)
                     /gene="NDAI0D03770"
                     /locus_tag="NDAI_0D03770"
                     /db_xref="GeneID:11495145"
     mRNA            complement(<892761..>894716)
                     /gene="NDAI0D03770"
                     /locus_tag="NDAI_0D03770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669886.1"
                     /db_xref="GeneID:11495145"
     CDS             complement(892761..894716)
                     /gene="NDAI0D03770"
                     /locus_tag="NDAI_0D03770"
                     /inference="similar to DNA sequence:INSDC:YGR009C"
                     /note="similar to Saccharomyces cerevisiae SEC9 (YGR009C);
                     ancestral locus Anc_4.78"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669934.1"
                     /db_xref="GeneID:11495145"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:G0WA80"
                     /translation="MGIKKLLKLKPPEEETPDQNRETLQELGISTKNIHKKQKNRFAA
                     YGQFAKDRIGDKFFAPPGYEQYAPYNELPSESQNDHANDQGDTTLVNQEKDQEHHHHA
                     LKLFSKHKSKHGNGGCNSASTSPSGDDPYAVNTDACTYYNEPYKEVDKDYFNMLSSGP
                     TPSSKKYVDPYEPQVLRDSNTDLNASEIDDACSIPNGKNYTSLPSRLSGTENTAIPYT
                     NPSLSSRNVTPPPNSMNYESRHTNPYAILTPDKYTAATTTTPRINSNPGVSSPLAFDD
                     NPYTRASEVNRSLSKYIVESDGGLNQSELHLMDSTVENNEDDLNVTMDGIHDDYGDGD
                     GDGDDDVVDLNETIGENNLSGWQLQEQIENEGQEQTSDRVVSTYHPEKEAGSDHGGYG
                     TELNPNPGYQTFEQIQREEEARQQEEEDEEVDQVKQQIRYTKQSSVASTRNTLKMAHE
                     AEMAGMNTMGMLGHQSEVLNNTERNLDLIKVQNSVAEDKVEELKKINRSIFAVHAKNP
                     FNSKRRQMEREEKIRNEKVEQQLMMEETNKRLTDSTNRVAHALDDNGKDNNPSLIQEK
                     YKRQEILKRAKQYQFENDKEDDEMEVELDKNLDKIGQISSRLKNLAIASGEEVQSQTE
                     RLKNMEENTDTLDIKLQMNTSKLAGIR"
     gene            complement(<895256..>897379)
                     /gene="NDAI0D03780"
                     /locus_tag="NDAI_0D03780"
                     /db_xref="GeneID:11495146"
     mRNA            complement(<895256..>897379)
                     /gene="NDAI0D03780"
                     /locus_tag="NDAI_0D03780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669887.1"
                     /db_xref="GeneID:11495146"
     CDS             complement(895256..897379)
                     /gene="NDAI0D03780"
                     /locus_tag="NDAI_0D03780"
                     /inference="similar to DNA sequence:INSDC:YGR145W"
                     /note="similar to Saccharomyces cerevisiae ENP2 (YGR145W);
                     ancestral locus Anc_4.77"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669935.1"
                     /db_xref="GeneID:11495146"
                     /db_xref="GOA:G0WA81"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012580"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0WA81"
                     /translation="MVLKSTSASDVSVYQVSGTNSARSLPDWIAKKRKRSLKNDLEYQ
                     NRVELIQDFEFSEASNKIKVSPDGQYAMATGTYKPQIHVYDFANLSLKFDRHTDSENV
                     DFIMISDDWTKSVHLQNDRSIQFQNKGGLHHTTRIPKFGRSLAYNKVNCDLFVGASGN
                     ELYRLNLEQGRFLNPFKTDTEGVNHVSISDANGLISVGMEDNVVEFWDPRARSRVAKL
                     FLENELENSSFQVTTTSFRKDGLNFACGTSNGYTYLYDLRTSAPTTVKDQGYGFEIKK
                     IIWLDDVGTENKILTSDKRIAKIWDRVDGKAYASMEPNVDINDIEHLPGTGMFFTANE
                     GIPMHTYYIPNLGPSPRWCSFLDSITEELEEKPSDSIYSNYRFITRTDVKKLSLSHLI
                     GSNVLRAYMHGFFIDTELYDKVALIANPNAYKDEREREIRRRIEKERESRIRTSGAVV
                     KPKIKVNKSLVDKLSQKRGDKAVEKVLTDDRFKEMFEDEDFQVDEDAYDYKQLNPVKS
                     ARETEEGAAKRIRALTAAEESDEERIAIREGKYDSNDEDESSEEEEDDEEEDDEEEGE
                     RKTNKPSEKDKKTIQKQLKSIERRKKAKQESDKFINEMSVGATASQEQTTGKVTFADQ
                     VQELNAEEQERKSDESILHRNHRGEAELTFVPKKTKKPKKVKKQNGSGSDDDEDDDEN
                     KRDNGRTKQRYDSRRRASKNVFRGM"
     gene            complement(<897790..>900690)
                     /gene="NDAI0D03790"
                     /locus_tag="NDAI_0D03790"
                     /db_xref="GeneID:11495147"
     mRNA            complement(<897790..>900690)
                     /gene="NDAI0D03790"
                     /locus_tag="NDAI_0D03790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669888.1"
                     /db_xref="GeneID:11495147"
     CDS             complement(897790..900690)
                     /gene="NDAI0D03790"
                     /locus_tag="NDAI_0D03790"
                     /inference="similar to DNA sequence:INSDC:YGL036W"
                     /note="similar to Saccharomyces cerevisiae YGL036W;
                     ancestral locus Anc_4.76"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669936.1"
                     /db_xref="GeneID:11495147"
                     /db_xref="UniProtKB/TrEMBL:G0WA82"
                     /translation="MHRREPRSNNDTPRSCDEKEESYLSTDSNIAPARNQVSEQTVNH
                     LIESLINAFQNINNPDLNISKLILNIINSLKYLPFQEKSFRIDLKNVDIFTPILKTDN
                     NDEFIFDENYNYKLDLFSILFAYCSIHKSLHEFIIDSWDNWYHLLLNSQSTIVSDNEE
                     LGFYTVINKIEQFECLTPDLLNYFNFNLINPLINSWIPKWKSFIDLGDSPSTTLSSLS
                     SSPTLLSSPYPNNKNSNIYSDSRLLTTVLNVTSIDFFIATSIITLKYDVFNLNTTKDG
                     EQQQTYNPFIVYELSKRISMFPKLIPNTIYLNALDLIISKGVTPSTISSVRKNEVIEN
                     SHEQGIKNHKDDLTFHLKVIMEFIDHPELNYLKEPRLVLLLQIALQNISNHIPIHILH
                     KTLSSMGSTQTLIAIFNMAQFLLAKFLIDLENCSQYSDTNSISNSKSNVMSNTDIIVP
                     PWFDEVMIPPIPPISKSLFIFEAKLDDDDIDPLFQLSGNNSFKNIISSLLESLNLIII
                     INKNILSQYKALSINPLDLQNNYANKAETADAKNTKNNKDNVYISNNDRNKVDPSIRL
                     LTNEKYMEICFIPIISCFLLSDLLKNNQRKNTSLGLSLIANTTKALEALIELHGNMSL
                     FHLIKFIEKISMEDLSLQKVSINLLNHLFFHNASNPDYIKQLCLQNELTTQALNKYIS
                     SWNDGSEDYKNFFEILFDTKQPTFDNENVRPTLSSIIDLVKQLPDFADKFGSLDLSVS
                     SKATVANNSMLRTNINVNKNNKNTIEQASPIQPVPNRLGVSKPFISSTTSSSSTKYDA
                     YTTSSFIPSNKSFPSPMVSSANSTTNKYMYSAGATGIDNHGGHMTMTMTSAPVPVDTF
                     SSQRMDMHNAVPHRNNLSDEIMNNSISNMPKTPTSMASNNTSTTSSNINTTATTNNSN
                     NKNSTLWNESPGFSSSKMVNTGKNYILGGHNRVRNNSRAQSIHIDEFEQQQY"
     gene            <902627..>903268
                     /gene="NDAI0D03800"
                     /locus_tag="NDAI_0D03800"
                     /db_xref="GeneID:11495148"
     mRNA            <902627..>903268
                     /gene="NDAI0D03800"
                     /locus_tag="NDAI_0D03800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669889.1"
                     /db_xref="GeneID:11495148"
     CDS             902627..903268
                     /gene="NDAI0D03800"
                     /locus_tag="NDAI_0D03800"
                     /inference="similar to DNA sequence:INSDC:YGL037C"
                     /note="similar to Saccharomyces cerevisiae PNC1 (YGL037C);
                     ancestral locus Anc_4.75"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669937.1"
                     /db_xref="GeneID:11495148"
                     /db_xref="GOA:G0WA83"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="UniProtKB/TrEMBL:G0WA83"
                     /translation="MKALLIIDVQNDFLPPNGTLAVPHGDEIVHPILELIHDEKQDWH
                     RVVMTRDWHPKNHISFAKRHNQEPYSKITYKSPKPGDKTTQEGVLWPVHCIQNTRGSQ
                     LADPLLKETYKNHYKIVDKGFLSDREYYSAFHDIWNFHKTELHEYLQKHHITEVYIVG
                     LALDYCVKETAISAAKLGYKTTILKDYTKPVNSDDESMMKLKEEFNSYNIKLD"
     gene            <906005..>907204
                     /gene="NDAI0D03810"
                     /locus_tag="NDAI_0D03810"
                     /db_xref="GeneID:11495149"
     mRNA            <906005..>907204
                     /gene="NDAI0D03810"
                     /locus_tag="NDAI_0D03810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669890.1"
                     /db_xref="GeneID:11495149"
     CDS             906005..907204
                     /gene="NDAI0D03810"
                     /locus_tag="NDAI_0D03810"
                     /inference="similar to DNA sequence:INSDC:YGL038C"
                     /note="similar to Saccharomyces cerevisiae OCH1 (YGL038C);
                     ancestral locus Anc_4.74"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669938.1"
                     /db_xref="GeneID:11495149"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G0WA84"
                     /translation="MFPYDTQKPIPRKIWQTWKVSTNDPTFPSNFRNFQQKWSLAAKE
                     TENSTPSEEKFQYSLITDDNIESLLNNVYGEAPLVIDAFQLMPNNILKADFFRYLILY
                     ARGGIYSDMDTIPLKELKDWPSLSSSSSPSLFSSAPIPYKGFIPSSPSASVSPSASSR
                     KEPGLVIGIEADPDREDWKKWYARRIQFCQWTIQSKPGHPILRELILNITSTTLNSVP
                     HSNLKKIRNSMIDSTVKNDYNINYRDKRRDDKNYKHDSLKTFDNVDGSDIMNWTGPGI
                     FSDIIFEYMNNLVKTNSDIILINSNYVVIPNLRPQLMRRIMKNQQKNNHTKIENSLNL
                     KRLIPWEFFTLITEPVLVDDIMVLPITSFSPDVGQMEAKSSTDEMAFVKHMFEGSWKE
                     EADSNKK"
     gene            907696..907768
                     /gene="NDAI0Dtrna4A"
                     /locus_tag="NDAI_0Dtrna4A"
                     /db_xref="GeneID:11495150"
     tRNA            907696..907768
                     /gene="NDAI0Dtrna4A"
                     /locus_tag="NDAI_0Dtrna4A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCA"
                     /db_xref="GeneID:11495150"
     gene            complement(<908209..>909015)
                     /gene="NDAI0D03820"
                     /locus_tag="NDAI_0D03820"
                     /db_xref="GeneID:11494821"
     mRNA            complement(<908209..>909015)
                     /gene="NDAI0D03820"
                     /locus_tag="NDAI_0D03820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669891.1"
                     /db_xref="GeneID:11494821"
     CDS             complement(908209..909015)
                     /gene="NDAI0D03820"
                     /locus_tag="NDAI_0D03820"
                     /inference="similar to DNA sequence:INSDC:YGR152C"
                     /note="similar to Saccharomyces cerevisiae RSR1 (YGR152C);
                     ancestral locus Anc_4.73"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669939.1"
                     /db_xref="GeneID:11494821"
                     /db_xref="GOA:G0WA85"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WA85"
                     /translation="MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYRKTI
                     EIDNKVFDLEILDTAGVAQFTAMRELYIKSGMGFLLVYSVTDRQSLDELMELREQVLR
                     IKDSSKVPMVLVGNKADLNDERVISVEEGIEVSSTWGKVPFYETSALLRSNVDEVFVD
                     LVRQIMRNEMESIANAEIRNPSMQRRNGSSTNPSPVARSGARQQQQQQLRNQEPNSTI
                     EGNATSRTKPQRSGQKAVSGQQLSSTNAVNSSSDKKASDTAKSSGCCVIS"
     gene            complement(910236..910314)
                     /gene="NDAI0Dtrna10L"
                     /locus_tag="NDAI_0Dtrna10L"
                     /db_xref="GeneID:11495139"
     tRNA            complement(join(910236..910280,910236..910314))
                     /gene="NDAI0Dtrna10L"
                     /locus_tag="NDAI_0Dtrna10L"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUG"
                     /db_xref="GeneID:11495139"
     gene            <912331..>913353
                     /gene="NDAI0D03830"
                     /locus_tag="NDAI_0D03830"
                     /db_xref="GeneID:11494815"
     mRNA            <912331..>913353
                     /gene="NDAI0D03830"
                     /locus_tag="NDAI_0D03830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669892.1"
                     /db_xref="GeneID:11494815"
     CDS             912331..913353
                     /gene="NDAI0D03830"
                     /locus_tag="NDAI_0D03830"
                     /inference="similar to DNA sequence:INSDC:YGL040C"
                     /note="similar to Saccharomyces cerevisiae HEM2 (YGL040C);
                     ancestral locus Anc_4.70"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669940.1"
                     /db_xref="GeneID:11494815"
                     /db_xref="GOA:G0WA86"
                     /db_xref="InterPro:IPR001731"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G0WA86"
                     /translation="MHTAEFLDIDRTDISSVLAGGYNHPLLREWQNERQLTKNMLIFP
                     LFISDNEDDCCAIESLPNIKRFGVNKLKEYMKPLVAKGLRSVILFGVPLKEGSKDPVG
                     TSADDPQGPVIQAIKLLRREFPDLYIMCDVCLCEYTSHGHCGVLYDDGTINREKSVAR
                     IAAVAVNYAKAGAHCVAPSDMIDGRIKEIKRGLINAGLAHKTFVLSYSAKFSGNLYGP
                     FRDAACSAPSSGDRKCYQLPSGGRGLARRALRRDLGEGADGIIVKPSTFYLDIMRDAS
                     EICNDLPICAYHVSGEYAMLHAAAEKGIIDLKTMAFESHQGFLRAGARLIITYFAPQF
                     LEWLDN"
     gene            <913796..>914635
                     /gene="NDAI0D03840"
                     /locus_tag="NDAI_0D03840"
                     /db_xref="GeneID:11495152"
     mRNA            <913796..>914635
                     /gene="NDAI0D03840"
                     /locus_tag="NDAI_0D03840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669893.1"
                     /db_xref="GeneID:11495152"
     CDS             913796..914635
                     /gene="NDAI0D03840"
                     /locus_tag="NDAI_0D03840"
                     /inference="similar to DNA sequence:INSDC:YGR017W"
                     /note="similar to Saccharomyces cerevisiae YGR017W;
                     ancestral locus Anc_4.154"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669941.1"
                     /db_xref="GeneID:11495152"
                     /db_xref="GOA:G0WA87"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="InterPro:IPR024624"
                     /db_xref="UniProtKB/TrEMBL:G0WA87"
                     /translation="MPSQMAPWVPTFIQSCKNNTQQPFTPFQFATIDAVNNLPRVRTV
                     VFRDFLFHDKQTNILTFNSDLRSHKLCGNTASTPFESCFYFPQTWEQYRLTGQCFVIS
                     NNKEKNHIPKSIVRKYALFSSHRDCHMQGQSEVEENGEEQEAEEECEEGENYGNDESY
                     EDYEEEEEDDLLCEEDWHAEVKRQWESLSRSSKSLYRKPAPGSPLTTETSKKLDKLQR
                     GVDGAKEDDGLENFGIICLCIDSVDYLNLKDGRGGERWIYKRMSEGDCSDTEAWEEEE
                     VCP"
     gene            <915736..>917160
                     /gene="NDAI0D03850"
                     /locus_tag="NDAI_0D03850"
                     /db_xref="GeneID:11495153"
     mRNA            <915736..>917160
                     /gene="NDAI0D03850"
                     /locus_tag="NDAI_0D03850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669894.1"
                     /db_xref="GeneID:11495153"
     CDS             915736..917160
                     /gene="NDAI0D03850"
                     /locus_tag="NDAI_0D03850"
                     /inference="similar to DNA sequence:INSDC:YGR019W"
                     /note="similar to Saccharomyces cerevisiae UGA1 (YGR019W);
                     ancestral locus Anc_4.155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669942.1"
                     /db_xref="GeneID:11495153"
                     /db_xref="GOA:G0WA88"
                     /db_xref="InterPro:IPR004631"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G0WA88"
                     /translation="MTPAESYYPTEPSVPTVLTETVPGQFTLKAMSQLGEVFDVRPSY
                     FVADFEKSIGNYIVDVDGNTYLDLYAQIASIALGYNNPALIEVAKSPEMIRALVDRPA
                     LGNFPSKDLESMLKQILKFAPKGQDHVWSGLSGADANELAFKAAFMYYKNKQRQGKDF
                     TKEENESVMNNLPPGSPDLAVLSFKRAFHGRLFASGSATCSKPIHKLDLPAFRWPHAE
                     FPSYKYPLGDKANAEFNQREDDRCLKNVEELIKTWPIPVAALLIEPIQSEGGDNHASK
                     YFLQGLRDLTLKYNVVYIIDEVQTGVGSTGKFWCHEYADITPPVDLVTFSKKFQSAGY
                     FFHDPAFIPSAPYRQFNTWCGEPARMLIAGAIGEEIVKNDLLSQCSRVGAYMFKKLEG
                     LQKEHPTLFHNLRGKDRGTFIAWDLPSSEQRDLLLKTLRANGCNVGGCSTNAVRLRPS
                     LTFEEKHCDIFINVLAKSIAQVLV"
     gene            complement(<917381..>917746)
                     /gene="NDAI0D03860"
                     /locus_tag="NDAI_0D03860"
                     /db_xref="GeneID:11495154"
     mRNA            complement(<917381..>917746)
                     /gene="NDAI0D03860"
                     /locus_tag="NDAI_0D03860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669895.1"
                     /db_xref="GeneID:11495154"
     CDS             complement(917381..917746)
                     /gene="NDAI0D03860"
                     /locus_tag="NDAI_0D03860"
                     /inference="similar to DNA sequence:INSDC:YGR020C"
                     /note="similar to Saccharomyces cerevisiae VMA7 (YGR020C);
                     ancestral locus Anc_4.157"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669943.1"
                     /db_xref="GeneID:11495154"
                     /db_xref="GOA:G0WA89"
                     /db_xref="InterPro:IPR005772"
                     /db_xref="InterPro:IPR008218"
                     /db_xref="UniProtKB/TrEMBL:G0WA89"
                     /translation="MADKRTLIAVIGDEDTTTGLLLAGIGQVTNNNSNLTDKNFFIYQ
                     DGKTTREEVSKIFEHYTEERNDIAILLINQHVAEIIRSQVDSFVNPFPAILEIPSKDH
                     PYDPEKDSVLKRVRKLFGE"
     gene            <918130..>919095
                     /gene="NDAI0D03870"
                     /locus_tag="NDAI_0D03870"
                     /db_xref="GeneID:11495001"
     mRNA            <918130..>919095
                     /gene="NDAI0D03870"
                     /locus_tag="NDAI_0D03870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669896.1"
                     /db_xref="GeneID:11495001"
     CDS             918130..919095
                     /gene="NDAI0D03870"
                     /locus_tag="NDAI_0D03870"
                     /inference="similar to DNA sequence:INSDC:YGR021W"
                     /note="similar to Saccharomyces cerevisiae YGR021W;
                     ancestral locus Anc_4.158"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669944.1"
                     /db_xref="GeneID:11495001"
                     /db_xref="InterPro:IPR002876"
                     /db_xref="InterPro:IPR017856"
                     /db_xref="InterPro:IPR026563"
                     /db_xref="InterPro:IPR026564"
                     /db_xref="InterPro:IPR029072"
                     /db_xref="UniProtKB/TrEMBL:G0WA90"
                     /translation="MLQRILKRGPCYVKRTAQALGLASRTFNTLNNITHSGHNKWSTI
                     KHQKMKNDAIKNKAANKISLQITSAVKANDTTSLNNLVELAMKSNIPKRVVENAINKG
                     KIGTIGDGSENNNLCMYEGIGPGGVAFVVECSTDNKNRTVGLVRSAFLKANGSMTPTS
                     YLFDVKGYLLVVPPKELDNEEKVFEKSIEIDGIEDIELLKGEEEGDENRDSTTIRSVS
                     DTKQGVDNNENLAGEKYYEIIVGDPADTSQVANELQREGFTIEQQIGNKYIAKDDMKV
                     NIDDENVMERLQKLISQLEAIDEFRGFYTNCDAVQQSFKTPLAQA"
     gene            <920461..>922215
                     /gene="NDAI0D03880"
                     /locus_tag="NDAI_0D03880"
                     /db_xref="GeneID:11495002"
     mRNA            <920461..>922215
                     /gene="NDAI0D03880"
                     /locus_tag="NDAI_0D03880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669897.1"
                     /db_xref="GeneID:11495002"
     CDS             920461..922215
                     /gene="NDAI0D03880"
                     /locus_tag="NDAI_0D03880"
                     /inference="similar to DNA sequence:INSDC:YGR023W,YLR332W"
                     /note="similar to Saccharomyces cerevisiae MTL1 (YGR023W)
                     and MID2 (YLR332W); ancestral locus Anc_4.159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669945.1"
                     /db_xref="GeneID:11495002"
                     /db_xref="InterPro:IPR007567"
                     /db_xref="UniProtKB/TrEMBL:G0WA91"
                     /translation="MICNKKRILLYASLLHIVTSQEFIIPPAGNETTTTSLESTLPPS
                     IPSPIISSITELSTSSSSPSVQVVPPTSSDTPQTSLSSSSSSLYAQLSSTTPLPASSS
                     LGPLLISSSTIPTTTFSSSSNIVSSRSTSSIIIASPSFTSIASPSSSTSSDTSSSSIT
                     TTSTWYRSITTTTSTSSSLPIISSTSSLIISSSTSSATIQSTSSSSTRRIFSSSSSSF
                     SSSSSLPSRTTSSSRRSSSTSRTSRIISSSISSSTSRISSSSSSSSTTSSSSFTVSST
                     TTSASTSSSPTLSLDLRKTVTSIIHGKTILSNYYTTITYTPTATANSSNSKNSHSGLT
                     KKNRNIVLGCVLGIGIPLLLLIGLILYHFCIKSKSTNFIDSDGKVITAYKTNNLHKLW
                     NLLIGKKNNNEEYHSNLPLGSRNNDGGENGYNFDNDDILVQRNIRNDDGSDMPSQISI
                     DNSNIMHTYVDNDDNIDTTTTMNHKNMEPYDTFVHGAPGADTTTSTDNTNSTSRSDSS
                     QSNKLMIQEEKIYNNNDEDEDDNQNSFNDNEATNNINIHNNNNENNSVNDDDNYDDDD
                     DEDEDTRHNRTGFTITNL"
     gene            923127..923198
                     /gene="NDAI0Dtrna7D"
                     /locus_tag="NDAI_0Dtrna7D"
                     /db_xref="GeneID:11495003"
     tRNA            923127..923198
                     /gene="NDAI0Dtrna7D"
                     /locus_tag="NDAI_0Dtrna7D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:11495003"
     gene            <923519..>924718
                     /gene="NDAI0D03890"
                     /locus_tag="NDAI_0D03890"
                     /db_xref="GeneID:11494834"
     mRNA            <923519..>924718
                     /gene="NDAI0D03890"
                     /locus_tag="NDAI_0D03890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669898.1"
                     /db_xref="GeneID:11494834"
     CDS             923519..924718
                     /gene="NDAI0D03890"
                     /locus_tag="NDAI_0D03890"
                     /note="ancestral locus Anc_4.160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669946.1"
                     /db_xref="GeneID:11494834"
                     /db_xref="UniProtKB/TrEMBL:G0WA92"
                     /translation="MTTIPVYKCSLAEVIHAYTTTPKYLIVAQSTLNNPFEVHLHYST
                     HADSGIVVPNKTFKYPIHISRRITPGINYTTTVKRLEITETPILEKSKKALKTIVYNL
                     IIVCIDGIRITTLENLVEPEYSQLNEWVLPNKNDSISSFYCQSRKNGTIEIVLGTTFC
                     SIVHLLFYIETGTFRNLDLQKGTALYTIDELISDSVVSICGLRSPSKGSNFPCTNENE
                     LITRNSFTDALSVATVDGKVHIVSKNKSEVHDFLESILPDENKEHNVTAADSVIAKEF
                     MNSSLIFVVANITNVGCIIFEKSKRRWEQLEILERDHNAIEDTPLLDHILSLNVDMNE
                     FIIYSGSVNGKLYQWTYNYKDYQLISSSVFEENIYNVVHSISMEGNARKLFFIHNDDT
                     CINYIQL"
     gene            complement(<924753..>925466)
                     /gene="NDAI0D03900"
                     /locus_tag="NDAI_0D03900"
                     /db_xref="GeneID:11495004"
     mRNA            complement(<924753..>925466)
                     /gene="NDAI0D03900"
                     /locus_tag="NDAI_0D03900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669899.1"
                     /db_xref="GeneID:11495004"
     CDS             complement(924753..925466)
                     /gene="NDAI0D03900"
                     /locus_tag="NDAI_0D03900"
                     /inference="similar to DNA sequence:INSDC:YGR024C"
                     /note="similar to Saccharomyces cerevisiae THG1 (YGR024C);
                     ancestral locus Anc_4.161"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669947.1"
                     /db_xref="GeneID:11495004"
                     /db_xref="GOA:G0WA93"
                     /db_xref="InterPro:IPR007537"
                     /db_xref="InterPro:IPR024956"
                     /db_xref="InterPro:IPR025845"
                     /db_xref="UniProtKB/TrEMBL:G0WA93"
                     /translation="MAKSRFEYVREFESHDVLLPQCYIVVRIDGKKFHEFSKYYEFAK
                     PNDDRALKLMNAAAKNVVLQYRNDVILAYGESDEYSFILKSDTSLFNRRRDKISSLFV
                     SLFTSNYVTLWPKFFVGVELHPKHLPFFDSRCVQYPNLKAIKDYLSWRFVDTHINNLY
                     NTAFWKLIQVCGMNPREAENRLSGTYSSGKQEILFKDCGINYNNEPEMYKKGSLITRK
                     GEILHIDVIKMIDDLFVGF"
     gene            <925793..>926623
                     /gene="NDAI0D03910"
                     /locus_tag="NDAI_0D03910"
                     /db_xref="GeneID:11495005"
     mRNA            <925793..>926623
                     /gene="NDAI0D03910"
                     /locus_tag="NDAI_0D03910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669900.1"
                     /db_xref="GeneID:11495005"
     CDS             925793..926623
                     /gene="NDAI0D03910"
                     /locus_tag="NDAI_0D03910"
                     /inference="similar to DNA sequence:INSDC:YGR026W"
                     /note="similar to Saccharomyces cerevisiae YGR026W;
                     ancestral locus Anc_4.162"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669948.1"
                     /db_xref="GeneID:11495005"
                     /db_xref="UniProtKB/TrEMBL:G0WA94"
                     /translation="MAGTIKIIRKKDPKKADPLARQKLIWTVGHTMTLVFGALFTLTY
                     FFHVLLFFKYRSWKWLFLRVKKNYSIIKGTRWYHTILRWSPQLLYRLSLIGVFTSGSV
                     TMFQNWNGLNPTWYDLLSSSNFQAMLMALLWFLGGGKSFYKLLPFMILSYMHLLDKDN
                     EFNTESKKKEDQLTMANVHLLHLVSYSEIFIVIALVLDTLLMKNGSSGIMLVIYLGIY
                     WLRLNFSPYAQITLLRILSKFDKKIPPKHKNNWDTIKRFIYAKMKAHERRLQEVGRTA
                     "
     gene            complement(<927114..>927440)
                     /gene="NDAI0D03920"
                     /locus_tag="NDAI_0D03920"
                     /db_xref="GeneID:11495006"
     mRNA            complement(<927114..>927440)
                     /gene="NDAI0D03920"
                     /locus_tag="NDAI_0D03920"
                     /product="ribosomal protein S25"
                     /transcript_id="XM_003669901.1"
                     /db_xref="GeneID:11495006"
     CDS             complement(927114..927440)
                     /gene="NDAI0D03920"
                     /locus_tag="NDAI_0D03920"
                     /inference="similar to DNA sequence:INSDC:YGR027C,YLR333C"
                     /note="similar to Saccharomyces cerevisiae RPS25A
                     (YGR027C) and RPS25B (YLR333C); ancestral locus Anc_4.163"
                     /codon_start=1
                     /product="ribosomal protein S25"
                     /protein_id="XP_003669949.1"
                     /db_xref="GeneID:11495006"
                     /db_xref="InterPro:IPR004977"
                     /db_xref="UniProtKB/TrEMBL:G0WGX4"
                     /translation="MPPKQQLSKAAKAAAAMAGGKKSKKKWSKNNHKDKAQHAVILDQ
                     EKLDRIMKEVPTYRYVSVSVLVDRLKIGGSMARVALRDLEKQGIIKPVSKHSKQAIYT
                     RAVASE"
     gene            <928651..>929715
                     /gene="NDAI0D03930"
                     /locus_tag="NDAI_0D03930"
                     /db_xref="GeneID:11495007"
     mRNA            <928651..>929715
                     /gene="NDAI0D03930"
                     /locus_tag="NDAI_0D03930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669902.1"
                     /db_xref="GeneID:11495007"
     CDS             928651..929715
                     /gene="NDAI0D03930"
                     /locus_tag="NDAI_0D03930"
                     /inference="similar to DNA sequence:INSDC:YGR028W"
                     /note="similar to Saccharomyces cerevisiae MSP1 (YGR028W);
                     ancestral locus Anc_4.166"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669950.1"
                     /db_xref="GeneID:11495007"
                     /db_xref="GOA:G0WA96"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WA96"
                     /translation="MPNKIDLKTITDWSVLIGTGISIYYLCSRLLNDAEIGPLGRSKE
                     SRQRQETQWKRLCEKSPDFANLELNAYEQSILASVITPEEINITFEDIGGLDHIVSEL
                     NESVIYPLTMPELYTNGSLLQAPSGVLLYGPPGCGKTMLAKSLALESGANFISVRMST
                     LMDKYYGESNKMVDALFSLANKIEPCIIFIDEIDSVLRERTSFDHEVTANLKAEFMTL
                     WDGLISSRRIMVVGATNRINDIDDAFLRRLPKRFYISLPNAEQRSHILQVLLKGTELD
                     DEFDLEAVVARTDGMSGSDLKELCREAALKAAKEYIKKKRMQAKEGETNPDATLLKVR
                     PLRTSDFTGVNEEPNNLGLD"
     gene            <930509..>931172
                     /gene="NDAI0D03940"
                     /locus_tag="NDAI_0D03940"
                     /db_xref="GeneID:11495008"
     mRNA            join(<930509..930576,930647..>931172)
                     /gene="NDAI0D03940"
                     /locus_tag="NDAI_0D03940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669903.1"
                     /db_xref="GeneID:11495008"
     CDS             join(930509..930576,930647..931172)
                     /gene="NDAI0D03940"
                     /locus_tag="NDAI_0D03940"
                     /inference="similar to DNA sequence:INSDC:YGR029W"
                     /note="similar to Saccharomyces cerevisiae ERV1 (YGR029W);
                     ancestral locus Anc_4.167"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669951.1"
                     /db_xref="GeneID:11495008"
                     /db_xref="GOA:G0WA97"
                     /db_xref="InterPro:IPR017905"
                     /db_xref="UniProtKB/TrEMBL:G0WA97"
                     /translation="MEKIPDGQHENIAEPAIKENVKFCLPCIAFKTFRQVGITISESV
                     KTFMQDHEKVDPKSPPPSISLPINATVQTRQPIETDLIPGSRTYTREDPPDVQNLGAS
                     SWTFLHAMTAKYPGNPSDTQKMEMERFLTLFSHVYPCNWCAKDFEKFIQDNSPKVESR
                     EELGRWMCEAHNHVNGKLNKPKFNCDFWEKRWKDGWD"
     gene            complement(<932008..>932490)
                     /gene="NDAI0D03950"
                     /locus_tag="NDAI_0D03950"
                     /db_xref="GeneID:11495009"
     mRNA            complement(<932008..>932490)
                     /gene="NDAI0D03950"
                     /locus_tag="NDAI_0D03950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669904.1"
                     /db_xref="GeneID:11495009"
     CDS             complement(932008..932490)
                     /gene="NDAI0D03950"
                     /locus_tag="NDAI_0D03950"
                     /inference="similar to DNA sequence:INSDC:YGR030C"
                     /note="similar to Saccharomyces cerevisiae POP6 (YGR030C);
                     ancestral locus Anc_4.169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669952.1"
                     /db_xref="GeneID:11495009"
                     /db_xref="GOA:G0WA98"
                     /db_xref="InterPro:IPR002775"
                     /db_xref="InterPro:IPR020224"
                     /db_xref="UniProtKB/TrEMBL:G0WA98"
                     /translation="MKTARVQYKRNETDLDISTQTQCFQFIQEKIIPDLLNLNADFDR
                     SKINYFKISKNDNIKQKVEKLQTVTSGECVCAYAYGPHLQKMLSILEICKNVVKKNDL
                     EGSISQWNHLTCFELVQEGRNELLEKKINVPILISVITANSALASSIEFNTNKWTKQS
                     "
     gene            <932976..>933914
                     /gene="NDAI0D03960"
                     /locus_tag="NDAI_0D03960"
                     /db_xref="GeneID:11495010"
     mRNA            <932976..>933914
                     /gene="NDAI0D03960"
                     /locus_tag="NDAI_0D03960"
                     /product="ribosomal protein P0"
                     /transcript_id="XM_003669905.1"
                     /db_xref="GeneID:11495010"
     CDS             932976..933914
                     /gene="NDAI0D03960"
                     /locus_tag="NDAI_0D03960"
                     /inference="similar to DNA sequence:INSDC:YLR340W"
                     /note="similar to Saccharomyces cerevisiae RPP0 (YLR340W);
                     ancestral locus Anc_4.170"
                     /codon_start=1
                     /product="ribosomal protein P0"
                     /protein_id="XP_003669953.1"
                     /db_xref="GeneID:11495010"
                     /db_xref="GOA:G0WA99"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="UniProtKB/TrEMBL:G0WA99"
                     /translation="MGGVREKKVEYFAKLRSYLEEYKSIFIVGVDNVSSQQMHEVRKE
                     LRGRGVVLMGKNTMVRTAIRGLIGESSDFEKLLPFIKGNVGFVFTNASLQDIKEVIIS
                     NKVAAPARAGAIAPEDIWVRAVNTGMEPGKTSFFQALGVPTKIARGTIEIVSDVKVVD
                     AGQKVGQSEASLLNLLEISPFSFGLSIVQVYDNGQIFPSSILDITDDELVGHFVSAVS
                     TIASISLAIGYPTLPSVGHTLINNYKDLLAVAIGSGYHFAEIEELVDRIENPDKYASA
                     APAAAAASSGDAAPAEEAAAEDEESEDEDMGFGLFD"
     gene            <934277..>935368
                     /gene="NDAI0D03970"
                     /locus_tag="NDAI_0D03970"
                     /db_xref="GeneID:11495011"
     mRNA            <934277..>935368
                     /gene="NDAI0D03970"
                     /locus_tag="NDAI_0D03970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669906.1"
                     /db_xref="GeneID:11495011"
     CDS             934277..935368
                     /gene="NDAI0D03970"
                     /locus_tag="NDAI_0D03970"
                     /inference="similar to DNA sequence:INSDC:YGR031W"
                     /note="similar to Saccharomyces cerevisiae YGR031W;
                     ancestral locus Anc_4.172"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669954.1"
                     /db_xref="GeneID:11495011"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0WAA0"
                     /translation="MLLMVTLYIRKVEITLKRQRLPVRSNIMSTVFYRPFTHHFHFAK
                     PFKRSLLYNRSRHISYFSDDYFKPLSDLDNDLMTDNIPAVELSFDHIKAKHGSGKKAP
                     FIILHGFFGNKTNNRTLGRGLNEQLNRDIYLLDLRNHGRSPHMERHDYTSMAHDVELF
                     IEKHMTPDIKPIIIGHSMGAKVGMSIVLRKPSISSMLVNIENAPVSKVPEDTFPRYIR
                     QLLRICNNPDIKTMDDVDEKLKEVEQTASVRQFLMTNLTRKKNLETSEYAIKSRIPLD
                     ILNDSVIKGNISGWEFDPNFHQWKGPTLFIRGTESNYITDEYLPTIGLFFPRFEVRDV
                     QGAGHWVNSENPNKCVEYISEFVERHEDL"
     gene            <936521..>942043
                     /gene="NDAI0D03980"
                     /locus_tag="NDAI_0D03980"
                     /db_xref="GeneID:11495012"
     mRNA            <936521..>942043
                     /gene="NDAI0D03980"
                     /locus_tag="NDAI_0D03980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669907.1"
                     /db_xref="GeneID:11495012"
     CDS             936521..942043
                     /gene="NDAI0D03980"
                     /locus_tag="NDAI_0D03980"
                     /inference="similar to DNA sequence:INSDC:YGR032W,YLR342W"
                     /note="similar to Saccharomyces cerevisiae GSC2 (YGR032W)
                     and FKS1 (YLR342W); ancestral locus Anc_4.173"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669955.1"
                     /db_xref="GeneID:11495012"
                     /db_xref="GOA:G0WAA1"
                     /db_xref="InterPro:IPR003440"
                     /db_xref="InterPro:IPR026899"
                     /db_xref="UniProtKB/TrEMBL:G0WAA1"
                     /translation="MSYNDQGDRDRYDGPNDGYQQDEMHDQYGQPIYPDEGRQQSPDG
                     FNLPNDDSYSDSLNFAPPHANNSGYDSYGGQYTPSQMSYGEPRSGTSTPVFGNGPFDS
                     SGMEIGLPNDPYPAWTADPTAPVTVEQIEDIFIDLTNKFGFQRDSMRNMFDHFMTMLD
                     SRASRMEPAKALISLHADYIGGDTSNYKKWYFAAQLDMDDEIGFRNLKLNKLRRKARK
                     SKKSNKKAMKNYSPEEIDTILRQLEGDNSLQAADFRWKAKMRSLTPIQRVRQLALYLL
                     CWGEANQVRFTAECLCFIYKCASDYLDSPECQNRIDPIPEGDYLDRIITPLYQYIRNQ
                     VYEISEGRYIKRERDHHQIVGYDDVNQLFWYPEGIAKIVLDDGRKLIDVPVEERYLRL
                     GDITWENVFFKTYKETRTWLHMVTNFNRIWIMHISVYWMYVAYNAPALYTHNYQQLVN
                     NQPLASYRWATAALGGTVAGLIQLLATLCEWLFVPRKWAGAQHLTRRFMFLCIVFGVN
                     LGPVIFVFAYDKDTVYSKAAYIVSIVMFFVAVVTIVYFSVMPLGGLFTSYMNKSSRRY
                     VASQTFTANFAPLQGYNKLLSYLVWITVFGAKYAESYYFLILSLRDPIRILSTTTMRC
                     TGEYWWGARLCKHQSKIVLGLMIATDFILFFLDTYLWYIIINTIFSISKSFYLGVSVL
                     TPWRNIFTRLPKRIYLKILATDHMQIQYKPKVLISQIWNAIIISMYREHLLAIDHVQK
                     LLYHQVPSEVEGKRSLKAPLFFTAPDANKSYEAFFPKDSEAERRISSFAQSLAVPIDR
                     PLPVDNMPTFTVLTPHYSERILLSLREIIREDDQFSRVTLLEYLKQLHPLEWDCFVKD
                     TKILAEETAVYEGQEEEMMKEEGEKSEIDDLPFYCIGFKSAAPEYTLRTRIWASLRSQ
                     TLYRTVSGFMNYSRAIKLLYRVENPDIVQAFGGNAEGLERELEKMTRRKFKFLVSMQR
                     LAKFKPHELENAEFLLRAYPDLQIAYLDEEPPLHEGDEPRIYSALIDGHCEILENGRR
                     RPKFRVQLSGNPILGDGKSDNQNHALIFYRGEYIQLIDANQDNYLEECLKIRSVLAEF
                     EELDAEQIDPYIPGMKYEEQVTNHPVAIVGAREYIFSENSGVLGDVAAGKEQTFGTLF
                     ARTLSQIGGKLHYGHPDFINATFMTTRGGVSKAQKGLHLNEDIYAGMNAMLRGGRIKH
                     CEYYQCGKGRDLGFGTILNFTTKIGAGMGEQMLSREYYYLGTQLPIDRFLSFYYAHPG
                     FHLNNLFIQLSLQMFMLTLVNMHALAHEAIICLYDRNRPITDVLYPIGCYNFSPVNDW
                     VRRYTLSIFIVFFIAFIPIIVQELIERGLWKATLRFFRHLLSLSPMFEVFAGQIYSSA
                     LLSDLTVGGARYIATGRGFATSRIPFSILYSRFAGSAIYMGARSMIMLLFGYSCQLEC
                     CIALVLGFFVQHYYFHHLFSILINFHGKIFFLDYRDFVRWLSRGNGKYHRNSWIGYVR
                     MSRSRITGFKRKLLGDESEKAAGDASRAHRINLILGELIPCAVYAAGCFIAFTFINAQ
                     TGVSTTDDDRVNSVLRLIICTLCPIGLNMAVLLFCVSISCCSNALLGMCCKRTSATLA
                     AFAHGVAVIGHVGFFIVMWVLEGFNFIRMLMGVIACIQCQRFIFQCTTVLLLSREYKN
                     DHVNTAFWSGKWNSNGVTFSNLFREYIAKVLELSEFAADFVLGHVILFCQLPVICIPY
                     IDKMHSIMLFWLKPSRQIRPPIYSLKQTRLRRRMVAKYCFLYMVVFVLFAGCIIGPAV
                     AGSRVHKDLGTSLTGAAHNLFQPRHVDNNDTGVGISTYSGHYYTHTPSLKTWATIN"
     gene            complement(<942407..>943153)
                     /gene="NDAI0D03990"
                     /locus_tag="NDAI_0D03990"
                     /db_xref="GeneID:11495013"
     mRNA            complement(<942407..>943153)
                     /gene="NDAI0D03990"
                     /locus_tag="NDAI_0D03990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669908.1"
                     /db_xref="GeneID:11495013"
     CDS             complement(942407..943153)
                     /gene="NDAI0D03990"
                     /locus_tag="NDAI_0D03990"
                     /inference="similar to DNA sequence:INSDC:YGR033C"
                     /note="similar to Saccharomyces cerevisiae TIM21
                     (YGR033C); ancestral locus Anc_4.175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669956.1"
                     /db_xref="GeneID:11495013"
                     /db_xref="GOA:G0WAA2"
                     /db_xref="InterPro:IPR013261"
                     /db_xref="UniProtKB/TrEMBL:G0WAA2"
                     /translation="MLLNSSIRQVKPCIPLLRTLTHLYPKAILTKQLQYRRLYATSQN
                     ETKKENGKNNSTTDKQKADKKSNGRPSMLWPKLKTLTSFTLSGSLILGGIGISAIVLY
                     LIISELFSPSGDTQLFNRAVTMVEKDPTVRDMLQCKDSALRKERLKAYGELITHDRWT
                     RNRPIVSTKKLDRSGITHHFMRFHVESKKKRALVHIEAKDSQTNYQPDFTTVYVDIPG
                     EKRFYLIRPKLAQIVKPTGFLGVNWGPRKS"
     gene            943391..943462
                     /gene="NDAI0Dtrna7R"
                     /locus_tag="NDAI_0Dtrna7R"
                     /db_xref="GeneID:11495014"
     tRNA            943391..943462
                     /gene="NDAI0Dtrna7R"
                     /locus_tag="NDAI_0Dtrna7R"
                     /product="tRNA-Arg"
                     /note="codon recognized: CGG"
                     /db_xref="GeneID:11495014"
     gene            <943975..>944823
                     /gene="NDAI0D04000"
                     /locus_tag="NDAI_0D04000"
                     /db_xref="GeneID:11494839"
     mRNA            join(<943975..943993,944459..>944823)
                     /gene="NDAI0D04000"
                     /locus_tag="NDAI_0D04000"
                     /product="ribosomal protein L26"
                     /transcript_id="XM_003669909.1"
                     /db_xref="GeneID:11494839"
     CDS             join(943975..943993,944459..944823)
                     /gene="NDAI0D04000"
                     /locus_tag="NDAI_0D04000"
                     /inference="similar to DNA sequence:INSDC:YGR034W,YLR344W"
                     /note="similar to Saccharomyces cerevisiae RPL26B
                     (YGR034W) and RPL26A (YLR344W); ancestral locus Anc_4.176"
                     /codon_start=1
                     /product="ribosomal protein L26"
                     /protein_id="XP_003669957.1"
                     /db_xref="GeneID:11494839"
                     /db_xref="GOA:G0WAA3"
                     /db_xref="InterPro:IPR005756"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR005825"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:G0WAA3"
                     /translation="MAKQSLDVSSDRRKARKAYFTAPSSVRRVLLSAPLSKELRAQYG
                     IKALPIRRDDEVLVARGAKKGQEGKVSSVYRLKFAIQVDKVTKEKSNGASVPINIHPS
                     KVVITKLHLDKDRKALIQRKGGKLE"
     gene            <945216..>946649
                     /gene="NDAI0D04010"
                     /locus_tag="NDAI_0D04010"
                     /db_xref="GeneID:11495015"
     mRNA            <945216..>946649
                     /gene="NDAI0D04010"
                     /locus_tag="NDAI_0D04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669910.1"
                     /db_xref="GeneID:11495015"
     CDS             945216..946649
                     /gene="NDAI0D04010"
                     /locus_tag="NDAI_0D04010"
                     /inference="similar to DNA sequence:INSDC:YLR345W"
                     /note="similar to Saccharomyces cerevisiae YLR345W;
                     ancestral locus Anc_4.177"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669958.1"
                     /db_xref="GeneID:11495015"
                     /db_xref="GOA:G0WAA4"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G0WAA4"
                     /translation="MTKETVSSNPINKEATITNHEELHNGLGSEEVRINNHMARTNTR
                     WQNQNHSSNRNHDFYPGQLYGTESGKLFHAGKIMIVLVGLPATSKTLLAHSLERYCKW
                     LGVVSRVFNLADYRRKFKDVPKEYFFGGETSTKAIEVRKQIRKVSINDMKKFFQEENG
                     QLAIFDAMNTQKMERRCIQENFQCLNVNVLFVESIMTDKDLTERNIKLVMETIKEGND
                     EFDKKIRYSLLNKMLTSKPSYEEIEDSEKLSYVKFNNFGKQIVVKNNHQGYLLNKLVF
                     FLMNLRSGKGRIFFCSSNSIHQEDISNCLKSIYNRVIEQIKKEDIVRRNFSPSLQEDD
                     RPNSPILTIWCEHKFQLEEDSDIELINKSQLRRMNLGAIEGLSEEEIEKQYPKEYKES
                     FEDLYHYRYPRAESYHDLAIRLEGLLLELEHQQSDLLIFADESVLRILYGYFMSSSCI
                     EVPLLNFGKGEIVELSLKTFSKEIKKL"
     gene            complement(<948220..>948930)
                     /gene="NDAI0D04020"
                     /locus_tag="NDAI_0D04020"
                     /db_xref="GeneID:11495016"
     mRNA            complement(<948220..>948930)
                     /gene="NDAI0D04020"
                     /locus_tag="NDAI_0D04020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669911.1"
                     /db_xref="GeneID:11495016"
     CDS             complement(948220..948930)
                     /gene="NDAI0D04020"
                     /locus_tag="NDAI_0D04020"
                     /inference="similar to DNA sequence:INSDC:YGR036C"
                     /note="similar to Saccharomyces cerevisiae CAX4 (YGR036C);
                     ancestral locus Anc_4.179"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669959.1"
                     /db_xref="GeneID:11495016"
                     /db_xref="GOA:G0WAA5"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:G0WAA5"
                     /translation="MDNTTAYANENIIPFDDTYILYDPNDPISFLSAYFSLLPILILS
                     FYLSWFIITRELEACIMAAGQLSNEIFNNIIKNIIKQTRPYHNYFGESFQQNTLRSGY
                     GMPSAHSQFMGFLTLYLSLRYIYNWNNLSAFWKFLGISFITILGGCVCFSRLYLKYHS
                     FNQVLVGWTLGTLTGSSYYLLVGIIREIGIIDWVLTWPIMKWLYVKDSWNLAPSTLKE
                     DYQIYLQKKSGKYTKKTE"
     gene            complement(<949599..>949859)
                     /gene="NDAI0D04030"
                     /locus_tag="NDAI_0D04030"
                     /db_xref="GeneID:11495017"
     mRNA            complement(<949599..>949859)
                     /gene="NDAI0D04030"
                     /locus_tag="NDAI_0D04030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669912.1"
                     /db_xref="GeneID:11495017"
     CDS             complement(949599..949859)
                     /gene="NDAI0D04030"
                     /locus_tag="NDAI_0D04030"
                     /inference="similar to DNA sequence:INSDC:YGR037C"
                     /note="similar to Saccharomyces cerevisiae ACB1 (YGR037C);
                     ancestral locus Anc_4.181"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669960.1"
                     /db_xref="GeneID:11495017"
                     /db_xref="GOA:G0WAA6"
                     /db_xref="InterPro:IPR000582"
                     /db_xref="InterPro:IPR014352"
                     /db_xref="InterPro:IPR022408"
                     /db_xref="UniProtKB/TrEMBL:G0WAA6"
                     /translation="MVSQLFEEKAKAVQELPKKPSDDELLQVYALYKQATVGDNNKEK
                     PGIFNLKDRSKWNAWEELKGMSQEEAEKKYIELVDSLSAKYA"
     gene            <950469..>951188
                     /gene="NDAI0D04040"
                     /locus_tag="NDAI_0D04040"
                     /db_xref="GeneID:11495018"
     mRNA            <950469..>951188
                     /gene="NDAI0D04040"
                     /locus_tag="NDAI_0D04040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669913.1"
                     /db_xref="GeneID:11495018"
     CDS             950469..951188
                     /gene="NDAI0D04040"
                     /locus_tag="NDAI_0D04040"
                     /inference="similar to DNA sequence:INSDC:YGR038W,YLR350W"
                     /note="similar to Saccharomyces cerevisiae ORM1 (YGR038W)
                     and ORM2 (YLR350W); ancestral locus Anc_4.182"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669961.1"
                     /db_xref="GeneID:11495018"
                     /db_xref="GOA:G0WAA7"
                     /db_xref="InterPro:IPR007203"
                     /db_xref="UniProtKB/TrEMBL:G0WAA7"
                     /translation="MSDNIQHSTPQATSSYTTSYDQKNSELKPFPSSSGHSIMTPLSS
                     SRSHSESLSKQNIEPVKDHRRRRSSSIISHVEPETFEDENDQQMLPNMNASWVDQRGA
                     WIIHVVIILLLKLFYNLLPGITTEWSWTLTNMTYVIGSYVMFHLIKGTPFDFNGGAYD
                     NLTMWEQIDDETLFTPSRKFLIAVPIALFLVSTHYSHYDFKLFSWNFILTFLVAVVPK
                     LPVTHRLRISIPGITGRAQIS"
     gene            <952438..>953538
                     /gene="NDAI0D04050"
                     /locus_tag="NDAI_0D04050"
                     /db_xref="GeneID:11495019"
     mRNA            <952438..>953538
                     /gene="NDAI0D04050"
                     /locus_tag="NDAI_0D04050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669914.1"
                     /db_xref="GeneID:11495019"
     CDS             952438..953538
                     /gene="NDAI0D04050"
                     /locus_tag="NDAI_0D04050"
                     /inference="similar to DNA sequence:INSDC:YGR040W"
                     /note="similar to Saccharomyces cerevisiae KSS1 (YGR040W);
                     ancestral locus Anc_4.184"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669962.1"
                     /db_xref="GeneID:11495019"
                     /db_xref="GOA:G0WAA8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0WAA8"
                     /translation="MSRTITFDIPSQYQLVDLIGEGAYGTVCSAIHKPSGVKVAIKKI
                     QPFSKAMFVTRTLREIKLLTYFHNHENIISILDKVKPISVNKLNAVYLVQELMETDLQ
                     KIIMNSNNNPLSDDHIQYFTYQILRALKAIHSAQVIHRDLKPSNLLLNSNCDLKVCDF
                     GLSRCLTSSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSVGCILAEMV
                     SGRPLFPGRDYHHQLWLILEVLGTPSLEDFAQIKSKRAKEYISNLPMRSPMPWVNVLN
                     TQRNLNPDMLDLLTKMLLFNPNKRITAAEALNHPYLATYHDPEDEPDYPPLNLNDEFW
                     KLDNEIRQPDDEEISMDILKQMLYDEVIKTMD"
     gene            <954472..>956115
                     /gene="NDAI0D04060"
                     /locus_tag="NDAI_0D04060"
                     /db_xref="GeneID:11495020"
     mRNA            <954472..>956115
                     /gene="NDAI0D04060"
                     /locus_tag="NDAI_0D04060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669915.1"
                     /db_xref="GeneID:11495020"
     CDS             954472..956115
                     /gene="NDAI0D04060"
                     /locus_tag="NDAI_0D04060"
                     /inference="similar to DNA sequence:INSDC:YGR041W,YLR353W"
                     /note="similar to Saccharomyces cerevisiae BUD9 (YGR041W)
                     and BUD8 (YLR353W); ancestral locus Anc_4.186"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669963.1"
                     /db_xref="GeneID:11495020"
                     /db_xref="UniProtKB/TrEMBL:G0WAA9"
                     /translation="MPYSDSNRSPPEGKRPPLNKTTSLFQEGSSNFNGQSPSQRSTTS
                     YTVYIDREKLQNAISSHHRTPSCQSGSDCENITSSGSENDTDTDSDTASDMSLHSTNG
                     VNIDIKYNRDSTENRGQIRHNFTPSANLSPPALPYNTSFEDNSGSIHESRGHVSIGTV
                     STSMLLNKSSNNKLIDSSPSFGSIHSTSTNIQKAPHSTSSYKVPLTKQISPTPVSRQD
                     TAVMKTLILNQSLSKKSELLSENSSSIRYDDTIEPKIEHAVELLRKEINVNTQDNAHI
                     KPELNISTEFIPQKYKIPTKALQSPIYRNSRRQLSVSILNNKILPSPTESRVNRTVSL
                     NKMPSHMDRTNSEPLTYTYATCEKQQPKLQSPTSPQTEETHVKYTQSQIELIMETMHE
                     YRENVRREHEPYSFDHDDGDIDNIFEKVDFDKYNNMRETYPIQHIDSESITSFDSDNG
                     NFWEIFSIWRILLILFICLLIPPLFFFIAFGEKIGLKNYSLMRMIMNSEHRLGLYKGF
                     LWKVDVNWFRYTCLIIGVLEILSITAGICVGFGVGLTIG"
     gene            <956545..>957342
                     /gene="NDAI0D04070"
                     /locus_tag="NDAI_0D04070"
                     /db_xref="GeneID:11495021"
     mRNA            <956545..>957342
                     /gene="NDAI0D04070"
                     /locus_tag="NDAI_0D04070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669916.1"
                     /db_xref="GeneID:11495021"
     CDS             956545..957342
                     /gene="NDAI0D04070"
                     /locus_tag="NDAI_0D04070"
                     /inference="similar to DNA sequence:INSDC:YGR042W"
                     /note="similar to Saccharomyces cerevisiae YGR042W;
                     ancestral locus Anc_4.187"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669964.1"
                     /db_xref="GeneID:11495021"
                     /db_xref="InterPro:IPR018838"
                     /db_xref="UniProtKB/TrEMBL:G0WAB0"
                     /translation="MPIYGPIKKKHKTWHDGKLKYFEVNNRFILYTEESNIVLASEFV
                     TNSKAVRSFLDPEGFDIEEHQIFARFLIIISDVISDYTREVQTTRVQHPDNTTNVPTT
                     LGMKMTTNDNRNGKLLKTNPTVVKRQLITPISNSKINGFSQNRMKSNESPSPTLALKV
                     NRPFKAPRMITREISSQQLFNRPSKRDLSTNIIDVRHGPETGTQVSPTEPIKNNSIRQ
                     TVRQEKPHVLTQMPTKKTTMVRRFQLERVNSIGNKRRTKIVHTGISI"
     gene            complement(<957700..>958713)
                     /gene="NDAI0D04080"
                     /locus_tag="NDAI_0D04080"
                     /db_xref="GeneID:11495022"
     mRNA            complement(<957700..>958713)
                     /gene="NDAI0D04080"
                     /locus_tag="NDAI_0D04080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669917.1"
                     /db_xref="GeneID:11495022"
     CDS             complement(957700..958713)
                     /gene="NDAI0D04080"
                     /locus_tag="NDAI_0D04080"
                     /inference="similar to DNA sequence:INSDC:YGR043C,YLR354C"
                     /note="similar to Saccharomyces cerevisiae YGR043C and
                     TAL1 (YLR354C); ancestral locus Anc_4.188"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669965.1"
                     /db_xref="GeneID:11495022"
                     /db_xref="GOA:G0WAB1"
                     /db_xref="InterPro:IPR001585"
                     /db_xref="InterPro:IPR004730"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018225"
                     /db_xref="UniProtKB/TrEMBL:G0WAB1"
                     /translation="MPPQKKQKVQPKGEKTSLEYLKETGTKVVADTGDFEQIAKYEPM
                     DSTTNPTLILAASKKEEYAKLMDNAIEYGKSHGDTLEEKAENAIDKLLVEFGTEILKI
                     VPGKVSTEVDARLSFDKEAMVSKAIDLMKLYDEAGISKERVYIKLSSTWEGIQAAKEL
                     EEKHGIHTNLTLLFSFVQAVACAEANVSLVSPFVGRITDYYKSKTGKDYPPEDDPGLK
                     SVERIYYYYKKHSYDTVIMAASMRNIGQVKQLAGIDNLTLSLSVLDSLLNSHESIEKR
                     LVPEDAKEKGDEKETFINDESKFRYQLNDDAMATDKLADGIRKFAADAITLTDLVKER
                     LSS"
     gene            complement(<959363..>960733)
                     /gene="NDAI0D04090"
                     /locus_tag="NDAI_0D04090"
                     /db_xref="GeneID:11495023"
     mRNA            complement(<959363..>960733)
                     /gene="NDAI0D04090"
                     /locus_tag="NDAI_0D04090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669918.1"
                     /db_xref="GeneID:11495023"
     CDS             complement(959363..960733)
                     /gene="NDAI0D04090"
                     /locus_tag="NDAI_0D04090"
                     /inference="similar to DNA sequence:INSDC:YGR044C"
                     /note="similar to Saccharomyces cerevisiae RME1 (YGR044C);
                     ancestral locus Anc_4.189"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669966.1"
                     /db_xref="GeneID:11495023"
                     /db_xref="GOA:G0WAB2"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0WAB2"
                     /translation="MAYIGTQKKSYSKIENNFTGTNKVSKAYLPIEEYRMKHEPFTLD
                     SMVEHIKLQELVSYEDSASCFRYLDECNRKIEVEDVFKYDNNRTDSNRSFMNESIFLA
                     EMENGYSSIILDEPHCSQNCQQSELKNSFNMVPFISEPHFEQCNTPNIYYLPQEIKKE
                     TPNIQINNTANNVLSLPKVRELKRSTETFEDPPFFEPDMDFFPLLLTPDENIFSNVSK
                     NINTSGNLNGTTNNNSGNNVTTNKSLPQQLENDPNYSLEARQVDEFQWDIFLTPPTTP
                     DTQTYVNQLKNDKPLLKALSKKHKRGSYRCAHCPSMFGTIFEYAAHMDEFEIKREFKC
                     PFRLCPWKILGLPRRSDLRRHCAIQHKHELPESLKEELNLKDEAYPSTECPNLFCEKE
                     FYRKDALNRHIAIVHEKENSRFNKRLKKLYEECAYIATEEGRVAYIREQLLKDHKTKK
                     KNTSSA"
     gene            <962391..>962999
                     /gene="NDAI0D04100"
                     /locus_tag="NDAI_0D04100"
                     /db_xref="GeneID:11495024"
     mRNA            <962391..>962999
                     /gene="NDAI0D04100"
                     /locus_tag="NDAI_0D04100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669919.1"
                     /db_xref="GeneID:11495024"
     CDS             962391..962999
                     /gene="NDAI0D04100"
                     /locus_tag="NDAI_0D04100"
                     /inference="similar to DNA sequence:INSDC:YGR049W,YLR356W"
                     /note="similar to Saccharomyces cerevisiae SCM4 (YGR049W)
                     and YLR356W; ancestral locus Anc_4.191"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669967.1"
                     /db_xref="GeneID:11495024"
                     /db_xref="UniProtKB/TrEMBL:G0WAB3"
                     /translation="MPHTSLDLTKTVAISSLGLYAGLLTTTTLVSTITPIDLLTSQVR
                     HLACVIGCYESGLAALSTGAFALTYYLSPPKLRLPYLLYGVAVSPLTCGYMYVSSKLS
                     HAWASKKEIKSNAENSDMSSPEVVEEPTSKVPFHHPPIDGSAEGAECPFGKKAHKNGA
                     SVKPNASCHKALNIQLWVSAAAALGIFVKIVHESRYEPTVLL"
     gene            <966439..>967560
                     /gene="NDAI0D04110"
                     /locus_tag="NDAI_0D04110"
                     /db_xref="GeneID:11495025"
     mRNA            <966439..>967560
                     /gene="NDAI0D04110"
                     /locus_tag="NDAI_0D04110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669920.1"
                     /db_xref="GeneID:11495025"
     CDS             966439..967560
                     /gene="NDAI0D04110"
                     /locus_tag="NDAI_0D04110"
                     /inference="similar to DNA sequence:INSDC:YGR052W"
                     /note="similar to Saccharomyces cerevisiae YGR052W;
                     ancestral locus Anc_4.192"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669968.1"
                     /db_xref="GeneID:11495025"
                     /db_xref="GOA:G0WAB4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:G0WAB4"
                     /translation="MYYNLTKIQSGTFSTVYKAWSSTLERYVALKIMSKSKYSANGVA
                     NEYNIMKHLGTGHPNVCSMLDYYEDNDNYVLVLEYCECGDMYDFLAIAKSQGDALSPS
                     IIELDFTKILRQLVSAIKYAHSLGIAHRDIKPENVLLTKEGNVKLADWGHATLESYSK
                     DTHIGTDNYRAPETFEDRDAYNTYKIDYWSLGVTSLYLLFGQCPFKNLSIQNSSSSSF
                     SSSSSSSSSDSSMDSIDVDDNKIVEVNSYLEGSNFLSFVKDPNAFIYRYYLAPIMNVK
                     NGKIFSYLDSQVPLYRWKDMVNNYNLFYLSKVIISTLICIEAEQRSLHKFHKLLNKIC
                     TDSVNSNGSSMVPSHKLKNAYSLNKMDLDYTSVSAQNIT"
     gene            complement(<967757..>968626)
                     /gene="NDAI0D04120"
                     /locus_tag="NDAI_0D04120"
                     /db_xref="GeneID:11495026"
     mRNA            complement(<967757..>968626)
                     /gene="NDAI0D04120"
                     /locus_tag="NDAI_0D04120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669921.1"
                     /db_xref="GeneID:11495026"
     CDS             complement(967757..968626)
                     /gene="NDAI0D04120"
                     /locus_tag="NDAI_0D04120"
                     /inference="similar to DNA sequence:INSDC:YGR053C"
                     /note="similar to Saccharomyces cerevisiae YGR053C;
                     ancestral locus Anc_4.193"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669969.1"
                     /db_xref="GeneID:11495026"
                     /db_xref="UniProtKB/TrEMBL:G0WAB5"
                     /translation="MRIHLPLHYYVFAPALRRQPLNVSNDLLQGKCISLLYLQKRPLS
                     DDHHANLGTITKYLTVGGIPNLLQKSIDDKYLCEDVQLRLLPTIYPYIPTIHGRSKYN
                     ASLNAIRLIVRNFILSEKCRLHILSVQTVLSKSTLEKNANFKFITNHDKLIVKWQTCL
                     SEDDCKTHKLENMKSTKLAGKNAAADDDESTSHIVDYILDPSKGQLNENIVSKHFQDI
                     NLSVAEDKEDGEASGEREIKEQKPKKISKLLKGIQIFEFNEDNTKIQVHTFENIEMIN
                     FEKKIDTGGAFAC"
     gene            <969109..>971877
                     /gene="NDAI0D04130"
                     /locus_tag="NDAI_0D04130"
                     /db_xref="GeneID:11495027"
     mRNA            <969109..>971877
                     /gene="NDAI0D04130"
                     /locus_tag="NDAI_0D04130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669922.1"
                     /db_xref="GeneID:11495027"
     CDS             969109..971877
                     /gene="NDAI0D04130"
                     /locus_tag="NDAI_0D04130"
                     /inference="similar to DNA sequence:INSDC:YGR056W,YLR357W"
                     /note="similar to Saccharomyces cerevisiae RSC1 (YGR056W)
                     and RSC2 (YLR357W); ancestral locus Anc_4.196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669970.1"
                     /db_xref="GeneID:11495027"
                     /db_xref="GOA:G0WAB6"
                     /db_xref="InterPro:IPR001025"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR027180"
                     /db_xref="UniProtKB/TrEMBL:G0WAB6"
                     /translation="MSEAQDPKWLRKFLKAQYVGVYQLKDSQGNEIYHIFETCPPKNE
                     YPDYYEMIKKPVSLNTLKKRVPHYNEPQEFVRDIVQIQWNAKTYNTKDSIIYEYATIL
                     DNYIKEEIIPTLKEYFSEVRYPYLGPLPDPADEQEQLKYKKEDDEQAILEAKPIVEEK
                     KKRKRRTRREIEEDERRQRNIKNGIIDQHDTSIEPESRPASRLGSEMDEPPNGNKVPR
                     LDSLKNFSAYSPMSEPQSRSTTPQIEDNSPYIRPSKPKRHIKRGRPPVIDLPYVQRIK
                     LVLKNLRREVDDTGAPITQDFMRLPDDPSYNTVIQFPMCLDEIKKKIKKRAYKDFESF
                     QYDFILMVRNYKSFYRSNPIAIEKANDLENRFNLFAKQELSKPDTDYMPGGELRLPLD
                     SVEYNGVMYNIGDWVLIKNPNDPNKPIIGQIFRFWSTPNGEKWLNSCWYYRPEQTVHR
                     VDRIFYKNEVMKTGQYRDNLIQDVVGKCFVVHFTRFQRGNPVGYEGPLFVCEFRYNES
                     DRAFNKIRTWRACNPEEIRDQEEITTPIPGRKFFKYPSPLRHLLPPNATEHDPVPTAT
                     PGVQNAPPLIGAVYLRPKQERDDLGEYSTSDDCPRHIIRPGEAHKPGIIDMDTGTISF
                     SSTNTSMPKISSSSMTHILEAREPSVSSTTRNFNNVPQPNKMNTEANNHPLQSSLANV
                     SSSTVISRIMGNGPLTVQKLKMIENFRLRQQIDQRQQMKKAQASKYNKTTNLGNLIEQ
                     VSKTDSTPILIDAPSTYVLPVSITKHIEAVQRTDDNNHIRLVESSKDETNITKNERGN
                     VLWFRGPSISIKERLFNSGNEYTQSPLNRWVKQYKRQKLDTVNTTNLNMDFEEVEESI
                     TQGKTDADADADADADADATNDEDDISSDEESTSLTCTYPLGLRPSTAYMARKLRLFQ
                     DTINNLSS"
     gene            complement(<972168..>972893)
                     /gene="NDAI0D04140"
                     /locus_tag="NDAI_0D04140"
                     /db_xref="GeneID:11495028"
     mRNA            complement(<972168..>972893)
                     /gene="NDAI0D04140"
                     /locus_tag="NDAI_0D04140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669923.1"
                     /db_xref="GeneID:11495028"
     CDS             complement(972168..972893)
                     /gene="NDAI0D04140"
                     /locus_tag="NDAI_0D04140"
                     /inference="similar to DNA sequence:INSDC:YGR057C"
                     /note="similar to Saccharomyces cerevisiae LST7 (YGR057C);
                     ancestral locus Anc_4.198"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669971.1"
                     /db_xref="GeneID:11495028"
                     /db_xref="InterPro:IPR021713"
                     /db_xref="UniProtKB/TrEMBL:G0WAB7"
                     /translation="MDNILISLAHFCDKHGPRILLVTQSSQNGARSDDLLLPDYPIDS
                     YCESCLLHFPQGNETIRSMRSTLDEKCYVTTQYSSIRYQLMNSIIRRCFSEETMVYDN
                     MPLVFYDQLRGLNLIMGFKLYDANARGNERRYCFILTIDSKDSDAAMKILSNNWNFII
                     GGFFKMINHINESHNKELKNQSNERDHTNGLSPLMSNYLRGNKSKLAKNLVELTNDKN
                     IFLKMHKWNTYLLNMLITNASPK"
     gene            <973396..>974433
                     /gene="NDAI0D04150"
                     /locus_tag="NDAI_0D04150"
                     /db_xref="GeneID:11495029"
     mRNA            <973396..>974433
                     /gene="NDAI0D04150"
                     /locus_tag="NDAI_0D04150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669924.1"
                     /db_xref="GeneID:11495029"
     CDS             973396..974433
                     /gene="NDAI0D04150"
                     /locus_tag="NDAI_0D04150"
                     /inference="similar to DNA sequence:INSDC:YGR058W"
                     /note="similar to Saccharomyces cerevisiae PEF1 (YGR058W);
                     ancestral locus Anc_4.203"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669972.1"
                     /db_xref="GeneID:11495029"
                     /db_xref="GOA:G0WAB8"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:G0WAB8"
                     /translation="MGKKKLNYAAGDDLLLFATPKEAMEESRRRILEDKIRRRQRDER
                     ITSAPVVNSPHEQTQQLQQTNSPQLIQRQPLQYRNTQPLPVHQHHPPLPNHLPLGQPN
                     VRSNRPIPPPSNMSQVPILAPTTNEYGGRPIHHALPYVRHSSSSPTSRKSPTPDAPHR
                     VANDPNKDVQIAVQLFNNHDIRKRGRLTAEELQNLLQNDDNSRFCISSIDSLINLFGA
                     TRFGTVNQQEFVSLYKRVKIWRKVYVDNDINGSCTISSAEFYNSLQQLEYLIPFEVCE
                     KFFDQFAEFINENNFSKELKFDKFVEALVWLLRLTKVFRNFDSDQNGIAQVHYKDFIE
                     MTLYLGRFLPH"
     gene            <974771..>976309
                     /gene="NDAI0D04160"
                     /locus_tag="NDAI_0D04160"
                     /db_xref="GeneID:11495030"
     mRNA            <974771..>976309
                     /gene="NDAI0D04160"
                     /locus_tag="NDAI_0D04160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669925.1"
                     /db_xref="GeneID:11495030"
     CDS             974771..976309
                     /gene="NDAI0D04160"
                     /locus_tag="NDAI_0D04160"
                     /inference="similar to DNA sequence:INSDC:YGR059W"
                     /note="similar to Saccharomyces cerevisiae SPR3 (YGR059W);
                     ancestral locus Anc_4.204"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669973.1"
                     /db_xref="GeneID:11495030"
                     /db_xref="GOA:G0WAB9"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR025662"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WAB9"
                     /translation="MNTQSFVENDDTDCPQNFQDYLTGFFEMRKLRLLNAELNNPTSN
                     QKQNKTKLLPTKKDYVYQKIMPGYHVGIDNIPKQLERITRNKGTNFNLLVAGQSGTGK
                     TTLVNTLFGQTIINNQENESLTSCCGISKKKMIIEADDTQLNLTIIETPSYGNKTNNS
                     MSWIPLVNYVDEQIRSYIFQEEQPYREHLQDNRIHCCLYLLEPNLRKLNKLDLITMKE
                     LSKRVNLIPVINKVDILNPNMLKDLKIQVKYTLDNRGVSICQFLTEFNNENGVEFDDI
                     RTQYPFGVISSDKQILNNSGKLVLGRKYKWGIIEVDNSEFSDFLKLKQFLINDYMVDL
                     VKSTESYYESCRSELLQTRILKARDYSNYNAEEYDKQASSPLTPISIPPDSLEELKEL
                     DYDDIENNKLKNYKCYEIFNKKLMDKIYIDWSPEFMERQFLFKKKFNEIINLEEKKFF
                     KWAQALKKKQTVLNKEITTMAKQVEFLEGECRNLERMVLVDKKGGFYSNNSSTTLVGF
                     HFKR"
     gene            <978415..>979341
                     /gene="NDAI0D04170"
                     /locus_tag="NDAI_0D04170"
                     /db_xref="GeneID:11495031"
     mRNA            <978415..>979341
                     /gene="NDAI0D04170"
                     /locus_tag="NDAI_0D04170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669926.1"
                     /db_xref="GeneID:11495031"
     CDS             978415..979341
                     /gene="NDAI0D04170"
                     /locus_tag="NDAI_0D04170"
                     /inference="similar to DNA sequence:INSDC:YGR060W"
                     /note="similar to Saccharomyces cerevisiae ERG25
                     (YGR060W); ancestral locus Anc_4.206"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669974.1"
                     /db_xref="GeneID:11495031"
                     /db_xref="GOA:G0WAC0"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:G0WAC0"
                     /translation="MSLVFNNATLVDLVRTDTYAGTLRNIAQAQPALNIMEKYWAAWY
                     TYMNNDILATGLMFFLLHEFVYFFRCLPWFIIDQIPYFRRWKLQPTKIPSTKEQLYCL
                     KAVLLSHFLVEAIPIWTFHPMCQKLGISIEVPFPSVKRMTLEIMLFFVLEDMWHYWGH
                     RLFHYGVFYKYIHKQHHRYAAPFGLSAEYAHPVETMTLGFGTVGMPILYVMYTGQLHL
                     FTLCIWITLRLFQAVDSHSGYDFPFSLNKFMPFWAGAEHHDLHHHYFIGNYASSFRWW
                     DFCLDTEAGPEAKLAREERMKRKAETAAKKRS"
     gene            complement(<979760..>983827)
                     /gene="NDAI0D04180"
                     /locus_tag="NDAI_0D04180"
                     /db_xref="GeneID:11495032"
     mRNA            complement(<979760..>983827)
                     /gene="NDAI0D04180"
                     /locus_tag="NDAI_0D04180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669927.1"
                     /db_xref="GeneID:11495032"
     CDS             complement(979760..983827)
                     /gene="NDAI0D04180"
                     /locus_tag="NDAI_0D04180"
                     /inference="similar to DNA sequence:INSDC:YGR061C"
                     /note="similar to Saccharomyces cerevisiae ADE6 (YGR061C);
                     ancestral locus Anc_4.207"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669975.1"
                     /db_xref="GeneID:11495032"
                     /db_xref="GOA:G0WAC1"
                     /db_xref="InterPro:IPR000728"
                     /db_xref="InterPro:IPR010073"
                     /db_xref="InterPro:IPR010918"
                     /db_xref="InterPro:IPR016188"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:G0WAC1"
                     /translation="MVTYILPGPKALSDFRTENLIQNINKYTNSASIILDVRSCYIHY
                     VETKDSDKDLSPGKYELLQTLLKYDSELDIINDSSSKQLFDLVAKDIPGSTLGQDTYL
                     IRIVPRSGTISPWSSKATNIAHVCGLAHDITRIERGLALLIKTVPNFPLLENLNDTSL
                     KSVFDKMTQQLYLQEPPILKDIFTHQAPRPLIHVPLTSDPSSPPRDILQKANRNLGLA
                     LDDGEMDYLINAFKEIIHRDPTDVELFMFAQVNSEHCRHKIFNAKWSIDGQEKDLSLF
                     QMIRNTHNLNPEFTISAYSDNAAVIDTENDAIFFAPDSCTKHWKSIKESVAMLIKVET
                     HNHPTAVSPFPGAATGSGGEIRDEGATGRGSKTKCGLSGFSVSDLLIPNHKQPWELDV
                     GRPDHIASALDIMIEAPLGSASFNNEFGRPCINGYFRTLTTRVTNATGKEEIRGFHKP
                     IMIAGGFGAIRPQFSLKNTPITSGSCLIVLGGESMLIGLGGGAASSISSGEGSADLDF
                     ASVQRGNPEMERRCQQVIDACVALGDSNPIQSIHDVGAGGLSNALPELVHDNDLGAKF
                     DIRKVLSLDPGMSPMEIWCNESQERYVLGVSVNDYPIFEKICQRERAPYALVGHATAE
                     QKLIVEDSLLKTTPIDLEMSILFGKPPKMSRSAITEPLALSDIDLSVIPSLSDAIERV
                     LCLPSVASKSFLITIGDRSVTGLVDRDQFVGPWQVPVADVGVTATSLGDSVISTGEAM
                     AMGERPVNALISAAASAKLAVAESLLNILAADVKSLNHIKLSANWMSPASHQGEGSKL
                     YEAVQALGMDLCPALGISIPVGKDSMSMKMKWDDKEVTAPLSLNITAFAPVNNTSKTW
                     IPLLNKDYKDSLLVLVDLATLVKHSLGGSALLQVYNEVGNTSPTVHDNGLLKSFLESL
                     LELHQTDIVLAYHDRSDGGLLVTLLEMAFTSRCGLNINTTATDKNAILLSLFNEELGS
                     IFQVAESKLDEFKKILTRNGIPGEFIKVVAKPNFNTQDIRIINEQGEIIYANTRAQLE
                     QIWASTSYELQKLRDNPNTAIEEYSTIKDDQDPGLHFSLTYNPADDLQIGSLLSASRP
                     KVAILREQGVNGQMEMAWCFEQAGFTSVDVTMSDLIDGRFHLDEFVGLAACGGFSYGD
                     VLGAGAGWAKSVLFHEGVRSQFVKFFQERQDTFAFGACNGCQFLSRLKEIIPGCENWP
                     IFERNVSEQYEARVCMVEILNTINEGKKQENVFLNGMVGSKLPIAVAHGEGKATFTNN
                     KQLEQFENNGLCAIRYIDNYDNVTEKFPFNPNGSANGIAGIMSPNGRVLAMMPHPERV
                     CRLEANSWYPAGKYDEWEGYGPWIRLFRSARKWVS"
     gene            <984552..>984815
                     /gene="NDAI0D04190"
                     /locus_tag="NDAI_0D04190"
                     /db_xref="GeneID:11495033"
     mRNA            <984552..>984815
                     /gene="NDAI0D04190"
                     /locus_tag="NDAI_0D04190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669928.1"
                     /db_xref="GeneID:11495033"
     CDS             984552..984815
                     /gene="NDAI0D04190"
                     /locus_tag="NDAI_0D04190"
                     /inference="similar to DNA sequence:INSDC:YLR363W-A"
                     /note="similar to Saccharomyces cerevisiae YLR363W-A;
                     ancestral locus Anc_4.208"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669976.1"
                     /db_xref="GeneID:11495033"
                     /db_xref="InterPro:IPR019034"
                     /db_xref="UniProtKB/TrEMBL:G0WAC2"
                     /translation="MVQKALKVTKKSKDPRRITKKQKNLRKAAPLQLKSKKKSLQHLK
                     KLNKSASLTETTEKLIASRVGHLELLKGTRKEIERKNRKENSK"
     gene            complement(<985083..>986048)
                     /gene="NDAI0D04200"
                     /locus_tag="NDAI_0D04200"
                     /db_xref="GeneID:11495034"
     mRNA            complement(<985083..>986048)
                     /gene="NDAI0D04200"
                     /locus_tag="NDAI_0D04200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669929.1"
                     /db_xref="GeneID:11495034"
     CDS             complement(985083..986048)
                     /gene="NDAI0D04200"
                     /locus_tag="NDAI_0D04200"
                     /inference="similar to DNA sequence:INSDC:YGR062C"
                     /note="similar to Saccharomyces cerevisiae COX18
                     (YGR062C); ancestral locus Anc_4.209"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669977.1"
                     /db_xref="GeneID:11495034"
                     /db_xref="GOA:G0WAC3"
                     /db_xref="InterPro:IPR001708"
                     /db_xref="UniProtKB/TrEMBL:G0WAC3"
                     /translation="MMLSRISKTNLGQQAWRNTGLRHNSRIISSIFPRRQVHMETFQP
                     ISDIFITLHETSGIPWLFMVPMMTLTLRSLVTLPLSIWQRKRIVKQQELRKIVQATTP
                     ILQLRLAAQTLQKKKQQGNAIAGELAMLSSPTSKASLVLTPEQIKQMAIKETRKRQKK
                     LFKKYNVPLWKNVVLPLVQIPLWVTISMGIRNLVDRRFFEVGEQWAKDFDIDGIDLSG
                     PLDPLPMLVPIVLGTFSLLNVEFNGKMMLNKDTNLVGIKTYTDESTTLAQSMRSIMNV
                     SRMGCIFMMGVSSQTSILLALYWISSQFFSLVQNMILDKVWPYQR"
     gene            complement(<986302..>986589)
                     /gene="NDAI0D04210"
                     /locus_tag="NDAI_0D04210"
                     /db_xref="GeneID:11495035"
     mRNA            complement(<986302..>986589)
                     /gene="NDAI0D04210"
                     /locus_tag="NDAI_0D04210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669930.1"
                     /db_xref="GeneID:11495035"
     CDS             complement(986302..986589)
                     /gene="NDAI0D04210"
                     /locus_tag="NDAI_0D04210"
                     /inference="similar to DNA sequence:INSDC:YGR063C"
                     /note="similar to Saccharomyces cerevisiae SPT4 (YGR063C);
                     ancestral locus Anc_4.210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669978.1"
                     /db_xref="GeneID:11495035"
                     /db_xref="GOA:G0WAC4"
                     /db_xref="InterPro:IPR009287"
                     /db_xref="InterPro:IPR016046"
                     /db_xref="InterPro:IPR022800"
                     /db_xref="InterPro:IPR029040"
                     /db_xref="UniProtKB/TrEMBL:G0WAC4"
                     /translation="MLCGIVQTTNEFNTNGCPNCQGIFEEAGVGTMECTSPSFEGLVG
                     MCKPGKSWVAKWLSVDPYIPGMYAIKVDGRLPGEVVELLPHYKPRDGSQVE"
     gene            complement(<987497..>989347)
                     /gene="NDAI0D04220"
                     /locus_tag="NDAI_0D04220"
                     /db_xref="GeneID:11495036"
     mRNA            complement(<987497..>989347)
                     /gene="NDAI0D04220"
                     /locus_tag="NDAI_0D04220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669931.1"
                     /db_xref="GeneID:11495036"
     CDS             complement(987497..989347)
                     /gene="NDAI0D04220"
                     /locus_tag="NDAI_0D04220"
                     /inference="similar to DNA sequence:INSDC:YGR065C"
                     /note="similar to Saccharomyces cerevisiae VHT1 (YGR065C);
                     ancestral locus Anc_4.212"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669979.1"
                     /db_xref="GeneID:11495036"
                     /db_xref="GOA:G0WAC5"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G0WAC5"
                     /translation="MLKNIDYRKKFFPHLRILPEDINAESGANYDDDDDDDDDVSSLD
                     VMRESEEITQRKKSSSSNSGADLESFHDENHETFASTNGATTKLQPNIPYELRDENGR
                     KWWKYFDEFEYRINKEYRKSRKWYEFLYPNHTTHSKAERKLLYKLDIVVGFYFLVLCW
                     SKSVDTNNYTNAYVSNMKEDLHMKGNDYIHTSTISNVGAIVFQLPFMYLLPKYPAHII
                     LPMMDLGWTWFTFACYRAKSLSELQAYRFILNAFGAAYYPVSQYILGCWYAPDELTSR
                     VFLFFCGQLLGGVTSGLLQARIFKSLNGVNGLAGWRWMFLIDAIAISLPTAILGFFVI
                     PGIPSKCYSLFLTDEEIRIARVRNKRNQIKDGIDSSKLISLFKWDLWKKVFFTPTFWV
                     LLIFDTCSWNNMTAFSGSYTLWLKSNTKYSIEQVNNLSVLPACLGFAYVFVCAAGADL
                     FHCKWIFMVFAAIMNCISCGLLIKWDIPSNAKWFAFLTTYFSVAPSPCLWSFINDFLR
                     FDPQVKAITWIAIYSFSQSTNAWIPNLAWPTVESPRFKTGYTVCLIFGAIYGAWTFVV
                     LYFYKKNERKHALGNGIILYDSSKQENPPSFVTKEMEQRSDGYYYLKKQA"
     gene            <991795..>992587
                     /gene="NDAI0D04230"
                     /locus_tag="NDAI_0D04230"
                     /db_xref="GeneID:11495037"
     mRNA            join(<991795..991927,992328..>992587)
                     /gene="NDAI0D04230"
                     /locus_tag="NDAI_0D04230"
                     /product="ribosomal protein S22"
                     /transcript_id="XM_003669932.1"
                     /db_xref="GeneID:11495037"
     CDS             join(991795..991927,992328..992587)
                     /gene="NDAI0D04230"
                     /locus_tag="NDAI_0D04230"
                     /inference="similar to DNA sequence:INSDC:YLR367W"
                     /note="similar to Saccharomyces cerevisiae RPS22B
                     (YLR367W); ancestral locus Anc_4.213"
                     /codon_start=1
                     /product="ribosomal protein S22"
                     /protein_id="XP_003669980.1"
                     /db_xref="GeneID:11495037"
                     /db_xref="GOA:G0WAC6"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="UniProtKB/TrEMBL:G0WAC6"
                     /translation="MTRSSVLADALNAINNAEKTGKRQVMIRPSSKVIIKFLQVMQKH
                     GYIGEFEYIDDHRSGKIVIQLNGRLNKCGVISPRFNVKINDIEKWTANLLPARQFGFV
                     ILTTSAGIMDHEEARRKHVSGKILGFVY"
     gene            complement(<993054..>996563)
                     /gene="NDAI0D04240"
                     /locus_tag="NDAI_0D04240"
                     /db_xref="GeneID:11495038"
     mRNA            complement(<993054..>996563)
                     /gene="NDAI0D04240"
                     /locus_tag="NDAI_0D04240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669933.1"
                     /db_xref="GeneID:11495038"
     CDS             complement(993054..996563)
                     /gene="NDAI0D04240"
                     /locus_tag="NDAI_0D04240"
                     /inference="similar to DNA sequence:INSDC:YGR067C"
                     /note="similar to Saccharomyces cerevisiae YGR067C;
                     ancestral locus Anc_4.214"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669981.1"
                     /db_xref="GeneID:11495038"
                     /db_xref="GOA:G0WAC7"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0WAC7"
                     /translation="MAVDGDHDNKTNDLPNSKSTSLTEHIPMPMPMPSSSSSVSSTSL
                     ASYSGTSIGSDNHPPQPLDSSPNCSSSNKNISPPKTGIFSKRFICSFCAKAFSRSEHK
                     IRHERSHTGFKPYKCLLCDHSFVRSDLTIRHLKTVHKDQINLLQKDNLKNEDPSEFSQ
                     TSIETIIRSLIKIDHSDKNSNSNIKHISDKNLKIKTNSEINNNNNNNNNTKRRKNKKR
                     KNKQKDIHNILVRSPSPTSSSLSSLQQQKHDHQSVPPFSSSSSSLIPSISLIYHNKKY
                     PNGNQIGKEKDHQDIKIKHEIDESVYLYLISKYNKEVFPYDLKQINHLTQLSLNHLLN
                     TDHSKSLLLKNIKKDVMEINSPSLLLSLLSLGKLESSPLEKSRNDSEKLWLLSLNEAK
                     ELVPNSNENIEIIIITYSILSHILLCSYSSLSPTSKSSSKIYSLDNIINFLDLHFQNI
                     LNIIIDNNASTNDNLLRYLCDNNDTGEETFWNIFNLWVSLIKITNSFNDTSLKIYKWF
                     TNQTLIDKNDTTGNNYKENNEDIKLIELLITNKSTSYIEFNGKFILNSLANSLYCESI
                     LMTSLPNTYNGNFQSLREYHNSLINANKKVSMFANSILRTNNIHHNQPSKNHDPHVFS
                     TIQNLKNWKYNILLPNCPDKFIPLLSEYLIPILSNEHWLLWEVTWLDFLRILRSPVLI
                     SRNGVLEDPSSSIAKIKTKNNVSLQNHTLLSTPTMKKPSIQYPRLNQSWYIDDFLNII
                     HPTDSSLILNNLGICVIPILINLLTITTTSTATNEQQLEDNELIINEKFIRLIVDIII
                     FQLKICSCDLIVPFPNASNHTLGYLKNPIIQMLFFVWYSIIMNHTKNNNKDNKESEDH
                     EFQCISFFINHYIKNPNKRINIDVLFEKDLSIILFDLNSMEFKGYHYLLKFISTYFIE
                     EIIKKKLLISPYLDDLTKSKLMEMSSRTLHALDLKLKHTTRPHTRIHSQQISFNNAST
                     DNPNFVPNTIISINNARTTTSRPSSNNIPLNEHKNKITTITADQHKPLNKIPSISTTI
                     EPTATATATATTNGKRKCSIAEIINDNNSYDIDTEVNQQNDNKRLNFQQLPSIQQSNY
                     TYANCNTSPIRITNNYYSNQRLPFILNPRRYSSLDMSPKKNPTPYSANSSSRDGIVTT
                     NGSATMDNPTIDNSNNDTINNGI"
     gene            complement(<997392..>999344)
                     /gene="NDAI0D04250"
                     /locus_tag="NDAI_0D04250"
                     /db_xref="GeneID:11495039"
     mRNA            complement(<997392..>999344)
                     /gene="NDAI0D04250"
                     /locus_tag="NDAI_0D04250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669934.1"
                     /db_xref="GeneID:11495039"
     CDS             complement(997392..999344)
                     /gene="NDAI0D04250"
                     /locus_tag="NDAI_0D04250"
                     /inference="similar to DNA sequence:INSDC:YGR068C"
                     /note="similar to Saccharomyces cerevisiae YGR068C;
                     ancestral locus Anc_4.215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669982.1"
                     /db_xref="GeneID:11495039"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="UniProtKB/TrEMBL:G0WAC8"
                     /translation="MFSRTYLSASTSNGSSSSSSSSSPSKIRHHHDYTGHSGKKEIPK
                     VSYFDIKVESPYEDLILIQGSPLESQPISLNGKLIIRLNEDIIVKKIGLKLFGNFKLD
                     FLQTNNNGLTSIVKEKKKILECQWDNLLLNSKGRMIIGNEYFTYSHAQDNVNVGMGMN
                     VNVSEDDSTNVKRTISSPVMMSRFMRRKPYSSQILEIPYVNTSEDNEGGGERRYIGTP
                     FNRTITKEDNNNVSTYFHLRKGYYELPFNIMLPNELPETIEGLQSGSVLYNFEGHIDR
                     RKKSSISNLMKDNGTSSSSSNSNSSSNSTSTSTSMNGTTMNRTKQQRAYDIITANMGN
                     RMFWKYKYLRILRTLSMDNLAMQEEICVGNSWKNKLQYEISIPSRAIPIGSMTPINIK
                     IFPFQKGYILNKISVNLNQYYSMKDSNNEVYDDEVTIFKQSMTKFGNLVENETNMLVD
                     KFELSSNVKIPNNLKKLTQDCDLNDDLIRVLHKLIIRIHLKRRSDDDDGMNGNNGFKS
                     LEIKANLPVLLYISPQVYLEGRLVLFDQQNGKIHFRPNEFVPIFSHDNIVNNANGNTI
                     VNQFSYEPELPPPNYQDHGQDRLLQHDVPINAHYDDSIQENIMQRDTTRVLTDTTSAP
                     TTCSSLSSTYDNAPSYQEYELPEYES"
     gene            <1000175..>1001479
                     /gene="NDAI0D04260"
                     /locus_tag="NDAI_0D04260"
                     /db_xref="GeneID:11495040"
     mRNA            <1000175..>1001479
                     /gene="NDAI0D04260"
                     /locus_tag="NDAI_0D04260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669935.1"
                     /db_xref="GeneID:11495040"
     CDS             1000175..1001479
                     /gene="NDAI0D04260"
                     /locus_tag="NDAI_0D04260"
                     /inference="similar to DNA sequence:INSDC:YKL181W"
                     /note="similar to Saccharomyces cerevisiae PRS1 (YKL181W);
                     ancestral locus Anc_4.278"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669983.1"
                     /db_xref="GeneID:11495040"
                     /db_xref="GOA:G0WAC9"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:G0WAC9"
                     /translation="MRKCKIFVGNSHPELGKLVCERLGIEPAPCTLKKFANGETSVQI
                     GVSVRDEDVYVIQSGSPTINDHIMELLILVSACRGGSARKITAVIPQFPYSKQCKMKK
                     HRGAITARMLANLLVMAGADHVVSMDLHASQMQGFFTKPVDNLYGGPSLAKWIRENVE
                     DYEDAVVVSKNPGGTKRVTALADALKINFAMIHTDRRRAKDIYSQNRDLQQLRLRKQS
                     MLRKNKPIIRQGDDPNEEENIILTNGIQTARIRNGHVIGDDEEDETENNKNDDNDTAL
                     ESDSDDAPSIVASDSYALGGTYDAVDSEDEKEIEELQKEQLITLVGNVRDRSAIILDD
                     MVDSPRSFISAAEHMAQNCGAKKVYVVATHGIFTGDCLQELEKCEYIHKIIVTNTYPI
                     PQESLNSKKLVVIDVSPIFAECIRRDHYGESISVLFDSLATI"
     gene            complement(<1001771..>1004983)
                     /gene="NDAI0D04270"
                     /locus_tag="NDAI_0D04270"
                     /db_xref="GeneID:11495041"
     mRNA            complement(<1001771..>1004983)
                     /gene="NDAI0D04270"
                     /locus_tag="NDAI_0D04270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669936.1"
                     /db_xref="GeneID:11495041"
     CDS             complement(1001771..1004983)
                     /gene="NDAI0D04270"
                     /locus_tag="NDAI_0D04270"
                     /inference="similar to DNA sequence:INSDC:YDL077C"
                     /note="similar to Saccharomyces cerevisiae VAM6 (YDL077C);
                     ancestral locus Anc_4.274"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669984.1"
                     /db_xref="GeneID:11495041"
                     /db_xref="InterPro:IPR019452"
                     /db_xref="InterPro:IPR019453"
                     /db_xref="UniProtKB/TrEMBL:G0WAD0"
                     /translation="MLRARKLDSFQSPGINAILPITESEKLIISKKNGEIEVYIREDS
                     KYRLFQTFPNFLANTISTNDKQIENLYYSERLATIFVHCNSTLLLLNSTNLQLYDRIH
                     DKRGIKKCWLLESYPIPMQKKHASQKKQEEDHNDDDDEAPCKVMTFLLYVTTKSNRIR
                     LLIWDERHYQKMVEIGLPSSKETLLSAEILDLKTIVLATNKGIYTWSYYDERPILERI
                     DKIVRRKYPKGIVPALKMLEQSCKKFDKTDSLPSQDNDEYDTKSISRLSRKSSISTFW
                     NTTALSRHPAFRTDMKYIFKPNIDHPPVIIDWKSGYLFNISIEKKVPELLLISNNVQF
                     FEWNSQFPNIQYLSSDILIMNNSKTLRFVDYRHGFTFLEAMIEKGIKKVVNLWGIHFL
                     VWTNDDEICFYKYQVDDGPIREEHSRTLESVTTSADQLKEETESICSTNHNSSFNQLW
                     HKVIFYKYFLNSPSSLELCESNDPEQSLDICAMKLRDYTVIWCLSIVEKLRMHISVLK
                     RNGFNWESDPDIRYLQNYILKGIFETFTDFWAPPQLVILKTFPYKVARLVEDITGQIH
                     SCFPTKTDDTTFEIPPTSLRNWCVPYLIDMRRHIKNLIGKDNKSQEIIWHCYDRSIKQ
                     TLEFFLVDKHDGNIDTNTMLKLLDMVLFEIYFDYAPNMVGPFISVPNMCDFSIVFDKL
                     KSRHMFQELIDFSYLRGEHDKALEFLTNLENEIEFSSKIPNLNEKIKALVTFYLKKLP
                     NEYLETIFKYTNWLLEHNKNDSHDLLLLIFLNDSITRDASKVYEYINDKDKELSLQYL
                     EFTVGTLKSNDPMAHMTLIERYLENLNEPTTRNKLQGMLEKTSVYEPRSVLELLDDKI
                     KFDSSSRNDNSVFKDDDDLKFVKFLKTYSFQRLNQHEESIDLLFTELSEYKLAAGYCS
                     RVYEHSSDDGKTILLYLFKKITAIKEIEKMQSFLIQFLEEFSCKLDVIFLYRSIPSSC
                     NMKSIGDILLRSIKSLSIKKDEKRMLKNLLHVELINITNELWTNYSQYGVLNDSYKCS
                     VCRRNFSTLNTDTVCWFTIHGKNVYTHSSCAKTLQKDTGY"
     gene            complement(<1005312..>1006247)
                     /gene="NDAI0D04280"
                     /locus_tag="NDAI_0D04280"
                     /db_xref="GeneID:11495042"
     mRNA            complement(<1005312..>1006247)
                     /gene="NDAI0D04280"
                     /locus_tag="NDAI_0D04280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669937.1"
                     /db_xref="GeneID:11495042"
     CDS             complement(1005312..1006247)
                     /gene="NDAI0D04280"
                     /locus_tag="NDAI_0D04280"
                     /inference="similar to DNA sequence:INSDC:YDL076C"
                     /note="similar to Saccharomyces cerevisiae RXT3 (YDL076C);
                     ancestral locus Anc_4.271"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669985.1"
                     /db_xref="GeneID:11495042"
                     /db_xref="InterPro:IPR013951"
                     /db_xref="UniProtKB/TrEMBL:G0WAD1"
                     /translation="MTSATIPHDPNEIYRQTQSRIYSLQETILDSTKDVRGNHDSTGK
                     AANMLDDHLKFDALMAEKTLKKTNEYYTNSIIPLLKLNEEIYKNKVLSNIGTLQYHPT
                     KTGKFSRSRHNTDEKLLLEPPSLLYYNQVYERNMPPPFLPALGLNHIHSLLTVHVLYE
                     QLYDLFNESTSPRVNNNEIWGSDIYTDDSDPLLALKHCGFSIPNNKNKDRSYKHPSSG
                     SNNEFRRTPANLENPDNVKGESYISTSKKFDLDITILYLQPLRYYPPMYRNGIWSRSW
                     GEMSQFALEMDDEYCAPHDGLSFGIYELVIKPRDG"
     gene            <1007531..>1007743
                     /gene="NDAI0D04290"
                     /locus_tag="NDAI_0D04290"
                     /db_xref="GeneID:11495043"
     mRNA            <1007531..>1007743
                     /gene="NDAI0D04290"
                     /locus_tag="NDAI_0D04290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669938.1"
                     /db_xref="GeneID:11495043"
     CDS             1007531..1007743
                     /gene="NDAI0D04290"
                     /locus_tag="NDAI_0D04290"
                     /inference="similar to DNA sequence:INSDC:YDL075W,YLR406C"
                     /note="similar to Saccharomyces cerevisiae RPL31A
                     (YDL075W) and RPL31B (YLR406C); ancestral locus Anc_4.270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669986.1"
                     /db_xref="GeneID:11495043"
                     /db_xref="GOA:G0WAD2"
                     /db_xref="InterPro:IPR000054"
                     /db_xref="InterPro:IPR020052"
                     /db_xref="InterPro:IPR023621"
                     /db_xref="UniProtKB/TrEMBL:G0WAD2"
                     /translation="MGTDDVRLAPELNQAIWKKGIKGVEYRMRLRISRKRNEEEDAKN
                     PLFSYVEPVFVASAKGLQTVVVEEDA"
     gene            complement(<1008897..>1011128)
                     /gene="NDAI0D04300"
                     /locus_tag="NDAI_0D04300"
                     /db_xref="GeneID:11495044"
     mRNA            complement(<1008897..>1011128)
                     /gene="NDAI0D04300"
                     /locus_tag="NDAI_0D04300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669939.1"
                     /db_xref="GeneID:11495044"
     CDS             complement(1008897..1011128)
                     /gene="NDAI0D04300"
                     /locus_tag="NDAI_0D04300"
                     /inference="similar to DNA sequence:INSDC:YDL074C"
                     /note="similar to Saccharomyces cerevisiae BRE1 (YDL074C);
                     ancestral locus Anc_4.268"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669987.1"
                     /db_xref="GeneID:11495044"
                     /db_xref="GOA:G0WAD3"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013956"
                     /db_xref="UniProtKB/TrEMBL:G0WAD3"
                     /translation="MSELDQPPTKKIKLQQSEHRLELSDPTEPLTQRDVIAFQKEAIF
                     RCLNQNRTLLDSLKVKYEVTERDYNGIVSQISKIITIFFTLLNLIHSSSIFSSSILND
                     DERKLIENLLLNSKNDDDADSNTPVHLIIESSTQLMDIFNKCLSKDQEFQLDKNKLMQ
                     NLEKLTNEKSKLSLQNEKLNNQLTSLQTHYESLIKKYDRDDSITVKRVFSKEISNCKD
                     VGPNVQEVNTQQQFASGTETKLEQKGGLIDSTIQANNNIALSPKGDVEGQQENSCNVT
                     NGDSLSDDKKILQYEVKISDLENQIVILNDTLKSLEEIKLENENKIRELNTQVSQKIN
                     ISISKDRFNSSISVDNSDRDMLMIKIDQLTKENKELTETNEQFLSKFQKLSSDQEFIT
                     NNIKEQFKASNGNLFKMNQSLEKDLTRIRTTRDELLSKLAILEKEKSKSELLTDLENV
                     NKILTEQWKSMEKRNSTYSSDSPDKQSLLKEIQDMEMAFKDVSTLLNKKYIKLSNSES
                     TITKLSVEKTKADQKYFAAMRSKDSILIENKNILKKFNKINDLILQLKDNEIILTKKI
                     ENLQKQLNFSQLNEKGLINKNKTISTNLVNLNSEINNLKKINSNLNQLNLTQANDLTK
                     LNSLMKSIEMENKKLTSKNGQLEKTNMKLSDKLFKDNKSNNINGGNNTMIDTNQNEEL
                     ENFRQLVYCSLCSKNWKNMAIKTCGHVFCQDCCKERLAARMRKCPTCNNPFGSNDLMA
                     IHL"
     gene            <1011715..>1014672
                     /gene="NDAI0D04310"
                     /locus_tag="NDAI_0D04310"
                     /db_xref="GeneID:11495045"
     mRNA            <1011715..>1014672
                     /gene="NDAI0D04310"
                     /locus_tag="NDAI_0D04310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669940.1"
                     /db_xref="GeneID:11495045"
     CDS             1011715..1014672
                     /gene="NDAI0D04310"
                     /locus_tag="NDAI_0D04310"
                     /inference="similar to DNA sequence:INSDC:YDL073W"
                     /note="similar to Saccharomyces cerevisiae YDL073W;
                     ancestral locus Anc_4.267"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669988.1"
                     /db_xref="GeneID:11495045"
                     /db_xref="InterPro:IPR013887"
                     /db_xref="UniProtKB/TrEMBL:G0WAD4"
                     /translation="MSINDEQRLFQSLNEFLAVLDRKPSNTKQCAKCLKETIRILKMD
                     LLSLLRHQLHQHVLPSNSIYNKTQGRDILIQWWVSLLNYLNYNNNDNGNIFQFIEQQE
                     QEQQRDITVDDQGNKTLENLCLSLLSIIFECISKIITLLMILPSHSQREYDVYCHHIL
                     LTIENISNILISNSRHRSLQFYQKYNSLLAPFLGKLNAFGLIYLPDDQYFDVHLLLTF
                     YPIEHLTIKQLNKTTSSKTSIFAWKERNFKLQNSENSNDLKSKKTLIDRQKINHCLLV
                     KNFKIIQSYLKNDQIFMSFYWHYWYIIICTLSSSQFKVMDLNQIPTSKIILKYATSGL
                     LKADITNLNSFITKNTLIPKFNKNSLNNNELINDTMPDVNINDINGTKKVNKNILSPS
                     QINDHIFKYFKSIKLWECLESLVVLFSKRTHGDSDNNNDDETLQYCKKLIKTHDSFTL
                     KFMSRISAYDYNTGNIIFNKLFQFIIYKFHKYDHNLTFVSSFNWSKWLDGMIAMLKTN
                     NLNSQIVTIICLFNIWSLLPSRIQMHFATELIELNQSLIFDTLLIESFSNVIPILLWK
                     FIIFKMIPSITKEEDFTDTIRKSIFLKINEIYNELVSIQNYLNNLQNEKSKVKYFNRV
                     NLSIEDNLLFYDNKKLIIKREWPFLSSIVSSNNTISNNNAKKNENKKQKQKKNDKDLS
                     FPTLTSIFTKSPTLIQTGGSYPYDVIEQRTDGFQHSSDDDSSDNDGDDHVDTTYDVEF
                     DLKSTFNSWFSKLVTTTTPEEEDDENDDEVRNEYGDENAYNANIIDAPELTYMDSLME
                     KIKYDPTKVLSSTNGNNKVFNVFHMVNFANESFKYHKRLNQYNRIWRSKAREEKQLPK
                     LPNSVDGMDKDIPVAIKDSISTEIKGNTVNEYNDKDSFDIKLPYPDLSLLGIDSIIPV
                     ETNDMVIDEKSNTSKNMDTRIMKLITRQNKLVKFINIFNLTMEEYYDFLNLVNSDHTN
                     VFLEFEIIKPSGI"
     gene            complement(<1015358..>1017577)
                     /gene="NDAI0D04320"
                     /locus_tag="NDAI_0D04320"
                     /db_xref="GeneID:11495046"
     mRNA            complement(<1015358..>1017577)
                     /gene="NDAI0D04320"
                     /locus_tag="NDAI_0D04320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669941.1"
                     /db_xref="GeneID:11495046"
     CDS             complement(1015358..1017577)
                     /gene="NDAI0D04320"
                     /locus_tag="NDAI_0D04320"
                     /inference="similar to DNA sequence:INSDC:YLR403W"
                     /note="similar to Saccharomyces cerevisiae SFP1 (YLR403W);
                     ancestral locus Anc_4.265"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669989.1"
                     /db_xref="GeneID:11495046"
                     /db_xref="GOA:G0WAD5"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0WAD5"
                     /translation="MSTSNLTTTTANSASVSSTGFGSNIPSISITNTSLSPSPSSPSS
                     TITASNNNTTNMFPNHQDPHSLDPLAMSSNSISLNPSNNTINNNSSNNSNNHHHNGNN
                     SAVDLAKLRRESIAHSQGMGGVTWGSLTIGSWLKDEVMFHATLKNPNSNPMISKSRNN
                     SIFNTLRRPSINVNNINYYASFGNSHSPPVSHNAYMPDLEQEYCKDYSCCGLSLPSLH
                     DLLRHYEDAHIESGNPTSNSISSNTTTATTTGKKTKKVQSQNKQNIHNSDNNNQTHII
                     QQTLDQNKNTIPMNQSTTTSNAKSKKSKLSSMDPSSSSSSSSSSTTNSNTHTNTSVPI
                     NNNNNNTKTNTNTNINGNLVDTVPTSDVFLQPTINSNNNNNTRLLTLLLLQQYHIILS
                     TITHSITVVVVTIITITIKVIPLKKINNNLNISNNLLSNATNANNNNNNNNNNSDFSM
                     RNDSIDISFMDGNLLTNDTSFSPTFMNIDHHMASSMNDPSQFLSQQSQQQSHRLSSTT
                     TAGVMGPPTQHSINNVLSNLHNHTYNSNNNNNHNNNHNNNIQSNNMSLDATTAAVNLP
                     QHGLINANILHSKNSTNTNTMTPQTFQLPSRQNNNTTTNNNNNTNINKNNNTSNNNNN
                     PHINKHQQPGYIDDPARRLYVMDHEEHKPFKCPVIGCEKTYKNQNGLKYHKLHGHQNQ
                     KLQENPDGTFTILDPDSNEPFFDNQGNAKDKPYRCEVCGKRYKNLNGLKYHRGHSTH"
     gap             1020975..1020994
                     /estimated_length=20
     gene            complement(<1021095..>1021826)
                     /gene="NDAI0D04330"
                     /locus_tag="NDAI_0D04330"
                     /db_xref="GeneID:11495047"
     mRNA            complement(<1021095..>1021826)
                     /gene="NDAI0D04330"
                     /locus_tag="NDAI_0D04330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669942.1"
                     /db_xref="GeneID:11495047"
     CDS             complement(1021095..1021826)
                     /gene="NDAI0D04330"
                     /locus_tag="NDAI_0D04330"
                     /inference="similar to DNA sequence:INSDC:YDL072C"
                     /note="similar to Saccharomyces cerevisiae YET3 (YDL072C);
                     ancestral locus Anc_4.263"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669990.1"
                     /db_xref="GeneID:11495047"
                     /db_xref="GOA:G0WAD6"
                     /db_xref="InterPro:IPR008417"
                     /db_xref="UniProtKB/TrEMBL:G0WAD6"
                     /translation="MAIYVIMLYMCKGSFPLSSYLTGYITHTSTSIHTTTTNRQVEEE
                     VVRTYNCPNPSLKAKQLLQTQHQQQQQQEDMSLYYSLVFAILVTEIILFAILALPIPS
                     KFRKPLTLILLKPFKIPPIQIALKCILSFILLLFIDSINKVININKELSTTSSNSNPT
                     PAISSSNDRIEILSRKFFAQRNMYLTGITLFLTFIVMRTFTLVNELLDLKDRYRIIEN
                     RIGGKGSKLSKEEQIEIDEKINYKN"
     gene            complement(<1021953..>1022774)
                     /gene="NDAI0D04340"
                     /locus_tag="NDAI_0D04340"
                     /db_xref="GeneID:11495048"
     mRNA            complement(<1021953..>1022774)
                     /gene="NDAI0D04340"
                     /locus_tag="NDAI_0D04340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669943.1"
                     /db_xref="GeneID:11495048"
     CDS             complement(1021953..1022774)
                     /gene="NDAI0D04340"
                     /locus_tag="NDAI_0D04340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669991.1"
                     /db_xref="GeneID:11495048"
                     /db_xref="UniProtKB/TrEMBL:G0WAD7"
                     /translation="MKSFLTKNYKKQTASSSSSLSLSLSLYPSKQLSTATTIGTHIKP
                     FQPLKPSLFSHRIIPNSTINFNNTYNNNIHDQLLRRNNQKDLIKIDKIINILQLKEKN
                     NRFNINPLELTKLLYVQKLNSYITIRNNDSKKITLKNLLNLGGSILNLQILKFYLNLY
                     GEGTNMYQNTNNNMNNMNNSFKLKNLQNSILKFTLSLNNNSTGNNVNLLGISNLNQPE
                     NKIPKRIRIKFDSNCLLIILGYLEMAMPTTKGRDILHPFIIERFIKPYIKHKYRI"
     gene            complement(<1023231..>1023413)
                     /gene="NDAI0D04350"
                     /locus_tag="NDAI_0D04350"
                     /db_xref="GeneID:11495049"
     mRNA            complement(<1023231..>1023413)
                     /gene="NDAI0D04350"
                     /locus_tag="NDAI_0D04350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669944.1"
                     /db_xref="GeneID:11495049"
     CDS             complement(1023231..1023413)
                     /gene="NDAI0D04350"
                     /locus_tag="NDAI_0D04350"
                     /inference="similar to DNA sequence:INSDC:YDL067C"
                     /note="similar to Saccharomyces cerevisiae COX9 (YDL067C);
                     ancestral locus Anc_4.257"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669992.1"
                     /db_xref="GeneID:11495049"
                     /db_xref="GOA:G0WAD8"
                     /db_xref="InterPro:IPR014368"
                     /db_xref="UniProtKB/TrEMBL:G0WAD8"
                     /translation="MTAIAPITGTLRRRIFTDIFIGFSLGGVIASYWWWGFHKQKVNK
                     REDYYAKLAELKNQEE"
     gene            <1024297..>1025571
                     /gene="NDAI0D04360"
                     /locus_tag="NDAI_0D04360"
                     /db_xref="GeneID:11495050"
     mRNA            <1024297..>1025571
                     /gene="NDAI0D04360"
                     /locus_tag="NDAI_0D04360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669945.1"
                     /db_xref="GeneID:11495050"
     CDS             1024297..1025571
                     /gene="NDAI0D04360"
                     /locus_tag="NDAI_0D04360"
                     /inference="similar to DNA sequence:INSDC:YDL066W"
                     /note="similar to Saccharomyces cerevisiae IDP1 (YDL066W);
                     ancestral locus Anc_4.254"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669993.1"
                     /db_xref="GeneID:11495050"
                     /db_xref="GOA:G0WAD9"
                     /db_xref="InterPro:IPR004790"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:G0WAD9"
                     /translation="MLSRRFLSSTATAAKNFNKIKVSTPVVELDGDEMTRIIWDQIKT
                     KLIKPYLDIDLKYYDLSIQSRDATKDQITIDAANAIKKYGVGIKCATITPDEARVKEF
                     NLTKMWKSPNGTIRNILGGTVFREPIVIPRIPRLIPGWEKPIIIGRHAHADQYKATDT
                     LIPGPGKLQLNFIPSNAQENSPITLDVYDYKGSGVALAMYNTDESIEGFAHSSFKLAI
                     DKKLNLFLSTKNTILKKYDGRFKDIFQSIYETHYKAKFQQLNINYEHRLIDDMVAQMI
                     KSKGGFIMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHFR
                     KFQKGEETSTNSIASIFAWSRGLLKRGELDKNDQLCKFANLLEAATLNTVQQDGIMTK
                     DLALASGSQYVNTDGFLNAVEKRLKLELESID"
     gene            complement(<1025686..>1026834)
                     /gene="NDAI0D04370"
                     /locus_tag="NDAI_0D04370"
                     /db_xref="GeneID:11495051"
     mRNA            complement(<1025686..>1026834)
                     /gene="NDAI0D04370"
                     /locus_tag="NDAI_0D04370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669946.1"
                     /db_xref="GeneID:11495051"
     CDS             complement(1025686..1026834)
                     /gene="NDAI0D04370"
                     /locus_tag="NDAI_0D04370"
                     /inference="similar to DNA sequence:INSDC:YDL065C"
                     /note="similar to Saccharomyces cerevisiae PEX19
                     (YDL065C); ancestral locus Anc_4.250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669994.1"
                     /db_xref="GeneID:11495051"
                     /db_xref="GOA:G0WAE0"
                     /db_xref="InterPro:IPR006708"
                     /db_xref="UniProtKB/TrEMBL:G0WAE0"
                     /translation="MSTHFSDEEEYDDLDDLLDEDPATLDQSDIKVKLNNTDSKDSIN
                     VINDNDKEEEKTRSISEKVEDNATIDNGTTNARSNANNKEVQNMIDEFAGLMKNQKKS
                     QDESKNGDIDEEEDAKLMEKFTNVLNTLDNVTKHPQTSVKNDNTTTTTTTTTATNNVM
                     GNDKEDDEEGGFHKIVSKTLDRLKENDKKINDKLSDENNGGKKNKNVSSSENGNPDDI
                     LSSLLDQLVQGGEQGEGDIGEDGMDNAILNILNQMSSKEVLHQPMKEMYLEFDEWFKD
                     HREEEEFKDKIVTYDKQYLIIGKIVTLYEKDDYTNDLYRDEITNLLDELEQLGDTPVG
                     NVNAGAANGSSNNNTTMDDFSKLLNIDGLGDDNMDGFDEKLKDTCNQQ"
     gene            <1027182..>1027757
                     /gene="NDAI0D04380"
                     /locus_tag="NDAI_0D04380"
                     /db_xref="GeneID:11495155"
     mRNA            join(<1027182..1027219,1027322..>1027757)
                     /gene="NDAI0D04380"
                     /locus_tag="NDAI_0D04380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669947.1"
                     /db_xref="GeneID:11495155"
     CDS             join(1027182..1027219,1027322..1027757)
                     /gene="NDAI0D04380"
                     /locus_tag="NDAI_0D04380"
                     /inference="similar to DNA sequence:INSDC:YDL064W"
                     /note="similar to Saccharomyces cerevisiae UBC9 (YDL064W);
                     ancestral locus Anc_4.249"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669995.1"
                     /db_xref="GeneID:11495155"
                     /db_xref="GOA:G0WAE1"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="InterPro:IPR027230"
                     /db_xref="UniProtKB/TrEMBL:G0WAE1"
                     /translation="MSSLCLQRLQEERKKWRKDHPFGFFAKPTKKTDGTMNLQKWEAG
                     IPGKEGTLWAEGVYPITIEYPNEYPSKPPKVKLPAGFYHPNVYPSGTICLSILNEEQD
                     WRPAITLKQICLGIQDLLDSPNPNSPAQEPAWRSFSKNKVEYEKKVALQAKQYAK"
     gene            complement(<1028044..>1029963)
                     /gene="NDAI0D04390"
                     /locus_tag="NDAI_0D04390"
                     /db_xref="GeneID:11495156"
     mRNA            complement(<1028044..>1029963)
                     /gene="NDAI0D04390"
                     /locus_tag="NDAI_0D04390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669948.1"
                     /db_xref="GeneID:11495156"
     CDS             complement(1028044..1029963)
                     /gene="NDAI0D04390"
                     /locus_tag="NDAI_0D04390"
                     /inference="similar to DNA sequence:INSDC:YDL063C"
                     /note="similar to Saccharomyces cerevisiae YDL063C;
                     ancestral locus Anc_4.248"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669996.1"
                     /db_xref="GeneID:11495156"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0WAE2"
                     /translation="MGKSKKRSRASKARLNPLANNNDKGALNKKDANLVTKKIQPLLN
                     QLKSSVPNDRNMALNSVTVLCEDPHMRGLFLKEKLIQTILTNLLTDENIEIVVESYGL
                     LRNLALEEGYDVSMYLWRSDIWKSITLGFEKIVTSLNVMVSPSNDNTKSFGESKRLLF
                     DFIDNLLSLVIALSNGSNSILDDILSTEKTSQLFQLIIEILKFGHNKNNLPTKVFNQI
                     LDFIYDFSSESFEFIDAVKENEPIMSWLTSLFTNPESLNGDVLTETLIKGIFLQFQDD
                     NLTISQCEQLLSSLIKTTQETSLSLEKIERDLSVTIEDEELIKQSNNIANTGEKLKDY
                     TKRRSLAQIKLQHIEISLDIITGTIESAAIIMTSNNNTTEDFNGINNLLLDPTMIPQL
                     LLRLFDAFTARCLIIWNNLLWYALDAGFGVELVTLPEYKLIWDSIFKLNDEEFINKDI
                     GVLIGKYSTIWVFLKIIMTIANKDESNQLLQNVGLLNNSNFITGLQNKLIITTSGTAD
                     NGNANEDLELKQKYVSVLNCLAMIPGQDVKINQQIGQFFLEQMNSENTVVSTTIDIFS
                     SFCEIYSDGNFEYDETVFVQGGFLQILKDKIMPVFKSRFKLVDKNKEPELKERCREAF
                     NTLERFIQYKETERS"
     gene            complement(<1030507..>1030677)
                     /gene="NDAI0D04400"
                     /locus_tag="NDAI_0D04400"
                     /db_xref="GeneID:11495157"
     mRNA            complement(<1030507..>1030677)
                     /gene="NDAI0D04400"
                     /locus_tag="NDAI_0D04400"
                     /product="ribosomal protein S29"
                     /transcript_id="XM_003669949.1"
                     /db_xref="GeneID:11495157"
     CDS             complement(1030507..1030677)
                     /gene="NDAI0D04400"
                     /locus_tag="NDAI_0D04400"
                     /inference="similar to DNA sequence:INSDC:YDL061C,YLR388W"
                     /note="similar to Saccharomyces cerevisiae RPS29B
                     (YDL061C) and RPS29A (YLR388W); ancestral locus Anc_4.245"
                     /codon_start=1
                     /product="ribosomal protein S29"
                     /protein_id="XP_003669997.1"
                     /db_xref="GeneID:11495157"
                     /db_xref="GOA:G0WAE3"
                     /db_xref="InterPro:IPR001209"
                     /db_xref="InterPro:IPR018271"
                     /db_xref="UniProtKB/TrEMBL:G0WAE3"
                     /translation="MAHENVWFSHPRRYGKGSRQCRVCSSHTGLVRKYDLNICRQCFR
                     ERANDIGFYKYR"
     gene            complement(<1031862..>1032662)
                     /gene="NDAI0D04410"
                     /locus_tag="NDAI_0D04410"
                     /db_xref="GeneID:11495158"
     mRNA            complement(<1031862..>1032662)
                     /gene="NDAI0D04410"
                     /locus_tag="NDAI_0D04410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669950.1"
                     /db_xref="GeneID:11495158"
     CDS             complement(1031862..1032662)
                     /gene="NDAI0D04410"
                     /locus_tag="NDAI_0D04410"
                     /inference="similar to DNA sequence:INSDC:YDL059C"
                     /note="similar to Saccharomyces cerevisiae RAD59
                     (YDL059C); ancestral locus Anc_4.239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669998.1"
                     /db_xref="GeneID:11495158"
                     /db_xref="GOA:G0WAE4"
                     /db_xref="InterPro:IPR007232"
                     /db_xref="UniProtKB/TrEMBL:G0WAE4"
                     /translation="MSSFQSNHVSYEGTVYSTRPGLELQDFQLEEDWNGRPASEWSVT
                     RIGILQSKIEKYTYKIYHSNRFGKHNLSKLIARHKLVEFANETFGFDGWHMDVIDIDA
                     RELLNSSAKVNLTKTIGTNTNNNENSEDNDRKPKKIGIKDDEESKDNDNGDHNIKHTV
                     LAEAQVRITLKDGTNTQMGGIGKATMPFKGDSFSKAKKEAVNDALKKALLSFEKIILD
                     YETKVENNYYVDGLYVNKIKQTNFETIHDSNTNNNDISVPSRIKQEEF"
     gene            <1033897..>1039641
                     /gene="NDAI0D04420"
                     /locus_tag="NDAI_0D04420"
                     /db_xref="GeneID:11495159"
     mRNA            <1033897..>1039641
                     /gene="NDAI0D04420"
                     /locus_tag="NDAI_0D04420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669951.1"
                     /db_xref="GeneID:11495159"
     CDS             1033897..1039641
                     /gene="NDAI0D04420"
                     /locus_tag="NDAI_0D04420"
                     /inference="similar to DNA sequence:INSDC:YDL058W"
                     /note="similar to Saccharomyces cerevisiae USO1 (YDL058W);
                     ancestral locus Anc_4.238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669999.1"
                     /db_xref="GeneID:11495159"
                     /db_xref="GOA:G0WAE5"
                     /db_xref="InterPro:IPR006953"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024095"
                     /db_xref="UniProtKB/TrEMBL:G0WAE5"
                     /translation="MDLIQGFIQQPKPQSVDETIPTLCDRIKNATLINDRRSAVLGIK
                     AFSRQYRETVIASGLKPLLSTLQRDSIDDDMVRAILETLLILFIRGDGDVDLTRSWIS
                     QQSRLQNGKYPSPLLMKQEIENVDQFSLWIADALTQSEDLLHLIISFLETENFHIRLY
                     TIQLLEAVMATRPLKARSAIISLPTSISTIVNLLDDIHEPVRDEAILLLMAVVNDSPH
                     VQKLVAFENIFERLFNIIEEEGGLRGSLVVNDCLSLINNILKYNTSNQTLFLETGNLP
                     KLAHVLNEPLVENEEFFWNDQRIININTTLDIVALNVEPGNMVTSKHQMVLLQSNVFM
                     LVLRLAFFPTIPRKVRPIALLTAADIIRNNEYAQAEFTKIDVPYFDPSLPTVEKDTPQ
                     EETLSISVIDLLMNWILYANSVHTFDTRMAASELLKAYFYDNFQIQKDFLSHQIEVYT
                     NSNSLSSNSTHTSVKSNAFEVLLNYDPDLKLNPYKLFFVTDLVMYLFNDENGEAMELK
                     GLLKSLNHESVVVEGEQEEVDEQMSPIQTVLELLLTSLNSADIRIPISYTSLLIFWLY
                     GDLNAVNDFVSNRANIEQLLTFSYQIQDEDITIKCMISMLLGVSYEFSSKDSPFPRKE
                     YFEFFTKTIGRDNYSSRIKQFKNDSLFSKIDKSKLISHDLSFETDETGLPKIYFSEYF
                     IHLFNDNFHRIINALNHSPDDEPVAKLSFETFEEIQLKCNDLKNEIQELQTSSRSSID
                     SLQLKLDTITKEFEETSGNLKTYELNNSNLQAKLSQLESELNEAKETLKKVNDECREL
                     NKLKNENLQKLEKDNKKIQDLDTKLHKVQQELKISSEAKKKAHDDINKMSRDLIGLSR
                     EKQELEGKCGSLERDMKIKSNNFDQEKNKLNQKIQEKSKEIETLNKKLEELKNNITSL
                     EKEKDGTALALQHWKSKFESHDALVPKLTEKLKSLATSFKLLEKEKLALENDFTKYRS
                     EHSHQNAEFQKAIGDITKERDLLRSEKETLVANFSQLKELSDKLKTENSDHSAAYEAV
                     KNELEESMLHMNEQLKELETEKAEGDQKLANLEEKLNMMKKQLEDKDQQLTKLCEGEA
                     NNKKQLVTAEETISSLKADKETFMEKLEASGLEVEKLQTELKDTKLQHGEAETRLTNM
                     KKEHADKDIANNEKICSLEEDLKKQQIVMDKEKANAEELEEKLNEKETELADVLRNKA
                     AIEKELTESSEKIKTLNAELEALTEKLNQNEMEAEKLRENLLKDQNASKEEISALENT
                     LKELHSEKETQMEEKSKLESDIKSLETELDETKKKHASEIESLHEQIEKINEETKDFK
                     AIIEKAASNLKRTESDLKVLKEKYTKNEEKLKIMEVASKEHAELKKKQESEYELLENR
                     LKMLEEDVKLKEKELSEHKKSLLEAQEQEKSSTIELAKLKSAAADEKNKLEEEIKSCK
                     VELKNKAQAFEKERKLLNEGSSSITKEYSEKVSELEDKLEAVNSAHQSKLEELDSLKT
                     NMIELENKNSEQLKKEKASIVILEETISKQKKDIDNLHSEVEDSQEKCKNINKDLTKK
                     LREMQSASETYDSNLKRMEETIEEKNVEIEKSSKSIEELEKELGSQQLKLKDLQNENT
                     EVIKKNKDILDEKISEIGNLKEKNESLSEENETLSKSADQLKSEVSKRDEALKISKKV
                     IDEYKVKDEQLSKLQSQLAQVNKEYSDSKQAMEDLQKRIGDAEENTKQFNNTKKDDED
                     KIKQLEKEVEDMKAKLELSESSVANDQLKISELEKIIEDNKEILLAEKEVNQKQEKSI
                     QSLELEKKTVVEEKRKLEEKLDEESAQHIKKTETFAKENEEQKDELETLKEKLKTLEE
                     QNQKFKNKLEDKSELDDLMLLVTELDEKNSKYRLKLEELGAELTSDDDDDDDDDDDDD
                     EEDEDDGEEDDDEA"
     gene            <1040300..>1042711
                     /gene="NDAI0D04430"
                     /locus_tag="NDAI_0D04430"
                     /db_xref="GeneID:11495160"
     mRNA            <1040300..>1042711
                     /gene="NDAI0D04430"
                     /locus_tag="NDAI_0D04430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669952.1"
                     /db_xref="GeneID:11495160"
     CDS             1040300..1042711
                     /gene="NDAI0D04430"
                     /locus_tag="NDAI_0D04430"
                     /inference="similar to DNA sequence:INSDC:YDL056W"
                     /note="similar to Saccharomyces cerevisiae MBP1 (YDL056W);
                     ancestral locus Anc_4.232"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670000.1"
                     /db_xref="GeneID:11495160"
                     /db_xref="GOA:G0WAE6"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="InterPro:IPR018004"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G0WAE6"
                     /translation="MSDNKIYSARYSGVDVYEFVHPTGSVMKRKSDDWVNATHILKVA
                     NFSKAKRTRILEKEVLKETHEKVQGGFGKYQGTWVPMNIALNLAEKYGVYDELKVFFD
                     FKHLDGSASPPPAPKHHHASRTDSKRKATKSASMSVISDNPKGSKQPKLINMSTQAHI
                     GTILPTTYANEQNGEFTINNETTSGMAKRNGIAVINPVIRKSRRGRPPSVGTTQRKLG
                     VGKNVSLQRSQSDMIFPKPLIPNSSISTNQLPFIQRSTLEPLNELKQEMRKDQFREIK
                     IDDGLSSDIEQTDNNEINEHNFVAPRQSSAIKSKRSIHSIDSSPKSVPSSPNSGTTSP
                     LNDVDDEDGAQVPGTSPIRSGIARFSTEKKPEKTDINDKVNDYLSKLVEYFISDEMRT
                     NNPVADELLRPPPDSAPFIDSPIDSEQHSAFHWACSMGQLSIAEALFNAGANIRATNS
                     EGQTPLMRSAMFHNSYTKHTFPMIFKLLHETVFDEDRHGQTVLHHIIKRKSTTPSAVY
                     YLDIFLGSLKDFAQPYGIDLLMNAQDENGNTALHLAALNGDKRFFNTLISNGSLLTIQ
                     NKEGRTPNEIMNNKYEDGDTSNAMMINRSPTFPAAMVSDYLMYPSQAATTISRGIPNI
                     TNAMKRIADAYNDSYAQRDEEEKALVKTLKSISTTIDNIDGKTTEVLDNERGKDLDTL
                     IEKQLKDVEELQRSIARLKKEMESKLEYRETKRLDHFMKENSDDINTVSNDDNIDGRI
                     KLATELSVFQLKRKFFVQEILKLFDNNMKIHKYRRMISEGTEIKTDEIDACLDTILQS
                     LLNGS"
     gene            complement(<1043289..>1044374)
                     /gene="NDAI0D04440"
                     /locus_tag="NDAI_0D04440"
                     /db_xref="GeneID:11495161"
     mRNA            complement(<1043289..>1044374)
                     /gene="NDAI0D04440"
                     /locus_tag="NDAI_0D04440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669953.1"
                     /db_xref="GeneID:11495161"
     CDS             complement(1043289..1044374)
                     /gene="NDAI0D04440"
                     /locus_tag="NDAI_0D04440"
                     /inference="similar to DNA sequence:INSDC:YDL055C"
                     /note="similar to Saccharomyces cerevisiae PSA1 (YDL055C);
                     ancestral locus Anc_4.231"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670001.1"
                     /db_xref="GeneID:11495161"
                     /db_xref="GOA:G0WAE7"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR018357"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G0WAE7"
                     /translation="MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANA
                     GVTDIVLAVNYRPEVMVETLQKYEKEYGVNITFSVEEEPLDTAGPLKLAEKILKKDDS
                     PFFVLNSDVICEYPFKELADFHKAHGGKGTIVATKVDEPSKYGVIVHDIATPNLIDRF
                     VEKPKEFVGNRINAGIYILNPEVIDLIEMKPTSIEKETFPILVNEKSLYSFDLEGFWM
                     DVGQPKDFLSGTVLYLESLAKKSPEKLTTGSNIVGNALIDPTAKISPLAKIGPNVVIG
                     PNVTIGDGVRIERSVVLANSNIKEHSLVKSTIVGWNSTVGRWCRLEGVTVLGDDVNVK
                     DEIYINGGKVLPHKSIATNVPQESIIM"
     gene            <1045997..>1046926
                     /gene="NDAI0D04450"
                     /locus_tag="NDAI_0D04450"
                     /db_xref="GeneID:11495162"
     mRNA            <1045997..>1046926
                     /gene="NDAI0D04450"
                     /locus_tag="NDAI_0D04450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669954.1"
                     /db_xref="GeneID:11495162"
     CDS             1045997..1046926
                     /gene="NDAI0D04450"
                     /locus_tag="NDAI_0D04450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670002.1"
                     /db_xref="GeneID:11495162"
                     /db_xref="GOA:G0WAE8"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:G0WAE8"
                     /translation="MSDIFTNQTLTNLIQADTFQETLYNIYIHQPTLNIIEKYWATWY
                     IYMQNDTLATGLMFFLLHEFMYFFRCLPWFIIDQIPYFRRWKLQPTKIPTAKEQFFCL
                     KSVLLSHFLVEAIPIWTFHPMCQKLGITIAVPFPNWLLMAKEITLFFILEDIWHYWLH
                     RLFHYSYFYKYIHKQHHRYAAPFGLVAEYAHPIETMSLGFGTVGMPIFYVMYTGRLHL
                     FTLCCWITLRLFQAVDAHSGYDFPWSLNKFMPFWAGAEHHDLHHHYFIGNYASSFRWW
                     DYYMDTEAGPEAKLEREERMKLKALKKVKVKKH"
     gene            1048113..1048210
                     /gene="NDAI0Dtrna8K"
                     /locus_tag="NDAI_0Dtrna8K"
                     /db_xref="GeneID:11495151"
     tRNA            join(1048113..1048150,1048174..1048210)
                     /gene="NDAI0Dtrna8K"
                     /locus_tag="NDAI_0Dtrna8K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAA"
                     /db_xref="GeneID:11495151"
     gene            complement(<1048402..>1049994)
                     /gene="NDAI0D04460"
                     /locus_tag="NDAI_0D04460"
                     /db_xref="GeneID:11494841"
     mRNA            complement(<1048402..>1049994)
                     /gene="NDAI0D04460"
                     /locus_tag="NDAI_0D04460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669955.1"
                     /db_xref="GeneID:11494841"
     CDS             complement(1048402..1049994)
                     /gene="NDAI0D04460"
                     /locus_tag="NDAI_0D04460"
                     /inference="similar to DNA sequence:INSDC:YDL054C"
                     /note="similar to Saccharomyces cerevisiae MCH1 (YDL054C);
                     ancestral locus Anc_4.229"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670003.1"
                     /db_xref="GeneID:11494841"
                     /db_xref="GOA:G0WAE9"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G0WAE9"
                     /translation="MPISGLEHYLSYHLRIILPHVLSKSSSRRVAYLFSLFSAITSGF
                     ITLISLYSQPWQTHLHYSSWQINMISSVTNLGMYLTPPILGIIADNHGPITLSCLSIL
                     GFIPSYAYLGHIFYNPPPHNSITNSEPLSSLSFNLTLLCFMIIGISTSALYFSALITC
                     TKLYPTKKLLSISLPTTSFGISSLVGSQLLRIPWFWSIPSSSSSSFSSTAIETDKILN
                     LGRVFHTFAWLYVIIGIFAWVATGTVSMLNCSKEEELQIEQNYHSSVNKYQDREQQPL
                     LSNGTNSDYSSSGSNIINEVQTEQEIEPIKSNSMVTIFKDPLTYVLAISMLLSLGPLE
                     MFVTNMSSLSHLLIKHETTTLSSQILSIYAFSSTLARLSTGLTMDLFSRYKISLKWLL
                     LSLLSLGLFSQALILHFTTGATTSTVIASTDLLFMSILLGQVYGGLFTIYPTITLVIY
                     GEKLFGTAYGSLMVAPAIGSIVSCMSYAKVYDSNCNVSDTGVMGRNCISPVYKMTVLQ
                     FVLSIGLTGTAFYFWRKRRISF"
     gene            complement(<1050483..>1050953)
                     /gene="NDAI0D04470"
                     /locus_tag="NDAI_0D04470"
                     /db_xref="GeneID:11495164"
     mRNA            complement(<1050483..>1050953)
                     /gene="NDAI0D04470"
                     /locus_tag="NDAI_0D04470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669956.1"
                     /db_xref="GeneID:11495164"
     CDS             complement(1050483..1050953)
                     /gene="NDAI0D04470"
                     /locus_tag="NDAI_0D04470"
                     /inference="similar to DNA sequence:INSDC:YDL053C"
                     /note="similar to Saccharomyces cerevisiae PBP4 (YDL053C);
                     ancestral locus Anc_4.228"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670004.1"
                     /db_xref="GeneID:11495164"
                     /db_xref="UniProtKB/TrEMBL:G0WAF0"
                     /translation="MTNTSTISSKSSTITQKPKSTGWAQATAKSLPKQQETKNTKPKP
                     SSASSNDKSILKTADTDVTESKYKNKKNLAVHREPFNQKTVKAYMDKSFKKYLNDPNV
                     TKYEDITIQIFGTKNSSPDWDTVTSYNKKKNRKNNKYVCLNPLLKKFETISSSK"
     gene            complement(<1051289..>1052089)
                     /gene="NDAI0D04480"
                     /locus_tag="NDAI_0D04480"
                     /db_xref="GeneID:11495165"
     mRNA            complement(<1051289..>1052089)
                     /gene="NDAI0D04480"
                     /locus_tag="NDAI_0D04480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669957.1"
                     /db_xref="GeneID:11495165"
     CDS             complement(1051289..1052089)
                     /gene="NDAI0D04480"
                     /locus_tag="NDAI_0D04480"
                     /inference="similar to DNA sequence:INSDC:YDL052C"
                     /note="similar to Saccharomyces cerevisiae SLC1 (YDL052C);
                     ancestral locus Anc_4.226"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670005.1"
                     /db_xref="GeneID:11495165"
                     /db_xref="GOA:G0WAF1"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="InterPro:IPR004552"
                     /db_xref="UniProtKB/TrEMBL:G0WAF1"
                     /translation="MGSNIVYYLRSTLGIFVLIICAIYGVIASIVCTLIGKQHLAQYL
                     TARCYSNAMKYIMNIDVKVIDEENLKNLPFIVVSNHQSMLDILMLGKLFPPGCTITAK
                     KSLKYVPFLGWFMALSGTLFLDRSNRTKSVTTLHNGLTKIRNNKRAIWIFPEGTRSHT
                     TDLEMLPFKKGAFHLAQQGKLPIVPVVVANTSTIKSSKWKVYNTGCMVVKVLKPLSTE
                     GLQKDDIPAFSEKVRDLMDKELKELGYCPANNITNLPPNVLEAQKKNL"
     gene            <1053319..>1054158
                     /gene="NDAI0D04490"
                     /locus_tag="NDAI_0D04490"
                     /db_xref="GeneID:11495166"
     mRNA            <1053319..>1054158
                     /gene="NDAI0D04490"
                     /locus_tag="NDAI_0D04490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669958.1"
                     /db_xref="GeneID:11495166"
     CDS             1053319..1054158
                     /gene="NDAI0D04490"
                     /locus_tag="NDAI_0D04490"
                     /inference="similar to DNA sequence:INSDC:YDL051W"
                     /note="similar to Saccharomyces cerevisiae LHP1 (YDL051W);
                     ancestral locus Anc_4.224"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670006.1"
                     /db_xref="GeneID:11495166"
                     /db_xref="GOA:G0WAF2"
                     /db_xref="InterPro:IPR002344"
                     /db_xref="InterPro:IPR006630"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G0WAF2"
                     /translation="MSESADVTPQPRRNSFSPIEFNAKISQQCLKQVEFYFSESNFPY
                     DKFLRSTAEKNDGWVPISTIATFNRMKKYRPVDKVIEILKTSKILQVSEDGENVKRIV
                     PLDLSKDSKNSKRFDQNKRTLVIMNFPHENVDVEFIELQENIENFLHDLANVNQVRLR
                     KDHQKKFNGNVIVEFQTLNDCEDFKKKYSVDNKENPDQKEPLETLSYENRKLNVLTKK
                     QFDLQREATKSKNFSGSGQRSRSFTGHRKNMPKITPPESTEKENETAEKASESAIEAD
                     KEN"
     gene            complement(<1054661..>1055473)
                     /gene="NDAI0D04500"
                     /locus_tag="NDAI_0D04500"
                     /db_xref="GeneID:11495167"
     mRNA            complement(<1054661..>1055473)
                     /gene="NDAI0D04500"
                     /locus_tag="NDAI_0D04500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669959.1"
                     /db_xref="GeneID:11495167"
     CDS             complement(1054661..1055473)
                     /gene="NDAI0D04500"
                     /locus_tag="NDAI_0D04500"
                     /inference="similar to DNA sequence:INSDC:YDL049C"
                     /note="similar to Saccharomyces cerevisiae KNH1 (YDL049C);
                     ancestral locus Anc_4.223"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670007.1"
                     /db_xref="GeneID:11495167"
                     /db_xref="GOA:G0WAF3"
                     /db_xref="InterPro:IPR008659"
                     /db_xref="InterPro:IPR018466"
                     /db_xref="UniProtKB/TrEMBL:G0WAF3"
                     /translation="MQLRLIYILPIFVFLLNLVKADLTIITPEPGEKYDLSETGEVSI
                     DLSWVYLDSTPSKADITSFTFSLCTGPNYKINCLATLAKVSAAEVDSDIYKANILGTL
                     GTDGVYYIQIFAQTESGYTIHYSPKFYLEGMTGVLVAYTIMESADPTPETRITTGAVG
                     ATIDSRSFTVPYTKQTGKARYAPMQMQPGTKLTAKSWTRKYATSAVTFYTSMRKSLQQ
                     VTTITPGWSYAISSDVNYATHAPFPSDNGGWYDPSKRLSLTTRKINLRKRAV"
     gene            complement(<1057468..>1059150)
                     /gene="NDAI0D04510"
                     /locus_tag="NDAI_0D04510"
                     /db_xref="GeneID:11495168"
     mRNA            complement(<1057468..>1059150)
                     /gene="NDAI0D04510"
                     /locus_tag="NDAI_0D04510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669960.1"
                     /db_xref="GeneID:11495168"
     CDS             complement(1057468..1059150)
                     /gene="NDAI0D04510"
                     /locus_tag="NDAI_0D04510"
                     /inference="similar to DNA sequence:INSDC:YDL048C,YLR375W"
                     /note="similar to Saccharomyces cerevisiae STP4 (YDL048C)
                     and STP3 (YLR375W); ancestral locus Anc_4.222"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670008.1"
                     /db_xref="GeneID:11495168"
                     /db_xref="GOA:G0WAF4"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0WAF4"
                     /translation="MTAAPLIQMNNPLPNEPTSNIVSSMNSMNSTTKNGTMKPIPTNS
                     TNSTNSPSPTETSPRTNSTMTSTMNSPTNGAYPVKLENNESSQVFLKPILNGYSNQPL
                     SNRNNITNGTYPVFNPITNSTSNTSTSTNNNNNNNNNNNNNDFNTTSSSRSSSVISSS
                     NNNNMAIKLPPISSFDSLILAAQTSSNPNTRRSNSLFANFMSPQQPPLSSMSNHIYSP
                     IIENQTKNSSITLNEPSPMHCNNGALKSLNILPRTRSASTVNIPGFSSLLSNSFQNSN
                     LSTPISTPSSSLNVSIAPSPLVSSCSSPTDTDNDSTIRRSSTSIKNIRTPMVNKLRTN
                     KNSDGSISISNSNANNSKSRKKKQCPTCLNYYANLSTHKSTHLTPEDRPHKCPICERG
                     FARNNDLIRHKKRHWKDEFIKDKFKILQDSDNPTNAVAGAAGSNNNLTTKQQRDLLKK
                     DQLKSLHQIKGAFKCPYNKSLINLDMEIYPEKKKEVLNFTPLSCHQTGVFSRCDTYKN
                     HLKALHFEYPPRTRKEDRGVVPGRCKHCGMGFVNVDVWLNKHVGKECGYYYH"
     gap             1060103..1060298
                     /estimated_length=196
     gene            <1060889..>1063849
                     /gene="NDAI0D04520"
                     /locus_tag="NDAI_0D04520"
                     /db_xref="GeneID:11495169"
     mRNA            <1060889..>1063849
                     /gene="NDAI0D04520"
                     /locus_tag="NDAI_0D04520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669961.1"
                     /db_xref="GeneID:11495169"
     CDS             1060889..1063849
                     /gene="NDAI0D04520"
                     /locus_tag="NDAI_0D04520"
                     /inference="similar to DNA sequence:INSDC:YGR071C,YLR373C"
                     /note="similar to Saccharomyces cerevisiae YGR071C and
                     VID22 (YLR373C); ancestral locus Anc_4.221"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670009.1"
                     /db_xref="GeneID:11495169"
                     /db_xref="GOA:G0WAF5"
                     /db_xref="InterPro:IPR003656"
                     /db_xref="UniProtKB/TrEMBL:G0WAF5"
                     /translation="MLSSHDSTEDPAGYSETLPSATEDATDKEENQPSITDTSIELPI
                     ENIGHNDHVLNSVDNTSDNDLNANVEENDITFAVTEHDGNTKWVPAQTLKKTNALLWT
                     HYLGIDGALNIVKCKHCNTILKRGPHDAAKNSTVNFRMHLKTAHKVTPNMSFYDEENI
                     LDNNVTKNLHSRESTLDDVSSTFDSQLFKRRKYIKKPKTLPPFTLDMSKEITKLKPRD
                     VPSETTIKTRQHFFPSNNLLAIVVASENLPLDFANNSALKLLMSSILTSLPTSPDSIR
                     ENIIGMATSINKMIRKSSIQNDYHLPFELDISHLRNDLIGTERKLLLCTLIMNGLKDL
                     PSFNFYSLSHQIWNQQYSLISIQFIDYVNSKLRILPISIEDMGNKPITPKLLNRQLYN
                     VISKYPGLTNSLLSISAPRKICDTLKSADPIPNEFGKRGYDHTENSVIHNYDDGEEEE
                     EHAEQEIINSVIENAIQNLHYQPCIVSALEDCVTVFFGLPSTNIYEEQISKSDMVSTL
                     RNKDDTALDSLIDLNRLDISLSIFEKISSFYEEINNDSWQMERFQATYSDIFGNNNNN
                     NNNNNDDDDDGENDILNQTKNPFNKKFYSSSIHCLKRFLRLRPLIENMTPFLQNEIFS
                     DLDFQIMKSTLLTLQSLNKLILLHYVSPSDFNFINIIPTILTIEAHINQQLEISKYNR
                     YKRPFLLVQNLIKSIKDRLLLNDTNLLGSFLSPIIVSNESRLKTVFGTTDTGKIIKRV
                     SNIAMKIVMKYVHVPDEEKLMEKGENGTHDESETEHEPEPFLQLAFGTIGRSSEKSPK
                     TRLIDDVQECCQQLFERLFLAFLRNVQSEYPKGRKIFCEKNGYIPTNDGQYRKVNASG
                     GANDYDDNDALGYEDSFSNALNDEDVHTGSQNILDPIEELLTIHLPLCDIFWNQYLMY
                     NTDPLFTIILNIVRSISSTSKRSEYAFLKNYRANISGSILEETIKVAVFDKQCAIGKV
                     DFNSDTLTSLGNYI"
     gene            complement(<1064213..>1065280)
                     /gene="NDAI0D04530"
                     /locus_tag="NDAI_0D04530"
                     /db_xref="GeneID:11495170"
     mRNA            complement(<1064213..>1065280)
                     /gene="NDAI0D04530"
                     /locus_tag="NDAI_0D04530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669962.1"
                     /db_xref="GeneID:11495170"
     CDS             complement(1064213..1065280)
                     /gene="NDAI0D04530"
                     /locus_tag="NDAI_0D04530"
                     /inference="similar to DNA sequence:INSDC:YLR372W"
                     /note="similar to Saccharomyces cerevisiae SUR4 (YLR372W);
                     ancestral locus Anc_4.220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670010.1"
                     /db_xref="GeneID:11495170"
                     /db_xref="GOA:G0WAF6"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:G0WAF6"
                     /translation="MEQIAEQVIANATNDATASIETVSSSLLDLLSTIPWVQYQAPSL
                     EHPFGLELWPIFSKAFEYFAGYPAEDFRFIHNETFLANGYQAMGVIAVYYVIIFGGQT
                     ILRALNAKPVTINLIFQLHNLFLTSASLVLLLLLVEQLIPMIYQHGLLWSICSPNAFA
                     PKLITLYYLNYLTKFIELIDTVFLVLKRKKLLFLHVYHHGATALLCYTQLVGHTSVEW
                     VPISLNLGVHVVMYWYYFLSSCKIRVWWKQWVTRFQIIQFIIDLVFVYFATYTFYAHK
                     YFDGILPHMGTCYGDQLAAAYGYLILTSYLLLFISFYVTSYYRRGAKKAAEKLEKKDI
                     IEGSTTSGVKKNTTKVSSRKA"
     gene            complement(<1066028..>1070323)
                     /gene="NDAI0D04540"
                     /locus_tag="NDAI_0D04540"
                     /db_xref="GeneID:11495171"
     mRNA            complement(<1066028..>1070323)
                     /gene="NDAI0D04540"
                     /locus_tag="NDAI_0D04540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669963.1"
                     /db_xref="GeneID:11495171"
     CDS             complement(1066028..1070323)
                     /gene="NDAI0D04540"
                     /locus_tag="NDAI_0D04540"
                     /inference="similar to DNA sequence:INSDC:YGR070W,YLR371W"
                     /note="similar to Saccharomyces cerevisiae ROM1 (YGR070W)
                     and ROM2 (YLR371W); ancestral locus Anc_4.219"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670011.1"
                     /db_xref="GeneID:11495171"
                     /db_xref="GOA:G0WAF7"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:G0WAF7"
                     /translation="MSKTNNDLNNRYNIYMDIFGTQRLPDTYPPHSVSSSSVTNHHKH
                     MNVITDENPNIPKRIEDIPDLNYIIAQDVSHLAIAENSEHEDDHDHNNDALLNQKTNI
                     KYVSETHTLSSSETSPISGPRKSNVSSELSEKIETPTSFASLVNPFVSKPLTNTKPIY
                     NTSPSTITTETLEQNRQIQSSHTPTTIPVQKANKNAFVQKKKPSLPQLSLNVLKKQSH
                     ASSSPSHTPTQSRKSPLQGFGFFSRPSSKDLHEQQLQQQQQQQQQQQQQRYNSNNSPR
                     NHSRSNSNSNSRSMSLTTSTLKNITSPFHGKSNDNNNNNNNNYQQQPHHGSATSNPFF
                     DSKMNGNTTATDYNNNNNDNFSMISHQTSSTIGLGLKTKLSSTSLSSKRYTSASGTSL
                     SHHQSYSQLQSSQQQYYKYHQHNHHGNNQQHRRRSSVLNTPLSASASTISKPILSASN
                     KKPRVYPALLSRVAKKFKESIELGEHKKDGLIYRGAFTGKHAVDVICSIIRSSDRNLA
                     LLLGRSLDAQKLFHDVVYEHRLRDSPYEVYEFTENSRFVGSAANNSHYPLMLLSSSTQ
                     LSNNTADTGMVGSTSQSSLSSNQQMALLQQQRQNSLSLSESQLPHSHTQSTITMHDTI
                     NNNNAEQDEMVSTVATVNGVFTLLAECYSPTCTKHKLCYSISCPRRLEQQARLNLKPK
                     GGLKRNISVVVDDDDDTDESLSWTTSVPKEIWENLPKKEIKRQEAIYEVFTSEKKFVK
                     SLEITRDTFMKTLSETNIIPADIRKNFIKHVFAHINDIYSVNRRFLEALSDRQKSSPV
                     VRGIGDIILRFIPFFEPFVAYVASRPYAKYLIETQRSVNPYFARFDEDMMNSSLRHGI
                     DSFLSQGVSRPGRYMLLVREIMKSSNPEKDSRDLEILTKAMDALKDFMKRIDKASGAA
                     QDRHDVKLLKQKILFKNEYVNMGLNDEKRKIKHEGILSRKELSRSDGTVVGDVQFYLL
                     DNMLLFLKAKAVNKWHQHKVFQRPIPLPLLFVCAGEDMPPLRKYIGSNADTSGTIVQS
                     EYNSTNPRNAITFLYYGAKHRYQVTLYAAQFAGLQTLLDKVKEEQARLINDTSLINVT
                     KISDKFFDYSNKINSVTTCDGGRKLLIATNSGLYSSDIKRQPRDKKNGSKPSILFSTP
                     IQLIQRNNITQVAVLEEFQSILLLVDKKLYSCPLTLLQVEGSSGTSFFKKHSKELINH
                     VNFFAEGDCNGKRLIVTAHSSSHSIKFFEHEHPLLSNKHGGGSSSTSGGNNNNSKKSI
                     KKKIIEVTFDSEPVSISFLKANLCIGCKKGFQIVSVSQNAHESLLDPADTSLEFALRD
                     SLKPMAIYRVGNMFLLYYTEFAFFVNNQGWRKKESHIIHWEGEPQKFAIWYPYILAFD
                     PNFIEIRKIETGELVRCILGDKIRLLQSNTQEILYVYEDYRGFDTVASLDFWG"
     gene            complement(<1071153..>1072079)
                     /gene="NDAI0D04560"
                     /locus_tag="NDAI_0D04560"
                     /db_xref="GeneID:11495172"
     mRNA            complement(<1071153..>1072079)
                     /gene="NDAI0D04560"
                     /locus_tag="NDAI_0D04560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669964.1"
                     /db_xref="GeneID:11495172"
     CDS             complement(1071153..1072079)
                     /gene="NDAI0D04560"
                     /locus_tag="NDAI_0D04560"
                     /inference="similar to DNA sequence:INSDC:YKL183W"
                     /note="similar to Saccharomyces cerevisiae LOT5 (YKL183W);
                     ancestral locus Anc_4.281"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670012.1"
                     /db_xref="GeneID:11495172"
                     /db_xref="UniProtKB/TrEMBL:G0WAF8"
                     /translation="MVKEKQQCQLALTKPTVENVIPYTQYKKTQPQFNNESTDDLLYD
                     NNGHHLILFGGGRDLVLTLLNTTSTATTSNAASSTTSRMENVELFILNSSIVLWFGIL
                     GHGLEIPYTSCIYHGTKSNNHERDGHKLEILLTLERDPILNEFFPRDHMEGTTFNYNN
                     SAGDGDLSSIELLLKPKYSTYDRHYNQEIETLFTFENFGINRGDELVLNCHEALSLGM
                     EVHGSEFEDTDNDDEDNTELESEAVFTGLSGILKSQNTYLNAGLADDLDGDSTMDNVF
                     SNDNYEAGMSMEFYNNQPATGRKNPRSDHPHL"
     gene            complement(<1072649..>1074064)
                     /gene="NDAI0D04570"
                     /locus_tag="NDAI_0D04570"
                     /db_xref="GeneID:11495173"
     mRNA            complement(<1072649..>1074064)
                     /gene="NDAI0D04570"
                     /locus_tag="NDAI_0D04570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669965.1"
                     /db_xref="GeneID:11495173"
     CDS             complement(1072649..1074064)
                     /gene="NDAI0D04570"
                     /locus_tag="NDAI_0D04570"
                     /inference="similar to DNA sequence:INSDC:YKL184W"
                     /note="similar to Saccharomyces cerevisiae SPE1 (YKL184W);
                     ancestral locus Anc_4.282"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670013.1"
                     /db_xref="GeneID:11495173"
                     /db_xref="GOA:G0WAF9"
                     /db_xref="InterPro:IPR000183"
                     /db_xref="InterPro:IPR002433"
                     /db_xref="InterPro:IPR009006"
                     /db_xref="InterPro:IPR022643"
                     /db_xref="InterPro:IPR022644"
                     /db_xref="InterPro:IPR022653"
                     /db_xref="InterPro:IPR022657"
                     /db_xref="InterPro:IPR029066"
                     /db_xref="UniProtKB/TrEMBL:G0WAF9"
                     /translation="MSTVKVELNSTLSNSTTTLVEMTNSSTQIKPDSKEDIFLNQYLE
                     SLKKDPKIAILPHRQSHAQISEALQSRIKTINDETCEPGDENSFFVCDLKEIRNLYDN
                     WHNKLPRIQPFYAVKCNPNPLILRQLASMGVNFDCASKLEIETILKMGVSPERIIYAN
                     PCKVSSFIRFAKEQNVKKSTFDNVEELYKIKKFHPNSDLFLRITTDDSTAQCRLSTKY
                     GCELQNVDELLSKVKELNLNLVGVSFHVGSGASDFSTLYKAVRDARFVFDKAIKDHSL
                     PALKILDVGGGFQFETFNESSAVLNMAIDEFFPENCGVDIIAEPGRYFVATAFTLAAH
                     VIAKRSVSQFDSNDDEHRIMLYINDGVYGNMNCILFDHQEPTPKILYHDGNFHYDDLQ
                     TSTPLANNNGVCPYKVSMWGPTCDGLDCITKEYYLKYDLVVGDWLYFPNLGAYTSSAA
                     TPFNGFDQTADIIYINQNESL"
     gene            complement(<1075178..>1077607)
                     /gene="NDAI0D04580"
                     /locus_tag="NDAI_0D04580"
                     /db_xref="GeneID:11495174"
     mRNA            complement(<1075178..>1077607)
                     /gene="NDAI0D04580"
                     /locus_tag="NDAI_0D04580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669966.1"
                     /db_xref="GeneID:11495174"
     CDS             complement(1075178..1077607)
                     /gene="NDAI0D04580"
                     /locus_tag="NDAI_0D04580"
                     /inference="similar to DNA sequence:INSDC:YKL185W"
                     /note="similar to Saccharomyces cerevisiae ASH1 (YKL185W);
                     ancestral locus Anc_4.283"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670014.1"
                     /db_xref="GeneID:11495174"
                     /db_xref="GOA:G0WAG0"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:G0WAG0"
                     /translation="MDNMSAMSLKSFSINHLPSTQEIDRPKTYFDDLLLPSSPRRIPT
                     LSAHKTSTKNILSNGLPALQFPQNKGLIGNHENTLDILLKKKANTAPGSPVHSGLQYY
                     KKLNNREFKRHHQKTKSISDITPQTSPTFNKAQLSPTLSSYSDSLINSNTHFTLTENL
                     SRNGKQNQNQISSPTLLPSISNLPQIHLLDRLPNHNHHGNIIKRTTNTTITTTTNKVT
                     KPIPRLPSLRHLKLLPDPTIQRNSHYYPDTSRPTPFWRDNLINWCKEKNYQEYKRLME
                     ILSQSDRNYCFEGTVPKNLFSLNSNSNLKLEKTCKISSILQPKDQFSNLSNNSWECQT
                     PVTPPMSPNDSPSSEGIQTKDKEDYNNNNNNNNNTDITDLTDDDIDIEEQNQKIRCSK
                     NKNSGNFIKFTPFISEKLVQTVKKEKLMKSNNNGSNITTTNNNTGHKKTNSFKALEIK
                     RLLENRDILSITSKTGHTTTRKNKNNNNMNMNKIFKPTKIRQNSSEIFNSVVKDLVEK
                     IDQRNSKHHHVNNIKKSAKITNNNNDIAPNSSGYTTPRCNSPIRSTATLPKYRKFFVQ
                     SSFPGQPIVSRSPSPSSSIASSTGSDSGSSTSNTSSIQNSPSYSPMRPTTINGEYVDY
                     LLTPTEGTSSLSSRMQPKLKSKLKTQSKSNKAKKSYRKKKENTKSNNNLEQGTHCVYK
                     HSDDTNDHCNINHPQHNGTNNSAGTSPRQHTHQQHLRRCVSCRSSDSPCWRPSWSKMK
                     HDQLCNSCGLRYKKTHTRCLNELCLKIPTKSELSMMKTNGIDKQFVHSRGETVEGYRC
                     LFCNYITETIE"
     gene            <1078911..>1079435
                     /gene="NDAI0D04590"
                     /locus_tag="NDAI_0D04590"
                     /db_xref="GeneID:11495175"
     mRNA            <1078911..>1079435
                     /gene="NDAI0D04590"
                     /locus_tag="NDAI_0D04590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669967.1"
                     /db_xref="GeneID:11495175"
     CDS             1078911..1079435
                     /gene="NDAI0D04590"
                     /locus_tag="NDAI_0D04590"
                     /inference="similar to DNA sequence:INSDC:YKL186C"
                     /note="similar to Saccharomyces cerevisiae MTR2 (YKL186C);
                     ancestral locus Anc_4.284"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670015.1"
                     /db_xref="GeneID:11495175"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="InterPro:IPR019488"
                     /db_xref="UniProtKB/TrEMBL:G0WAG1"
                     /translation="MNQGAATSHQPEILQTFIKKILLHLDDNETKNLQQFLSYFNNTN
                     CKIIFNGAPFAQPMIFLQMWQEQFVQTQHALTSLDYQIIPGSGTMILNINSKVRFDES
                     GRDRLGQDALIKDGSNRGGLNNNTRPIFGSYFGVSLQLVIDDRIFRNDFNGVISCFNY
                     NMLYKPEDSLIKIH"
     gene            <1081783..>1084083
                     /gene="NDAI0D04600"
                     /locus_tag="NDAI_0D04600"
                     /db_xref="GeneID:11495176"
     mRNA            <1081783..>1084083
                     /gene="NDAI0D04600"
                     /locus_tag="NDAI_0D04600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669968.1"
                     /db_xref="GeneID:11495176"
     CDS             1081783..1084083
                     /gene="NDAI0D04600"
                     /locus_tag="NDAI_0D04600"
                     /inference="similar to DNA sequence:INSDC:YKL187C,YLR413W"
                     /note="similar to Saccharomyces cerevisiae YKL187C and
                     YLR413W; ancestral locus Anc_4.285"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670016.1"
                     /db_xref="GeneID:11495176"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0WAG2"
                     /translation="MQPTTTFRGKNLLLSIIILFLFTIFIVIIVATAGSTANYKPLTN
                     IYIGDADISHINVTKIIPAVGPILVIMGTALTAPNSSLDEIFGSLKEIADTPALTPLL
                     TLLSNAEDVENSIIALSDLAPLALSGNPVSDTKELTEISGLLSVSNNDTGTLTGLSEL
                     VLPAMAHLNSSSSSSASDDSTTIVMTLLNDSIDPLNSTISLKYLNGLTPDDKVMMLPV
                     FRIFGSSDNITMTLQSLEGIMNADPPIPPQLASTLLTTIQSGLERSDNLTAVLSSIGS
                     LVPDAQRSSFNSVGQLLNASSSPNNTLSILSDLIEENITESQVAKNSFGELTSLMMNS
                     NNKSMVVQSVQSLAMVPNTTEADMQLDALTTMLRSTDNQNATVDTLATLSSGLSPNSS
                     TFEYIPSLFQLLGASKEPGESFSSLVTLTAWAQQNPETFTPIVAILNSAESVEQISEE
                     ALTVMTPTLLEFLKIPIHFRLSIFSLCKANLKNEIIECSSPHAVQNMDFRHIVYDALM
                     DSDFEPYLRALNITADSLQLDGRLQDREHEYVPSIKAVLAMNLLAIITSFFTMIFLFL
                     LIFLRRFIVHKTMWFCSLVLVLFVGLFTGLGATICQVVVSIIKSGTHHDRYGVVFSAG
                     SAYFGCVWTAFALAVVSNFIMLYIVWNMAEALLGRTFFRKRTSTRTDIEQGDGEEDEE
                     YDEEIPSRVVVDDDAIVRTGKKDDVENASNGSSGSRSGIEAEEKLPPTTNVMTATTAV
                     SGAERASDSASNEEEIVNEKNVNAYD"
     gene            <1084921..>1087599
                     /gene="NDAI0D04610"
                     /locus_tag="NDAI_0D04610"
                     /db_xref="GeneID:11495177"
     mRNA            <1084921..>1087599
                     /gene="NDAI0D04610"
                     /locus_tag="NDAI_0D04610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669969.1"
                     /db_xref="GeneID:11495177"
     CDS             1084921..1087599
                     /gene="NDAI0D04610"
                     /locus_tag="NDAI_0D04610"
                     /inference="similar to DNA sequence:INSDC:YKL188C"
                     /note="similar to Saccharomyces cerevisiae PXA2 (YKL188C);
                     ancestral locus Anc_4.287"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670017.1"
                     /db_xref="GeneID:11495177"
                     /db_xref="GOA:G0WAG3"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010509"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WAG3"
                     /translation="MTANVLSFYRRHRLRILKTSYILLLFTTLYNVNGGGSNTTANDR
                     KDNKKSQVTDKNDKTLPSYQRNKIKNSGRIEGYSGNEDNDEGEESDVQALIISPKNDR
                     LSKSRSGSNVEQEDKKNPNVSEPTPKRRRTDFLLKIILNDKKCLILFFTQAILLIIRT
                     FLSLHVATLDGKLVSSLVKAQYPKFLKILLGQWMVLGIPASFINALINYLTKLCSVTI
                     NRLISKVLLDKYLSSHHTFYAVAASTGVGTGTTPNKKDGSDDDNNNTTQRINSVSEIQ
                     DNLTKDIYTFSTNTSILLNQLLKPMLDLILCSFKLLMSSTNNMGEGTLALGLIVYGSN
                     SILKLIQPNFTSLTMKRASLESAFRSLHSNIHTHSEEIALLKGQDRELANLDFTFYKL
                     VLFLNREIKAKALYDLATTFIIKYTWGAAGLVLCSIPIFFKGDTTTNLDEELLIEDNS
                     NRDKQDEHDITADFITNRRLLLTASSSIGRFVELKKNVQQLRGVSLRLNEFNDLLDRN
                     LNPQLEEKDTSMIEYNNSLIKFENVPLITPANQVLVKNLSFELKHGDHLLIIGPNGCG
                     KSSLFRILGGLWPVRQIDDPNLKTKLILPKRSLNDETNGNKQECSIFYLPQKPYMGNR
                     STFREQIIYPDTMEQFLQRFNNDYEKGDKELTKILEALELDDLIAENLSLILAQRSMN
                     DQTSKKISIQEQSQAQAKNQGEKIEGDDVDDRDLIMVPSNGVETSSADDAETSSSSSI
                     INVRDAFDLRRNWSDELSIGVQQRLAMARMYYHRPKFAVLDECTSAVSPEMEQKMYKI
                     SQDFGISLISVCHRTSLWHFHNYLLRFDGKGGYQFNKFDPVKRLKEEEKLTELNSLLD
                     QQVPVWKKKLTDLKIARRSNLVKKSQSELNVTKTIA"
     gene            complement(<1088112..>1089665)
                     /gene="NDAI0D04620"
                     /locus_tag="NDAI_0D04620"
                     /db_xref="GeneID:11495178"
     mRNA            complement(<1088112..>1089665)
                     /gene="NDAI0D04620"
                     /locus_tag="NDAI_0D04620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669970.1"
                     /db_xref="GeneID:11495178"
     CDS             complement(1088112..1089665)
                     /gene="NDAI0D04620"
                     /locus_tag="NDAI_0D04620"
                     /inference="similar to DNA sequence:INSDC:YKL189W"
                     /note="similar to Saccharomyces cerevisiae HYM1 (YKL189W);
                     ancestral locus Anc_4.289"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670018.1"
                     /db_xref="GeneID:11495178"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013878"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR028637"
                     /db_xref="UniProtKB/TrEMBL:G0WAG4"
                     /translation="MFKKYKNQDLDMAFWWKKNPKTSSDYVKLISNQLAKIAASSSSS
                     TVLSTSSSQPNSTNAIAASNSSMNPSSSPNSTSATSDSNKKLQEECSKYLIGLKHFIL
                     ADTDPHPSPEAIDELYTAMFRSDLFYDLILHIPDLEFEARKEVMIIFAICLNYSKDNK
                     FVTVDYFIQQPKTINLMLKICESSLQQKRSASHDVFLVIGNMIIECIKYEQLCRIILK
                     DPQLWNFFEFAKLANFEISTQSLQILNAVFTTHSKLVSKEFFNNSNNIINFIKRINKL
                     MTHGNYVTKRQSTKLLASLIIQRNFNQLMNTYINAPESLKIIMNLMTDKSKNLQLEAF
                     NCFKILIANPRKSKPILDILIKNREKLLKYFETFGLDNQDPVFLNEREFVIDRIENLP
                     RIISANIDPSSSSTMANNPNINLMSSSPSSHNTTGILSPMNTANITNTTASLTTQTAT
                     PSSHKLANLSSHSRGGAAISNTSVANIINNNNSNVSENINSINHTSHTNHNHSSHNHG
                     HTSQDSHLS"
     gene            complement(1090019..1090102)
                     /gene="NDAI0Dtrna11L"
                     /locus_tag="NDAI_0Dtrna11L"
                     /db_xref="GeneID:11495179"
     tRNA            complement(1090019..1090102)
                     /gene="NDAI0Dtrna11L"
                     /locus_tag="NDAI_0Dtrna11L"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUA"
                     /db_xref="GeneID:11495179"
     gene            <1090486..>1091964
                     /gene="NDAI0D04630"
                     /locus_tag="NDAI_0D04630"
                     /db_xref="GeneID:11494816"
     mRNA            <1090486..>1091964
                     /gene="NDAI0D04630"
                     /locus_tag="NDAI_0D04630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669971.1"
                     /db_xref="GeneID:11494816"
     CDS             1090486..1091964
                     /gene="NDAI0D04630"
                     /locus_tag="NDAI_0D04630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670019.1"
                     /db_xref="GeneID:11494816"
                     /db_xref="GOA:G0WAG5"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="UniProtKB/TrEMBL:G0WAG5"
                     /translation="MVTRRRSRTVEESVDNSKESTLESNVNEEDQDESKEDEEDGPLP
                     KKIKLDNANGDTKDIVNDDDGDGAELSDKPSKEELITPTPVIVNLDDADAKDDDTDAK
                     VNGDTNIDSKNPVIDETIADEEKGIVSFEFDGVEYKFKERASVIEEKEGKIEFRVVNN
                     DNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVVRKPLTVVGGITYRP
                     FDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIGYFKK
                     QGFTKEITLDKSIWMGYIKDYEGGTLMQCSMLPKIRYLDAGKILLLQEAALRRKIRTI
                     SKSHVVRPGLEVFKELKNIKPIDPMTIPGLKEAGWTPEMDELAQRPKRGPHFAAIQNI
                     LTELQNHAAAWPFLQPVNKEEVPDYYEFIKEPMDLSTMEIKLENNKYQKMEDFIYDAR
                     LVFNNCRMYNGENTSYFKYANRLEKFFNSKIKEIPEYAGLLN"
     gene            complement(<1092523..>1093050)
                     /gene="NDAI0D04640"
                     /locus_tag="NDAI_0D04640"
                     /db_xref="GeneID:11495180"
     mRNA            complement(<1092523..>1093050)
                     /gene="NDAI0D04640"
                     /locus_tag="NDAI_0D04640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669972.1"
                     /db_xref="GeneID:11495180"
     CDS             complement(1092523..1093050)
                     /gene="NDAI0D04640"
                     /locus_tag="NDAI_0D04640"
                     /inference="similar to DNA sequence:INSDC:YKL190W"
                     /note="similar to Saccharomyces cerevisiae CNB1 (YKL190W);
                     ancestral locus Anc_4.292"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670020.1"
                     /db_xref="GeneID:11495180"
                     /db_xref="GOA:G0WAG6"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:G0WAG6"
                     /translation="MGAAPSKIVDNLLEDTNFDLDEIERLRKRFMKLDRDSSGSIDKN
                     EFMSIPGVSSNPLAGRIMEVFDADNSGDVDFQEFITGLSIFSGRGSKNEKLKFAFKIY
                     DIDKDGFISNGELFIVLKIMVGSNLNDEQLQQIVDRTIMENDLDGDGHLSFEEFKSAI
                     ETTEVAKSLTLDIDI"
     gene            complement(<1094078..>1095856)
                     /gene="NDAI0D04650"
                     /locus_tag="NDAI_0D04650"
                     /db_xref="GeneID:11495181"
     mRNA            complement(<1094078..>1095856)
                     /gene="NDAI0D04650"
                     /locus_tag="NDAI_0D04650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669973.1"
                     /db_xref="GeneID:11495181"
     CDS             complement(1094078..1095856)
                     /gene="NDAI0D04650"
                     /locus_tag="NDAI_0D04650"
                     /inference="similar to DNA sequence:INSDC:YKL191W"
                     /note="similar to Saccharomyces cerevisiae DPH2 (YKL191W);
                     ancestral locus Anc_4.293"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670021.1"
                     /db_xref="GeneID:11495181"
                     /db_xref="GOA:G0WAG7"
                     /db_xref="InterPro:IPR002728"
                     /db_xref="InterPro:IPR010014"
                     /db_xref="UniProtKB/TrEMBL:G0WAG7"
                     /translation="MVETNAELPSSVPAPVAFSTVQTANEFTFQKFDTLKEDREFYLG
                     PHTTLEELREKINDYYALDELITFLNENQDKNYNDITLQFPDPLIKDSTFITNILQDK
                     FAELKTATSKEEKNTIIPKFWVLADTAYSACCVDEVAAEHVNADLVVHFGDACLNAIQ
                     KLPVVYSLGRPYLPLHDIIEKFKTQFPDKSSKVCLMSNSAYTLHMKPLFDHLTDVEGY
                     ENLIYSQINAAMASDQATILGEEHSLTATESDKCVVTLGSRLLFSRNQDLTIGNGIQD
                     DEETLTILQNEYDLFHLTVPQDPHLLYLTTVFKSVVLYDNKNENVITGPFPSMMKRYK
                     YMSVARTAGCIGILVNTLSLRNTKETINQLTKLIRNSGKKHYLFVVGKPNVAKLANFE
                     PVDIWCILGCSQSGIIIDQINEFYKPIITPYELTMALNDEVTWTGKWVVDFKKALEQI
                     SDQIDDQESKPPSTANMEESEAPEFDVVTGKYVSTSRPLRNVYHLELESPSENSGIQT
                     RGDSSNQVIKRTVGGDVIKGTVSTSVSHLQSRNWKGLGSDFSEQDNYEEEGATVEQGI
                     SGVARGYGFDRTDAIAKKNAGAGQSK"
     gene            <1096345..>1097463
                     /gene="NDAI0D04660"
                     /locus_tag="NDAI_0D04660"
                     /db_xref="GeneID:11495182"
     mRNA            <1096345..>1097463
                     /gene="NDAI0D04660"
                     /locus_tag="NDAI_0D04660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669974.1"
                     /db_xref="GeneID:11495182"
     CDS             1096345..1097463
                     /gene="NDAI0D04660"
                     /locus_tag="NDAI_0D04660"
                     /inference="similar to DNA sequence:INSDC:YKL193C"
                     /note="similar to Saccharomyces cerevisiae SDS22
                     (YKL193C); ancestral locus Anc_4.298"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670022.1"
                     /db_xref="GeneID:11495182"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:G0WAG8"
                     /translation="MSTSQDKDITPTAAHFEAEQDQDQEQDVTNVTSSPSQTPPITDT
                     APTTTSQGMQVIEDEHPEFITADSDLTTDLPEDIDVIDLIHLKIRSLEELNLYRFKEL
                     TQLCLRQNLIESISEVEVLPHDKITDLDFYDNRIKHISSNVNYLTNLKNLDLSFNKIK
                     NIKNIDKLINLENLYFVQNKISKIENLSTLKNLKNLELGGNRLQELEKDAFVGLENLQ
                     EIWLGKNAIPKLVNLSPLKNLKILSIQANRLKKIEGLEELTNLEELYVSNNFISKLEG
                     LENNKKLTILDITANKITKIENISHLKQLTDLWASFNKIDQSFQSLGEEMTDLPVFET
                     IYLEGNPIQLQNETSYRRKLILTLGPSLQKIDATFIRG"
     gene            <1097768..>1099147
                     /gene="NDAI0D04670"
                     /locus_tag="NDAI_0D04670"
                     /db_xref="GeneID:11495183"
     mRNA            <1097768..>1099147
                     /gene="NDAI0D04670"
                     /locus_tag="NDAI_0D04670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669975.1"
                     /db_xref="GeneID:11495183"
     CDS             1097768..1099147
                     /gene="NDAI0D04670"
                     /locus_tag="NDAI_0D04670"
                     /inference="similar to DNA sequence:INSDC:YKL194C"
                     /note="similar to Saccharomyces cerevisiae MST1 (YKL194C);
                     ancestral locus Anc_4.299"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670023.1"
                     /db_xref="GeneID:11495183"
                     /db_xref="GOA:G0WAG9"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002320"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:G0WAG9"
                     /translation="MRRTASTCLSSKKTRISRAIWFNNYSTKPPINTTSLLQEVSTKQ
                     KLFSTDPISPGSIFFLPNGTKIFNKLISFMKVQQLQPIFGFKEVITPLIYKKSLWEKS
                     GHWANYKEDMFHVEGEDIEKETFGLKPMNCPGHCVIFNKTDHSYNELPIRYSDFSPLH
                     RNEPSGSLSGLTRLRKFHQDDGHIFCTPEQVEQEILNCLKFIDLCYIKVFKLTNGYTI
                     NFSTRPTDHYIGELPVWNHAENVLQSILTKSGKPWELNEGDGVFYGPKLDIMIKDHNG
                     KSHQVATIQLDFQLPERFDLKYKDADNTYKRPIMIHRAVFGSVERFLGLLIDQNKGKW
                     PFWLNPYQVMIIPINTKNQDHLATAKMLVDKLRGTTTGIDNANNLEPIPMHGYQFNAD
                     LDDRSEPVGYRIKDAILKYYSYLIIIGDEEVKTGKFSVKERDNRSNLQHLTTDEIIEK
                     FSTLEEKYM"
     gene            complement(<1099332..>1101230)
                     /gene="NDAI0D04680"
                     /locus_tag="NDAI_0D04680"
                     /db_xref="GeneID:11495184"
     mRNA            complement(<1099332..>1101230)
                     /gene="NDAI0D04680"
                     /locus_tag="NDAI_0D04680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669976.1"
                     /db_xref="GeneID:11495184"
     CDS             complement(1099332..1101230)
                     /gene="NDAI0D04680"
                     /locus_tag="NDAI_0D04680"
                     /inference="similar to DNA sequence:INSDC:YKL195W"
                     /note="similar to Saccharomyces cerevisiae MIA40
                     (YKL195W); ancestral locus Anc_4.302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670024.1"
                     /db_xref="GeneID:11495184"
                     /db_xref="UniProtKB/TrEMBL:G0WAH0"
                     /translation="MLPIRRRLPNAFPSVITIRRSVGIIRSRNNNKNLIWVPCRHFSS
                     SSPSLTRSLIPLSIQSYFRKKPTGQTISAILITLLITTSAIYWISPNKNKHTLPTIDA
                     HENLPAGNVETLKNPSLEDLRNTSENIEDHFVTDNTGTNQPIDPKESTLDGPRIEIPV
                     LSEENIRNTEDILLSDENDDDNRHEEQSASTELSGDILSDESINSERDGENDSVVWFD
                     SVIPPSIGSDEEPSKDNIITEDQISNADELKRLEDEINTRQVKEQSNPSPTESEHVPN
                     LATGSISNHLDESKNPVHEEKEEQFYLEEINIPGDITILNPRSSVPQDHECEEEKQKI
                     TTTTVQRTTPSEFEEFEDTEDEESLSTNDSLNYEEIIIPGDINLISMNDHKFHHNGDN
                     KKTVEDVKINTSQPENIIKVVPGIENSNNETNENNYARNPEVGVPTSATTEDEDRKEE
                     ASRKVVEDRLVEERETNKSAGSVTNDIENDIENKKEETDTKIELSSNSNEPGIDEIIE
                     ANTLTKQDIDETLSQDEEENMKKKEKELHEEGAYNPDTGEINWDCPCLGGMAQGPCGN
                     EFKIAFSCFVYSKTEPKGSDCWDKFKNMQTCFRLYPEYYSNDIGKNESKSEVIKPKAD
                     TNTQLPPS"
     gene            <1101865..>1102467
                     /gene="NDAI0D04690"
                     /locus_tag="NDAI_0D04690"
                     /db_xref="GeneID:11495185"
     mRNA            <1101865..>1102467
                     /gene="NDAI0D04690"
                     /locus_tag="NDAI_0D04690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669977.1"
                     /db_xref="GeneID:11495185"
     CDS             1101865..1102467
                     /gene="NDAI0D04690"
                     /locus_tag="NDAI_0D04690"
                     /inference="similar to DNA sequence:INSDC:YKL196C"
                     /note="similar to Saccharomyces cerevisiae YKT6 (YKL196C);
                     ancestral locus Anc_4.303"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670025.1"
                     /db_xref="GeneID:11495185"
                     /db_xref="GOA:G0WAH1"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR010908"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:G0WAH1"
                     /translation="MKINYIGVFRTGGDKALELSEVKDLSQFGFFERSSVGQFMTFFA
                     ETVASRTNPGQRQSIEEGDYIGHVYARSEGICGVLITDKEYPVRPAYTLLNKILDEYL
                     VAHTPQTWQNVTETNESLKMKELDTYITKYQDPSQADAIMKVQQELDETKIVLHKTIE
                     NVLQRGEKLDNLVDKSESLTASSKMFYKQAKKTNSCCTIM"
     gene            complement(1102705..1102778)
                     /gene="NDAI0Dtrna4N"
                     /locus_tag="NDAI_0Dtrna4N"
                     /db_xref="GeneID:11495186"
     tRNA            complement(1102705..1102778)
                     /gene="NDAI0Dtrna4N"
                     /locus_tag="NDAI_0Dtrna4N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:11495186"
     gene            <1103670..>1105547
                     /gene="NDAI0D04700"
                     /locus_tag="NDAI_0D04700"
                     /db_xref="GeneID:11494823"
     mRNA            <1103670..>1105547
                     /gene="NDAI0D04700"
                     /locus_tag="NDAI_0D04700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669978.1"
                     /db_xref="GeneID:11494823"
     CDS             1103670..1105547
                     /gene="NDAI0D04700"
                     /locus_tag="NDAI_0D04700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670026.1"
                     /db_xref="GeneID:11494823"
                     /db_xref="GOA:G0WAH2"
                     /db_xref="InterPro:IPR000262"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR008259"
                     /db_xref="InterPro:IPR012133"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:G0WAH2"
                     /translation="MRRRLITSLVKKGNFQSKRSLHLTNNNLYISSSILKKHPNTGNI
                     PGIQSIENAYKRSYHTYLYMSLTGISFYSLAIIILNNSIHDRHIDNDSKMELDPVKSK
                     TPITPNELMKHNTPEDCWVVINNQVYDLTTFIQVHPGGPNIIRSNAGKDVTAIFNPLH
                     PPNTIETMLPKQCYVGPLEGGLPKELICNPYTPGESMEDIRRKIILKNHLPPLESIIN
                     LYDFEKLASKILSNQAWAYYSSGANDEISYRENHSAYTRIFFKPKVLVDVSKVDLSTE
                     MLGSKIEVPFYATATALCKLGNPEGGEMDIARGCGQGLIKVPQMISTLASCSVEEIVG
                     AAPSKDQIQWYQVYINSDRNVTRHMIKKVEDLGVKALFVTVDAPFMGAREKDLKIKFS
                     NSSQGPKVMTSKAKDDINKSIVNKKEEAAGDVTEGASRTLSKFIDPSLTWKDIIELKK
                     WTKLPIVIKGVQRVEDVVKAAEIGVDGVVLSNHGGRQLDFSRPPVELLAESVPILKEK
                     KLDDKLELYVDGGIRRGTDVLKALCLGAKGVGLGRPFLYANSCYGKDGVQKAIDILKD
                     EIEMSMRLLGVTSIKELNEDLLEISNLKSRSVNVSKDVLFEDLYQNPTYADFSSVEPA
                     E"
     gene            <1106280..>1108130
                     /gene="NDAI0D04710"
                     /locus_tag="NDAI_0D04710"
                     /db_xref="GeneID:11495187"
     mRNA            <1106280..>1108130
                     /gene="NDAI0D04710"
                     /locus_tag="NDAI_0D04710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669979.1"
                     /db_xref="GeneID:11495187"
     CDS             1106280..1108130
                     /gene="NDAI0D04710"
                     /locus_tag="NDAI_0D04710"
                     /inference="similar to DNA sequence:INSDC:YML054C"
                     /note="similar to Saccharomyces cerevisiae CYB2 (YML054C);
                     ancestral locus Anc_4.304"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670027.1"
                     /db_xref="GeneID:11495187"
                     /db_xref="GOA:G0WAH3"
                     /db_xref="InterPro:IPR000262"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR008259"
                     /db_xref="InterPro:IPR012133"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:G0WAH3"
                     /translation="MNRSGTLLLTKKLPGVGKLVSRGTAVDINAGTKYYSKASTKIFR
                     SKYNGSYSNSKKVNWSLALATIAAATVSLTLSPWNASQISNDANINDEKPLISPDEVA
                     KHHTPADCWVVIHDKVYDLTSFIPIHPGGPDIIKSNAGKDVTNIFGPIHAPGVIEKYL
                     PPRCYLGPLESPMPSHLVCDPYTPGESKADIIRKLELRKNLPPLNSLVNLYDFEKLAS
                     KILSNQAWAYYSSGAEDEISYRENHSAYRRIFFKPRILVDVSKVDTNTEMLGSKTDVP
                     FYVSATALCKLGNPREGEKDIARGCGQGSTKVPQMISTLASCSVDEIVEAAPSKDQIE
                     WYQVYVNSDRKITKDMIKHVEKLGIKALFVTVDAPSLGRREKDLKIKFLGSDQGAKVM
                     KENPEIVNQDKNDNDSEPANGASRALSKFIDPSLTWNDIMEMRKWTKLPIVIKGVQRV
                     EDVVKAAEVGVNGVVLSNHGGRQLDYSRPPIELLAEAMPILKEKQLDDKLELYVDGGI
                     RRGTDVLKALCLGAKGVGLGRPFLYANSCYGKDGVQRAIEMLTEELEMSMRLLGVTSI
                     KDLSSDLLDLTNLKGRSVNVSKDYLFDNVYRTNTLASFQNGYDDDDDDDD"
     gene            complement(<1108287..>1108808)
                     /gene="NDAI0D04720"
                     /locus_tag="NDAI_0D04720"
                     /db_xref="GeneID:11495188"
     mRNA            complement(<1108287..>1108808)
                     /gene="NDAI0D04720"
                     /locus_tag="NDAI_0D04720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669980.1"
                     /db_xref="GeneID:11495188"
     CDS             complement(1108287..1108808)
                     /gene="NDAI0D04720"
                     /locus_tag="NDAI_0D04720"
                     /inference="similar to DNA sequence:INSDC:YML055W"
                     /note="similar to Saccharomyces cerevisiae SPC2 (YML055W);
                     ancestral locus Anc_4.307"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670028.1"
                     /db_xref="GeneID:11495188"
                     /db_xref="GOA:G0WAH4"
                     /db_xref="InterPro:IPR009582"
                     /db_xref="UniProtKB/TrEMBL:G0WAH4"
                     /translation="MSKPVNVYSTPEVAKVLDEALPSVLETLNYKESFKLIDIKLIIG
                     YSIAAVAGTSFLLDKKLGHKNVIAYQEILVACYFFLSALLWYFKKYIEKSVTYTGQHS
                     QNGSKIAISTSYEEAEPKYYVTFVKNDTKDEEFKRVLETTKVFNEAGYLQTKLLHDWF
                     QEQLDTIEIKKDN"
     gene            <1109256..>1111241
                     /gene="NDAI0D04730"
                     /locus_tag="NDAI_0D04730"
                     /db_xref="GeneID:11495189"
     mRNA            <1109256..>1111241
                     /gene="NDAI0D04730"
                     /locus_tag="NDAI_0D04730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669981.1"
                     /db_xref="GeneID:11495189"
     CDS             1109256..1111241
                     /gene="NDAI0D04730"
                     /locus_tag="NDAI_0D04730"
                     /inference="similar to DNA sequence:INSDC:YLR429W"
                     /note="similar to Saccharomyces cerevisiae CRN1 (YLR429W);
                     ancestral locus Anc_4.309"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670029.1"
                     /db_xref="GeneID:11495189"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015048"
                     /db_xref="InterPro:IPR015049"
                     /db_xref="InterPro:IPR015505"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G0WAH5"
                     /translation="MAMDSKIVQNSKYRYVYGKNAKKDLQYENIKVTTNPWDSNLIKC
                     NEKFIAVNWFSSGSVGSFAILRIDQVGKLPDQISLFKGHKSQILDTDFDPFNTYRIAS
                     ASDDCSIGIWDIPKNYSPSTYLDDEENIPKDISPSFFLYGHARKVGHILYHPTIPNIL
                     ASSSLDYSVKIWNIGTKKDEITLRHSDMVTSMSFSYDGAYLATISRDKMLRIWDIREN
                     KIISETRAHRGPKIQRVLWLGDSNYVVTTGFSKTCERQIGLWNAFQLRNNGKSKFYGI
                     DQSSGLLMPFFDNLTKILYVVGRGDANIRYYEFQNNELLQLSQYQSLEPQRGFSILPR
                     SLCNGKGNELMKCLRLVDGNRIVPVSFFVPRRVEGFQKEKTSTSSKPQITMSASEWFG
                     QKSDKVIMSNKTNVLSLNNSSKSLMNPRGITEHGNEKSLSVTDAFSPPTSINEDSNIS
                     IPSLRISKLRRREEPPLARSYLRSISSEEEKRTRRRITSQKNRLISGLSDSPIKKGEE
                     ILRPEEESSSVNLTEAEDRKVAKITPQVAATSTEEPSIKQLSNTLKWNDNQIGVSLSI
                     NTPNTKIASIDIKKQSNSLGSTLAIHISMNALTFNMQSENLFRDSVLDNIASLGNHVT
                     TLEDNLKYLQDMDTSHLARLRSLEQKIQILEEKTARD"
     gene            <1111768..>1113711
                     /gene="NDAI0D04740"
                     /locus_tag="NDAI_0D04740"
                     /db_xref="GeneID:11495190"
     mRNA            join(<1111768..1112224,1112609..>1113711)
                     /gene="NDAI0D04740"
                     /locus_tag="NDAI_0D04740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669982.1"
                     /db_xref="GeneID:11495190"
     CDS             join(1111768..1112224,1112609..1113711)
                     /gene="NDAI0D04740"
                     /locus_tag="NDAI_0D04740"
                     /inference="similar to DNA sequence:INSDC:YML056C,YLR432W"
                     /note="similar to Saccharomyces cerevisiae IMD4 (YML056C)
                     and IMD3 (YLR432W); ancestral locus Anc_4.312"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670030.1"
                     /db_xref="GeneID:11495190"
                     /db_xref="GOA:G0WAH6"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001093"
                     /db_xref="InterPro:IPR005990"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR015875"
                     /db_xref="UniProtKB/TrEMBL:G0WAH6"
                     /translation="MAAVRDYKTALEHLKTYPKKDGLSVQELMDSNTRGGLTYNDFLI
                     LPGYVGFGSTDVVLRTRLTKKIALNTPFVSSPMDTVTEADMAIHMALLGGIGIIHHNC
                     SHDEQAAMVRKVKKYENGFINSPIVVSPQTTIAEARQMKQDYGFSGFPVTENGQFPGK
                     LLGIVTSRDIQFVEDATLPVSEIMTKDPVTSLHGITLSEGNEILRKIKKGKLLIVDEE
                     NNLVSMLSRADLMKNQNYPLASKSATTKQLLCGASIGTLPTDRIRLTKLVEAGLDVVV
                     IDSSQGNSLFQIEMLKWIKQTYPDLEVIAGNVATREQAANLIAAGCDGLRIGMGSGSI
                     CITQEVMACGRPQGTAVYNVCQFANQFGVPCMADGGVANIGHIVKAIALGASTVMMGG
                     MLAGTTESPGEYFFRDGKRLKSYRGMGSVDAMNKGAASASRYFSEDDKVFVAQGVAGS
                     VVDKGSIKKFIPYLYNGLQHSCQDIGVTSVNALREEVQSGNVRFEFRTASAQLEGGIN
                     NLHSYEKRLHN"
     gene            complement(<1115064..>1115432)
                     /gene="NDAI0D04750"
                     /locus_tag="NDAI_0D04750"
                     /db_xref="GeneID:11495191"
     mRNA            complement(<1115064..>1115432)
                     /gene="NDAI0D04750"
                     /locus_tag="NDAI_0D04750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669983.1"
                     /db_xref="GeneID:11495191"
     CDS             complement(1115064..1115432)
                     /gene="NDAI0D04750"
                     /locus_tag="NDAI_0D04750"
                     /inference="similar to DNA sequence:INSDC:YLR437C,YML058W"
                     /note="similar to Saccharomyces cerevisiae YLR437C and
                     SML1 (YML058W); ancestral locus Anc_4.316"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670031.1"
                     /db_xref="GeneID:11495191"
                     /db_xref="InterPro:IPR013900"
                     /db_xref="UniProtKB/TrEMBL:G0WAH7"
                     /translation="MTMDEKSKLEYLKDVNSAADRIRHHLAMSHQQEVEEANRAQAAT
                     TVVPEFKRVPLPTMNTAPPMLEKNCTSSFYESGSTLEMWEESVEQKLQNIDQDIKSNK
                     FGAADLNTMFASGKIEEMDF"
     gene            complement(<1116851..>1117087)
                     /gene="NDAI0D04760"
                     /locus_tag="NDAI_0D04760"
                     /db_xref="GeneID:11495192"
     mRNA            complement(<1116851..>1117087)
                     /gene="NDAI0D04760"
                     /locus_tag="NDAI_0D04760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669984.1"
                     /db_xref="GeneID:11495192"
     CDS             complement(1116851..1117087)
                     /gene="NDAI0D04760"
                     /locus_tag="NDAI_0D04760"
                     /inference="similar to DNA sequence:INSDC:YML058W-A"
                     /note="similar to Saccharomyces cerevisiae HUG1
                     (YML058W-A)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670032.1"
                     /db_xref="GeneID:11495192"
                     /db_xref="UniProtKB/TrEMBL:G0WAH8"
                     /translation="MPASTSTSTATETIPLAEQKLHDMTIEQQKDLYGDEQVFNNYIV
                     NLADRVRSSIGGGYSLPKEKIEPVKANVETFPTL"
     gene            <1118495..>1119085
                     /gene="NDAI0D04770"
                     /locus_tag="NDAI_0D04770"
                     /db_xref="GeneID:11495193"
     mRNA            <1118495..>1119085
                     /gene="NDAI0D04770"
                     /locus_tag="NDAI_0D04770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669985.1"
                     /db_xref="GeneID:11495193"
     CDS             1118495..1119085
                     /gene="NDAI0D04770"
                     /locus_tag="NDAI_0D04770"
                     /inference="similar to DNA sequence:INSDC:YLR179C"
                     /note="similar to Saccharomyces cerevisiae YLR179C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670033.1"
                     /db_xref="GeneID:11495193"
                     /db_xref="InterPro:IPR008914"
                     /db_xref="UniProtKB/TrEMBL:G0WAH9"
                     /translation="MATILKALKEQEVIPDVIKNEQFQPVGEFAIKYTTEESKVLNAQ
                     LGSYLTPLEAKSKPTTINVKFFDESLDLEHDRFTFVMTDPDAPSRTDKTYSEYCHYVE
                     TDIDLSKADAEGWRPIGNGKVVSSYIGPGPPPKTGKHRYVFLLYKQPRDLTKFTEVKG
                     QFNWGYGIPGVGANKWASENKLDLVAADFFFSENTD"
     gene            <1119585..>1124414
                     /gene="NDAI0D04780"
                     /locus_tag="NDAI_0D04780"
                     /db_xref="GeneID:11495194"
     mRNA            <1119585..>1124414
                     /gene="NDAI0D04780"
                     /locus_tag="NDAI_0D04780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669986.1"
                     /db_xref="GeneID:11495194"
     CDS             1119585..1124414
                     /gene="NDAI0D04780"
                     /locus_tag="NDAI_0D04780"
                     /inference="similar to DNA sequence:INSDC:YML059C"
                     /note="similar to Saccharomyces cerevisiae NTE1 (YML059C);
                     ancestral locus Anc_4.318"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670034.1"
                     /db_xref="GeneID:11495194"
                     /db_xref="GOA:G0WAI0"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR001423"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:G0WAI0"
                     /translation="MNITQDKSTPSSSSSASPISTSQERKGLPEQLIQAKHDWFLSSI
                     GNFTWVIIYFCTGSTMFVLKGISYILTLFLLQIPGKIIHSANKMRFTISFTVILTVIA
                     ILIYITYCIVKARVLSQYKKLTPDEDSLLMNQNIGAGTNREAGSTPLNRSENMKNRNS
                     NNINDDTFLSSYLDQFLSAIKIFGYLEKPVFHALTKNMKTQKLDEGEILLLDNSIGFA
                     IVVEGTLQVFHEVEQTADEIVRNEARDDITEHESVLRVEALTNNDNEDLTTYNSGISD
                     SDSDSDFDSDDESSGYIRLKNGLGKFQLLNTVKPGNPISSLVNILNLFTSANPNASPY
                     NINGSRSDSNDRGNSNNIDMQLQFGKFTLNSDNATSSCPTPSMDTTPPLQSSEHIPAL
                     LSPYSIPKVVARASTDCTIAIIPPQAFARLTAKYPRSASHMIQMILAKLYNVTFQTAH
                     NYLGLTREIMDIELSLNRSVKYELPYYLKETVIRKSKASNSEIKHNDSNRHARKSSFE
                     SSKPRLDSKTTSLSNDNLQAPIPAKPSRNSMVIGSRHVVLDSRDHLNPGDLLSNVPLS
                     RKEYNDDTPARDSKSPNQWTSKANASHDHIDTKKHLKSYDRPKLKKNYQNGSSASFIK
                     TLKTKHGMNEDIKTRSFSAAQEETEDSSVRMAVTEAFFAFMGVSQSNMSAANPETSFT
                     DSNTNLGRSVHRSSEISLDPSIGSSVTHQTTLRILPSEYTITSRRQMKRNKKKKPYKE
                     EISSNLDFDSAKNEFAQGLQLKFFKQGSNIVEANSDGKGMFYVISGKISVSTSSDSDD
                     HPTNKKNHKIEHTLFSIGSGGIAGYLSGIVGYKSFVNLKAQTDVYVGFLPNKVIERLC
                     DKYFLIYLRIAETLSGLLSSRMLKLDHALEWVHLSASETLFSQDDPANGIYVVLNGRL
                     RQLQERKRNTTNDVNEAITHHDSKKDKMKNSTTYPVVVGELAQGESFGEVEVLTAMNR
                     FTTIVAVRDSELARIPRTLFESIAMEHPSIMIRVSRLVAKKIMGNNYTQNNEDNNLAI
                     PLTKSLNSLNSHYQTQNHSSGKITFRTITILPIREGLPVENFAMKLVQAFKQVGRNTI
                     GLNQRTTLTHLGRHAFDRLAKLKQSGYFAELEEMYQTVVYIADTPSKSSWTQTCIAQG
                     DCILLLADATSLPDIGEYENLLLKSKTTARTELILLHPERYVEPGLTQKWLRYRPWVH
                     SHHHIQLVVNPLEGISANKIHGFNGGALALVDKFIQTDFSKKTQQNISKLLPDSLKTT
                     VENFSSRFMKKRNAQFYTPTNPHKNDFLRLARILSGQAIGLVLGGGGARGLSHLGVIQ
                     AIEEQGIPIDMIGGTSIGSFVGGLYAKDYDLVPIYGRVKKFAGRISSLWRTLLDLTWP
                     VTSYTTGHEFNRGIWKTFGDTRIEDFWIQYYCNSTNITNSVQEIHSFGYAWRYIRASM
                     SLAGLLPPLEEHGSMLLDGGYLDNLPVLEMKARGCDTIFAVDVGSVDDRTPMKYGDSL
                     NGFWIVFNRWNPFSSHPNVPNMAEIQVRLGYVASVNALEKAKNTAGVLYIRPPIENYA
                     TLDFGKFEEIYAVGVDYGRIFFQELESEGKMPFLPGCQAQVVASEVPEFLLHRRHSI"
     gene            complement(<1124503..>1125633)
                     /gene="NDAI0D04790"
                     /locus_tag="NDAI_0D04790"
                     /db_xref="GeneID:11495195"
     mRNA            complement(<1124503..>1125633)
                     /gene="NDAI0D04790"
                     /locus_tag="NDAI_0D04790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669987.1"
                     /db_xref="GeneID:11495195"
     CDS             complement(1124503..1125633)
                     /gene="NDAI0D04790"
                     /locus_tag="NDAI_0D04790"
                     /inference="similar to DNA sequence:INSDC:YML060W"
                     /note="similar to Saccharomyces cerevisiae OGG1 (YML060W);
                     ancestral locus Anc_4.321"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670035.1"
                     /db_xref="GeneID:11495195"
                     /db_xref="GOA:G0WAI1"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR012904"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:G0WAI1"
                     /translation="MLKFHQIKVNKDELSLTNVLQAGQAFRWVFNEKENHYTTTMKVT
                     ESNKYFIVVLSQPADDLIEFTSPDLSLDPEHLRSHLERYFRLDVSLNNLLLNEWIPKD
                     HRFKTISAHGVRILAQEPWETLISFICSSNNNIARITKMCHSLCTNYGEEVGVFDGQK
                     FFSFPSSDVIAERATETALRDLGFGYRAKYIIETAKKVSKVRADGNYENDTALFRKLQ
                     SSFSYIEMREHLMGYTGVGPKVADCVCLMGLGMDDVVPVDVHVSRIAKRDYQIIANNK
                     NISTLKKLYADLPITRKKINLELDHIRLELYNKWGLYAGWAQGVLFSKEVGKVSGATS
                     SGEIKKRAIVQVDIDIKEETATRTTFDRVSNKHRKNIKREQI"
     gene            <1126081..>1128645
                     /gene="NDAI0D04800"
                     /locus_tag="NDAI_0D04800"
                     /db_xref="GeneID:11495196"
     mRNA            <1126081..>1128645
                     /gene="NDAI0D04800"
                     /locus_tag="NDAI_0D04800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669988.1"
                     /db_xref="GeneID:11495196"
     CDS             1126081..1128645
                     /gene="NDAI0D04800"
                     /locus_tag="NDAI_0D04800"
                     /inference="similar to DNA sequence:INSDC:YML061C"
                     /note="similar to Saccharomyces cerevisiae PIF1 (YML061C);
                     ancestral locus Anc_4.322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670036.1"
                     /db_xref="GeneID:11495196"
                     /db_xref="GOA:G0WAI2"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010285"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WAI2"
                     /translation="MNIWKQQLVSIFYRKSIIPLGAFFNTSIFLQTTKKMGIRPLSST
                     SFFANEPKRIKMSNEDLDALFSDSGEWEVDMHNEVKNDVSENDDDVILMRGLQYNPVD
                     PAKKLMGASSIIFPKTNSEQIKSMPSGVEKSFTLTKKIPQVTFKDNVDIKTERFRQPL
                     NRKESNLEPACTKHNELRPSFPSEKQTPEESTMLRKPSVPPVTKWPTTLPVVSNSAQS
                     NISMNDSSLEIIKEETKVTHSNKFTLLTQPPTFTNLDMETPTKKLNLPKNTKIKIPIR
                     LSTEQENIITLAEKGINIFYTGSAGTGKSILLREMIRALRRKYDADEVAVTASTGLAA
                     CNIGGITVHSFAGIGLGNGEAVNLYKKVRRSKKHLRRWQKIKALVVDEISMIDGKLLD
                     KLDYIAQKIRKNHAPFGGIQLIFCGDFFQLPPVSKDPQNPTVFAFESKAWKAGIKSTI
                     MLQKVFRQQGDAEFITMLNQMRLGKIDENTEREFKKLTRPLADDEIIPAELYSTRAEV
                     DRANFSRLNKLPGLTHTFESIDGGELQDQEMKERLLQNFLAPKTLQLKVGAQVMMIKN
                     MDETLVNGSLGKILAFVDPQTYMFYKTISDDPTVPLSQLEDLVSNPQPLMDSWNEEKD
                     TDNVRQKSAKDSFCRPKTTDIKAELDDSIFDFLDGVEGQDIEIDTNIKRKKELMQMLH
                     ASSNGRKLPLVRFKTSDLSTRTILVEPENWAIEDENEKPIVSRVQLPLMLAWSLSIHK
                     AQGQTLPKVKVDLRRVFEKGQAYVALSRAVSREGLQVLNFDRTRILSHQAVIDFYSTL
                     TSAENAIKQFDHLPKETSSGIRREYAPTSNYRASRSSTKTPAGTDGILALLEKHKK"
     gap             1131368..1131400
                     /estimated_length=33
     gene            1132097..1132189
                     /gene="NDAI0Dtrna4F"
                     /locus_tag="NDAI_0Dtrna4F"
                     /db_xref="GeneID:11495163"
     tRNA            join(1132097..1132134,1132153..1132189)
                     /gene="NDAI0Dtrna4F"
                     /locus_tag="NDAI_0Dtrna4F"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /db_xref="GeneID:11495163"
     gene            1135009..1135080
                     /gene="NDAI0Dtrna2H"
                     /locus_tag="NDAI_0Dtrna2H"
                     /db_xref="GeneID:11494822"
     tRNA            1135009..1135080
                     /gene="NDAI0Dtrna2H"
                     /locus_tag="NDAI_0Dtrna2H"
                     /product="tRNA-His"
                     /note="codon recognized: CAC"
                     /db_xref="GeneID:11494822"
     gene            complement(<1135992..>1137872)
                     /gene="NDAI0D04810"
                     /locus_tag="NDAI_0D04810"
                     /db_xref="GeneID:11494817"
     mRNA            complement(<1135992..>1137872)
                     /gene="NDAI0D04810"
                     /locus_tag="NDAI_0D04810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669989.1"
                     /db_xref="GeneID:11494817"
     CDS             complement(1135992..1137872)
                     /gene="NDAI0D04810"
                     /locus_tag="NDAI_0D04810"
                     /inference="similar to DNA sequence:INSDC:YHL024W"
                     /note="similar to Saccharomyces cerevisiae RIM4 (YHL024W);
                     ancestral locus Anc_4.33"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670037.1"
                     /db_xref="GeneID:11494817"
                     /db_xref="GOA:G0WAI3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G0WAI3"
                     /translation="MKMTMKAKKTMIVKKTMIVKKTMIALKRREKRMRKRTRKRKKIP
                     PAMNTKPFRGRPSSCVFVASLTSTLTDDELCVSVTDYFKKFGEIVRVKVLRDQANRPY
                     AFVQYTNDKDANNALKTAHGSLLNGRRLRCEPARVNRTLFITHDSPISKMEIESICNK
                     FGELDQLVPKRDDTQFTRRFSYPVSDACSWFAQFTFRDDAIRAFANLKSDSAWNVQWA
                     QNIRVPHFFNLLSKNNEGQDSNSNASPSISSTIVDTQNDYKNNSNLSQGEEEMITIDK
                     KSIFVGQLPQETTKEDLETHFWKHGKILDLNLIHKPTNVFAFIQYESEKSAAAALETE
                     NHSIFISKTIHVQYKEIGGIHNKKHLKKNSFFGYKPNTFSGPQLNLAPPPISMYRRNS
                     IDVPPLSMSYMPPPPPLAEFEMNSYIPYGMNTIPTARRKSLPSWRSNKMDESTDVNST
                     ITNDATIDDKSDVSDAVTTNAIGSTTTYDNSAEASLNINENGDRSTTINTSNNNYTTN
                     TMSKKYPRRGNQNFGEPVKPYYYQPYYYHHPMPYPMAPGHTPQNSAGTMPYMMLYSMP
                     PIPPPNIRGATIPPTSDKTHIFPANVRTKPRVMPDFQPSEMYENQIDRLPKKKGPECL
                     NY"
     gene            complement(<1139382..>1142102)
                     /gene="NDAI0D04820"
                     /locus_tag="NDAI_0D04820"
                     /db_xref="GeneID: