GenomeNet

Database: RefSeq
Entry: NC_016483
LinkDB: NC_016483
Original site: NC_016483 
LOCUS       NC_016483            1184459 bp    DNA     linear   CON 05-JUN-2017
DEFINITION  Naumovozyma dairenensis CBS 421 chromosome 5, complete genome.
ACCESSION   NC_016483
VERSION     NC_016483.1
DBLINK      BioProject: PRJNA79341
            BioSample: SAMEA2272418
            Assembly: GCF_000227115.2
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Naumovozyma dairenensis CBS 421
  ORGANISM  Naumovozyma dairenensis CBS 421
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Naumovozyma.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 1184459)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1184459)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE580271.
            Accession numbers for all the chromosomes in this genome project:
            HE580267-HE580278.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1184459
                     /organism="Naumovozyma dairenensis CBS 421"
                     /mol_type="genomic DNA"
                     /strain="type strain:CBS 421"
                     /db_xref="taxon:1071378"
                     /chromosome="5"
     gene            complement(<267..>824)
                     /gene="NDAI0E00100"
                     /locus_tag="NDAI_0E00100"
                     /db_xref="GeneID:11499078"
     mRNA            complement(<267..>824)
                     /gene="NDAI0E00100"
                     /locus_tag="NDAI_0E00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670021.1"
                     /db_xref="GeneID:11499078"
     CDS             complement(267..824)
                     /gene="NDAI0E00100"
                     /locus_tag="NDAI_0E00100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670069.1"
                     /db_xref="GeneID:11499078"
                     /db_xref="InterPro:IPR021646"
                     /db_xref="UniProtKB/TrEMBL:G0WAQ6"
                     /translation="MVTGRFLVDIIEKKIINPNEQHYLRNLTDEEKEYIEECDLLDWN
                     ILKLTKHPYAVDSPQLFDVLNANNEDFYEDKNGDLWIVPPTEYKGELTPRKYRSIPLH
                     FKSFGWRHIYEPLKKVPLPENPFANDSLESLLGGYHESKDLQDEEYFAFLKDLATLVS
                     YDQQRSYYIKSFNELKSLYIASQGQ"
     gene            complement(<963..>1727)
                     /gene="NDAI0E00110"
                     /locus_tag="NDAI_0E00110"
                     /db_xref="GeneID:11499097"
     mRNA            complement(<963..>1727)
                     /gene="NDAI0E00110"
                     /locus_tag="NDAI_0E00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670022.1"
                     /db_xref="GeneID:11499097"
     CDS             complement(963..1727)
                     /gene="NDAI0E00110"
                     /locus_tag="NDAI_0E00110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670070.1"
                     /db_xref="GeneID:11499097"
                     /db_xref="UniProtKB/TrEMBL:G0WAQ7"
                     /translation="MQYPIITVPKGQFTIIDGFLINLNSKVVTDLSSDDSKTTLTPGG
                     WYLLKNTYNPMSLTKLYFIDSNYMFTNKSVLLWILKPYIYVKFCERNSKYYCEPCTRH
                     QATHKAISIPIVRLEETVSKYMVLEEPLTGTQETHSGPFNQQLKDQQVCETLNTEQTT
                     TNNSDISMDQLKGFSLPDVKYIPEHYFIKIKPPITRLKIKNLEKKEEQDKVKELEVLQ
                     RSLFDMSLEKNYWRLRKMKEYFSQTGDPKMTLLRLN"
     gene            <1990..>4239
                     /gene="NDAI0E00120"
                     /locus_tag="NDAI_0E00120"
                     /db_xref="GeneID:11499098"
     mRNA            <1990..>4239
                     /gene="NDAI0E00120"
                     /locus_tag="NDAI_0E00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670023.1"
                     /db_xref="GeneID:11499098"
     CDS             1990..4239
                     /gene="NDAI0E00120"
                     /locus_tag="NDAI_0E00120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670071.1"
                     /db_xref="GeneID:11499098"
                     /db_xref="GOA:G0WAQ8"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="InterPro:IPR011907"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:G0WAQ8"
                     /translation="MSVEPVFVISEQYTEKHGEELRSFYKVQNACVQLKEAIKIIYAN
                     AKPNEELVELFTNGNELEQAIAKSPAMSIASYLYSVQPSFDVESIFEHYAFHEDSTPV
                     DQFIKYPVVSDASLENLAFIHRSLPNMNVNLTESQRTMMSNERLEFLGDSWLGALVAY
                     SLYKKYPFANEGALSKMKQAIVNNDNLEKISKKLGFPEKLRGNIPHTSLRKKDKKSKL
                     YADCVEAYIGALVVDRYSAEFKEVSQWLEDLSEDIFEEMGDSLTRDPLNKNSKGELAE
                     ILQFNKLGKKVEYKTLNKKSPFRVEVRLGNIVLGVGVGDNIKEAEQRSAMFALENPKE
                     LEKYTASPIESTSKVNNDLEYSPAYDDDESTLALNPAVDSPSEASDAMSSTSALVESV
                     VKEVGDSGNVAVLIDTLMNRMSNVVEQMVSSTVSNILEKKGDVSVLTPELKANSTMGE
                     VEAKNIKRTRKETTNNTQNMERIAKMDSIKKKVPPISYDEPDPNIIIINSESEDASES
                     SFDDRRQKRVQTRNDLPNEAFINVDSNGIYKSSTNLKALQDFNALAAAYDAKGKKGRK
                     NKGGQQDGNLVGGFDPAKDSNNRPGERKGRLAFGSRINNNPGNLEGRLGSSKKANTNN
                     RPGKSAGGRSVPGMSGSINKTLGLKAGLDPSKDSNNRGGEKVPSSNNSTRYDKEASEK
                     LYALLGKSNMCPEYETTNEGDGFYTVCRIKGMGITIGEGSGRSKKISQHIAAGNALRN
                     KEVKKLLSR"
     gene            complement(<4463..>5515)
                     /gene="NDAI0E00130"
                     /locus_tag="NDAI_0E00130"
                     /db_xref="GeneID:11499099"
     mRNA            complement(<4463..>5515)
                     /gene="NDAI0E00130"
                     /locus_tag="NDAI_0E00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670024.1"
                     /db_xref="GeneID:11499099"
     CDS             complement(4463..5515)
                     /gene="NDAI0E00130"
                     /locus_tag="NDAI_0E00130"
                     /inference="similar to DNA sequence:INSDC:YMR315W"
                     /note="similar to Saccharomyces cerevisiae YMR315W;
                     ancestral locus Anc_3.0"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670072.1"
                     /db_xref="GeneID:11499099"
                     /db_xref="GOA:G0WAQ9"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR004104"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G0WAQ9"
                     /translation="MAPVLNVGIVGTGIFARDRHLPSYQEYPNDFKVVAAFNRTKSKA
                     QEFAKIAGIPDDKVYDNLDEIMNDKNVSFIDALLPAQFNLSAVKKAIEVNKPILLEKP
                     IAATMAQAREIVQLSDASDLPIAIAENWLYLTCIKLALKQLERIGPIVAFTHNSTGPF
                     VSTNKYLATSWRQNPEHIGGFLSDGGVHQLALVTALLGEFESVSALTKQVRPESGADD
                     IVFSTVKMRDNNVIGSFTYGSAFGATEKSVFLKIYGKNGTVTVELSDKTQPLVKVRIG
                     DSIENAGKEEIFQVEKDESFGVNPEFLNFHEAVSKNDKSLIKSSPRATFHHLACVAAF
                     LESSANNGKNVSVETI"
     gene            <7455..>7973
                     /gene="NDAI0E00140"
                     /locus_tag="NDAI_0E00140"
                     /db_xref="GeneID:11499100"
     mRNA            <7455..>7973
                     /gene="NDAI0E00140"
                     /locus_tag="NDAI_0E00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670025.1"
                     /db_xref="GeneID:11499100"
     CDS             7455..7973
                     /gene="NDAI0E00140"
                     /locus_tag="NDAI_0E00140"
                     /inference="similar to DNA sequence:INSDC:YML098W"
                     /note="similar to Saccharomyces cerevisiae TAF13
                     (YML098W); ancestral locus Anc_8.878"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670073.1"
                     /db_xref="GeneID:11499100"
                     /db_xref="GOA:G0WAR0"
                     /db_xref="InterPro:IPR003195"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G0WAR0"
                     /translation="MPRKLKRTHLFSKDVSSLLYAYGDIPHPLPQSIQCLDELVSSYL
                     VDICHVAYQTAKNSQRNKVKLEDFKFAVRNDATKLGRAEELIATNKLITEAKKQFNET
                     DSNSLKRYREEEFEEGDDDEDLEGNDMEDENEHQGSTGKLHSSTKKKARMITKPRTTK
                     ANKSSKKVKVDK"
     gene            complement(<8354..>10162)
                     /gene="NDAI0E00150"
                     /locus_tag="NDAI_0E00150"
                     /db_xref="GeneID:11499101"
     mRNA            complement(<8354..>10162)
                     /gene="NDAI0E00150"
                     /locus_tag="NDAI_0E00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670026.1"
                     /db_xref="GeneID:11499101"
     CDS             complement(8354..10162)
                     /gene="NDAI0E00150"
                     /locus_tag="NDAI_0E00150"
                     /inference="similar to DNA sequence:INSDC:YML130C"
                     /note="similar to Saccharomyces cerevisiae ERO1 (YML130C);
                     ancestral locus Anc_8.877"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670074.1"
                     /db_xref="GeneID:11499101"
                     /db_xref="GOA:G0WAR1"
                     /db_xref="InterPro:IPR007266"
                     /db_xref="UniProtKB/TrEMBL:G0WAR1"
                     /translation="MKLGTSLINLCSLSTGMLVFTSATSSAYAQGNATESTFSSSKAN
                     EIISDSTPFCKVEKDSTVSTSCNITFQEINNINENIRNDLQSLVNTDFFKYFKLDIYK
                     QCPFWDDSNRLCTDGSCSIDIVEDWSKLPEYWQPEHLSELKDPSNSSDEDLVTDCSFL
                     DQLCNDNKKLQYMQNDIDYCDVNEFESKESVLIDLTKNPERFTGYGGQQSANIWKHIY
                     GENCFSMDTQGKCLAKDAFYRLVSGLHASIGVHISNEMLNSETGQWGPNLEFFMSRVG
                     NFPDRITNIYFNYAVVAKSLWKIMPFLKHLDFCNEYDNDVKGKIINITSQLDSNIFQE
                     DLLFKNDLDYSLKDEFRSRFKNVTKIMDCVDCDTCRLWGKVQTTGYATSLKILFEFDE
                     ADEESRQNVVDKLTKYELIALLNTFDRLSQAIEAINSFERMYNKNMNNLKTKENPNAS
                     FIFGKNNFFRLLKGAKDYINNNFSSSNAEQEEITKRDVNKLLEDEKEPVKFADLKLPE
                     KKYIKKQTTTSNSKSKNTTPIIKSENKWKKAWNTEIANVMEAFRFIWRSYLDLPRNLW
                     KLLLVNMNKLWNKFIGVANYLNEKEENPILYKLNIQ"
     gene            complement(<10576..>11328)
                     /gene="NDAI0E00160"
                     /locus_tag="NDAI_0E00160"
                     /db_xref="GeneID:11499102"
     mRNA            complement(<10576..>11328)
                     /gene="NDAI0E00160"
                     /locus_tag="NDAI_0E00160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670027.1"
                     /db_xref="GeneID:11499102"
     CDS             complement(10576..11328)
                     /gene="NDAI0E00160"
                     /locus_tag="NDAI_0E00160"
                     /inference="similar to DNA sequence:INSDC:YML092C"
                     /note="similar to Saccharomyces cerevisiae PRE8 (YML092C);
                     ancestral locus Anc_8.871"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670075.1"
                     /db_xref="GeneID:11499102"
                     /db_xref="GOA:G0WAR2"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G0WAR2"
                     /translation="MADRYSFSLTTFSPSGKLGQIDYALTAVNQGVTSIGIKATNGIV
                     IATEKKSSSPLALTETLSKVELITPDIGAVYSGMGPDYRVLVDKSRKVAHSNYKRIYG
                     EYPPTKLLVSEIAKIMQEATQSGGVRPFGVSLLVAGHDEHRGFSLYQVDPSGSYFPWK
                     ATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIEIAVIGDEN
                     PEMLGYTGVPTDKGPRFKKLTSQEINDRLEAL"
     gene            complement(<12147..>12338)
                     /gene="NDAI0E00170"
                     /locus_tag="NDAI_0E00170"
                     /db_xref="GeneID:11499103"
     mRNA            complement(<12147..>12338)
                     /gene="NDAI0E00170"
                     /locus_tag="NDAI_0E00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670028.1"
                     /db_xref="GeneID:11499103"
     CDS             complement(12147..12338)
                     /gene="NDAI0E00170"
                     /locus_tag="NDAI_0E00170"
                     /inference="similar to DNA sequence:INSDC:YML129C"
                     /note="similar to Saccharomyces cerevisiae COX14
                     (YML129C); ancestral locus Anc_8.868"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670076.1"
                     /db_xref="GeneID:11499103"
                     /db_xref="InterPro:IPR029208"
                     /db_xref="UniProtKB/TrEMBL:G0WAR3"
                     /translation="MARYAWYTRVTDTLHRLTVLTLVGGTLYMSGALAYTLYMNGKRY
                     EKQVTQKESPEAINSNTPK"
     gene            complement(<12836..>14344)
                     /gene="NDAI0E00180"
                     /locus_tag="NDAI_0E00180"
                     /db_xref="GeneID:11499104"
     mRNA            complement(<12836..>14344)
                     /gene="NDAI0E00180"
                     /locus_tag="NDAI_0E00180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670029.1"
                     /db_xref="GeneID:11499104"
     CDS             complement(12836..14344)
                     /gene="NDAI0E00180"
                     /locus_tag="NDAI_0E00180"
                     /inference="similar to DNA sequence:INSDC:YML128C"
                     /note="similar to Saccharomyces cerevisiae MSC1 (YML128C);
                     ancestral locus Anc_8.867"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670077.1"
                     /db_xref="GeneID:11499104"
                     /db_xref="InterPro:IPR018803"
                     /db_xref="UniProtKB/TrEMBL:G0WAR4"
                     /translation="MKHLVLYCSTALYVSSGVLASSSSSSSENSVFPFDTWTEDDLKD
                     YVNDHMNNLKDISTKSLDDLKADAMDVWDQNMHPKPWWKFWASDDKQFPWMSNKGMGK
                     AEDISDWLFNSWSKDDLHKYLLKNRIKADANDSKDAMVQLAKKYFKDISKKSKASGYY
                     PSSSYFKDWSVEDLTNWLDKYKISYKRDMINKKEDLMHLVRKNMYAVSNKVEKERLNL
                     LDSMDLANKQFLNKAGELKENIFDTWSSNDLEKWLESHDVQLDEKLMHSHDYLVEQAN
                     DNYSLLKDDINWYLKYLKKKTTPFMEKSPENVDSTWKSVTSAGQDMYSKTKKKTNEVI
                     NDTFLIGIDDWSKGRLKEFLDIRDIDYSMFATKKDLIQKVRDSRNAPLRKLKDNMISF
                     KDWSCEKRGEMASQVTEGMDMASKKAGDMKEKFGEIWYETFENWSQDDLKAYLESFGI
                     RMKPTSTREEMIQSAKENTQWFFGIKQEPFYKRVLNKAQDLAKRGYAMMVTC"
     gene            <15301..>17109
                     /gene="NDAI0E00190"
                     /locus_tag="NDAI_0E00190"
                     /db_xref="GeneID:11499105"
     mRNA            <15301..>17109
                     /gene="NDAI0E00190"
                     /locus_tag="NDAI_0E00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670030.1"
                     /db_xref="GeneID:11499105"
     CDS             15301..17109
                     /gene="NDAI0E00190"
                     /locus_tag="NDAI_0E00190"
                     /inference="similar to DNA sequence:INSDC:YML127W"
                     /note="similar to Saccharomyces cerevisiae RSC9 (YML127W);
                     ancestral locus Anc_8.866"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670078.1"
                     /db_xref="GeneID:11499105"
                     /db_xref="GOA:G0WAR5"
                     /db_xref="InterPro:IPR003150"
                     /db_xref="UniProtKB/TrEMBL:G0WAR5"
                     /translation="MSVSGSHSPFIANTPTPIIQNNSIPQQTLDANNNNNNNNVITGD
                     DNNNNNTFSNIIPVPIKVSRQQSNAILSNNHNQRHLQYSLNNLNVFNQIPKDNISTAG
                     VDSLSRFKLALLSGIPEEIKWTLKKYLVYSTKAPYMISLKNLPDLLQLFKNLILDLMP
                     IIENFNQPLINDMNDKLQIGITSLLILRNLAQDTESIQVLVADEEIKNFILFVLTKFQ
                     MISKGDPNWQLWESNSSYFNELIHYTIDLMEGISSYIAPAKKNNPFFQTLVSALNFTK
                     DRYMVISILRSLSRLLVRSKADEESAADDLHEKSLNLIVSFLLIEKDSELIIASLDFL
                     YQYMLPGNERISGLFDNEERYSIFTTMLPKLLTYNVKLPNYSALNETNIKLITRVRPP
                     PPTTPPHLPENLFKQLLLLNEPMRSTAWLRCCFEPVEDAEFTQIALWRAYEAKFSQPI
                     RESGRKLLAAVEFIKNVSNAFHDASAMVIVDQVTGKKRFVIKGIQPREKAISIKEGDI
                     ASRNTLVGLTSKFLDDPYNLTPSKQLNLPSIDFPTELSDVSKVATTFLCLVSNDTKGP
                     GGKFCKEIKPLIFHRLVDVPPLISLLSEYMDNTPNV"
     gene            complement(<17656..>18600)
                     /gene="NDAI0E00200"
                     /locus_tag="NDAI_0E00200"
                     /db_xref="GeneID:11499106"
     mRNA            complement(<17656..>18600)
                     /gene="NDAI0E00200"
                     /locus_tag="NDAI_0E00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670031.1"
                     /db_xref="GeneID:11499106"
     CDS             complement(17656..18600)
                     /gene="NDAI0E00200"
                     /locus_tag="NDAI_0E00200"
                     /inference="similar to DNA sequence:INSDC:YML125C,YML087C"
                     /note="similar to Saccharomyces cerevisiae PGA3 (YML125C)
                     and YML087C; ancestral locus Anc_8.862"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670079.1"
                     /db_xref="GeneID:11499106"
                     /db_xref="GOA:G0WAR6"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:G0WAR6"
                     /translation="MSAEEYEEEQPNILDDPIHGIYIPTALFVFGIALLTYLSKEYRL
                     LLALPILFTSLVVRALLAYQRRRSLFPDKWTKLELEDQTVISKNTALYRFKLKTPLES
                     LNIPAGFHIAARVFIDGKEEIRYYNPISSKLDKGYFDLLIKSYADGKVSKYFAGLKPG
                     ESVEFKGPIGELNYNVNSSTALAIVAGGSGITPVLQMLNEIITTPEDLTKVSLIYAND
                     TENDILLKDELDEMAKKYPHFDIHYVVRYPSETWKGDVGLVTREQMQKYLPESSDDHR
                     LLICGPEGMENMVVNYAKELGWKQSYSKSKGDDQVYVF"
     gene            complement(<19177..>21018)
                     /gene="NDAI0E00210"
                     /locus_tag="NDAI_0E00210"
                     /db_xref="GeneID:11499107"
     mRNA            complement(<19177..>21018)
                     /gene="NDAI0E00210"
                     /locus_tag="NDAI_0E00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670032.1"
                     /db_xref="GeneID:11499107"
     CDS             complement(19177..21018)
                     /gene="NDAI0E00210"
                     /locus_tag="NDAI_0E00210"
                     /inference="similar to DNA sequence:INSDC:YML123C"
                     /note="similar to Saccharomyces cerevisiae PHO84
                     (YML123C); ancestral locus Anc_8.858"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670080.1"
                     /db_xref="GeneID:11499107"
                     /db_xref="GOA:G0WAR7"
                     /db_xref="InterPro:IPR004738"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G0WAR7"
                     /translation="MTTTINNINNNNIQDEDNNNNNNNNNNNIIPTTEGGNMAFHNYI
                     NDFAHIEDPLERRRLALQKIDEMEFGWSHIRTILIAGVGFLTDSYDIFAINLGISMMS
                     YVYWAGNMPSSTNTLLKVSTSVGTVIGQIGFGTMADIMGRKKIYGLELILMIVTTILQ
                     CMTGSSPSINFVAILTFYRIVMGIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQA
                     WGQILGGIVALILVAAYKPMLIGAETGDMCGPDCIKACDQMWRILVGIGAVPGLIGLY
                     FRLTIPESPRYSLDVDAASDLESIEYTKVEIIDEKQLTSSASTSSKLNDNNSNNDLTS
                     LSREKTAVERMEIKPPKASFKDFCHHFGQWKYGKILLGTAGSWFMLDVAFYGLSLNTA
                     VILQTIGFASSENVYKKLYNSAVGNLILICAGSLPGYWASVFTIDIVGRKPIQLMGFI
                     ILTILFCIIGFAYNKISDGGLLGLYILCQFFQNFGPNVTTFIVPGECFPTRYRSTAHG
                     ISAASGKIGAIIAQTALGSLIDHNCARDGKPKNCWLPHVMQIFALFMLLGIFLTLLIP
                     ETKRMTLEEINEKYHQEVDPSKYSAKASGSENTTSDPEYEITRRLDV"
     gap             21785..21804
                     /estimated_length=20
     gene            <23266..>24174
                     /gene="NDAI0E00220"
                     /locus_tag="NDAI_0E00220"
                     /db_xref="GeneID:11499108"
     mRNA            <23266..>24174
                     /gene="NDAI0E00220"
                     /locus_tag="NDAI_0E00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670033.1"
                     /db_xref="GeneID:11499108"
     CDS             23266..24174
                     /gene="NDAI0E00220"
                     /locus_tag="NDAI_0E00220"
                     /inference="similar to DNA sequence:INSDC:YML121W"
                     /note="similar to Saccharomyces cerevisiae GTR1 (YML121W);
                     ancestral locus Anc_8.855"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670081.1"
                     /db_xref="GeneID:11499108"
                     /db_xref="GOA:G0WAR8"
                     /db_xref="InterPro:IPR006762"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WAR8"
                     /translation="MPTSVNTRNNSNSNSNNAISNNNIPNNRKKLLLMGRSGSGKSSM
                     RSIIFSNYSAFDTRRLGATIDVEHSHLRFLGNMTLNLWDCGGQDVFMENYFGKQKDHI
                     FQMVQVLIHVFDVESQDVLKDIEIFQKALKQLKKYSPDAKIFVLLHKMDLVQLDKRND
                     LFQIMMEKLNETSISYGFNNVIGFPTSIWDESLYKAWSQIVCSLIPNMSIYQNNLKNL
                     QKILNAYEIILFERTTFLVISSSNNNNNNNNILGNSTNNNNNNNSNNDNSNNSILLDP
                     KRFEKISNIMKNFKQSCTKLKVNLKL"
     gap             24268..24287
                     /estimated_length=20
     gene            complement(<24551..>26320)
                     /gene="NDAI0E00230"
                     /locus_tag="NDAI_0E00230"
                     /db_xref="GeneID:11499109"
     mRNA            complement(<24551..>26320)
                     /gene="NDAI0E00230"
                     /locus_tag="NDAI_0E00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670034.1"
                     /db_xref="GeneID:11499109"
     CDS             complement(24551..26320)
                     /gene="NDAI0E00230"
                     /locus_tag="NDAI_0E00230"
                     /inference="similar to DNA sequence:INSDC:YML120C"
                     /note="similar to Saccharomyces cerevisiae NDI1 (YML120C);
                     ancestral locus Anc_8.854"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670082.1"
                     /db_xref="GeneID:11499109"
                     /db_xref="GOA:G0WAR9"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:G0WAR9"
                     /translation="MLSILYKNKSAVLASTNRMIRLASTSTKTTINSTTKPSTTTATA
                     SPTATTTANKTTTNSPITEPKRDISSTTSESVSTSSPNSQKQTISPVNKSGTGYASFK
                     TAKVIETEYNDKPTVVILGSGWGAIAFLKHIDTKRYNVAIISPRNYFLFTPLLPSTPV
                     GTVDEKSIIEPVVNFALKKKGNVTYYEATATEINPDRNTVTINSLSNVSKLNHHPSQS
                     SANANTNTKTNNDTMLTQDDCAEIKYDYLISAVGAEPNTFGIPGVEKHGLFLKEIPNS
                     LQIRQKFASNLEKANLLPPGDPERKRLLSIVVVGGGPTGVETAGELQDYVHQDLQKFL
                     PSVAKEVQIHLVEALPIVLNMFEKKLSSYAQETLEKTSIKLHLKTAVAKVEKDHLIAK
                     TKSDDGKTVIEEKIPYGTLIWATGNKARPIVTNLFPKITEQNKSTRALSVNKYLQVIG
                     SNNIFAIGDNAFIGLPPTAQVAHQQAEYLAKNFDKMAQLPNFHEKLQSRKQKFDLLFE
                     ENKFKPFKYTHFGALAYLGSERAIANITYGKRSLYTGGGLITFYIWRLSYLAMILSAR
                     SRFKVITDWLKLAFFKRDFFKGL"
     gene            <27597..>29156
                     /gene="NDAI0E00240"
                     /locus_tag="NDAI_0E00240"
                     /db_xref="GeneID:11499110"
     mRNA            <27597..>29156
                     /gene="NDAI0E00240"
                     /locus_tag="NDAI_0E00240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670035.1"
                     /db_xref="GeneID:11499110"
     CDS             27597..29156
                     /gene="NDAI0E00240"
                     /locus_tag="NDAI_0E00240"
                     /inference="similar to DNA sequence:INSDC:YML119W"
                     /note="similar to Saccharomyces cerevisiae YML119W;
                     ancestral locus Anc_8.852"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670083.1"
                     /db_xref="GeneID:11499110"
                     /db_xref="UniProtKB/TrEMBL:G0WAS0"
                     /translation="MMYSSASSSPTKRTLNNKLPFLNKGFYPYTDTDNCNNNTARAYN
                     HNAYSNDYNYELQTDSVPIIQQQQQFTVNHANDYKYSPQKSMKNNPYLNQRHQSISDH
                     NSNNTGDMSNNNNNNNNNRRYQQDFQQLQLQFQFQSQSQTTSQSPQRINYYVNNNNNN
                     LDNRHSPIRQTSPQRNINNSNNINHVYQYTKQNHYQNNNNNNNNNNNNTTQYHQISSP
                     QRQTTANYSPAKFQRTSPTKQYHYQEVKSESDILLTNSSYSKLNIKNRYFTENKEQLI
                     KDGDKLKPIINIIPKHSSTTSKTYKLLNPLLSEKSITSMDISSILKLNNATISHGNSK
                     HLLLANDPNFKINNLDEITMDLIMKKIKLINETKKKGKTTTKSITDEKLSENNIKEKD
                     KSKKVVVLDPTKSKLKNTTSLRKSNRHLINVITANSNPNDSFDLSFDGKAMDRSDIFR
                     MVDSFTMALSDDERELSGIILDTNNKAKKFDLQLKDNININILPAEITNNNGNNNNDS
                     PNNDENCLSSN"
     gene            complement(<29470..>29751)
                     /gene="NDAI0E00250"
                     /locus_tag="NDAI_0E00250"
                     /db_xref="GeneID:11499111"
     mRNA            complement(<29470..>29751)
                     /gene="NDAI0E00250"
                     /locus_tag="NDAI_0E00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670036.1"
                     /db_xref="GeneID:11499111"
     CDS             complement(29470..29751)
                     /gene="NDAI0E00250"
                     /locus_tag="NDAI_0E00250"
                     /inference="similar to DNA sequence:INSDC:YMR286W"
                     /note="similar to Saccharomyces cerevisiae MRPL33
                     (YMR286W); ancestral locus Anc_8.851"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670084.1"
                     /db_xref="GeneID:11499111"
                     /db_xref="GOA:G0WAS1"
                     /db_xref="InterPro:IPR005996"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="UniProtKB/TrEMBL:G0WAS1"
                     /translation="MVFYKITLQRSLIGLPKQTRTIVKTIGLGKRGSIVYRRVTPAMA
                     GSLAKVKELIDVEITEKALNKMEQRELRKSNPGFTIEKRNLNGIIDDTL"
     gene            <30097..>31593
                     /gene="NDAI0E00260"
                     /locus_tag="NDAI_0E00260"
                     /db_xref="GeneID:11499112"
     mRNA            <30097..>31593
                     /gene="NDAI0E00260"
                     /locus_tag="NDAI_0E00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670037.1"
                     /db_xref="GeneID:11499112"
     CDS             30097..31593
                     /gene="NDAI0E00260"
                     /locus_tag="NDAI_0E00260"
                     /inference="similar to DNA sequence:INSDC:YML118W,YMR285C"
                     /note="similar to Saccharomyces cerevisiae NGL3 (YML118W)
                     and NGL2 (YMR285C); ancestral locus Anc_8.850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670085.1"
                     /db_xref="GeneID:11499112"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:G0WAS2"
                     /translation="MISDSANDNAEPHQTQQNNQKKRNQKMNKKRMMLNTEYITKIRA
                     EREKKRELEREYRMKHGFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQS
                     LIQRDLFPGSGQALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGY
                     DCEFYKKNGKIHGVLIAWKRNLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEF
                     LNKDKSAIKKKGVIIGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKLGGIEKWYPFF
                     TGDFNSQPKDAPYVSITSKPVSFQNETKIVIECSAAYKYSKKRNGEEEEKNEGKEKQH
                     EIDSSDSSDAETDEEKEEIIPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAIS
                     LYSVGYRKVDPENAYINNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLK
                     TFERENNVKLRGLLKMPQSKEMCEHAIPYKGEYPSDHLCMMIQLELLE"
     gene            complement(31633..31681)
                     /gene="NDAI0Etrna8Y"
                     /locus_tag="NDAI_0Etrna8Y"
                     /db_xref="GeneID:11498822"
     tRNA            complement(join(31633..31669,31633..31681))
                     /gene="NDAI0Etrna8Y"
                     /locus_tag="NDAI_0Etrna8Y"
                     /product="tRNA-Tyr"
                     /note="codon recognized: UAC"
                     /db_xref="GeneID:11498822"
     gene            <33295..>36891
                     /gene="NDAI0E00270"
                     /locus_tag="NDAI_0E00270"
                     /db_xref="GeneID:11499094"
     mRNA            <33295..>36891
                     /gene="NDAI0E00270"
                     /locus_tag="NDAI_0E00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670038.1"
                     /db_xref="GeneID:11499094"
     CDS             33295..36891
                     /gene="NDAI0E00270"
                     /locus_tag="NDAI_0E00270"
                     /inference="similar to DNA sequence:INSDC:YML117W"
                     /note="similar to Saccharomyces cerevisiae NAB6 (YML117W);
                     ancestral locus Anc_8.844"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670086.1"
                     /db_xref="GeneID:11499094"
                     /db_xref="GOA:G0WAS3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR018835"
                     /db_xref="InterPro:IPR018885"
                     /db_xref="UniProtKB/TrEMBL:G0WAS3"
                     /translation="MKSYQQQQQENPYPRYNKSFSRRGSSYYMNVQQDQRSRKPSYIS
                     LNHSVHNPNMVYQHDPNGSQYFATTQQAYYIPSPLPNAPPTPFDTAYGATLLPSHLLM
                     GSPYVSTPNGIVPSSQQQSQMFLYSQSPAGTPNRKSFSQLNSMLNQPSSRSNFFTDSY
                     NNRYQNNPQTRIPEVDPNELFQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHSF
                     IYDFVQYSSIESIYLISNTDDEKDQDNENDKNKRSILLSFLSREICLSFYNNVLQRLN
                     EFKTNLQSKSLTLNFVILNYLEKTDDGSTANISNNQLNQIQENENDVNTNEFDYRNSM
                     NTVNALKFDLINPDATRFIMIELKTKCDKETLLNKHLSFLIDNKKNIRYILESIDLFN
                     IIENENSSENKSIIEAKNENENSPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIY
                     MAMELRDYLKLNGLKHGITNASYVQIKHVKKSLNSSSKRSSVTSTTDNKDKSEVDTNE
                     SVEGKDKKSEEAKSFNNKLSSITMSSPDTTYEGEDDIDIDIIISKLQKLKLKETIQVL
                     DIATYNTPLFQSHDSHMANITLSIVNPFEAQLMRPPPSNIVSPDQNHENLSYPILPPT
                     LPSIEKFPTRDQTLNQETSGRRSLSSSSTSLSNYQGRSNSNNYNTEAKEVKEQNKGER
                     NEGIFFVEQPTFNTDPTMYPIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSK
                     AEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGW
                     GNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLR
                     FDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGL
                     IINYGKDRCGNVNRNLISNKNSRHYRKVKKFSDNYKLRQLQEKRRVEQEKGKELNGGV
                     NDNKLPSLDALGIGLQRTAPPEEQKVPESNEDDANYDSAVTESDTNTFNALGFRIQSN
                     TDSHDDEQNDEKGEEQEEVDVIAHADDISSVNSSDVEIIIDCPHNESDTSMIQEKKKT
                     IRKNQQKIDRLAKARNAMFPEHRETIPDINNKLFHDRKNKDKNRRKQVQGGIQDQDPH
                     LSSTGKQQRVIPGADVMAQYLTQLQHSTFMYAANILGVSAEDNTYYDEEDTT"
     gene            <37676..>39325
                     /gene="NDAI0E00280"
                     /locus_tag="NDAI_0E00280"
                     /db_xref="GeneID:11499114"
     mRNA            <37676..>39325
                     /gene="NDAI0E00280"
                     /locus_tag="NDAI_0E00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670039.1"
                     /db_xref="GeneID:11499114"
     CDS             37676..39325
                     /gene="NDAI0E00280"
                     /locus_tag="NDAI_0E00280"
                     /inference="similar to DNA sequence:INSDC:YML116W,YMR279C"
                     /note="similar to Saccharomyces cerevisiae ATR1 (YML116W)
                     and YMR279C; ancestral locus Anc_8.843"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670087.1"
                     /db_xref="GeneID:11499114"
                     /db_xref="GOA:G0WAS4"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G0WAS4"
                     /translation="MLKHFHRHNSKNVEEEKEITQSTSSIIEEECSSITKEENNEVSE
                     DELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNI
                     ITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISG
                     FTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIG
                     AFMGSLFAGLIGTENPKQWPWAFYAFAIASAINLAISIYSIPNNIPTNIHGFAMDWIG
                     SIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIISIIALVLFFTYEIKYAKSPILPVE
                     VTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVAA
                     VIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSF
                     PAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRA
                     AEYLGVGLAGLGIVISGIYMAEVLWAKRKERLSSNRDHDMS"
     gene            complement(<39735..>41435)
                     /gene="NDAI0E00290"
                     /locus_tag="NDAI_0E00290"
                     /db_xref="GeneID:11499115"
     mRNA            complement(join(<39735..41238,41371..>41435))
                     /gene="NDAI0E00290"
                     /locus_tag="NDAI_0E00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670040.1"
                     /db_xref="GeneID:11499115"
     CDS             complement(join(39735..41238,41371..41435))
                     /gene="NDAI0E00290"
                     /locus_tag="NDAI_0E00290"
                     /inference="similar to DNA sequence:INSDC:YML115C"
                     /note="similar to Saccharomyces cerevisiae VAN1 (YML115C);
                     ancestral locus Anc_8.842"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670088.1"
                     /db_xref="GeneID:11499115"
                     /db_xref="InterPro:IPR005109"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G0WAS5"
                     /translation="MFGLLHKFGRNSRKDAKLELPISRNNSNVADELKKQRFIPKKKS
                     TAKNVAIGSVVSFIICALIYCGYSYFFNTSPRLGKINLYANKNNKVSTSYKTTELSDK
                     EYYNYDFENIEADVLGKFENGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVEKY
                     DLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCS
                     DGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMV
                     ETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLM
                     ANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLN
                     SWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSVVDLDGVGGVS
                     ILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDL
                     KEIANKERQSRHKE"
     gene            complement(<41787..>43781)
                     /gene="NDAI0E00300"
                     /locus_tag="NDAI_0E00300"
                     /db_xref="GeneID:11499116"
     mRNA            complement(<41787..>43781)
                     /gene="NDAI0E00300"
                     /locus_tag="NDAI_0E00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670041.1"
                     /db_xref="GeneID:11499116"
     CDS             complement(41787..43781)
                     /gene="NDAI0E00300"
                     /locus_tag="NDAI_0E00300"
                     /inference="similar to DNA sequence:INSDC:YML114C"
                     /note="similar to Saccharomyces cerevisiae TAF8 (YML114C);
                     ancestral locus Anc_8.838"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670089.1"
                     /db_xref="GeneID:11499116"
                     /db_xref="InterPro:IPR019473"
                     /db_xref="UniProtKB/TrEMBL:G0WAS6"
                     /translation="MASANETENYDMNEVQPPREIAHNHMDMQIEKLLQKSIAIQLKA
                     FKVDFSKLAFNQLTLLVDDQLNSLITELHRLSLLQRRNSMAKVDLELWMRGFNINPSD
                     LNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRTHIMESSTSDDNYDLTKQFRNISD
                     ATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTPQFNNPITDEKLIKQKLVEEGT
                     KSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEGPITDTDEEEKQAKNEKEKEQE
                     DTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSSKPNIISIHDEKIVNFFGHSSS
                     DKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSKLVCLEKEDYYDYDNDED
                     DLEERKNYNNNNDNDNRLSPIRKRAQINNEIISNLKRSFYSILNNYPKLKKAKKQRVK
                     LAIEKRDQRLQELRKIQEEERKVKEQKLLTKSENPLLSSNTSIVFSTHPTDIADVEAE
                     GEDGLGLFAGLGSSEEEEEEEEEEEEGEQQTATTHNVLQQLGSQRKEKEGTMTTTGNT
                     SVKIGEKQTDISVEPNNHETTEGSTQDIRTTEEQTNVEQAKQKPTDGQGKEELEDEEE
                     DDFDDHNFLFEDVVTSEFDKPGEDNKSTIVPNTNADIELI"
     gene            <45261..>46118
                     /gene="NDAI0E00310"
                     /locus_tag="NDAI_0E00310"
                     /db_xref="GeneID:11498791"
     mRNA            <45261..>46118
                     /gene="NDAI0E00310"
                     /locus_tag="NDAI_0E00310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670042.1"
                     /db_xref="GeneID:11498791"
     CDS             45261..46118
                     /gene="NDAI0E00310"
                     /locus_tag="NDAI_0E00310"
                     /inference="similar to DNA sequence:INSDC:YML113W"
                     /note="similar to Saccharomyces cerevisiae DAT1 (YML113W);
                     ancestral locus Anc_8.836"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670090.1"
                     /db_xref="GeneID:11498791"
                     /db_xref="UniProtKB/TrEMBL:G0WAS7"
                     /translation="MAKTLAQGRKPGSGRKPGKGKTLKEGRKPGSGRRRKTIVTEQQD
                     GDHNLENINIAHTHMNTITNTQIQTPLQSHVPLTLLSPSSIPTLPLAPLSPPKDNFEM
                     KLTARDLETVDALRGLIQSSNGFRNSISLPPISMDNNGFNNDNNNHNVELHVMHDHII
                     TRPKSVIPFISDHNSNNNNNNNNEQYQDQNHLLYPQTHFHTSMEAFKASRRTSINLIK
                     TPSESYNNSIHNNNNDNTQTNNENTRMVMLRNTSSVNQTDNNHITVKQTVNVSTGNNK
                     SSYHVTTTI"
     gene            <46706..>47929
                     /gene="NDAI0E00320"
                     /locus_tag="NDAI_0E00320"
                     /db_xref="GeneID:11498792"
     mRNA            <46706..>47929
                     /gene="NDAI0E00320"
                     /locus_tag="NDAI_0E00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670043.1"
                     /db_xref="GeneID:11498792"
     CDS             46706..47929
                     /gene="NDAI0E00320"
                     /locus_tag="NDAI_0E00320"
                     /inference="similar to DNA sequence:INSDC:YML112W"
                     /note="similar to Saccharomyces cerevisiae CTK3 (YML112W);
                     ancestral locus Anc_8.835"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670091.1"
                     /db_xref="GeneID:11498792"
                     /db_xref="InterPro:IPR024637"
                     /db_xref="UniProtKB/TrEMBL:G0WAS8"
                     /translation="MDSFEARLQFIQVLKNLQKNLSIIDNRTSISSGGETNPMSSSST
                     VDPIQFYLRSYKDHFEDFHQCLFDTTNKMNSLDRLNVLFYYSKILITLRSNMNEFNEK
                     VIFNVLLPSLCDLYHLILPNYDWKSLTNLDPCIEIYNLLKDNFFKDDELMTLKDYRIV
                     KDNEGEIQGTQENIAINKLSWYSVKDATTMRTTKDKEASSSTPSLGHSVMDHKESFIN
                     TRDLLQDRILKRQLFFKHYIQNGLTPVFGVDNNPHSTLKDSDHLATTTASVSPVLPLS
                     GQDQLAVTTTTNNTPTAVHTNMHDSSGNNTTNINKVHKSLTTNDRIIPIIIRRMENDR
                     ERHKRLKEKSWVVDRNIQRQRQKGQPLNTKKLILNVNEFESLWNNTNVNKLTIDDIKN
                     MKEMNLIAKQSYMIE"
     gene            <48961..>52086
                     /gene="NDAI0E00330"
                     /locus_tag="NDAI_0E00330"
                     /db_xref="GeneID:11498793"
     mRNA            <48961..>52086
                     /gene="NDAI0E00330"
                     /locus_tag="NDAI_0E00330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670044.1"
                     /db_xref="GeneID:11498793"
     CDS             48961..52086
                     /gene="NDAI0E00330"
                     /locus_tag="NDAI_0E00330"
                     /inference="similar to DNA sequence:INSDC:YML111W,YMR275C"
                     /note="similar to Saccharomyces cerevisiae BUL2 (YML111W)
                     and BUL1 (YMR275C); ancestral locus Anc_8.834"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670092.1"
                     /db_xref="GeneID:11498793"
                     /db_xref="InterPro:IPR007519"
                     /db_xref="InterPro:IPR007520"
                     /db_xref="InterPro:IPR022794"
                     /db_xref="UniProtKB/TrEMBL:G0WAS9"
                     /translation="MRSRPKTPQEKARNPTTSHRHSITTTTPNTTTTTSTTTSTARRP
                     LLRSNPTADNIHLNLDNRHYLSKNNNKKNSDNTNHNDQSEDDNINGTSQQSNDNLQAM
                     KSASMTNLQILGRSELSHGTNRETKVVSIAPPYYYDYNPNINEHFGNDINNNTNGEGG
                     GNNSLGYNMLSNIELGTTTTDQTNNLLVDVLPSFYMYNVLHRHIPQGNVDPDIHDYPP
                     NYQETITHVNPLLSNASTNDTTATTTANENIVENLTTTTMTTTTPPSNNTSSSNLNIL
                     NNLHPLNTRHYNISSNTNSTSHINNGSSSSTNELHTEIEDDLNDSDSIIIDKLYSLPK
                     LATPIEIDIRVTKNVSKPHIKNEEESILKEYTSGDIIHGYCIIENRSSQRLKFEMFYV
                     TLEAYISIIDNVRGKRTVKRFLRMVDLSASWSYTDIDLSSGINLVPGQIDSYDNSIIG
                     LKNNRILEPKTKYKKFFMFKLPNQLLDITCKQEQFSHCLLPPSFGIDRYKNSRKYSSI
                     KVNNVLGCGHLGVKGSPILTSDISDENVSINYTIDARIVGKDLKTQKLNIMKEKEYNL
                     RVIPFGFGTTLTSRNVFDKQLKDLRLLIQDRIDALEKVFERLKNDEPIINSDIHSNDL
                     SGTIDSDTELLSAEILRRKMDQLHINNRLDDNSNVFNDFKNMSPKENIIESELSYRIK
                     MKHKSSPNLKNVFFPGFLSGSHYSTNSVTTESSLSTDSIISNNIPQQSSTSSSTIGII
                     SSNRRTPLQHVSTTEHQSMDKSGLIVISTQIPKASLPYLSPSLLRKTNKFENKNRHDQ
                     ENWLRLSRLNTDEENTELTKLEIKLTCLQSNNSTPHNPPQIQSVNVELLAINGKSDNS
                     IPIKLQAAALLNEEKLSHITMSFKAYQNAISNYRKGFRENLMKLNELFNVGRTLSNAR
                     VLEFTDFITDQMRNDIESLCNLEVERIPVPDIFVKSALKQNVPEEKIPSTGSSSLTTP
                     WIKCGPSEYQRKLILNLEYSEKNNNHTLIPDFESCLCCRFYCIRVQVKFENHIGLATI
                     DIPVSVKKLNS"
     gene            complement(<52342..>53283)
                     /gene="NDAI0E00340"
                     /locus_tag="NDAI_0E00340"
                     /db_xref="GeneID:11498794"
     mRNA            complement(<52342..>53283)
                     /gene="NDAI0E00340"
                     /locus_tag="NDAI_0E00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670045.1"
                     /db_xref="GeneID:11498794"
     CDS             complement(52342..53283)
                     /gene="NDAI0E00340"
                     /locus_tag="NDAI_0E00340"
                     /inference="similar to DNA sequence:INSDC:YML110C"
                     /note="similar to Saccharomyces cerevisiae COQ5 (YML110C);
                     ancestral locus Anc_8.833"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670093.1"
                     /db_xref="GeneID:11498794"
                     /db_xref="GOA:G0WAT0"
                     /db_xref="InterPro:IPR004033"
                     /db_xref="InterPro:IPR023576"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0WAT0"
                     /translation="MLPRCNPFLGIRPLLLKSSYTISVSGATSAQRWFSQSPLISSTP
                     PIDQNNDETATTTHFGSKIVPKLEKEKMVGHVFSSVASKYDLMNDVMSLGIHRLWKNH
                     FINKLDPGKRLTSKQPLNFIDVAGGSGDIAFGILDYAKEKYHDQVSTMDIVDINPDML
                     KEGEKRALDQGRYYNDPRVRFMVQDGEKLDAIESNSKDIYTISFGIRNFTDIQAGLNT
                     AYRVLKPGGLFYCLEFSKIENDLMDLAYQQWAKILPVMGSVIANDFDSYQYLVESIER
                     FPNQENFKTMIEKAGFQSVGYESLTFGICAIHWGVKI"
     gene            <54073..>57564
                     /gene="NDAI0E00350"
                     /locus_tag="NDAI_0E00350"
                     /db_xref="GeneID:11498795"
     mRNA            <54073..>57564
                     /gene="NDAI0E00350"
                     /locus_tag="NDAI_0E00350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670046.1"
                     /db_xref="GeneID:11498795"
     CDS             54073..57564
                     /gene="NDAI0E00350"
                     /locus_tag="NDAI_0E00350"
                     /inference="similar to DNA sequence:INSDC:YML109W,YMR273C"
                     /note="similar to Saccharomyces cerevisiae ZDS2 (YML109W)
                     and ZDS1 (YMR273C); ancestral locus Anc_8.831"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670094.1"
                     /db_xref="GeneID:11498795"
                     /db_xref="InterPro:IPR013941"
                     /db_xref="UniProtKB/TrEMBL:G0WAT1"
                     /translation="MSEEPTNHPQLRKQTSRSYGNDNINNAASIQQARKEKRKSDMFI
                     AAKSLDNELQSVQNLKRLSIGSMDLLIDPELEFRVNNNNNISSISNNNNNLSIHNSST
                     SPSSSFSASSSSSSSSSFAVDTSISLEKNISTSPEISTNIPNTINSNSNNNDITQDTE
                     VSIEDSIDVTQSEYLHDEATLKKKTQNDMNIETSNDQPNSLQRSSHRSMSGVGSLKRN
                     GLNRRKLPFLSSSYASTSSTSKQSILSSQSEKDPTFTSSSSSDNLTPQNLLWVPANQH
                     PNIKPESYLELVQDTLHNIHLDDDNHNNDDAKVSTDDDLYSMDGTDETNKENLNIDYL
                     TKPSTSELRRKNKSLVRRPSGLRKSYTEFEEFNTSDEEDETSDCEEEQQLSTDNSTNN
                     ANHHQDIIINNKTPEIIIPKGNTRSSRFVSLKDITEELTKISNNAGLTDSDAITLART
                     LSMAGSFQDNSNNNHNSDNFNEEQNGNTPEDDEYASNMFMKNGLTIPTRSSLRRSRFN
                     TYRIRSGSSSTSAQSSSSSRTTSGSQMTNNNKTVTEPGRGNQPEDHNNTPASHYTARL
                     SYMSTTSPGSISDLYDHYQNSDSDVTPKAEQQNNNNIDKLTASNSNNTNTNNINSNNE
                     QYNISSDLSHASVSQDSSFLSNESSNNSILIKPQSSQSMLQENIDNQTESPACELPVD
                     STRQNNNEKQQQQQQQHLHKHANDDKNQKQDQENNHLFSKRNGWHWSSQKNPIESNTE
                     LSQANQTTTNNKSRHLQFFSHSADLKDESTNSSTTDTDTSTLAQKKETFDKKFAKLFK
                     RKSHENKNILKTKSSNSSLSKFRKHAKKSDTRLLSNTNKVGTSPPPPSSSNITDPDRT
                     MNHQSNSEKTSLTPTPKSKSLISKVAPVSIPTPTITISPSSDFVTQSEDINDERNKNE
                     DLFDLPALQPAVSFSSTKTTTSTSNNEIDSNKSSKEFVETVREIEGDDSQELSGGDIS
                     YEDNNIKNQLQEDESVVSPEDHFELSQESIEAEDQTQSFNDSATQPLSQQHGLPPRKL
                     TFDDVKRPERPNAPVEFTDSAFGFPLPALTVSTVIMFDHRLGINVERAIYRLSHLKLS
                     DSKRELREQVLLSNFMYAYLNLVNHTLYMEQVAQQETIDNVEFTGDDANDHQMNMVTG
                     NGGIYNDSNGSILIPDI"
     gap             57661..57680
                     /estimated_length=20
     gene            <57992..>58360
                     /gene="NDAI0E00360"
                     /locus_tag="NDAI_0E00360"
                     /db_xref="GeneID:11498796"
     mRNA            <57992..>58360
                     /gene="NDAI0E00360"
                     /locus_tag="NDAI_0E00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670047.1"
                     /db_xref="GeneID:11498796"
     CDS             57992..58360
                     /gene="NDAI0E00360"
                     /locus_tag="NDAI_0E00360"
                     /inference="similar to DNA sequence:INSDC:YML108W"
                     /note="similar to Saccharomyces cerevisiae YML108W;
                     ancestral locus Anc_8.830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670095.1"
                     /db_xref="GeneID:11498796"
                     /db_xref="InterPro:IPR015080"
                     /db_xref="UniProtKB/TrEMBL:G0WAT2"
                     /translation="MSSTNNMYRLMILLEEEIGEPDLKDGSIDEATETETKDVHNSDE
                     EKNVKKMHEFIEELILPFGTEELDLLNEWFDKFDEEICIPNEGHIKYEITSDGLIVLL
                     LDKEIEDVVGEIKKFIETNQ"
     gene            <59615..>60283
                     /gene="NDAI0E00370"
                     /locus_tag="NDAI_0E00370"
                     /db_xref="GeneID:11498797"
     mRNA            <59615..>60283
                     /gene="NDAI0E00370"
                     /locus_tag="NDAI_0E00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670048.1"
                     /db_xref="GeneID:11498797"
     CDS             59615..60283
                     /gene="NDAI0E00370"
                     /locus_tag="NDAI_0E00370"
                     /inference="similar to DNA sequence:INSDC:YML106W,YMR271C"
                     /note="similar to Saccharomyces cerevisiae URA5 (YML106W)
                     and URA10 (YMR271C); ancestral locus Anc_8.827"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670096.1"
                     /db_xref="GeneID:11498797"
                     /db_xref="GOA:G0WAT3"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR004467"
                     /db_xref="InterPro:IPR023031"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:G0WAT3"
                     /translation="MLEDYQKNFLDLAVECKALTFGSFTLKSGRVSPYFFNLGFFNTG
                     KLLSNLATAYAIAIIQSDLKFDVIFGPAYKGIPLASIVCVKLAEIGGSKFQNIQYSFN
                     RKEAKDHGEGGNIVGASLNNKRVLIIDDVMTAGTAINEAFEIIGKANGTVVGSIIALD
                     RQEIVDTTTSQNGLSATQAVSQRYGIPVLSIVSLSHVINYLDGKITKEEKSKIEEYRQ
                     TYGA"
     gene            complement(<60669..>61505)
                     /gene="NDAI0E00380"
                     /locus_tag="NDAI_0E00380"
                     /db_xref="GeneID:11498798"
     mRNA            complement(<60669..>61505)
                     /gene="NDAI0E00380"
                     /locus_tag="NDAI_0E00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670049.1"
                     /db_xref="GeneID:11498798"
     CDS             complement(60669..61505)
                     /gene="NDAI0E00380"
                     /locus_tag="NDAI_0E00380"
                     /inference="similar to DNA sequence:INSDC:YML105C"
                     /note="similar to Saccharomyces cerevisiae SEC65
                     (YML105C); ancestral locus Anc_8.826"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670097.1"
                     /db_xref="GeneID:11498798"
                     /db_xref="GOA:G0WAT4"
                     /db_xref="InterPro:IPR002778"
                     /db_xref="InterPro:IPR022938"
                     /db_xref="UniProtKB/TrEMBL:G0WAT4"
                     /translation="MPKLEEITDYNDIDDLDMDLAELDPSLRTPIAPKITPTVVRSQD
                     NEEATQLPDFATQFQQSNYNNIGNENAFAFINPQTGKIERSKQVSKEILKDMKKFQIL
                     YPCYFDKNRSHKEGRRVPKELAVENPLAKTMADAAGNLGLICVFEDQKTHPQDFGNPG
                     RIRILLKQNGQIAADGNRFKGGKRELMKSIAKYLQKHPTTLKSLRELPYGPDYDGVES
                     KKIPRVKGFKMNDIVPLHSPLLMGHPMVKSIYEEQPQAPKPAINDKPMKMPKNKYKVI
                     RR"
     gene            complement(<61806..>65318)
                     /gene="NDAI0E00390"
                     /locus_tag="NDAI_0E00390"
                     /db_xref="GeneID:11498799"
     mRNA            complement(<61806..>65318)
                     /gene="NDAI0E00390"
                     /locus_tag="NDAI_0E00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670050.1"
                     /db_xref="GeneID:11498799"
     CDS             complement(61806..65318)
                     /gene="NDAI0E00390"
                     /locus_tag="NDAI_0E00390"
                     /inference="similar to DNA sequence:INSDC:YML104C"
                     /note="similar to Saccharomyces cerevisiae MDM1 (YML104C);
                     ancestral locus Anc_8.824"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670098.1"
                     /db_xref="GeneID:11498799"
                     /db_xref="GOA:G0WAT5"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR003114"
                     /db_xref="InterPro:IPR013937"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="UniProtKB/TrEMBL:G0WAT5"
                     /translation="MSTNGIITIHRYRHVLGIIVFLLIARHLFWILTFGVLPLIGFFL
                     FTTLATTLPDINRPVEKHLKRAHTPETNSFSSINEPIFEKSSKISKELENIIDLILRD
                     FINSWFTRIDPNEDSSFPKAIRCLLRLAVINLQKRVATEDTLENLILKLLPLFTKYVN
                     TYCDARESILNDPTSQKALQNNFEFQLAVEFNKNYKLHKAIPLRSNELDNDIGKYLNG
                     LSQQLLSEIIDENELKSPFVSILLREIMDSCIFNPLVSKFTDPDTWNLIMISIGEKKM
                     KERTQVKQIRRILTKELQGHSTSNSPTNARVNLTNIKLDLKPSFTGEQFEMFLKELSS
                     MNSITELRANKFILMTKLVELRKNIDNSQIDCKYKDRLLLSLKLVQSKLLHNDMINNR
                     EANKNDNIAKQLYTFLSDEENILDEFESFIRAISFDFVSSDKLCLNEFKKYLYTCPDK
                     KGITLLKYWEIVESSKNPLEDVSSNEILLETTFVSSTEIRSIYSELFQDVDLQIMKTL
                     DKGLVSNVLLFLSTSNNGDEQALVLARRSLLLLQKEAERVLQSEFFEKFKESKVFLQM
                     ISSNDFTKTDIYTKFFTSEKALDPMTPNTHTTNDTFDSVRILTNPDLNEALEKIVNAP
                     SLEETDRIHGNEGHNGKAVKNTLKNEKSIFEAEIQTNRTESFNELELLNSEFNVENSE
                     IVDNPEHGFNIRKLQKMKRKFSTISDKIAQLTISIEEIEKELELLNYLVLKAELTNNQ
                     NQLKLLRKSQKALLRELKNEELLQQQCLIKKDANALYRQTKVFIKSFYLEHRTNINNL
                     GETAYYLIDIEHCYNGHTTTWETGRRYNEFFKLNEYLKKYYRSQVKFLQKNEMFPSKI
                     PMSFKYHINPYLLYEERQHKLEMYLRALLNIPEICQDSVFRAFVIDKAMVDIYGMDQL
                     NQSTNDNSTSNSSTHSIPTMKNLNTSSMSSIASNSSSGSQVALYDQVHSNPPADQNNQ
                     INVEDLEDGENYKNDEFHPFQNDPMIRHESKPIVKSICNLFISVFQLNRNNSNSNWLR
                     GKAISTVLQQLLGSTIEKYIKINIEEIRSEEGIYEMLGLLKKSLWGVNGSITKRKTEP
                     IRPIRTPGEKTRTRCDSQVVLQSLFIELCGKVVGLSNSRDAAIRVHGMLQNRYLSCSM
                     ILEMLDIFFLDVIIKENTTEAYHD"
     gene            complement(<65678..>71323)
                     /gene="NDAI0E00400"
                     /locus_tag="NDAI_0E00400"
                     /db_xref="GeneID:11498800"
     mRNA            complement(<65678..>71323)
                     /gene="NDAI0E00400"
                     /locus_tag="NDAI_0E00400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670051.1"
                     /db_xref="GeneID:11498800"
     CDS             complement(65678..71323)
                     /gene="NDAI0E00400"
                     /locus_tag="NDAI_0E00400"
                     /inference="similar to DNA sequence:INSDC:YML103C"
                     /note="similar to Saccharomyces cerevisiae NUP188
                     (YML103C); ancestral locus Anc_8.821"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670099.1"
                     /db_xref="GeneID:11498800"
                     /db_xref="InterPro:IPR018864"
                     /db_xref="UniProtKB/TrEMBL:G0WAT6"
                     /translation="MIPKTTLNITSNTTSTNTNTNTNAGSIPFTYINHFLRSYVKHQR
                     NATDINNNNNNNNNNNNIDISPLENLNHQEDDDMYDDLPSNGIISTFKKIYHYLDTNK
                     TLFTQLTHFNTSSSASSTHDNNKRSKSISSPPEYFNKLTLRGSTFDNINKDIFHKSWI
                     ISNFLDLDFKETLKIISLITNNNNDDDENNNTTVLTIQDLIMAVLKERNAILETLLIL
                     LSNIDFPIIKDNLFNFFTIESIENISNDLISLFQSLIEENSTINYYDNIFIDEKIFLD
                     NANANDTGKNNNNDRLVQLIDLKNSNNLIYITNLLKILTNLFLNSNPSNEIILKWCQL
                     FNNENVLLALNSNITSFTPSLSSTTTIANANSNSNEGNSISILQSLFVVNSLLILGLD
                     TKTSSIKILDSENHFFNNKEIFKSIHSIFINSLNFASLNDQLSLNPTLYYMWSFILYT
                     KSIILDETFDNDNDDNDTEDFVNYVFNTKNNNEPNNNNLLETINQFASIAEHLNVLNS
                     IEIIIQDLSNDEIYPTILSSFLAFTLNFIPINIKFSHLIKLTLSKEIPRPFVEKFLTN
                     NLIENKIATLKTKIPLLKEGLLPFINICSTSSQFADFHLNHLNSFTTFNSSSLTESDY
                     DINDIDPETNQDIDSDLIILKKDISVRLPVEFDSNISIIIPKDSIAKIIPITKEIATK
                     SSTSTNDNNKDDAISILSESAPIIPAPSSIVVFFYEYNGWSMIGHILENLARNFSDLS
                     NTNSMDQDLQQLMISIIDLIGKIVSSNELPQERINQIINELSNNSMNNMTDDIKNNNM
                     YDGGAELNKEIFDVIFKIFETSLNKRNYQILSTCTSFTNNLVINYPHLVWSYLARSDL
                     LDKYGKTGFANIILGTIELSTGNYDFTISLIKLTNILVIDLLVRELTLSYKTKCEVTD
                     KLLCHLIHIYENYQFWKFNDVNQRFQIGYQLTLIFSQILYHYYGIGCGIDANKNSNKT
                     TTNNEYQQHFISAIGKLINTFANLKALDSQAASNTLINILLSSQNDQISSKGNKSFGN
                     LYSELINISFYFAHLLVIIRSHTGLTPGNLEVLFYQNSKKFVEIYHSSPELRSPIITL
                     FDALIKVPRKSHILNNLVYNDKKINQEYPSLLSYLGEDHSKLFLQTLAEDLENNLNDY
                     QLSKNIYTFIGDLMETDQEGLAILFLTGQFASSNLKDKKSLIASNENKTIFKILQRKV
                     SELDELPVSVAIKLLTTVARVCNTLKDARFFNDDQNCIEILLDIFLSFKQSQLQNEQQ
                     REETNNRTDLPLSRKEFIKLSNKYVLIFKIMEIFALSLYSSSNSTTSKVFQLLNRKDI
                     GTILTPFFEIHGYQMNLYESLQKEFNETYPLYDLNDFKVNQFYGSSLKNLPENAYDIQ
                     TMDLIFKNDEKWVGTCNSIGLRDRIIDLSINLQYIQNQISSTKSCGALLTSFVKLSKE
                     PNTFIDLVINLLDLNIRYGIINHDFEGIYFGRLELCFFILFSFQKNSKSIDEKKLIEI
                     LSRLLTIFKSNDVNYLKSVADPNRASTTFDFYIPILRSILIILTLSTSRTQFIELLSD
                     QLLEFFEFSFSNGVQLIFSQVLSDISQCKLDIGSKEDRLINFEKRKHSLNLLLSLFKT
                     LVSLKPTEHFNMLLASSLNDMGTIKVILNVYSSADYYKSKDDPTIGTIVLPYITSLCS
                     VPPIAEKFITNGMFTILLESPLSKVLQQGFIRPRLEPKLHSLWSNGLLVIIQILLRDF
                     GSRVLPECCLFISYFSKQIKSTIFSWSDNNRLVISTSLLNETWQLVLIQKMLDDLNYK
                     KYLGENLSNENDVGTTVSETDKTFELVSGLDYQYERRDLYAVLNKLLTHPRYLNSRII
                     SSTVEEQQLLDDESTRTVFVAQLKKSIKDLQDFLIQDEL"
     gene            <72769..>74559
                     /gene="NDAI0E00410"
                     /locus_tag="NDAI_0E00410"
                     /db_xref="GeneID:11498801"
     mRNA            <72769..>74559
                     /gene="NDAI0E00410"
                     /locus_tag="NDAI_0E00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670052.1"
                     /db_xref="GeneID:11498801"
     CDS             72769..74559
                     /gene="NDAI0E00410"
                     /locus_tag="NDAI_0E00410"
                     /inference="similar to DNA sequence:INSDC:YML102W"
                     /note="similar to Saccharomyces cerevisiae CAC2 (YML102W);
                     ancestral locus Anc_8.817"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670100.1"
                     /db_xref="GeneID:11498801"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0WAT7"
                     /translation="MEAANLQIYWHESQPVYSLCFEPPSLYSSSSSSSSSSATNAIDQ
                     KKLGMRLITAGGDNKIRSWSLNMSDSDLNFDSEPKTQVQKINSIDFLSSLTQHEQAIN
                     VVKFNPLGNILASAGDDGQVLLWKRHINDDVDVNDDDNNKDGTERTHIKKPFGMSNDN
                     DDDDNLEGVKDDNNNSWFIWKRLRPNGSNTSEIYDLDWSPCGNYIVIGSMDNCIRIFQ
                     ITKNKNDESSFLNNQIFSFNDHNHYVQGVVWDPMNQYILSQSADRSVNIYQLIWNHES
                     QLISIKFKNKIIKGDLPQSIATTTTGTRQNTLDYNNLKTSYLFHNESLPSFFRRLTIS
                     PCGSLFCIPTGIFKQPIVSKDDSTSSNNSNSDPNNCVYFYTRASIISNSNRPIFTIPS
                     LKKPALVIAFNPNFYPLSSSKDDENHHSHPYIKLPYKLIYAIATSNEILIYDTESIEP
                     ISIIGNLHYTALTDLSWSSDGTMLMISSTDGFCSYISIDAEKYFGNPFSNDEKFKIIN
                     LNRLKYEKTQTNSTTTNNNNDNSTGPSIMASTKNTVTPSNKMDIINILPVKRKNKSND
                     NSSTIEKKEDKSGIIIESLPLDKKMKPDEN"
     gene            complement(<74765..>75385)
                     /gene="NDAI0E00420"
                     /locus_tag="NDAI_0E00420"
                     /db_xref="GeneID:11498802"
     mRNA            complement(<74765..>75385)
                     /gene="NDAI0E00420"
                     /locus_tag="NDAI_0E00420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670053.1"
                     /db_xref="GeneID:11498802"
     CDS             complement(74765..75385)
                     /gene="NDAI0E00420"
                     /locus_tag="NDAI_0E00420"
                     /inference="similar to DNA sequence:INSDC:YMR264W,YML101C"
                     /note="similar to Saccharomyces cerevisiae CUE1 (YMR264W)
                     and CUE4 (YML101C); ancestral locus Anc_8.816"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670101.1"
                     /db_xref="GeneID:11498802"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="UniProtKB/TrEMBL:G0WAT8"
                     /translation="MSLGDLDNSTIIFITSIILGFILIKWFNMKNSNNNNDDESYAEM
                     TMTEIKETITTFNKPKDSDEKQTITNDDQKEAPQMKKKGNRFQKRMVNDDMIEVVATM
                     APSLDYEQIKFDLQKTGSIEKTIENFLRGDDFPFPEKKESNIQIGEKKVDSSNLELDG
                     LDDDDYNEEEDETYREDTMNDEEDDEEDEDYSQFADDDTNNSYDDY"
     gene            <76840..>80436
                     /gene="NDAI0E00430"
                     /locus_tag="NDAI_0E00430"
                     /db_xref="GeneID:11498803"
     mRNA            <76840..>80436
                     /gene="NDAI0E00430"
                     /locus_tag="NDAI_0E00430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670054.1"
                     /db_xref="GeneID:11498803"
     CDS             76840..80436
                     /gene="NDAI0E00430"
                     /locus_tag="NDAI_0E00430"
                     /inference="similar to DNA sequence:INSDC:YML100W,YMR261C"
                     /note="similar to Saccharomyces cerevisiae TSL1 (YML100W)
                     and TPS3 (YMR261C); ancestral locus Anc_8.813"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670102.1"
                     /db_xref="GeneID:11498803"
                     /db_xref="GOA:G0WAT9"
                     /db_xref="InterPro:IPR001830"
                     /db_xref="InterPro:IPR003337"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G0WAT9"
                     /translation="MTIIVASLFLPYTPQFEVIDPDAITSELAESNLIKVVDNNENIR
                     KKRTSSVHSASPFLLNNLSQESMAGAAAAIGTTHSPSLEPLNKFTAIPGQHHQQQQQQ
                     QQPIPSINISSASTGDLAHPNPLTIDEVVSSEQFMENLTASGTVSHTPALSAHHHPAQ
                     NASASVEEFFSSSNTVPDQIGSPAYSISSAPGLDIANAANSISTGPFSTGTSPDPTAS
                     LLKNVNKSLLVHSVLNLNNASQTSLDSLTNKYNQTNVTKGTVITPKSRAIPDISSAVV
                     NFAKVKQKHQQQSNLPSMRRMQSTPNVHTSSSTSTTAAGPTTGNVTNRHGTTPAKVSS
                     NLKYSQLAETETETETEHETESEGTRSKSASITQDHNIPLYDAKEQQGKDSTVHSDTL
                     SPIIRKTDKEKKSIDEENDSDSDLEVDSKDKKYNVPQFGGFSNNAKLRAQLLSSSHEL
                     FRNLPWKIALNDKGNGAMKNAINTAIIEETIKEPVSWVGTVGIPTDEIPDEITAKISK
                     TLQDEYQSTAVVTDDITFKGAYKNFCKQILWPTLHYQIPDNPNSKAFEDHSWNYYQKL
                     NQQFADQIIKIYKIGDTIWVHDYHLMLVPELVRKVLPNAKIGFSLHVSFPSSEVFRCF
                     AHREKILKGILGSNFVGFQTKEYARHFLQTSNRLLMADVGTDELKFNGKIVSVKYTPV
                     GIDTFTLNDQLKDERVFQWRHLIRERWEGKRLIVCRDQFDRIRGLHKKMLAFERFLKE
                     NPEYIEKVVLLQICIGKSSDSELERQIMMVVDRINSLSSNISISQPVVFLHQDLEFVQ
                     YLALSCEADMFLVNSLREGMNLTCHEFIVSSEEKNAPLLLSEFTGSASVVKGALLINP
                     WDIRHSANCIKQGLEMSKEEKRRHWKKMMKSVIENDSDNWILSSLQNIHNAWEFNQER
                     STVFNLAYDTLYTDYKKSEKHMFIFKISEPPTPRMLSILNDLSSKNIVFIMNSFSKVT
                     LESLYNRVLNIGLIAENGAYVRLNGSWYNIVQQVDWKSEVVKIFDDKVERLPGSYYKV
                     ADSMIRFHTENAEDQERVASVIGDAITHINTLFDERGIHAYVHKNIVFVQETGLSLAA
                     VQFLLKFYNNTSHPFDNSSIAVTQSENTFTQNGNGQSQIDFMMVTGSSSPVVEPIFRL
                     LKEEVGKATLRSGHSVVYGENVTYTYAKEHITGSNELFTILQNIPRIEKSKN"
     gene            <80965..>82215
                     /gene="NDAI0E00440"
                     /locus_tag="NDAI_0E00440"
                     /db_xref="GeneID:11498804"
     mRNA            <80965..>82215
                     /gene="NDAI0E00440"
                     /locus_tag="NDAI_0E00440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670055.1"
                     /db_xref="GeneID:11498804"
     CDS             80965..82215
                     /gene="NDAI0E00440"
                     /locus_tag="NDAI_0E00440"
                     /inference="similar to DNA sequence:INSDC:YOL054W"
                     /note="similar to Saccharomyces cerevisiae PSH1 (YOL054W);
                     ancestral locus Anc_8.808"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670103.1"
                     /db_xref="GeneID:11498804"
                     /db_xref="GOA:G0WAU0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018957"
                     /db_xref="UniProtKB/TrEMBL:G0WAU0"
                     /translation="MSDKLSVYLVARSSKVKNKILLRLLESLNCSICHDYMFVPMMTP
                     CGHNFCYGCLNNWITGGSKDLNCPQCRSTINEAPRLNLILRETLDSIIEFLNEKKKVS
                     RDAQFKKIMESKSMELSKYKKDLDKDNLFESFFKNSAMAVVDEDDDEGIPRCSNCHWE
                     IDPDDLEDNDNVCPHCNMRIRNSVQNISNRNSEVTNLRTNDAIIVGLDDDEYSSDEIQ
                     QIHDDLVRHPNADSPEIYSDSDLESDSNEDEESLIPRKQSNKHRDNFYDDEASEDYDE
                     EDNHTKINRNEDRISINSAEDSEDDSDLDGFIEHDDDALRDDGGIVVNEAGHISSNDE
                     EEQNSDYYEHNDDEGFVSGDSLNDESDESDHLEEHDDEDDEDDDEDDEDEDDGDDDDD
                     DRDEERSRKRQRRSRVVLDGSDDE"
     gene            <82593..>83789
                     /gene="NDAI0E00450"
                     /locus_tag="NDAI_0E00450"
                     /db_xref="GeneID:11498805"
     mRNA            <82593..>83789
                     /gene="NDAI0E00450"
                     /locus_tag="NDAI_0E00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670056.1"
                     /db_xref="GeneID:11498805"
     CDS             82593..83789
                     /gene="NDAI0E00450"
                     /locus_tag="NDAI_0E00450"
                     /inference="similar to DNA sequence:INSDC:YOL053W"
                     /note="similar to Saccharomyces cerevisiae YOL053W;
                     ancestral locus Anc_8.806"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670104.1"
                     /db_xref="GeneID:11498805"
                     /db_xref="UniProtKB/TrEMBL:G0WAU1"
                     /translation="MIYPLISRRTLVTSSPKGIIIRLQYPILRPLTFPLGPNHVNNTT
                     NCNGISITKRNYSLKFPYFDLKNTKLRLNTNNNVRMHENNKQVDGKHFFTKQGDVTEN
                     NEKSQLKHENPSHEEDEKVMAINSIQEAIRQQRNKRRKQMASIIFMILSSLLIGYGLG
                     YKVLYLRQEIFWPICPTSKYHKLSKNELKKINLLQIEKLARIRTLEQLSKHEMIKDQY
                     GIPLKLENEDNTEGVGEPFKIWCEDQDLCLFGVKIKPDGNNNNNKQKQRDEDHKWYRL
                     PFLFKWRFTYKSISLLITFQNILNSIGINKNGLYEIIEPEKVYGSFKYEHPLGRGSSS
                     VNDNKSDCGHPMHLWFLGEIKLDKDSLVIYKGKYHVDVKMQEITLLRKENGKLIEYIL
                     YNDIKR"
     gene            complement(<84148..>84327)
                     /gene="NDAI0E00460"
                     /locus_tag="NDAI_0E00460"
                     /db_xref="GeneID:11498806"
     mRNA            complement(<84148..>84327)
                     /gene="NDAI0E00460"
                     /locus_tag="NDAI_0E00460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670057.1"
                     /db_xref="GeneID:11498806"
     CDS             complement(84148..84327)
                     /gene="NDAI0E00460"
                     /locus_tag="NDAI_0E00460"
                     /inference="similar to DNA
                     sequence:INSDC:YMR251W-A,YOL052C-A"
                     /note="similar to Saccharomyces cerevisiae HOR7
                     (YMR251W-A) and DDR2 (YOL052C-A); ancestral locus
                     Anc_8.802"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670105.1"
                     /db_xref="GeneID:11498806"
                     /db_xref="UniProtKB/TrEMBL:G0WAU2"
                     /translation="MNLYKIVTPIIALSSLSNAQNLTDGQQQNAAIRNIDGQSAMTKA
                     GIAGTIIAGVIAYML"
     gene            85737..85809
                     /gene="NDAI0Etrna11A"
                     /locus_tag="NDAI_0Etrna11A"
                     /db_xref="GeneID:11498807"
     tRNA            85737..85809
                     /gene="NDAI0Etrna11A"
                     /locus_tag="NDAI_0Etrna11A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:11498807"
     gene            complement(86807..86880)
                     /gene="NDAI0Etrna15V"
                     /locus_tag="NDAI_0Etrna15V"
                     /db_xref="GeneID:11499081"
     tRNA            complement(86807..86880)
                     /gene="NDAI0Etrna15V"
                     /locus_tag="NDAI_0Etrna15V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:11499081"
     gap             87120..88006
                     /estimated_length=887
     gap             88397..89245
                     /estimated_length=849
     gene            complement(<91514..>92290)
                     /gene="NDAI0E00470"
                     /locus_tag="NDAI_0E00470"
                     /db_xref="GeneID:11499088"
     mRNA            complement(<91514..>92290)
                     /gene="NDAI0E00470"
                     /locus_tag="NDAI_0E00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670058.1"
                     /db_xref="GeneID:11499088"
     CDS             complement(91514..92290)
                     /gene="NDAI0E00470"
                     /locus_tag="NDAI_0E00470"
                     /inference="similar to DNA sequence:INSDC:YOR319W"
                     /note="similar to Saccharomyces cerevisiae HSH49
                     (YOR319W); ancestral locus Anc_8.797"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670106.1"
                     /db_xref="GeneID:11499088"
                     /db_xref="GOA:G0WAU3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G0WAU3"
                     /translation="MQKMSSIFTTLSQLSTYQASLDTANCIFECIYKVCSSSKMNSQM
                     SNPELSVYVGNIDPNVTKAQLYELFVQVSPISKIAYPKDKLLQTHQGYAFIEFYTPED
                     TNYVVKVMNNTVSLYDRFLKVRKSVQNLPSSNNKTYTTSKQVEVLPIAKVFVKNLDES
                     VDIQQLSNIFEKFGPLFKEPEIFYLSNNTLRCAHIFFKFYPDSDAAIGKLDNELIANK
                     RINLDYAYKEGHTIGKGNNKYGSETDRLLNKEAKKNGLLL"
     gene            complement(<92684..>94783)
                     /gene="NDAI0E00480"
                     /locus_tag="NDAI_0E00480"
                     /db_xref="GeneID:11498808"
     mRNA            complement(<92684..>94783)
                     /gene="NDAI0E00480"
                     /locus_tag="NDAI_0E00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670059.1"
                     /db_xref="GeneID:11498808"
     CDS             complement(92684..94783)
                     /gene="NDAI0E00480"
                     /locus_tag="NDAI_0E00480"
                     /inference="similar to DNA sequence:INSDC:YMR246W,YOR317W"
                     /note="similar to Saccharomyces cerevisiae FAA4 (YMR246W)
                     and FAA1 (YOR317W); ancestral locus Anc_8.796"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670107.1"
                     /db_xref="GeneID:11498808"
                     /db_xref="GOA:G0WAU4"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="UniProtKB/TrEMBL:G0WAU4"
                     /translation="MSPKHYTVEVGKAANIHETAPRRNAKAADKALIRPPNMNCSTVY
                     ELIVECCEKWGNRNAMGWRDIIEIHEEQKTVKKLIDGKETSVEKTWLYYELSPYHYTT
                     FKQLITIMNHLGKGLNKIGLNPNTEDKLHIYASTSHKWLKMFMGAQSQSLPVVTAYDT
                     LGEHGLIHSIRQTNSSAIFTDNSLLNSLINPLKECKGIRYVIHTDKIDPNDKRQNGKL
                     YSTANEAIEKIKEIRPDIKVYSFDEILELGEENDNNIELHLPKPDDLSCIMYTSGSTG
                     DPKGVVLKHSNIVAGIGGASLNVQGITGPTDRVIAFLPLAHIFEMAFELLSILWGSCL
                     GYATVKTLTNNSVRNCQGDLIEFKPTIMVGVAAVWETVRKGILQQINELPMITRKIFW
                     AAYYAKLKMNNYYIPGGNLLGNIVFKKVRNATGGNLRYMLNGGSPLSRNAQEFITNLI
                     CPMLIGYGLTETVANTTILDPTHFELGVAGDLTGAVTVKLVDVEELGYLAKNNQGEVW
                     IKGACVLPEYYKNPEETEKALTKDGWFMTGDIGEWTPHGHLKVIDRKKNLVKTQNGEY
                     IALEKLESIYRSNQYVQNICVYADENKVKPVGIIVPNHAPVRKLAKQLGVMKETDDDI
                     EPYLTDKKLVNAIFQDMLKTGKEQGLVGIEFLAGIVCFDDEWTPQNGFVTSAQKLKRK
                     KILDAVKRQVDQIYSST"
     gene            <96731..>97771
                     /gene="NDAI0E00490"
                     /locus_tag="NDAI_0E00490"
                     /db_xref="GeneID:11498809"
     mRNA            <96731..>97771
                     /gene="NDAI0E00490"
                     /locus_tag="NDAI_0E00490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670060.1"
                     /db_xref="GeneID:11498809"
     CDS             96731..97771
                     /gene="NDAI0E00490"
                     /locus_tag="NDAI_0E00490"
                     /note="ancestral locus Anc_8.794"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670108.1"
                     /db_xref="GeneID:11498809"
                     /db_xref="GOA:G0WAU5"
                     /db_xref="InterPro:IPR017452"
                     /db_xref="InterPro:IPR029730"
                     /db_xref="UniProtKB/TrEMBL:G0WAU5"
                     /translation="MSESFIDVSKSGNEAIQLNLPTGLDFHITKQGSDWLWAVFSIFG
                     CFLLCYLVFFFYAEIKGSKLTRYAVAPALLISFFQFFAYFTYASDLGWTGIEAEFNHI
                     TVKTSITGEHPGVRQIFYSKYCAWFLSYPCLLFLLELSGLSSSDEDVSALDTIHSLLM
                     QMIATEFWVVSLLVGALIKSTYKWGYWTFGAVAMLLVQGVIIKRQFFTLNVKAIEFKS
                     LMLMTSMLIVWLYFICWGISEGGNVIQPDGESVFYGVLDLCMFAVYPAFLVFTIAKDG
                     KLPNITVNNPLPGIHKHHENENDLQEQETDSEDEEGVHHEKEVSPDSPRASGATAFQP
                     EEDEAANVETST"
     gene            <99607..>101262
                     /gene="NDAI0E00500"
                     /locus_tag="NDAI_0E00500"
                     /db_xref="GeneID:11498810"
     mRNA            <99607..>101262
                     /gene="NDAI0E00500"
                     /locus_tag="NDAI_0E00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670061.1"
                     /db_xref="GeneID:11498810"
     CDS             99607..101262
                     /gene="NDAI0E00500"
                     /locus_tag="NDAI_0E00500"
                     /inference="similar to DNA sequence:INSDC:YMR243C,YOR316C"
                     /note="similar to Saccharomyces cerevisiae ZRC1 (YMR243C)
                     and COT1 (YOR316C); ancestral locus Anc_8.792"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670109.1"
                     /db_xref="GeneID:11498810"
                     /db_xref="GOA:G0WAU6"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="UniProtKB/TrEMBL:G0WAU6"
                     /translation="MISGKEIRIISLLTLDSVFFLLEITIGYMSHSLALIADSFHMLN
                     DIFSLLVALWAVNVAKNRDPDAKYTYGWKRAEILGALVNAVFLIALCFSIFIEALQRL
                     LQPEEIQNPRLVLYVGIAGLISNLFGLVLFHDHGHGHSHGHDHGHSHGGDLLELGTEQ
                     QHHTHSHDLEANMSHSHSHSHPHSNTDLSTESSLSKSNTPAISMSNEDLDDVLPDMVV
                     ERIASENTSLLPKDTNENENTLPTSSTTITNNNISTTPTPISNTMKTKNQKKSQRSLN
                     MHGVFLHVMGDALGNVGVIIAALTIWKTNYSWKYYTDPIVSLLITIIIFSSALPLSRK
                     ASRILLQGTPSTISADDVQREILTVPGVVAVHDFHIWNLTEAIFIASIHVEIDCIPDK
                     FLFSAKLIRNIFHNHGIHSATVQPEFISGNVSADTRNRFSRIAGGSSEFNSSSSIETN
                     GSIDNYRNNSDNSRPSAYGATTSNPHCLIDDAVNCNTANCLQNKKKKLDAYRNNRILY
                     ISPPDTVLFQFQTTSHRYIFYITYIYIHRQKINNNQRPCCLYI"
     gene            complement(<101670..>102704)
                     /gene="NDAI0E00510"
                     /locus_tag="NDAI_0E00510"
                     /db_xref="GeneID:11498811"
     mRNA            complement(<101670..>102704)
                     /gene="NDAI0E00510"
                     /locus_tag="NDAI_0E00510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670062.1"
                     /db_xref="GeneID:11498811"
     CDS             complement(101670..102704)
                     /gene="NDAI0E00510"
                     /locus_tag="NDAI_0E00510"
                     /inference="similar to DNA sequence:INSDC:YOR315W"
                     /note="similar to Saccharomyces cerevisiae SFG1 (YOR315W);
                     ancestral locus Anc_8.791"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670110.1"
                     /db_xref="GeneID:11498811"
                     /db_xref="UniProtKB/TrEMBL:G0WAU7"
                     /translation="MNNLIAPEPLILSTPRSKLISDVSLPVTPNKRPRTLDPFSNGNL
                     TPSKKLVKLQRTGLKTNPRTVIPQVLTFDTPLEHPNEMDSCNNKNLYDDILSRRLHLD
                     NKTTSPTSPTDLGSISPLSDISSIPSLSASSSPDIAGFDSKLDPFNTACFMMNWNGSK
                     SLINNETLELNRMIKTSMGRRRTGGGDDWKHSPCHRTIKPKRSILNLEQSSLNLIVSS
                     SRGSLKDATIFATEINSSTSNEDDGNKLPIISNIWERITIPVNSSIKKKHKERKERFL
                     RENELDLEDLDDSNGDVDADMDESIPDAALIRGYDFKYLNGKSGKGRNVKANTLDRNK
                     SVNWATPLAQ"
     gene            <104186..>105259
                     /gene="NDAI0E00520"
                     /locus_tag="NDAI_0E00520"
                     /db_xref="GeneID:11498812"
     mRNA            <104186..>105259
                     /gene="NDAI0E00520"
                     /locus_tag="NDAI_0E00520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670063.1"
                     /db_xref="GeneID:11498812"
     CDS             104186..105259
                     /gene="NDAI0E00520"
                     /locus_tag="NDAI_0E00520"
                     /inference="similar to DNA sequence:INSDC:YOR313C"
                     /note="similar to Saccharomyces cerevisiae SPS4 (YOR313C);
                     ancestral locus Anc_8.790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670111.1"
                     /db_xref="GeneID:11498812"
                     /db_xref="UniProtKB/TrEMBL:G0WAU8"
                     /translation="MSFHRKHSSTTTKNVPIILSKSLSQEQVEKERTLNKGQNVKGQG
                     TIAASSLTKTHDVHLADDLENVDFQNEQNPIIEDIPVDCNDSIDNVYPIRPELPLFRS
                     VEHLKVYPMVQETNNALKGFAVTRVIIANSKKMAKRILTSKPARCMVPVANTLDSIGN
                     STLNMTDKIIPAAMTTSFSDIHEHFMVPVKKVQKFTKDTKLRSVSLSKKYVYKPSHDR
                     LIEFRKYYNRKLIDTNNRPLIRGSLDPLARPINVKAEDMIVKYLPSETPLTNHEFCCE
                     VNKSAYLSTAVVSRSIPLLKRRIYTLMMVPCSYLEYANRKLNKNLDEKKDLGFKNTYH
                     ATMDTLKELNGEMFKKITRRPKV"
     gene            <105756..>106697
                     /gene="NDAI0E00530"
                     /locus_tag="NDAI_0E00530"
                     /db_xref="GeneID:11498813"
     mRNA            join(<105756,106180..>106697)
                     /gene="NDAI0E00530"
                     /locus_tag="NDAI_0E00530"
                     /product="ribosomal protein L20"
                     /transcript_id="XM_003670064.1"
                     /db_xref="GeneID:11498813"
     CDS             join(105756,106180..106697)
                     /gene="NDAI0E00530"
                     /locus_tag="NDAI_0E00530"
                     /inference="similar to DNA sequence:INSDC:YMR242C,YOR312C"
                     /note="similar to Saccharomyces cerevisiae RPL20A
                     (YMR242C) and RPL20B (YOR312C); ancestral locus Anc_8.789"
                     /codon_start=1
                     /product="ribosomal protein L20"
                     /protein_id="XP_003670112.1"
                     /db_xref="GeneID:11498813"
                     /db_xref="GOA:G0WAU9"
                     /db_xref="InterPro:IPR021138"
                     /db_xref="InterPro:IPR023573"
                     /db_xref="InterPro:IPR028877"
                     /db_xref="UniProtKB/TrEMBL:G0WAU9"
                     /translation="MAHLKEYQVIGRRLPTESVPEPKLFRMRIFASNEVVAKSRYWYF
                     LQKLHKVKKASGEVVSINQIHEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRVAA
                     VDTLYQDMAARHRTRFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKFPLPHRAQSTG
                     KTFSYKRPSTFY"
     gene            <107278..>108159
                     /gene="NDAI0E00540"
                     /locus_tag="NDAI_0E00540"
                     /db_xref="GeneID:11498814"
     mRNA            <107278..>108159
                     /gene="NDAI0E00540"
                     /locus_tag="NDAI_0E00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670065.1"
                     /db_xref="GeneID:11498814"
     CDS             107278..108159
                     /gene="NDAI0E00540"
                     /locus_tag="NDAI_0E00540"
                     /inference="similar to DNA sequence:INSDC:YOR311C"
                     /note="similar to Saccharomyces cerevisiae HSD1 (YOR311C);
                     ancestral locus Anc_8.788"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670113.1"
                     /db_xref="GeneID:11498814"
                     /db_xref="GOA:G0WAV0"
                     /db_xref="InterPro:IPR000374"
                     /db_xref="UniProtKB/TrEMBL:G0WAV0"
                     /translation="MVDVVMLDQTNLLPDEKLTSLKSFDNFDSSLKKRKSIKPIKVTK
                     VTTVDDDDVHLPVTEIHLKSHEWFGDFITKHEIPRKVFHSSIGFITIYLYTKGIDYKK
                     IKTPLIYAFVIIFILDLIRLRWAYFNKLYCGTVGALMRKKEIHTYNGVLWYILGLIFS
                     FSFFSKDVALISLFLLSWSDTAASTFGRKYGYLTPKLARNKSLAGSLAAFIVGFVTTL
                     LFYGYLVPRYDYVNKLGEIQWTPQTSKLSLNTLSWLGGLVGALSEGIDLFNWDDNFTI
                     PVLSSIFLSTVIHVFKK"
     gene            <108986..>110557
                     /gene="NDAI0E00550"
                     /locus_tag="NDAI_0E00550"
                     /db_xref="GeneID:11498815"
     mRNA            <108986..>110557
                     /gene="NDAI0E00550"
                     /locus_tag="NDAI_0E00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670066.1"
                     /db_xref="GeneID:11498815"
     CDS             108986..110557
                     /gene="NDAI0E00550"
                     /locus_tag="NDAI_0E00550"
                     /inference="similar to DNA sequence:INSDC:YOR310C"
                     /note="similar to Saccharomyces cerevisiae NOP58
                     (YOR310C); ancestral locus Anc_8.787"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670114.1"
                     /db_xref="GeneID:11498815"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR012974"
                     /db_xref="InterPro:IPR012976"
                     /db_xref="UniProtKB/TrEMBL:G0WAV1"
                     /translation="MSYVLTETSAGYALLKASDKKIYKSSSLIQDLDTSDKVLKEFKI
                     AAFSKFSSAANALEESNSIIEGKVSPQLEKLLEEIKKDKKSTLIVSETKLANSINKLG
                     LNFNVVSDAVTLDIYRAVKEYLPELLPGLNDSDLNKMSLGLAHSIGRHKLKFSADKVD
                     VMIIQAIALLDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARLILTMGVRSKA
                     SETDMSEILPEEIEERVKTAAEVSMGTEITQIDLDNIKCLADQIVEFAAYREQLSNYL
                     SARMKAIAPNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKH
                     DTPKYGLLYHASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARA
                     KVENRLSQLEGRDLRTTPKVVREAKKVEITEAQAYNADADTVAEPAASKSESGSDSDS
                     DSDDEEEEKKEKKDKKDKKEKKDKKDKKDKKRKRDEEEVESKESKKSKKDKKEKKDKK
                     DKKEKKSKKEKKEKK"
     gene            <111257..>113026
                     /gene="NDAI0E00560"
                     /locus_tag="NDAI_0E00560"
                     /db_xref="GeneID:11498816"
     mRNA            <111257..>113026
                     /gene="NDAI0E00560"
                     /locus_tag="NDAI_0E00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670067.1"
                     /db_xref="GeneID:11498816"
     CDS             111257..113026
                     /gene="NDAI0E00560"
                     /locus_tag="NDAI_0E00560"
                     /inference="similar to DNA sequence:INSDC:YOR308C"
                     /note="similar to Saccharomyces cerevisiae SNU66
                     (YOR308C); ancestral locus Anc_8.786"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670115.1"
                     /db_xref="GeneID:11498816"
                     /db_xref="InterPro:IPR005011"
                     /db_xref="UniProtKB/TrEMBL:G0WAV2"
                     /translation="MSEVNNSGVARNESLSVEETNKLRISLGLKPIPIPTKNNLVSKD
                     IGLETRLEAVKKENESVDGKPHFIANDKINLLRRRLTNIKNNIGKVTLLDEQERKTDP
                     TGDEDWLPKIGQRKKSGGAALKKKQRVALSYEHEEEDDESGANFPIMKLAHNISDIKA
                     GKDIILTLKESNILDDDDRGSEDEAGDMLENESLRQEKEDLKNLELRQMNKERRRKKI
                     ALTIGSRAIEDDEMNQKDIEGKSTLVIGAKNNINSEKPISFTNSSNKLKVVLPSDEEE
                     SDIGDFKPAKIRKRSKKQDSKILNKRKKISIHHAIKNVELTDEEENDNSLDSLDTLAP
                     TLKKGKSKSETADLSSRKITPEDIALQIRKEKFEEEERSKGIDRLRKAAASPRIVIDE
                     STVFLESLGSTLPTTTETDTIPKSHIEKTSNELVRRDENAEISAEGNENNFVVQEPNF
                     TDGLASTLQFLQTRGVFEDIKAKDNHSSSSNKVDDQTLKVRRSMTVEEVHQSIEETVK
                     KNKQKYPARGLERDALQDYNPSISLIYKDKEGNELTTKEAYKRLSQKFHGTKSNEKKL
                     AKAREKIKARNRQNNANNTFGFI"
     gene            <113413..>114846
                     /gene="NDAI0E00570"
                     /locus_tag="NDAI_0E00570"
                     /db_xref="GeneID:11498817"
     mRNA            <113413..>114846
                     /gene="NDAI0E00570"
                     /locus_tag="NDAI_0E00570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670068.1"
                     /db_xref="GeneID:11498817"
     CDS             113413..114846
                     /gene="NDAI0E00570"
                     /locus_tag="NDAI_0E00570"
                     /inference="similar to DNA sequence:INSDC:YOR307C"
                     /note="similar to Saccharomyces cerevisiae SLY41
                     (YOR307C); ancestral locus Anc_8.785"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670116.1"
                     /db_xref="GeneID:11498817"
                     /db_xref="GOA:G0WAV3"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:G0WAV3"
                     /translation="MSETTTESITTKRRGSIHKNLYDDSLFQLPNANDISKMGLYNEY
                     RNIPRHINHNHHRYRSQKTTTSRSYRNGLFNIEIPDLKSIKARQFIPEIDIKITILCL
                     AWYITSSISSNLSKAILKGFKHPVALTELQFLISATLCIMFVSLLNLNEKFKKSADFN
                     HRKLTCLNKIIDKFPEMIIPKYLNGSFQDSIINTFLKPNQIVIMTVFPMGLFQFVGHI
                     TSHNATALVPISIVHSVKALSPIATVGYYYFIKGGKKRADYNEYTFLTLSILIFGVIV
                     TCWFTHNNTKKTNGAKTVISSSSLILGLIYSCISMIIFVAQNIFAKEMFNKKSNSYST
                     SHKKEYLPSTSIEHSATHTATKHIDKITILFYCSTIGFILTFIPFITGELIKKNNSVF
                     HDLTLHILQLAIIHGVAHFIQALFAFQLIALLSSVNYSVANILKRIVIILVALSWESH
                     VNWGQFLGLTFTLIGLYGYDKYGLVRL"
     gene            <116173..>117852
                     /gene="NDAI0E00580"
                     /locus_tag="NDAI_0E00580"
                     /db_xref="GeneID:11498818"
     mRNA            <116173..>117852
                     /gene="NDAI0E00580"
                     /locus_tag="NDAI_0E00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670069.1"
                     /db_xref="GeneID:11498818"
     CDS             116173..117852
                     /gene="NDAI0E00580"
                     /locus_tag="NDAI_0E00580"
                     /inference="similar to DNA sequence:INSDC:YOR306C"
                     /note="similar to Saccharomyces cerevisiae MCH5 (YOR306C);
                     ancestral locus Anc_8.783"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670117.1"
                     /db_xref="GeneID:11498818"
                     /db_xref="GOA:G0WAV4"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G0WAV4"
                     /translation="MEQTSDNNKKSTSNNSNTLTPKQSFLAHINSKRNLLAYFTNNDT
                     ISRTSSADSLSSSANTVSNDNPTVDQGKVLSNDPKQYDQDAEDKDKNQLVREVTRERK
                     NKDDDDDNNTSDSSDDSSKYNGGFVVDDGQYYPEGGAKAWTVTFACFCGLIACFGLLN
                     ATGVVENHIQNHQLADQNTSTIGWVFSLLLFTCFASCILSGTYFDRNGFKKPMIFGSI
                     LHIAGMFATANSTKLWHFFLALSVCCGIGNGIILGPLVGCPAHYFSRRRGTATAIATA
                     GGSIGGALIPLLLRKFFSMTRPNNPDYGYMWGVRVWAFINMALLTIATVMGQERLKQV
                     DEIDESKTEKETRWKRFVRVYLFQSFDAKGFKDPKFLFCVIGTVFGELSCCAAITYFS
                     SYCNSHGITASDSYLLIMVINLTGIPGRWVPGYLSDILGRFNVAIGTLFVLSIVMLVG
                     WLPFGTDLTSMYVISALYGFFSGSTFSLLPVCCGQISKTEEFGKRYATTYSMVAIATL
                     VGIPITGAIIGDKTTVKYQHYVIFSGVTALVSCISFVISRYFCVGMKWRKF"
     gene            complement(<117986..>118750)
                     /gene="NDAI0E00590"
                     /locus_tag="NDAI_0E00590"
                     /db_xref="GeneID:11498819"
     mRNA            complement(<117986..>118750)
                     /gene="NDAI0E00590"
                     /locus_tag="NDAI_0E00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670070.1"
                     /db_xref="GeneID:11498819"
     CDS             complement(117986..118750)
                     /gene="NDAI0E00590"
                     /locus_tag="NDAI_0E00590"
                     /inference="similar to DNA sequence:INSDC:YOR305W"
                     /note="similar to Saccharomyces cerevisiae YOR305W;
                     ancestral locus Anc_8.782"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670118.1"
                     /db_xref="GeneID:11498819"
                     /db_xref="InterPro:IPR018828"
                     /db_xref="UniProtKB/TrEMBL:G0WAV5"
                     /translation="MNNLILLRTICKRWVHNDSIISFIRNNAAISQSTVFQGTLYELT
                     VLRELAEKLGMTSLEKVGGAHDGGVDIKGTWPISNLYKKLEAITHISDELSTIPKRSK
                     VNGRVFRPLIHRINDDILLGKQFAPLKVLVQAKAFRTTKVSPKELRELVGTFSSMVPD
                     TKRNSTIILMCSPHMLTKDSLNLINNVKLPLIYLRIEMLRSLNDGSYDIEKSGTLLNY
                     YENEYASKLLEGLSIQRWLTLKLYDVNQKFEIAVDE"
     gene            <119055..>119270
                     /gene="NDAI0E00600"
                     /locus_tag="NDAI_0E00600"
                     /db_xref="GeneID:11498820"
     mRNA            <119055..>119270
                     /gene="NDAI0E00600"
                     /locus_tag="NDAI_0E00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670071.1"
                     /db_xref="GeneID:11498820"
     CDS             119055..119270
                     /gene="NDAI0E00600"
                     /locus_tag="NDAI_0E00600"
                     /inference="similar to DNA sequence:INSDC:YOR304C-A"
                     /note="similar to Saccharomyces cerevisiae YOR304C-A;
                     ancestral locus Anc_8.781"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670119.1"
                     /db_xref="GeneID:11498820"
                     /db_xref="UniProtKB/TrEMBL:G0WAV6"
                     /translation="MSIDKLNHTEDRNVEEVEKEKDDSKNIVTVFDIASEIEKALRDV
                     KKRIEDDDEEFNKSLSNIEEMLKELTE"
     gene            complement(<119601..>122948)
                     /gene="NDAI0E00610"
                     /locus_tag="NDAI_0E00610"
                     /db_xref="GeneID:11498821"
     mRNA            complement(<119601..>122948)
                     /gene="NDAI0E00610"
                     /locus_tag="NDAI_0E00610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670072.1"
                     /db_xref="GeneID:11498821"
     CDS             complement(119601..122948)
                     /gene="NDAI0E00610"
                     /locus_tag="NDAI_0E00610"
                     /inference="similar to DNA sequence:INSDC:YOR304W"
                     /note="similar to Saccharomyces cerevisiae ISW2 (YOR304W);
                     ancestral locus Anc_8.778"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670120.1"
                     /db_xref="GeneID:11498821"
                     /db_xref="GOA:G0WAV7"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR015194"
                     /db_xref="InterPro:IPR015195"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WAV7"
                     /translation="MSVPDHQSKSIETIPSDEENESTQEENNLVLEEDPTPTPALSEV
                     DISQNDIDLGAKDDAYWQERKARFILTVDPKIAKQKDKKDTYKRFKYLLSLTDLFRHF
                     ISMKAKHDKNMQKLLKEVEASTSASKNENYVSRHHRKTEKEEDAELLAEEEGEGLETF
                     DDENYVNESPSFIQNGKLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLG
                     YLKYIKKIDGPFLIIVPKSTLDNWRREFNKWTPEVNAIILHGDKETRHKIIYDFILQA
                     RFDVLITSYEMVIKEKNALKKVAWQYIVIDEAHRIKNEESQLSQIIRLLYSKHRLLIT
                     GTPLQNNLHELWALLNFLLPDVFGDSGIFDDWFEQNNSEQDQEIVVQQLHTVLNPFLL
                     RRIKADVEKSLLPKIETNVYVGMTDMQIKWYKSLLEKDIDAVNGAVGKREGKTRLLNI
                     VMQLRKCCNHPYLFEGAEPGPPYTTDEHLVFNAGKMIVLDKLLKRLKEKGSRVLVFSQ
                     MSRLLDILEDYCYFRGFNYCRIDGSTSHEDRIEAIDDYNKPDSDKFVFLLTTRAGGLG
                     INLVTADTVVLFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQ
                     KLRLDQLVIQQGTGKKTANIGNNKDDLLEMIQYGAKSMFEKKATHITTDADIDEILKK
                     GQQKTEELNAKYQSLGLDDLQKYNEIDNQSAYEWNGKNFQKKSTDKVVNWINPSRRER
                     RREQQTYSVDDYYKEIIGGGSKSSKQTPQPKIPKPPKRIQGQDYQFFPKELDQLQAKE
                     QLAFKKKVNYKVTSYDITGTTGSDSDEEDDDEYTENGNEATDNDKEKHETKLTKEEIE
                     QKIKEEQEKISNAPDYTEADEEIKQKLISEAFSNWTRRDLLAFVNACAKFGRDNIDMI
                     KKSVESKTPEEVIAYSKVFWQRYQEIHGYEKYMNTIHNGEKKNEKLKHQETLLRKKIE
                     QYKYPLHEMMIQYPPNNARKTYNSLEDKFLLLMVNKHGITAKNLYEKLKQEIMMSDLF
                     TFDWFIRTRSVHELSKRVNTLMTLITREFESSEALKKKRTRANTKEDSTPLNDVISVA
                     EEEENQRIQEGQEQGHVDKRPRVEVGQ"
     gene            complement(<124178..>125377)
                     /gene="NDAI0E00620"
                     /locus_tag="NDAI_0E00620"
                     /db_xref="GeneID:11498596"
     mRNA            complement(<124178..>125377)
                     /gene="NDAI0E00620"
                     /locus_tag="NDAI_0E00620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670073.1"
                     /db_xref="GeneID:11498596"
     CDS             complement(124178..125377)
                     /gene="NDAI0E00620"
                     /locus_tag="NDAI_0E00620"
                     /inference="similar to DNA sequence:INSDC:YOR303W"
                     /note="similar to Saccharomyces cerevisiae CPA1 (YOR303W);
                     ancestral locus Anc_8.776"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670121.1"
                     /db_xref="GeneID:11498596"
                     /db_xref="GOA:G0WAV8"
                     /db_xref="InterPro:IPR002474"
                     /db_xref="InterPro:IPR006274"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:G0WAV8"
                     /translation="MSSPNATFTIKNGPSFQGKSFGAEKSIAGEAVFTTSLVGYPESM
                     TDPSYRGQILVFTQPLIGNYGVPSGEERDEFNLLKYFESPHVHVVGIVVAEYAYEYSH
                     WAAVESLASWCKREGVAAITGVDTREIVQYLREQGSSLGRITIGNDTPVDYIDPMSTH
                     LVAQVTTKQPFHISGKNPTANVALIDCGVKENIIRCLAARGANVTVLPYDYRIQDIAH
                     QFDGIFLSNGPGNPEMCEKTIANLKELLNNPKFDDIPIFGICLGHQLLALASGAKTMK
                     LKYGNRAHNIPAMDLTTGQCHITSQNHGYAVDPETLPSDQWKPYFVNLNDNSNEGMIH
                     LTRPIFSTQFHPEAKGGPLDTAVLFDKFFDNIETYHVIQQSKKKLAAVHQLDLSVDKL
                     AKERVLF"
     gene            127419..127491
                     /gene="NDAI0Etrna15R"
                     /locus_tag="NDAI_0Etrna15R"
                     /db_xref="GeneID:11498597"
     tRNA            127419..127491
                     /gene="NDAI0Etrna15R"
                     /locus_tag="NDAI_0Etrna15R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGA"
                     /db_xref="GeneID:11498597"
     gene            complement(<128590..>130062)
                     /gene="NDAI0E00630"
                     /locus_tag="NDAI_0E00630"
                     /db_xref="GeneID:11499087"
     mRNA            complement(<128590..>130062)
                     /gene="NDAI0E00630"
                     /locus_tag="NDAI_0E00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670074.1"
                     /db_xref="GeneID:11499087"
     CDS             complement(128590..130062)
                     /gene="NDAI0E00630"
                     /locus_tag="NDAI_0E00630"
                     /inference="similar to DNA sequence:INSDC:YOR301W"
                     /note="similar to Saccharomyces cerevisiae RAX1 (YOR301W);
                     ancestral locus Anc_8.774"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670122.1"
                     /db_xref="GeneID:11499087"
                     /db_xref="GOA:G0WAV9"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="UniProtKB/TrEMBL:G0WAV9"
                     /translation="MELDYKKIQTERLPTLYEVLIQKTKFPVDLWSFYTFLSQFPYAI
                     NYLDFWIDLMAHLRLCKDYISGIRESITYNQNEARNSRIRHHLQYTSEESIQHETQSI
                     QHHDDPEGGDEDDDDDDNISVTTSVLLNALLDEGHLDFENPERVSQFLQGNTEYSPKL
                     SQLLEDWKRHSIANNDSNRKGSLNRNNSNVRSRETNGAALPDVVDDILRKQSQQEERA
                     KITTKQLLNNALKICSIYLQSPERSERYLTNLPDDIRLKALNLVQNERRHDPQVFEEL
                     KSIAFQFLEMDCFPKFLSTVALHNIHDEISDWRFHSNARSHNLTRVDKSLIKNHDHIS
                     KSPFSTYTLLSRTIFGLLWLGIGFWIGYTLIFLKYDRGIRVVTIVPFAIGNYFIICGM
                     YRVDIIYSWFGVTQRLLYKHNEKNRDADREVQMDEKNGKNHHVSGILALLGGRSRLIR
                     IEHPFIKNILMKRGLWCLFLVLLSTGIFTVIFSCVPGYRI"
     gene            complement(<130440..>132668)
                     /gene="NDAI0E00640"
                     /locus_tag="NDAI_0E00640"
                     /db_xref="GeneID:11498598"
     mRNA            complement(<130440..>132668)
                     /gene="NDAI0E00640"
                     /locus_tag="NDAI_0E00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670075.1"
                     /db_xref="GeneID:11498598"
     CDS             complement(130440..132668)
                     /gene="NDAI0E00640"
                     /locus_tag="NDAI_0E00640"
                     /inference="similar to DNA sequence:INSDC:YMR237W,YOR299W"
                     /note="similar to Saccharomyces cerevisiae BCH1 (YMR237W)
                     and BUD7 (YOR299W); ancestral locus Anc_8.772"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670123.1"
                     /db_xref="GeneID:11498598"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015374"
                     /db_xref="UniProtKB/TrEMBL:G0WAW0"
                     /translation="MLSQGSIPEVKENEVGYALEERRSKLSQFLDLGPPDLITLIKYL
                     PSSSSHQGSTNAANHLSSTNSSNKDQSDATGPNSNENTPPISNEPSSIVTELHAHDKL
                     KGEIGTFFYSLGVDTSDPTAITIFLKKIADLITENPQTWFGKRKNFQIARISLSTWNT
                     FRKCDVNVMVHIPGTVQTFMLDYNGEQLQIEHSSQIDLIWAETFISGVVRSITLMKDN
                     SEEGEIQNLVETLIIDPLTSGQLGDVTNTFIDLFPLVYERGNLLGGPCYASNVTNINN
                     YLVETLSTIVNLTQSINKCREMLEKLVEKYPEAIVILVRLLFENDLEIDAINLVHEQL
                     EIVERQSEKYNNQQVVNYISALLCVEAEFLLNIKKDFKYAQLIAQKAVNYSPNEFKPW
                     YLLTKAYARLNDPENALVTLNACPMALLREKYTLKRVVPFPSDDSLHLPLPVDAVLDE
                     VTSLNSIDIQNEHKSSDPTLINLPAGNLKSTYQLAYKLLTEIVQLTGWELLLKIRTKL
                     FVMEEEYQGSINENIDSTSNEQDNETRNSTSTTAITTDLLRSKRLCERWLDNLFMLLY
                     EDLKTYTLWQTEQIYFEAQRTKYIKSTVEWEAFGLCARRLGHYPEAAVAFEKGLSQRF
                     SSKSAQQLMNYCVNERQRIINQSNLPNCDMTSSQIVSKISELDSTIIDLCVKTCCWNH
                     RWYIEFSLNLFNALSPVVFDMGLTKLSNEIAARYSESVFRLVRENLLDFFEKYTNDHY
                     DS"
     gene            complement(<133162..>134682)
                     /gene="NDAI0E00650"
                     /locus_tag="NDAI_0E00650"
                     /db_xref="GeneID:11498599"
     mRNA            complement(<133162..>134682)
                     /gene="NDAI0E00650"
                     /locus_tag="NDAI_0E00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670076.1"
                     /db_xref="GeneID:11498599"
     CDS             complement(133162..134682)
                     /gene="NDAI0E00650"
                     /locus_tag="NDAI_0E00650"
                     /inference="similar to DNA sequence:INSDC:YOR298W"
                     /note="similar to Saccharomyces cerevisiae MUM3 (YOR298W);
                     ancestral locus Anc_8.768"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670124.1"
                     /db_xref="GeneID:11498599"
                     /db_xref="UniProtKB/TrEMBL:G0WAW1"
                     /translation="MISVKGIIESFHVHFVGTETNRSFWEWVYLGSRIFILLTYILLH
                     SIVLIARRIITSIITCPIYRRVKVFKRNFFKNVPIVGKFKICLLDKWDNFIMEQLLPF
                     FEKILQTIELCFQLYVVELLFKNNENVQIFFTEDSEPLELFDGEEQLSTLLIANHRSV
                     NDYALVNYLIQDESLVRYTNKREVINKLWKENRTIVPILNFISWGKIFNFPKISLLKN
                     IVLKDENAYLKEDEFEDHLMTNNNQVYAIFPEINILTTELGFVQRKLNQEYIFVTKFY
                     NVLYPRFRNFITVVNCFGFVQNIKKMRHNYIFNETKQYLNEKFDKILLPTKKDDRKKN
                     EAQVSMILSDSGLFEKRPEDSSSRENKPVNRTSLSNFKLNPYFYDLTIVYYRPIITSK
                     GHNHTTGNMKIHKGYQLQQIVPSFLDLLMAKKPQRDMGKTTTKTKTKNHIKEEETTPT
                     DPVEEIGPIIIMVQISKCKMAPLLPLKDKKLERWLEQRWGHKDKLINIIDSKIEVK"
     gene            <134949..>135584
                     /gene="NDAI0E00660"
                     /locus_tag="NDAI_0E00660"
                     /db_xref="GeneID:11498600"
     mRNA            <134949..>135584
                     /gene="NDAI0E00660"
                     /locus_tag="NDAI_0E00660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670077.1"
                     /db_xref="GeneID:11498600"
     CDS             134949..135584
                     /gene="NDAI0E00660"
                     /locus_tag="NDAI_0E00660"
                     /inference="similar to DNA sequence:INSDC:YOR297C"
                     /note="similar to Saccharomyces cerevisiae TIM18
                     (YOR297C); ancestral locus Anc_8.767"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670125.1"
                     /db_xref="GeneID:11498600"
                     /db_xref="GOA:G0WAW2"
                     /db_xref="InterPro:IPR007992"
                     /db_xref="UniProtKB/TrEMBL:G0WAW2"
                     /translation="MLPHNSNIFFKTSRYVSRFAARQIHTIQPINCIHSIKYRQLSRC
                     YSSQFQDKEMEKYIKTGTPLAATSIEQDTTKPSSLPKTFTLPKPSQVEGSYHEEYEKI
                     AKYSLLPLSLVPFVISMAGGVVPPLLDTALATTFLIYIQYGFTSCIIEYLPKEKFHRW
                     HNAAKYLLYSFSSLSLYGIYQLETENNGLIDLISKLWQNDNDSNLYIFGRN"
     gene            complement(<136517..>137578)
                     /gene="NDAI0E00670"
                     /locus_tag="NDAI_0E00670"
                     /db_xref="GeneID:11498601"
     mRNA            complement(<136517..>137578)
                     /gene="NDAI0E00670"
                     /locus_tag="NDAI_0E00670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670078.1"
                     /db_xref="GeneID:11498601"
     CDS             complement(136517..137578)
                     /gene="NDAI0E00670"
                     /locus_tag="NDAI_0E00670"
                     /inference="similar to DNA sequence:INSDC:YMR234W"
                     /note="similar to Saccharomyces cerevisiae RNH1 (YMR234W);
                     ancestral locus Anc_8.766"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670126.1"
                     /db_xref="GeneID:11498601"
                     /db_xref="GOA:G0WAW3"
                     /db_xref="InterPro:IPR002156"
                     /db_xref="InterPro:IPR009027"
                     /db_xref="InterPro:IPR011320"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017067"
                     /db_xref="UniProtKB/TrEMBL:G0WAW3"
                     /translation="MGPRAFYGVNQGFQRGVFYSWHDCEQQVKGYKGAIFKKFNSFEE
                     AKNFAHGTSSNNSNNRGLRNENNNSKIKNRMNNARAPDVGIRKQHSLPSHLPRDAAER
                     IVKHTKFYAVKSGNPTVQSMIFRSWPECKSYIYRQKGLSFKSFDSLEDAENFINGVSN
                     PSLDYDLMGVRSLEFQTIYKLNPFNTAFYTSKCNVYCDGSSLGNGKYGARAGYGVFFE
                     TQPSLNISDRLRIGAQTNNRGEIQAVSEALKAIWKILSTSPNKLNFQIITDSEYVAKL
                     LNDRYMTYSIDKIHILPNHDLIVPLLAYFTCVKKYYEINADFFANKGNFKIEWVKGHA
                     GHYGNEMADELARRGASMD"
     gene            137889..137960
                     /gene="NDAI0Etrna12D"
                     /locus_tag="NDAI_0Etrna12D"
                     /db_xref="GeneID:11498602"
     tRNA            137889..137960
                     /gene="NDAI0Etrna12D"
                     /locus_tag="NDAI_0Etrna12D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:11498602"
     gene            complement(<138393..>142256)
                     /gene="NDAI0E00680"
                     /locus_tag="NDAI_0E00680"
                     /db_xref="GeneID:11499085"
     mRNA            complement(<138393..>142256)
                     /gene="NDAI0E00680"
                     /locus_tag="NDAI_0E00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670079.1"
                     /db_xref="GeneID:11499085"
     CDS             complement(138393..142256)
                     /gene="NDAI0E00680"
                     /locus_tag="NDAI_0E00680"
                     /inference="similar to DNA sequence:INSDC:YOR296W"
                     /note="similar to Saccharomyces cerevisiae YOR296W;
                     ancestral locus Anc_8.765"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670127.1"
                     /db_xref="GeneID:11499085"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR014770"
                     /db_xref="InterPro:IPR014772"
                     /db_xref="InterPro:IPR019558"
                     /db_xref="UniProtKB/TrEMBL:G0WAW4"
                     /translation="MQRISSSSSSILSNINFRDLSSLRPDVQRNDVYWDVLKILLFEY
                     IHEPRFAKEFVQTGVLRETRTPELNSMRNNRLSFIQTDLNVQNTVIDEQAIVRSITPK
                     LESYLRSVIMRKSGNDIQDILLRGSLSKFYNDLYMDPAMNIRLPSMTLEEIIGYFTKT
                     SANVVSKQNVKNIPQIIESHTKYFIGKLITMLPPNSSPGIVSRLKTYDQTIGKSKSFR
                     IKPPYPPSLKNMAVISPDFVLDNITHATYFQKLFGADPLVLQQDIIKLVPTVKDDVYC
                     HDLKLLLDQIKKDKGPMKSSDFETSQQFKLWYNYEFGELTSLLQTYGGKSVTLDINIP
                     LRIIPNRPRESFVYLLCLILNLESKTDPSSLALSHSASFFMNKCAKYWRIDFETTIST
                     LYYTAANLSRLNNEFFNLELTPNLYNVIFGKFLNAASYDVRYWNRIDKEQWLINYYYT
                     MDQCINSINDAFKRLCSEKRVDYSIPWVFYCNNAKLGNTMDILCEECGDIKRLWSKKL
                     KKTVHEASTQFYFSLLEKVPKGPDIEFQHLQNVAEDIYLKIKSIYTGYKKEHFELLGG
                     IHIPEEVTKVLVQAIVVDVGSMVQQVEKQTKKIKMKKYGPTDALSFYSSVKDLIGLYQ
                     DFGITKKLNSIERYFEKYLVELCGTTCSKFLEVITSSLQKEKWEPINAEIRYSYSVVD
                     IFKMLNESLSMFLNFEWGNEYQISKILTMLLKSFSDGLYVYTENVLRLIQVDLNSVES
                     KSTSNEARNTISTQLEEDKASRKFNIWSFNGMKNAINKKEYAPVPDPYEYKIRTCIIL
                     NNIEKMKSNLNDLEDRVQPEKITKFINHYEKNHKDLKEIANEQVKKLHHLYTIRIIEA
                     KDIKGFSKSGLSNAMLSLQDMKQRKEISCTKIISKTTNPIWDEEVELMVPYNEKRELL
                     LTVWHHPTSKFKSVGGDEICGKAQLILSKKKFLDDGYPNAVELNLDQQGTLSLQISLE
                     TEKMDATFSLGKAYRTLSRTSDRIIELMVSKFSPFIKYSLSRENLMKLHGNSGQEGAT
                     ESKIGDALLPLFDYLNANLGILSSQLSETLLLAIMSKAWSEILTTADILLLPSLSSSD
                     HKHRLRSARSSIWNSSTLDIVGYGRPLTPLEQATIFMWLSNLGIEFFHNDGQGLPMTE
                     VENAYYQNLKKIPHFYEMSVRDLKAATNDLMTDYVKHLKLIYSNKNYGTSVKRIGTTV
                     ERQKTIMANATKLKRQQIREEIQKEQVDPLEQSVEALKIVLRILITKGESDYVHKCVK
                     QQIKEKKQLSLQMKLDAAIQGKIVK"
     gene            complement(<142612..>144006)
                     /gene="NDAI0E00690"
                     /locus_tag="NDAI_0E00690"
                     /db_xref="GeneID:11498603"
     mRNA            complement(<142612..>144006)
                     /gene="NDAI0E00690"
                     /locus_tag="NDAI_0E00690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670080.1"
                     /db_xref="GeneID:11498603"
     CDS             complement(142612..144006)
                     /gene="NDAI0E00690"
                     /locus_tag="NDAI_0E00690"
                     /inference="similar to DNA sequence:INSDC:YMR233W,YOR295W"
                     /note="similar to Saccharomyces cerevisiae TRI1 (YMR233W)
                     and UAF30 (YOR295W); ancestral locus Anc_8.764"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670128.1"
                     /db_xref="GeneID:11498603"
                     /db_xref="InterPro:IPR003121"
                     /db_xref="UniProtKB/TrEMBL:G0WAW5"
                     /translation="MLFIKESKQIFLLANSEGQLEKKYLYMQLFIKWQTIYVTWLRTS
                     YISFYHFQIPIRFISHIKGMNDLPSFSSSINAILATGNPKKQSSKRVREALEEIFLFN
                     FEEANEDIDDKIEKYLKKHRNRNRNQIRLTLSELKKKNRKAILKLDKKLDRIEQRKNG
                     GVGKAKKERKITTGSRKYLLLEPLKSFLGESELSRQDTVKRIWTYIKQNKLQSPSDRR
                     EDLWDNKLKSLFQGYQRITVPIVAKIVSKYMLSLGSQSRYSNLSESSNTSAEEFETTV
                     EFESSKDSENEIVSTSDSFTNSSQEEGSQNEDETSMNSNFEGVEIDRPPDTPTGKTDY
                     ISDVVDEELSQDEDYEDGVELESWHGVWDEPDNTIMESSSAETNSDEEADADDLVNQD
                     GSFFHSEMNTSHGTPSDPENRDRYESSFVVADDSEQDLGEDDPELRQSFLDDEFDAVQ
                     TEPTDDFSESEESD"
     gene            complement(<144142..>144753)
                     /gene="NDAI0E00700"
                     /locus_tag="NDAI_0E00700"
                     /db_xref="GeneID:11498604"
     mRNA            complement(<144142..>144753)
                     /gene="NDAI0E00700"
                     /locus_tag="NDAI_0E00700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670081.1"
                     /db_xref="GeneID:11498604"
     CDS             complement(144142..144753)
                     /gene="NDAI0E00700"
                     /locus_tag="NDAI_0E00700"
                     /inference="similar to DNA sequence:INSDC:YOR294W"
                     /note="similar to Saccharomyces cerevisiae RRS1 (YOR294W);
                     ancestral locus Anc_8.763"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670129.1"
                     /db_xref="GeneID:11498604"
                     /db_xref="GOA:G0WAW6"
                     /db_xref="InterPro:IPR007023"
                     /db_xref="UniProtKB/TrEMBL:G0WAW6"
                     /translation="MSAEDYKTLPVTVEKAIPVNYDLGNLSVFDSNFMDKNDFDTSNG
                     KREENIKNMTRDNVQLLINQLLSLPIKTTTDSTGGSNGQSSSMTLLQLPAPITELPRE
                     KPLPKAKAQTKWEKFAATKGIQPKAKTGKMVYDEASGEWVPKWGYRGNNKKLDDQWLV
                     EVDDKVKGTDNELIDPRTLNRAERKRLIKKNEKQQKRNLKNAH"
     gene            complement(<145318..>146106)
                     /gene="NDAI0E00710"
                     /locus_tag="NDAI_0E00710"
                     /db_xref="GeneID:11498605"
     mRNA            complement(join(<145318..145583,146055..>146106))
                     /gene="NDAI0E00710"
                     /locus_tag="NDAI_0E00710"
                     /product="ribosomal protein S10"
                     /transcript_id="XM_003670082.1"
                     /db_xref="GeneID:11498605"
     CDS             complement(join(145318..145583,146055..146106))
                     /gene="NDAI0E00710"
                     /locus_tag="NDAI_0E00710"
                     /inference="similar to DNA sequence:INSDC:YMR230W,YOR293W"
                     /note="similar to Saccharomyces cerevisiae RPS10B
                     (YMR230W) and RPS10A (YOR293W); ancestral locus Anc_8.760"
                     /codon_start=1
                     /product="ribosomal protein S10"
                     /protein_id="XP_003670130.1"
                     /db_xref="GeneID:11498605"
                     /db_xref="InterPro:IPR005326"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:G0WAW7"
                     /translation="MLMPKEDRTKIHRYLFQEGVVVAKKDFNQPKHEEIDTKNLYVIK
                     ALQSLTSKGYVKTQFSWQYYYYTLTEEGVEFLREYLNLPEHIVPGTYIQDRSQTQRPQ
                     RRY"
     gene            <146622..>147602
                     /gene="NDAI0E00720"
                     /locus_tag="NDAI_0E00720"
                     /db_xref="GeneID:11498606"
     mRNA            <146622..>147602
                     /gene="NDAI0E00720"
                     /locus_tag="NDAI_0E00720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670083.1"
                     /db_xref="GeneID:11498606"
     CDS             146622..147602
                     /gene="NDAI0E00720"
                     /locus_tag="NDAI_0E00720"
                     /inference="similar to DNA sequence:INSDC:YOR292C"
                     /note="similar to Saccharomyces cerevisiae YOR292C;
                     ancestral locus Anc_8.759"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670131.1"
                     /db_xref="GeneID:11498606"
                     /db_xref="GOA:G0WAW8"
                     /db_xref="InterPro:IPR007248"
                     /db_xref="UniProtKB/TrEMBL:G0WAW8"
                     /translation="MPLQLPGSDRIFALRGHSASATQQSRLTILTRQIHRWEDESISQ
                     IKNFFRLKVFRITLTHLIILSIWLCFLWNYTSVYGELYAVNTLIASMIMNTILFGISD
                     TLAQSITCFLSETVDPIPQIVDDSARHLLHQFESPHDIESGYESDNLSVFNDYGLSPV
                     SSLYEEELDEHNDDHINAIQSRPETDVFNFRRFFGFMFWGFFISNFQVPWYRFLNFFY
                     TEDPTVVQVLERVLSDQLVYSPVQLYYFFMYSNYVIEKGNADTFKIKIRSIYISTLGC
                     NYLLWPAVQFINFLLMPKKFQVPFSSSVGVLWNCFLSMRNANKSITHKLR"
     gene            147895..147983
                     /gene="NDAI0Etrna9P"
                     /locus_tag="NDAI_0Etrna9P"
                     /db_xref="GeneID:11499113"
     tRNA            join(147895..147931,147947..147983)
                     /gene="NDAI0Etrna9P"
                     /locus_tag="NDAI_0Etrna9P"
                     /product="tRNA-Pro"
                     /note="codon recognized: CCA"
                     /db_xref="GeneID:11499113"
     gene            complement(<148162..>152715)
                     /gene="NDAI0E00730"
                     /locus_tag="NDAI_0E00730"
                     /db_xref="GeneID:11499096"
     mRNA            complement(<148162..>152715)
                     /gene="NDAI0E00730"
                     /locus_tag="NDAI_0E00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670084.1"
                     /db_xref="GeneID:11499096"
     CDS             complement(148162..152715)
                     /gene="NDAI0E00730"
                     /locus_tag="NDAI_0E00730"
                     /inference="similar to DNA sequence:INSDC:YOR291W"
                     /note="similar to Saccharomyces cerevisiae YOR291W;
                     ancestral locus Anc_8.758"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670132.1"
                     /db_xref="GeneID:11499096"
                     /db_xref="GOA:G0WAW9"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006544"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:G0WAW9"
                     /translation="MGPSENQTPNNNEDEHHQHSQYMARSTGPRASFASARTTSTSTT
                     LTSALMGPQPNNEMYSGATFETVPSSIVSFHHPQSFQSSNIFGTSLTSSSIGRRGRTS
                     ADIDRETDSAPLISPSREISRSPSRNPRFNFFTEDQINSAEGTSTLENTDFNTPWDAT
                     PSYEQDKIYASSELNSRRSSIYSNFSRRPSLSHSRNHDFHENTSEYGTSSYHGVPLTR
                     ISKTRDDTHNYEQEQQHTMHPPEVYQASTHSSSSLSRYTIADRIPVELEEQNDELMDG
                     TRSPTHSLSESNSDRSFQESTDGGNNFGTESETHSHHKKQAYQSSSGTDSQNEYLKPK
                     YHEKLYPNHPTDLYYQRFYIAEEDLVVGIAGYKTSKIRKQVYNLFCILTGGLLYLLFR
                     WLPTYKVLFIGSKVPLGRAEWVILENEFGDFDIQSIDRRWYNRPISTLLPIDDKEQEN
                     NDEVYNRHHYHHYHHVNENNPNIPILISFKYRYITFIYSPVGDMFKTNNNWVDPDWVD
                     VPSVLRGLSSAVQEDRVLAFDKNQINLEVKTISELLFNEVLHPFYIFQIFSIILWSLD
                     EYYYYAGCIFLISILSIMDTLIETRKTQESLAQMSHFSCEIRVFRDEFWTTINSADLV
                     PGDIYEISDPSLTIFPCDSILLSGDCIVNESMLTGESVPVSKSPASQDTLYQLIDDFQ
                     NVQISNFVSKSFLFNGTGIIRARIPHGQSAALAMVVRTGFSTTKGSLVRSMVFPRPTG
                     FKFYQDSFKYIGVMAIIALFGFSISCIEFIKIGLDKRTMILRALDIITIVVPPALPAT
                     LTIGTGFSLARLKKKGIFCISPTRVNIGGKIDIMCFDKTGTMTENGLDVLGVQLSKPI
                     SHNEFKFGEFVQDVHQLFSKISLNDCNSAQDYRARNFFMSLLTCHSLRMVDDELIGDP
                     LDFKMFQFTGWSYEENFQNKQFHSTYEERRKTPTLPENIDIIPVVVHPNGKDPKNIFI
                     DNDPHNFLGIVRSFEFLAELRRMSVIVKPNSDDVYWSFTKGAPEIIAEICNKATLPSD
                     FEDTLQYYTHNGYRVIACAGKVLPKNTWLYSQKISREEVESGLEFLGFIVFENKLKPS
                     TRDTLDVLQDANIRTVMCTGDNVLTAVSVARQSGLVKANHVYVPMLTDAVLEDEIPIL
                     WREVDDQDNILDGRTLKPIDSFSDYTLAITGDIFRLIFSGGSDIPEAYISEVLLKGSV
                     YARMSPDEKHELMEQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTS
                     KIFEISCVLDVIKEGRACLVTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYI
                     DLLLIIPIAIFMSWSKPYDKIVKKRPSANLISAKILVPLLASIIIILLFQVIPWQIVQ
                     KMGWYLKPVVGGDDLVESSDNTILFYISNFQYILTAIVLSVGRPYREPMSKNHGFIID
                     ITVSLLLNLCLMFMDPHSYLGKKFQLTPVSTRFKLFIVVWALLNYYVQLYIPTSLKKY
                     FKKRKSGKKYKNILQEKSMSFVV"
     gene            <154626..>156092
                     /gene="NDAI0E00740"
                     /locus_tag="NDAI_0E00740"
                     /db_xref="GeneID:11498608"
     mRNA            <154626..>156092
                     /gene="NDAI0E00740"
                     /locus_tag="NDAI_0E00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670085.1"
                     /db_xref="GeneID:11498608"
     CDS             154626..156092
                     /gene="NDAI0E00740"
                     /locus_tag="NDAI_0E00740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670133.1"
                     /db_xref="GeneID:11498608"
                     /db_xref="UniProtKB/TrEMBL:G0WAX0"
                     /translation="MIDSEKSINNKLWSKKLPTQTLFCLIILFLVIKIIRTIHFNNVT
                     SSWDDGSLLNLPLMMYLSNPLPDKKSSFSSLPISSNKLPYTKYFKNLDHIQIQILKIA
                     GTKILEKNARLRLMKCLDSNLNGLFLVGRDVDEDNNIYKLAYFCFLDTASPPLGKTLP
                     GPYLSTLFSLSIFWRLIPLAIIRVIILNRSRLLEFFKNFLKTILFNKKLINKESSSGT
                     VFVSKKTETDTNKLDETTHKSTDEYKQHQRQFTWETVPNKQEKAKTIELPKDQSESSV
                     PGNPHSRTFPCLFESKNKGSSDNDENSNMSQIISQNSELLYFAHNSKPKSQEKEEQST
                     AEEPGEDETKIDTSATSASSLSESVSSSYKWKVGNINKLNKKQDSKKTTIPKQEHKRN
                     SPDEPKMSFDITTVQGRAAWKKYMIDKKRNDNKKNENPKDTTKENEIKEYSYLFKGRY
                     GQEREKKPYGNSTEINPFTENLPTNGKLRPLVPYMSVA"
     gene            <156529..>157581
                     /gene="NDAI0E00750"
                     /locus_tag="NDAI_0E00750"
                     /db_xref="GeneID:11498609"
     mRNA            <156529..>157581
                     /gene="NDAI0E00750"
                     /locus_tag="NDAI_0E00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670086.1"
                     /db_xref="GeneID:11498609"
     CDS             156529..157581
                     /gene="NDAI0E00750"
                     /locus_tag="NDAI_0E00750"
                     /inference="similar to DNA sequence:INSDC:YOR288C"
                     /note="similar to Saccharomyces cerevisiae MPD1 (YOR288C);
                     ancestral locus Anc_8.750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670134.1"
                     /db_xref="GeneID:11498609"
                     /db_xref="GOA:G0WAX1"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:G0WAX1"
                     /translation="MHLKYFYTIALLSLFHTRIQAQNFYDTNPNIIEINAKNFDKVIH
                     QTNYTSLVEFYAPWCGYCKQLKPTFQKVAKKLNGVVQVVSVNCDLEMNKPLCASYGVE
                     GYPTLKVFRPPKVNLNNNNNNNNNNNNNNNNNKKKNSKTKKNNVNLHKHAVETYNGQR
                     NVAPIVEFVLSRIKNYVKNLPHVEKLKTILDRSHHILHGNDSTISRYSVVLFSSSSSK
                     KGRISPTYKSIALDWLSGYDFYQISITDVQPLKNTETFSKTYPNISEFLTEFTAGQTS
                     EEKSQLVVFDGLNDKYYVFDGPGITKLEVSRFLTKTLGEPPREGPLSKRDKFLEDLKL
                     NKKKKKGPKKNMHDEL"
     gene            <158141..>159145
                     /gene="NDAI0E00760"
                     /locus_tag="NDAI_0E00760"
                     /db_xref="GeneID:11498610"
     mRNA            <158141..>159145
                     /gene="NDAI0E00760"
                     /locus_tag="NDAI_0E00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670087.1"
                     /db_xref="GeneID:11498610"
     CDS             158141..159145
                     /gene="NDAI0E00760"
                     /locus_tag="NDAI_0E00760"
                     /inference="similar to DNA sequence:INSDC:YOR287C"
                     /note="similar to Saccharomyces cerevisiae YOR287C;
                     ancestral locus Anc_8.748"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670135.1"
                     /db_xref="GeneID:11498610"
                     /db_xref="GOA:G0WAX2"
                     /db_xref="InterPro:IPR009292"
                     /db_xref="UniProtKB/TrEMBL:G0WAX2"
                     /translation="MSYYFKNLKPEYESEEEGDDDNNLESILSRRISKVDDATNGESS
                     EEDEMKTISFSSLKKADQIMMEEEAKESKLSKKNKMKNSKLSTIKNNDTTSTRNESEA
                     TKKKYKEESFDEDSESDSDDEGAFFEEEEDNDDEQQNNKINKKQSKGKKKGKHAPIES
                     SSKKRLSKRGVREIPGLNIPKTQNSNLYQDIRFDKSTGESTDLSVIRRRYQFLDEYRE
                     KEISELTKRLHDRKFLNKITDYEKEEMESKLISMKSRLQSVKNKDLERKIVKEYEDEI
                     NRNNSTRYHLKDSEKRKVIQKWKFDHMKAKQREKVMERKRKKRLGKEFKQFEFHQNNK
                     "
     gene            complement(<159265..>159738)
                     /gene="NDAI0E00770"
                     /locus_tag="NDAI_0E00770"
                     /db_xref="GeneID:11498611"
     mRNA            complement(<159265..>159738)
                     /gene="NDAI0E00770"
                     /locus_tag="NDAI_0E00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670088.1"
                     /db_xref="GeneID:11498611"
     CDS             complement(159265..159738)
                     /gene="NDAI0E00770"
                     /locus_tag="NDAI_0E00770"
                     /inference="similar to DNA sequence:INSDC:YOR286W"
                     /note="similar to Saccharomyces cerevisiae YOR286W;
                     ancestral locus Anc_8.747"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670136.1"
                     /db_xref="GeneID:11498611"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:G0WAX3"
                     /translation="MLRTITGRTAILRQSSSRPTSLLLRTFSTKSPKIYDFNQIKKLV
                     QQPIESKTLVDVREPEELKEYAMPTAINIPLKTAPGALSLSSDEFFDIFHFEKPPINN
                     ELIFFCQKGIRAQTAEELARSYGYENTGIYPGSIKEWLEKNGKDIKPTATFQAKL"
     gene            complement(<160521..>160982)
                     /gene="NDAI0E00780"
                     /locus_tag="NDAI_0E00780"
                     /db_xref="GeneID:11498612"
     mRNA            complement(<160521..>160982)
                     /gene="NDAI0E00780"
                     /locus_tag="NDAI_0E00780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670089.1"
                     /db_xref="GeneID:11498612"
     CDS             complement(160521..160982)
                     /gene="NDAI0E00780"
                     /locus_tag="NDAI_0E00780"
                     /inference="similar to DNA sequence:INSDC:YOR285W"
                     /note="similar to Saccharomyces cerevisiae YOR285W;
                     ancestral locus Anc_8.746"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670137.1"
                     /db_xref="GeneID:11498612"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:G0WAX4"
                     /translation="MWKRIVSAWNGSDEVDSPHHHSSTTTTSSSSEYKSPIYNFQQMK
                     EIVYHPDPSVTLIDCREPSEFEVVRIPGSINIPFRTHPNAFILDDQEFKETFGVDKPS
                     KDSELIFFCASGMRASKAQNVAVQCGYENTALYKGSMNDWVDNGGDQLQFH"
     gene            complement(<161704..>162420)
                     /gene="NDAI0E00790"
                     /locus_tag="NDAI_0E00790"
                     /db_xref="GeneID:11498613"
     mRNA            complement(<161704..>162420)
                     /gene="NDAI0E00790"
                     /locus_tag="NDAI_0E00790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670090.1"
                     /db_xref="GeneID:11498613"
     CDS             complement(161704..162420)
                     /gene="NDAI0E00790"
                     /locus_tag="NDAI_0E00790"
                     /inference="similar to DNA sequence:INSDC:YOR283W"
                     /note="similar to Saccharomyces cerevisiae YOR283W;
                     ancestral locus Anc_8.745"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670138.1"
                     /db_xref="GeneID:11498613"
                     /db_xref="GOA:G0WAX5"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G0WAX5"
                     /translation="MTITRDVPYYCNNEDPNVIRLFIIRHGQTDHNVKKILQGHKDTS
                     INGTGIKQSEQLGEYLGNQDVNIKFDRVVSSDLKRCKETIETVLSYSNQDDLISKVEY
                     VYGLRERYMGVIEGMHLADAEKYADKHGKGSFRDFGEAPEDFVGRLSTCIEKVVAESS
                     KQNCKDKNVALVSHGGAIRTILRWLEYKGQNAQQIIVFNTSVTIVDYLKDEKQFVVRR
                     VGNTQHLGDGEFIVSDLKLR"
     gene            <162820..>163605
                     /gene="NDAI0E00800"
                     /locus_tag="NDAI_0E00800"
                     /db_xref="GeneID:11498614"
     mRNA            <162820..>163605
                     /gene="NDAI0E00800"
                     /locus_tag="NDAI_0E00800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670091.1"
                     /db_xref="GeneID:11498614"
     CDS             162820..163605
                     /gene="NDAI0E00800"
                     /locus_tag="NDAI_0E00800"
                     /inference="similar to DNA sequence:INSDC:YOR281C"
                     /note="similar to Saccharomyces cerevisiae PLP2 (YOR281C);
                     ancestral locus Anc_8.743"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670139.1"
                     /db_xref="GeneID:11498614"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR024253"
                     /db_xref="UniProtKB/TrEMBL:G0WAX6"
                     /translation="MQNEPMFQVQVDENEDSEWNDILRSKGVIPERPPSPTAQLEEAL
                     EEAIVKQYENRLEDKDLSDLEELEDEEDEDFLEFYKMKRLNEIKQLQSKSKFGTVFHI
                     NKPEYNKEVTLASGGKDKTIEEDQDGDLKSEKEGTYVFVHLSIESKLQSRILSHIFQL
                     ASKKFPDIKFVEIPANRAIENYPDINCPTLLVYYKGDVVKNMITLLELGGNNTTLKDF
                     EELMVRVKALDEKDSRLIMNQDDEESREQRHLKFDKKEKYKII"
     gene            complement(<163826..>165307)
                     /gene="NDAI0E00810"
                     /locus_tag="NDAI_0E00810"
                     /db_xref="GeneID:11498615"
     mRNA            complement(<163826..>165307)
                     /gene="NDAI0E00810"
                     /locus_tag="NDAI_0E00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670092.1"
                     /db_xref="GeneID:11498615"
     CDS             complement(163826..165307)
                     /gene="NDAI0E00810"
                     /locus_tag="NDAI_0E00810"
                     /inference="similar to DNA sequence:INSDC:YMR223W"
                     /note="similar to Saccharomyces cerevisiae UBP8 (YMR223W);
                     ancestral locus Anc_8.742"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670140.1"
                     /db_xref="GeneID:11498615"
                     /db_xref="GOA:G0WAX7"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G0WAX7"
                     /translation="MGHCRHIDQVFKNEKSREGVLKSCNAARFILKHSIMKQKYLYAM
                     RCSTCKEINAGSTFMCLQCDFSGCWNNSDFANHSKQMGHIFSINSSNGLLFCFKCVDY
                     IGDVEQINYSMLNKFWDDISKKTHITSQERKDGLFGLVNMGSTCFMSSILQTLIHNPY
                     VVNYSMCQTHYNMCQSKNPLSCTSCALDLIITEFYATESKGNNSSHTGFISLLNSLLQ
                     VNENFAGYSQQDAHEFLQFILNQIHNDYKLNSMEDVNSGNTTAIAMKTLPGTQNSNNN
                     NNNTNHIHGNDVSCKCLSHSNFQGSLKSSILCPQCNNDSKTTIDPFMDLSLDVKDKSN
                     LYQCLDSFHKLEKLHDFNFHCSECNSTQDPIKQLTLNKLSPLLVFQLKRFEHLLNGTT
                     VKINDFIEYPLYLNMKTYCQSSNNDTEEEESNSENVPDMIYELTSIISHKGTVNEGHY
                     IVVVKVNDGQWFKFNDSMVSAITEEEALKQQAYLLFYSVFQLN"
     gene            <165783..>166649
                     /gene="NDAI0E00820"
                     /locus_tag="NDAI_0E00820"
                     /db_xref="GeneID:11498616"
     mRNA            <165783..>166649
                     /gene="NDAI0E00820"
                     /locus_tag="NDAI_0E00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670093.1"
                     /db_xref="GeneID:11498616"
     CDS             165783..166649
                     /gene="NDAI0E00820"
                     /locus_tag="NDAI_0E00820"
                     /inference="similar to DNA sequence:INSDC:YOR280C"
                     /note="similar to Saccharomyces cerevisiae FSH3 (YOR280C);
                     ancestral locus Anc_8.740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670141.1"
                     /db_xref="GeneID:11498616"
                     /db_xref="InterPro:IPR005645"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0WAX8"
                     /translation="MTTKGKILMLHGFVQSDKIFSAKTGGLRKALKKLGYEMFIPCGT
                     HLINKSDLLSRSSERELNYDDKKQQDDDEQSINIAKEFNTVNDDDEKLYGWWIKKNSG
                     PKALLDYTIEQYTLDFLHDYVVENGPFDGILGFSQGAGLAGYLATDFNGILKLSKEEQ
                     PPLKFLISFSGFRLDPEMYQESYDKNSIMMPSLHVQGELDSVVSEERVMRLYNSCPED
                     SRALLKHPGGHFIPNSKPFLNQVSNWIVSVSNLQNTLNGKSNEEEKQKTESEMPDLDD
                     DLMDMIDSIGNL"
     gap             166915..166934
                     /estimated_length=20
     gene            <167677..>168834
                     /gene="NDAI0E00830"
                     /locus_tag="NDAI_0E00830"
                     /db_xref="GeneID:11498617"
     mRNA            <167677..>168834
                     /gene="NDAI0E00830"
                     /locus_tag="NDAI_0E00830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670094.1"
                     /db_xref="GeneID:11498617"
     CDS             167677..168834
                     /gene="NDAI0E00830"
                     /locus_tag="NDAI_0E00830"
                     /inference="similar to DNA sequence:INSDC:YOR279C"
                     /note="similar to Saccharomyces cerevisiae RFM1 (YOR279C);
                     ancestral locus Anc_8.738"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670142.1"
                     /db_xref="GeneID:11498617"
                     /db_xref="InterPro:IPR020318"
                     /db_xref="UniProtKB/TrEMBL:G0WAX9"
                     /translation="MLGMQEDDESAVDATPTNFNNIQLNANNKDNNDRKLIETNVIDK
                     DKLKQEIHQLNNKIKPLEFESYYEFFLLNTFKRGISESGKVNIDDLRSREHGMYYKRI
                     KRSKNNSNKNANKSKKIKNNKSSDNDYTNANIKAESLTTSSRRRTRSQATPESEIGKE
                     KDMNNSSDSDLADLHSDDNDDQNDTDTDDRIQGSSDNEEDDDDDDDDDEIEPAIVDNL
                     VGDDHKNKEEKEISNASTSESSSAEKSLTNGTVRKIDSLPSSPEESDDIEDNLDKEAT
                     SKEKVADDSEVANVTLNNYREGKEEEGETAEIQDLYESIIPKIEAPFRRSDWLLPPRL
                     RYVPEKQLRTKHVHTTIKINELVAFKRIRNVLSRFEGGVAGVRKRDWESVD"
     gene            complement(<168992..>169789)
                     /gene="NDAI0E00840"
                     /locus_tag="NDAI_0E00840"
                     /db_xref="GeneID:11498618"
     mRNA            complement(<168992..>169789)
                     /gene="NDAI0E00840"
                     /locus_tag="NDAI_0E00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670095.1"
                     /db_xref="GeneID:11498618"
     CDS             complement(168992..169789)
                     /gene="NDAI0E00840"
                     /locus_tag="NDAI_0E00840"
                     /inference="similar to DNA sequence:INSDC:YOR278W"
                     /note="similar to Saccharomyces cerevisiae HEM4 (YOR278W);
                     ancestral locus Anc_8.734"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670143.1"
                     /db_xref="GeneID:11498618"
                     /db_xref="GOA:G0WAY0"
                     /db_xref="InterPro:IPR003754"
                     /db_xref="UniProtKB/TrEMBL:G0WAY0"
                     /translation="MTTSKTVLLLKNKTEGNDRYDVLFKEKGYNPKFIPLIKHTHLPQ
                     ELLHLIADESYLKNLRYIVVTSQRTVECINEQILPQLTDKQKQLLFDKVVYTVGPTTA
                     SYLERSGFKNIKGGHEAGNGDILSDIIVSDLSSNNKDNMHEILLLVGKIRRDIIPKKL
                     NDNGFSIKEVIVYETDTLKDNCENFQATLEDNCWVVVFSPQGIDDILEYIKQNNILTN
                     HKIQIAAIGPTTEKFLNQNGIYEMIVSPKPDAHSLLNEIERHSKHET"
     gene            complement(<170233..>171432)
                     /gene="NDAI0E00850"
                     /locus_tag="NDAI_0E00850"
                     /db_xref="GeneID:11498619"
     mRNA            complement(<170233..>171432)
                     /gene="NDAI0E00850"
                     /locus_tag="NDAI_0E00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670096.1"
                     /db_xref="GeneID:11498619"
     CDS             complement(170233..171432)
                     /gene="NDAI0E00850"
                     /locus_tag="NDAI_0E00850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670144.1"
                     /db_xref="GeneID:11498619"
                     /db_xref="GOA:G0WAY1"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G0WAY1"
                     /translation="MPLVKDYTPVPLANTDLFKPLKVGNTTVEHRVVMAPLTRMRAHA
                     PGHIPNRDWAVEYYDQRSKRKGSMIITEGVFPSAQSSGYDNAPGIWTPEQIEQWTKIF
                     KKIHENGSFVWPQLWVLGRQAFPDAMARDGLRYDSASDDLYMDDEMKEKAIKSNNPQH
                     GITKDEIKQYVKDYVQGAKNAVEAGADGVEIHSANSYLLNQFLDPISNHRTDEYGGSI
                     ENRARFTLEVVDALIEAVGPERVGIRLSPWGRYGGMSGSADPTLLSQFCYVVGELEKR
                     AKAGKRIAFIHLVEPRVTDLFSDSTAVPEDDGTNDFIYSIWKGVVIRAGMFPARPESI
                     KAAVANDQTMIGAGRYFISTPDLVDRLEKGQPLNKYDRSTFYSFTKEGYTDYPTYEEA
                     VKLESST"
     gene            complement(<172025..>173599)
                     /gene="NDAI0E00860"
                     /locus_tag="NDAI_0E00860"
                     /db_xref="GeneID:11498620"
     mRNA            complement(<172025..>173599)
                     /gene="NDAI0E00860"
                     /locus_tag="NDAI_0E00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670097.1"
                     /db_xref="GeneID:11498620"
     CDS             complement(172025..173599)
                     /gene="NDAI0E00860"
                     /locus_tag="NDAI_0E00860"
                     /inference="similar to DNA sequence:INSDC:YMR217W"
                     /note="similar to Saccharomyces cerevisiae GUA1 (YMR217W);
                     ancestral locus Anc_8.733"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670145.1"
                     /db_xref="GeneID:11498620"
                     /db_xref="GOA:G0WAY2"
                     /db_xref="InterPro:IPR001674"
                     /db_xref="InterPro:IPR004739"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR022310"
                     /db_xref="InterPro:IPR022955"
                     /db_xref="InterPro:IPR025777"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:G0WAY2"
                     /translation="MAVKQVSGIFDTILVLDFGSQYSHLITRRLREFNIYAEMLPCTQ
                     KISELSWKPKGIILSGGPYSVYDPEAPHVDHDIFKLDVPILGICYGMQELAWINGKQV
                     GRGEKREYGPATLNVLDKSDPLFANIDHSTVWMSHGDKLHGLPTGFKTIATSDNSPYC
                     GIVHETKKIYGIQFHPEVTHSSQGKQLLKNFAVDLCHATQNWTMENFIETEIKRIREL
                     VGPTAEVIGAVSGGVDSTVASKLMTEAIGERFHAILVDNGVLRLNEAATVKKTLVEGL
                     GINLTVVDAADEFLGKLKGVTDPEKKRKIIGNTFIHVFEREAEKIKPKDGQEIQYLLQ
                     GTLYPDVIESISFKGPSQTIKTHHNVGGLLENMKLKLIEPLRELFKDEVRHLGELLGI
                     SHELVWRHPFPGPGIAIRVLGEVTREQVEIARKADHIYIEEIRKHGLYDKIAQAFACL
                     LPVKSVGVMGDQRTYEQVIALRAVETSDFMTADWYPFEHSFLKKVASRIVNEVDGVAR
                     VTYDITSKPPATVEWE"
     gene            complement(<176292..>177422)
                     /gene="NDAI0E00870"
                     /locus_tag="NDAI_0E00870"
                     /db_xref="GeneID:11498621"
     mRNA            complement(<176292..>177422)
                     /gene="NDAI0E00870"
                     /locus_tag="NDAI_0E00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670098.1"
                     /db_xref="GeneID:11498621"
     CDS             complement(176292..177422)
                     /gene="NDAI0E00870"
                     /locus_tag="NDAI_0E00870"
                     /inference="similar to DNA sequence:INSDC:YMR214W"
                     /note="similar to Saccharomyces cerevisiae SCJ1 (YMR214W);
                     ancestral locus Anc_8.730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670146.1"
                     /db_xref="GeneID:11498621"
                     /db_xref="GOA:G0WAY3"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:G0WAY3"
                     /translation="MFIELRFLISLIFLPLLIFAQDYYKILELDKDATDKDIRSAYRQ
                     LSKKYHPDKNPNDEDAHHKFIEVGQAYEILSDPEKRQRYDQFGPEGVNGQNGGGPGGA
                     GFHDPFDIFEQMFGGGGGMGGHGGNPFQQQRQRGQNVVARESTSLKNYYNGYVLKFSI
                     NLNDICDHCHGSGSNDGKSTKCPDCQGRGVTVQVIRMGMMTQQIQQVCGKCGGKGQII
                     KNPCKTCHGSKVVQKPKDFEIELPAGAPRKFVHAEHGAADKHPDYDSGDVYIEFTEND
                     KDNMGYRRRGPHLYRTEVLNATEALYGGWERQLAFLDSSKIVTIKREPNKIIQNGETE
                     RIAGFGMPLGNGRKGFGDLFIDYVVVMPESLSGEELRMRDEL"
     gene            complement(<177831..>178349)
                     /gene="NDAI0E00880"
                     /locus_tag="NDAI_0E00880"
                     /db_xref="GeneID:11498622"
     mRNA            complement(<177831..>178349)
                     /gene="NDAI0E00880"
                     /locus_tag="NDAI_0E00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670099.1"
                     /db_xref="GeneID:11498622"
     CDS             complement(177831..178349)
                     /gene="NDAI0E00880"
                     /locus_tag="NDAI_0E00880"
                     /inference="similar to DNA sequence:INSDC:YOR276W"
                     /note="similar to Saccharomyces cerevisiae CAF20
                     (YOR276W); ancestral locus Anc_8.729"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670147.1"
                     /db_xref="GeneID:11498622"
                     /db_xref="UniProtKB/TrEMBL:G0WAY4"
                     /translation="MYKYTIDELLQLKPSETLVANFDAVDFRAIIEKVKQLQSLKEEE
                     FAHHGGHGHFNRRRSSHHHAGRPKVKHNKPKVTTDSEGWSTLDNKKDVAEESEVVDGA
                     TTTAAGTTSNGNTRSSPVPSATIAQETLKVRPNNKNIGSSRPADTKDIVADKQIHGFN
                     AFAALESDEDDE"
     gene            <178870..>180888
                     /gene="NDAI0E00890"
                     /locus_tag="NDAI_0E00890"
                     /db_xref="GeneID:11498623"
     mRNA            <178870..>180888
                     /gene="NDAI0E00890"
                     /locus_tag="NDAI_0E00890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670100.1"
                     /db_xref="GeneID:11498623"
     CDS             178870..180888
                     /gene="NDAI0E00890"
                     /locus_tag="NDAI_0E00890"
                     /inference="similar to DNA sequence:INSDC:YOR275C"
                     /note="similar to Saccharomyces cerevisiae RIM20
                     (YOR275C); ancestral locus Anc_8.726"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670148.1"
                     /db_xref="GeneID:11498623"
                     /db_xref="InterPro:IPR004328"
                     /db_xref="InterPro:IPR025304"
                     /db_xref="UniProtKB/TrEMBL:G0WAY5"
                     /translation="MSELLAIPFKRSLQIDLNSELSKLIDFTTYQTSSFFQNDLQLIS
                     NNRNLILNPDLSIESLNLLKTYYQQICQLERKFPSNQIEFSWFQTLSLKSTGSSYKSF
                     QWEKLNILYNIGALYSFLAIDTTATTGDDESLKLKCNYFQSSATVFDYLFSLHESNPT
                     TEEYKLMDKHTIHALKYLMLAQAQECFWFKATLSNNYKDSLISRLSSQIVVYYKSALK
                     WSKLSSLIRKDWCDHIESKIHYFNAVTLYRRALTFGSEKEYGSMIRALLSSQSEIKSC
                     KLDSRASFQRKIEQELKDMERDNDFIHLQLVPDTIPTTIKPADMVKVFPIEEVIPMAP
                     STTTTTLFNDLIPITVMESSEAYNERQNTYIIENVINPLLALNKILKDSVKTKLTDID
                     TPIGLKNVSHEELFEIESSFTDLETNNPSIESYLTNIRQLLQSESHLDDQYRSKHGTL
                     HWTLPESKVVNSSFFEKLDILQKYLNDAKLTDKNNRELFGTIDVNLLTSPIKLPPSNN
                     PILIRAQQLINERESRITEIKLKSDNHKVLPKIISEYKKNGEHNLESVFMDHLKYFHD
                     DLKFVQEEKRRNSELIQDIEDENEKKNEKESQSQTRMERLDPRKLYIEDLQHSSNLLN
                     ELKQNIIEGAKFYVDLAKSTNQLLHATQQFVSNRKEEAEALDNKLMTV"
     gene            complement(<180968..>182254)
                     /gene="NDAI0E00900"
                     /locus_tag="NDAI_0E00900"
                     /db_xref="GeneID:11498624"
     mRNA            complement(<180968..>182254)
                     /gene="NDAI0E00900"
                     /locus_tag="NDAI_0E00900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670101.1"
                     /db_xref="GeneID:11498624"
     CDS             complement(180968..182254)
                     /gene="NDAI0E00900"
                     /locus_tag="NDAI_0E00900"
                     /inference="similar to DNA sequence:INSDC:YOR274W"
                     /note="similar to Saccharomyces cerevisiae MOD5 (YOR274W);
                     ancestral locus Anc_8.725"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670149.1"
                     /db_xref="GeneID:11498624"
                     /db_xref="GOA:G0WAY6"
                     /db_xref="InterPro:IPR002627"
                     /db_xref="InterPro:IPR018022"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WAY6"
                     /translation="MIRKTIQRIMPTAKKVIVIAGTTGVGKSQLSIQLATKFNGEIIN
                     SDSMQVYKDIPIISNKHPIGEREGIPHHVINHIDWTDEYYLHKFEEECLQTIEEIHSR
                     GKIPIIVGGTHYYLQALFNKKVETGSRELAKKESEILNSNDPNLIYQTLMVVDPDIAK
                     KYHPHDTRRVQRMLEIYYTTGKKPSEMYNDQQLTLRYNTLFLWLYSDPIPLDKRLDDR
                     VDAMLESGGMDEINQLYSYYKENNFKPEQCENGVWQVIGFKEFLPWLEKSSGVTLEEC
                     VDKMKIRTRQYAKKQVKWIRKMLIPDINGDIYILNASDLDKWQNIVSKRANSIAEEFV
                     NDTTIIEERAPVELSHLLDGIEMSTKVKQNKTEACEQFICEICCDQQGEKLRAIGTKN
                     WEIHLKSRRHKRNLTRGVKKAQYEKWKAQNKSSTRV"
     gap             182444..182463
                     /estimated_length=20
     gene            complement(<182574..>183968)
                     /gene="NDAI0E00910"
                     /locus_tag="NDAI_0E00910"
                     /db_xref="GeneID:11498625"
     mRNA            complement(<182574..>183968)
                     /gene="NDAI0E00910"
                     /locus_tag="NDAI_0E00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670102.1"
                     /db_xref="GeneID:11498625"
     CDS             complement(182574..183968)
                     /gene="NDAI0E00910"
                     /locus_tag="NDAI_0E00910"
                     /inference="similar to DNA sequence:INSDC:YOR272W"
                     /note="similar to Saccharomyces cerevisiae YTM1 (YOR272W);
                     ancestral locus Anc_8.721"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670150.1"
                     /db_xref="GeneID:11498625"
                     /db_xref="GOA:G0WAY7"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012972"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR028599"
                     /db_xref="UniProtKB/TrEMBL:G0WAY7"
                     /translation="MSSEEAPDKSQLKIRFFTREKDESLHVQDTPMYVPITLKRYGLS
                     EIVNHILESPTPIPFDFLVDGELLRTSLQEYLTKKGLSSENSLNLEYTRAVLPPSFLS
                     SFNNEDWISSLDVSRDTDNKAIISGSYDGVVRTWNMDGKVQKQYSGHSGPIKAVKFIS
                     NTRLVSAGNDRTLRLWKTKNDQLNNSNATEQDDDEDVEDGKTLAILEGHKAPVVSLDV
                     SIPTSRILSSSYDNAIGFWSTIYKEMTTVDPMEEIKNPDNKISTAAKKRRKLTLKDGT
                     IRRRAPLALLESHTAPVEQTNFDINDNTVGYSVSQDHTIKTWDLVTARCVDTKITSYS
                     LLSLVQMPTLNLLACGSSARHITLHDPRMDSSSSKITQQQLIGHKNFVVSLDTCPENE
                     YMLCSGSHDGTVKVWDVRSSSPMYTITREDKSVKKGINDKVLAVRWAEKVGIISGGQD
                     KKIQINKGDNIFKQ"
     gene            <185527..>186783
                     /gene="NDAI0E00920"
                     /locus_tag="NDAI_0E00920"
                     /db_xref="GeneID:11498626"
     mRNA            <185527..>186783
                     /gene="NDAI0E00920"
                     /locus_tag="NDAI_0E00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670103.1"
                     /db_xref="GeneID:11498626"
     CDS             185527..186783
                     /gene="NDAI0E00920"
                     /locus_tag="NDAI_0E00920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670151.1"
                     /db_xref="GeneID:11498626"
                     /db_xref="InterPro:IPR021031"
                     /db_xref="UniProtKB/TrEMBL:G0WAY8"
                     /translation="MKAVVLKVLFGLLVTAATSSAVLQVSSDTLYSEQRTIVGDVIVM
                     DGSSLLITHDPELGILSGTISNNGNLCIGTTDTTSIMSIDILATNIENKGNLIIDNGV
                     AGDKTTTVKVASLDNSGNLLIDLKDSMESLTVTNSFVNTGYMSLSHVTLQGYDGVFTF
                     KGPTSGITNSGTIDVSGTNITIDYPISGGGCIYGNEWRTDLTVNTNYQHDQTFWMQKS
                     DRASSITLLGAGKYIPVIRGFNSGNKIQFGRNIQKYDGTITTPSYNPDTGIVTTSNMY
                     GTFQIDIGKGYDGSKIKSEQSNSCPTVSDSSCYAPALTYGDDAVEPAAATERPTSCAS
                     RPDLSMAICSTVLPSLSSFPSSYSTSHISTGISSTTNNNGQCVKTETSTSYFSTLHTT
                     TYFYSKVSTITAPRTRTFITTYHTKI"
     gene            <187303..>188256
                     /gene="NDAI0E00930"
                     /locus_tag="NDAI_0E00930"
                     /db_xref="GeneID:11498627"
     mRNA            <187303..>188256
                     /gene="NDAI0E00930"
                     /locus_tag="NDAI_0E00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670104.1"
                     /db_xref="GeneID:11498627"
     CDS             187303..188256
                     /gene="NDAI0E00930"
                     /locus_tag="NDAI_0E00930"
                     /inference="similar to DNA sequence:INSDC:YOR271C"
                     /note="similar to Saccharomyces cerevisiae YOR271C;
                     ancestral locus Anc_8.720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670152.1"
                     /db_xref="GeneID:11498627"
                     /db_xref="GOA:G0WAY9"
                     /db_xref="InterPro:IPR004686"
                     /db_xref="UniProtKB/TrEMBL:G0WAY9"
                     /translation="MASSVPGPIELPESRYDLSTYWGRIRHCAEISDPTMLLTTKKDL
                     AHAREVISAYRHGLIKTPTEEFWIAKKHLDSTVHPDTGETVILPFRMSSCVISNLVVT
                     LGMLTPGLGTTGTLFWQWANQSLNVAVNSANANKSHKMSTKQLMTNYAAAVTASCGVA
                     LGLNSVVPKLKNVTPNTKLILGRLIPFAAVVTAGIVNVFLMRGNEIQKGISVYDSNGD
                     EVGKSKKAAFIAVGETALSRVINATPIMVIPPLILVKLQKGALMGKSVGMQTLANLGL
                     IAATSFAVLPFALGVFPQRQSIHVKKLETELHGKKDKKIKP"
     gene            <189540..>192095
                     /gene="NDAI0E00940"
                     /locus_tag="NDAI_0E00940"
                     /db_xref="GeneID:11498628"
     mRNA            <189540..>192095
                     /gene="NDAI0E00940"
                     /locus_tag="NDAI_0E00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670105.1"
                     /db_xref="GeneID:11498628"
     CDS             189540..192095
                     /gene="NDAI0E00940"
                     /locus_tag="NDAI_0E00940"
                     /inference="similar to DNA sequence:INSDC:YOR270C"
                     /note="similar to Saccharomyces cerevisiae VPH1 (YOR270C);
                     ancestral locus Anc_8.718"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670153.1"
                     /db_xref="GeneID:11498628"
                     /db_xref="GOA:G0WAZ0"
                     /db_xref="InterPro:IPR002490"
                     /db_xref="InterPro:IPR026028"
                     /db_xref="UniProtKB/TrEMBL:G0WAZ0"
                     /translation="MSAVETVPKDEAMFRSAVMSLVQLYIPQEIARDAVYTLGQLGIV
                     QFRDLNSETNSFQRTFVDEIRRLDNVQRQYRYFFKLLQKHNIPLYEGAIEQYDRPSNL
                     NDANIMSQLIVPPSTSAIDDHVQNAALLEQRLVQMEEATEQIEAQKVDLEQYRIVLQS
                     GDQFFQSGDSMALAATATVVDLEDTLRRSSITINFVTGIIPRDKINTFEQILWRVLRG
                     NLFFKHIEIEQPIFDVKTQSYIAKNAFIVYSHGDLILDRIKRIAESLDAHLYEIDKNP
                     ESRSQKLLKINENLSDLYTVLQSTTTTLESELFGIGQELNSWYQDIAREKSTYETLNK
                     FNFDKNRKTLIAEGWIPEDELSFLKDCLVQMTSKLGVDVPSIIQVLGTNKTPPTFHRL
                     NKFTQAFQSICDSYGVPQYREVNPGLPTIVTFPFMFAIMFGDMGHGFIMTMAALVFVL
                     NEKKFDRMKRGEILDMAYTGRYIILFMGLFSMYTGFLYNDIFSRSMTLFKSGWEWPED
                     FKAGEMLYAKKVGTYPIGIDWAWHGAENSLLFSNSYKMKLSIVMGFIHMTYSYMFSLV
                     NHLHFKSMIDIVANFIPGLLFMQGIFGYLSVCIIYKWSVDWIGDGKAAPGLLNMIINM
                     FLAPGTIDEELYPHQAKVQIFLLGMALLCVPWLLLMKPLHFKFTHSEKKNSFPTADDI
                     ETQALLHDENEDEIAETEGTIAANNDSEEGEGHGEELGDVIIHQVIHTIEFCLNCVSH
                     TASYLRLWALSLAHAQLSSVLWSMTLELSFGVPGALGVFMTVSLFTLWFCLTIAVLVM
                     MEGTSAMLHSLRLHWVESMSKYFVGDGIPYEPFVFQYLDMETDVANNAGNIAA"
     gene            complement(<192199..>193734)
                     /gene="NDAI0E00950"
                     /locus_tag="NDAI_0E00950"
                     /db_xref="GeneID:11498629"
     mRNA            complement(<192199..>193734)
                     /gene="NDAI0E00950"
                     /locus_tag="NDAI_0E00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670106.1"
                     /db_xref="GeneID:11498629"
     CDS             complement(192199..193734)
                     /gene="NDAI0E00950"
                     /locus_tag="NDAI_0E00950"
                     /inference="similar to DNA sequence:INSDC:YOR269W"
                     /note="similar to Saccharomyces cerevisiae PAC1 (YOR269W);
                     ancestral locus Anc_8.717"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670154.1"
                     /db_xref="GeneID:11498629"
                     /db_xref="GOA:G0WAZ1"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017252"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G0WAZ1"
                     /translation="MQIHWKLPLTKESKEDLDRSIIDYVQWQYNEREKATPSVLENNG
                     DDIDLDEKSLIASLKGLFLLPSDNTESTHEVNPLLLPRKWNSIVRLQRHIMTLEQTCR
                     DLTNQVDTLQQEAKKHDNTNTIDSESLNISWIPKTFPNYSITVDTSISSVKLHPRLPI
                     IFIGTDHGKLYAFDIFNPSLPLSSIQAHFKGITSIDSILLKSDKEGSAIISTTSKDLS
                     IKLYKWIVTENKFQLQRSLISHEHIVSQNKLFIHGNDILLASCSRDTTIKIWNTSTAY
                     CINSIPAHLDWVRSIDVFNEYVLSGSQDSSLRLTHWPSGNGLSIGKGHDFPIECVKFI
                     PFLIMPQNENDSKEEEDDDDATKVTIARQPPSDGINAEDYMKLGFKYCASASRDKLIK
                     IWEIPTPRFLMHRPPIPNGNNPIMKCVMTLKGHSSWVKDLQIRGNYLFSCSDDKTIKC
                     WSLENGECVKTWNDSHSGFITCLEMDSDITALKETTENKVNLHREIMVTAGLDSKCNI
                     YIR"
     gene            <195116..>197251
                     /gene="NDAI0E00960"
                     /locus_tag="NDAI_0E00960"
                     /db_xref="GeneID:11498630"
     mRNA            <195116..>197251
                     /gene="NDAI0E00960"
                     /locus_tag="NDAI_0E00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670107.1"
                     /db_xref="GeneID:11498630"
     CDS             195116..197251
                     /gene="NDAI0E00960"
                     /locus_tag="NDAI_0E00960"
                     /inference="similar to DNA sequence:INSDC:YOR267C"
                     /note="similar to Saccharomyces cerevisiae HRK1 (YOR267C);
                     ancestral locus Anc_8.716"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670155.1"
                     /db_xref="GeneID:11498630"
                     /db_xref="GOA:G0WAZ2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0WAZ2"
                     /translation="MPNLLSRNPFHTHHSSGNLNHANNHRHDNASPTTSSTHHHDQHH
                     QAPTLKRSSKSFLNFISRKPSTDSIRSEKSNDSTYNSPTSTHNNHSGYHTDLGGQASP
                     KQSHSMAELKRFFRPSMNKKLSMTQMHTSSHTGTNHFSPPSSTSTSTLNLNAHYVHNN
                     NNVYPSHPHGSTDHHAHTQSAIPPSTDSILSLSNNVNIYHDDSILAQKYGKLGKLLGA
                     GAGGSVKILVRPTDGVTFAVKEFRPRKPNESVKEYAKKCTAEFCIGSTLHHPNIVETV
                     DIFSDSKQNKYFEVMQYCPVDFFAVVMTGKMSRGEINCCLKQLLEGVKYLHSMGLAHR
                     DLKLDNCVMTEDGILKLIDFGSAVVFRYPFENEISMAHGIVGSDPYLAPEVITSTKRY
                     DPQCVDIWSVGIIYCCMMLKRFPWKAPRDTDENFRLYCLEDDIEHDYVQSAKHHEQLL
                     KERKTRRQRMHDGTHVEEKEEQQQTDGHQNASGSPDCKTNDGQQQTETTAKDNAQEEI
                     PSKTIKAKLEEEKGQKEAPHSPLQPRQEQSPPPPPKEQLDNVQQLPTPQVSNTKAEKD
                     VQRSPLVNEVEQCQGTTEQPNVQHQESATKSIGADSRQQGSDQKSIMSHKTTATQNHG
                     PHPHHKKTIHGPYRLLRLLPHASRPIMSRILEVNPEKRATLEDIFNDEWFKDIPACTM
                     NEKKQVIRAPGHHHTVVKEENAHLATYKV"
     gene            complement(<197813..>199066)
                     /gene="NDAI0E00970"
                     /locus_tag="NDAI_0E00970"
                     /db_xref="GeneID:11498631"
     mRNA            complement(<197813..>199066)
                     /gene="NDAI0E00970"
                     /locus_tag="NDAI_0E00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670108.1"
                     /db_xref="GeneID:11498631"
     CDS             complement(197813..199066)
                     /gene="NDAI0E00970"
                     /locus_tag="NDAI_0E00970"
                     /inference="similar to DNA sequence:INSDC:YOR266W"
                     /note="similar to Saccharomyces cerevisiae PNT1 (YOR266W);
                     ancestral locus Anc_8.715"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670156.1"
                     /db_xref="GeneID:11498631"
                     /db_xref="UniProtKB/TrEMBL:G0WAZ3"
                     /translation="MFSNHGTKMSIIRLYSTKKVVSKPVSSLTKIGFNQPIDISSKET
                     FNESLKTNKTFAQLHALYLTNKLQFQNDNDITKVASFTPEINSQRTLPRTQFPKNKIF
                     QQVIFDPKIPKWRKSITKWYRLGTTLLRYYRDGIKNTIKAYRSTTKYDLRTLFRQLEI
                     DNTTISTLKINRKDFIESLRSRNEFKKIPNFILLSLIFEECTVLICYFWPRVALWNCL
                     NPGGFKKLSDSLVQNEDPFQNEVIGDARYISPYSLDFQKLHSNLRRSHIMRMNFFKLK
                     FYELFQMKNPIIERLVNIYQYIFIDDRLLLQSILHGNEKAPVIWGYDELVNFILERKL
                     YHHGEDLNKLVNTNEGRDLLIWRMLLYLSFRFDNTIYLNGTSTFSEKWGTYNMYLLNN
                     PGTSINHDATTKITVLKENIVKSAL"
     gene            complement(<199318..>199644)
                     /gene="NDAI0E00980"
                     /locus_tag="NDAI_0E00980"
                     /db_xref="GeneID:11498632"
     mRNA            complement(<199318..>199644)
                     /gene="NDAI0E00980"
                     /locus_tag="NDAI_0E00980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670109.1"
                     /db_xref="GeneID:11498632"
     CDS             complement(199318..199644)
                     /gene="NDAI0E00980"
                     /locus_tag="NDAI_0E00980"
                     /inference="similar to DNA sequence:INSDC:YOR265W"
                     /note="similar to Saccharomyces cerevisiae RBL2 (YOR265W);
                     ancestral locus Anc_8.714"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670157.1"
                     /db_xref="GeneID:11498632"
                     /db_xref="GOA:G0WAZ4"
                     /db_xref="InterPro:IPR004226"
                     /db_xref="UniProtKB/TrEMBL:G0WAZ4"
                     /translation="MAPTQLEIKTKALQRLIKEESYYKEEIKEQKANVEKLKQDSNVD
                     PYDLKKQVEVLEDTERLLPTLYTKIEEFKENLEQFLQSYDGQEDLTESKAAVEEANAF
                     IQASKK"
     gene            complement(<200132..>201643)
                     /gene="NDAI0E00990"
                     /locus_tag="NDAI_0E00990"
                     /db_xref="GeneID:11498633"
     mRNA            complement(<200132..>201643)
                     /gene="NDAI0E00990"
                     /locus_tag="NDAI_0E00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670110.1"
                     /db_xref="GeneID:11498633"
     CDS             complement(200132..201643)
                     /gene="NDAI0E00990"
                     /locus_tag="NDAI_0E00990"
                     /inference="similar to DNA sequence:INSDC:YOR264W"
                     /note="similar to Saccharomyces cerevisiae DSE3 (YOR264W);
                     ancestral locus Anc_8.713"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670158.1"
                     /db_xref="GeneID:11498633"
                     /db_xref="UniProtKB/TrEMBL:G0WAZ5"
                     /translation="MPRKFLGERIEKGVDVIRPSSLTLTAEDIANLPIFQTSPFLEDV
                     QDDIIFHQPNKGKRLSRRFGGTMKIKQRLESVPELFLHDFNKRQKGKQPINTTTIVSS
                     DPKISYNNKYEENPRIRTANVRNITAPTYIKRKETIKRRIKPSTKEPTKTKLPLITVE
                     EKEELSNEIYYEEKVRLKDPLELPVPILPNSNQNIHAYPITAGPVAPNLNHHIPISEK
                     NGKSESEILFEEILDAYGSTADDNYLLTTNKGNNNNNNNNNKNPSTNFLLENEIDRIL
                     NHVIKKNNKSKMEKMNGLTTPKIIQSEFQGDIDFLDFSKTPIIESISSSPLKDMISSP
                     EYTGTSEQWSSDDDEDEGQERKSYTFSNSNTSDEGYCTAKESLSSIYSVEDLEIKSIP
                     KSNFKPTISRSLNFPQMKNQIVKSNVHFTYVKPLLFKLEDDTESSLSDEETSLLTRND
                     NDQKINASLKCLEKCQPCLSSETATERDSLKILQKQIENIDIISMTSSVYSEI"
     gene            complement(<202491..>203534)
                     /gene="NDAI0E01000"
                     /locus_tag="NDAI_0E01000"
                     /db_xref="GeneID:11498634"
     mRNA            complement(<202491..>203534)
                     /gene="NDAI0E01000"
                     /locus_tag="NDAI_0E01000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670111.1"
                     /db_xref="GeneID:11498634"
     CDS             complement(202491..203534)
                     /gene="NDAI0E01000"
                     /locus_tag="NDAI_0E01000"
                     /inference="similar to DNA sequence:INSDC:YOR262W"
                     /note="similar to Saccharomyces cerevisiae YOR262W;
                     ancestral locus Anc_8.712"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670159.1"
                     /db_xref="GeneID:11498634"
                     /db_xref="GOA:G0WAZ6"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WAZ6"
                     /translation="MSFAQIVIGPPGSGKSTYCNGCSQFFNAIGRHGQIINMDPANDS
                     LPYPCAVDIRDFITVEEVMQEQQLGPNGGLMYAVESLDKSIDLFILQIKSLIQEEKAY
                     LVFDCPGQVELFTHHSSYFKIFKKLEKQLSMRFCVVNLIDCYYITSPSQYVSILLLAL
                     RSMLMMDLPQINVFSKIDMLKSYGELPFRLDYYTEVQDLDYLLPYIEKESSSVLSKKY
                     SKLTETISELVSDFNLVSFEVLAIDDKQSMINLQASIDKANGYIFGASEVGGDTVWAE
                     ATREGAMLMNYDIQDRWIDNKEQYDKEEQERQEQIERERQMQDKEIDVDNDDEWESAL
                     KDWEEKQGTNYVR"
     gene            complement(<203904..>205625)
                     /gene="NDAI0E01010"
                     /locus_tag="NDAI_0E01010"
                     /db_xref="GeneID:11498635"
     mRNA            complement(<203904..>205625)
                     /gene="NDAI0E01010"
                     /locus_tag="NDAI_0E01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670112.1"
                     /db_xref="GeneID:11498635"
     CDS             complement(203904..205625)
                     /gene="NDAI0E01010"
                     /locus_tag="NDAI_0E01010"
                     /inference="similar to DNA sequence:INSDC:YOR260W"
                     /note="similar to Saccharomyces cerevisiae GCD1 (YOR260W);
                     ancestral locus Anc_8.709"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670160.1"
                     /db_xref="GeneID:11498635"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G0WAZ7"
                     /translation="MPIQAFIFCGRGHNLAPFTRQSSATTTTTTTTTTTTTTTTTLSN
                     ESKETSVVDAASIAIAKGPFLPKALLPIANRPMIEYVLDWCDQANFAEINIVASVEEL
                     PIIKKGLIPFMTLRNQQFELISKSLSLSNHTHHLQQLKSINFIPSKTSSTGESLQKEL
                     LDKIYTDFVLLPCDFLTDIPPQIFIDQYLNRDDDNLAMSVYYKNSLDATINDKKQLNK
                     FQKKFFTIYSENENSEKQPILLDIYSKDDVTRSKYLQVRSHLLWKYPNTTVSTNLNNS
                     SIYFCSYELVKLLTPTTTSNNNNDRADSVPSTATTTSSSTNVNEGETTDSTSIKPSYF
                     KKSNELIKDPINCNKPLSKLFRDLSRRSWQHSHPRETISIFILPPTTSFFIRSNNLIN
                     MMESTRFILKIKSHSTTTAPASSSSSIGLDSIVDPSCKIKDKSSSVKLSTMSYEGIIG
                     AKCRIAGSILFHGVQLDDDVILENCIIGPNVKIGKKAKLSNCYVEGNYIVEPKGNFKG
                     ETLSKVALEEEDIAIDSDNENALEMSSDENGSSDGTSDDDEDDNDESEEYSEDEEFED
                     DGLFDRS"
     gene            <206043..>207374
                     /gene="NDAI0E01020"
                     /locus_tag="NDAI_0E01020"
                     /db_xref="GeneID:11498636"
     mRNA            <206043..>207374
                     /gene="NDAI0E01020"
                     /locus_tag="NDAI_0E01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670113.1"
                     /db_xref="GeneID:11498636"
     CDS             206043..207374
                     /gene="NDAI0E01020"
                     /locus_tag="NDAI_0E01020"
                     /inference="similar to DNA sequence:INSDC:YOR259C"
                     /note="similar to Saccharomyces cerevisiae RPT4 (YOR259C);
                     ancestral locus Anc_8.708"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670161.1"
                     /db_xref="GeneID:11498636"
                     /db_xref="GOA:G0WAZ8"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WAZ8"
                     /translation="MSEEQDPLMAALSMDAESEQQQQSNAPGSAETATSNTDAPQQQA
                     AEEEVPRIDPEQEARNKALTQFKNKLLEHRRYDDQLKQRRQNIRTLEKLYDKTENDIK
                     ALQSIGQLIGEVMKELSEEKYIVKASSGPRYIVGVRNSVDRKKLKKGVRVTLDITTLT
                     IMRILPRETDPLVYNMTSFEQGEVTFDGIGGLTEQIRALREVIELPLKNPEIFQRVGI
                     KPPKGVLLYGPPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYA
                     KEHEPCIIFMDEVDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATN
                     RPDTLDPALLRPGRLDRKIEIPLPNEAGRLEIFKIHTEKVKKIGEFDFEAAVKMSDGF
                     NGADIRNCATEAGFFAIRDDRDHIIPEDLMKAVRKVAEVKKLEGSLEYQKL"
     gene            complement(<207521..>208168)
                     /gene="NDAI0E01030"
                     /locus_tag="NDAI_0E01030"
                     /db_xref="GeneID:11498637"
     mRNA            complement(<207521..>208168)
                     /gene="NDAI0E01030"
                     /locus_tag="NDAI_0E01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670114.1"
                     /db_xref="GeneID:11498637"
     CDS             complement(207521..208168)
                     /gene="NDAI0E01030"
                     /locus_tag="NDAI_0E01030"
                     /inference="similar to DNA sequence:INSDC:YOR258W"
                     /note="similar to Saccharomyces cerevisiae HNT3 (YOR258W);
                     ancestral locus Anc_8.707"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670162.1"
                     /db_xref="GeneID:11498637"
                     /db_xref="GOA:G0WAZ9"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR026963"
                     /db_xref="UniProtKB/TrEMBL:G0WAZ9"
                     /translation="MSSFWKSALQIYVKNPQKVPSEELVYYDEKVTIINDKFPKSTCH
                     LLILPRDGKLTLQHPTIALTDRIKDSLEEYVRMAQEYIFKTFTSKYKLVKPIPNVFDK
                     IEDFNDMEIFIDKFITVGVHSVPSMANLHIHVITKDFHSEKLKYKNHYLSFNSEFYRK
                     WDSLPLEQIPVRDEMIDLVKHGDLICCYCNANFKNQFAKLKKHLNEEFENHFKLK"
     gene            complement(<208468..>208932)
                     /gene="NDAI0E01040"
                     /locus_tag="NDAI_0E01040"
                     /db_xref="GeneID:11498638"
     mRNA            complement(<208468..>208932)
                     /gene="NDAI0E01040"
                     /locus_tag="NDAI_0E01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670115.1"
                     /db_xref="GeneID:11498638"
     CDS             complement(208468..208932)
                     /gene="NDAI0E01040"
                     /locus_tag="NDAI_0E01040"
                     /inference="similar to DNA sequence:INSDC:YOR257W"
                     /note="similar to Saccharomyces cerevisiae CDC31
                     (YOR257W); ancestral locus Anc_8.705"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670163.1"
                     /db_xref="GeneID:11498638"
                     /db_xref="GOA:G0WB00"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR029530"
                     /db_xref="UniProtKB/TrEMBL:G0WB00"
                     /translation="MNRNTDAELDEDEKRDILEAFNIFDLNKDGHLDFHEFKAATRAL
                     GFEVDKKQLLELISHYDKDGRHLINFEDFQEIMIQWMLERDPMLEIKKAFHLFDEDGT
                     GKITMKDLKKLAKSLDIRISDEELKEMIDEFDLDGDGGINEEEFISICTDTS"
     gene            <209218..>211440
                     /gene="NDAI0E01050"
                     /locus_tag="NDAI_0E01050"
                     /db_xref="GeneID:11498639"
     mRNA            <209218..>211440
                     /gene="NDAI0E01050"
                     /locus_tag="NDAI_0E01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670116.1"
                     /db_xref="GeneID:11498639"
     CDS             209218..211440
                     /gene="NDAI0E01050"
                     /locus_tag="NDAI_0E01050"
                     /inference="similar to DNA sequence:INSDC:YOR256C,YPL176C"
                     /note="similar to Saccharomyces cerevisiae TRE2 (YOR256C)
                     and TRE1 (YPL176C); ancestral locus Anc_8.702"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670164.1"
                     /db_xref="GeneID:11498639"
                     /db_xref="InterPro:IPR007365"
                     /db_xref="UniProtKB/TrEMBL:G0WB01"
                     /translation="MNYNRISMVDNDAMDPMFIEEPDSMITRPTMKEQLHNKVILPMK
                     YNVVDPFNDIISLMDRKSNNVFNFQLWRRFIYFLLVVFVLIFISQYDRIRHYKPIDHD
                     LIREEVRDWIDLNKFEKNWEYLSNLPHCSGTKGDETVSQYVMDSFLKSGMKNVKLEEY
                     KGYLNYPSNETHSLIVFKNNGTDEILKFELGENNFNPLSWNGKVENSFLIYGGDGTKE
                     SLQRILENNNNDILDHRDNFVLLLHYDGLVSEQLILAQMLGARGVLFISDKFDQREDV
                     ILMKSVAIPQFYTGDLLSPGWEGNSVRTISLNESDAIPHIPTLPLSYNQGQQLLSLVK
                     SEGKNGIRVSFEVKTIVERRHPVYNVIGKIEGREQPEKAIILSSSRNSIHHGAVYPNF
                     GTTMLLQFVELFQIIKKKYNWKPLRSIYFVSFGGNEYNHIGSTEFYEKYSLPLQQELY
                     SIVDITELGINVMHYANSSLKIETHPLLKNLFEDTTMDPNMNVSVSHVQHYGDWIPFL
                     ANGIPVSVISDPDLNLHKYPIHTKESTFANIEETLKDNNSTEAIQIFEITIYILDKIL
                     RLVDVPNIPYGLTDYVEVVDELLHSLEKDHSKKLNFDKMIRALLRWKKIGTERQKWLN
                     KWQSHISSSKSKKKNHKHNDIESVSARRERCDWNNRLTDIAKKTCSEYGLTGRPFYKA
                     LLFGPTFLRQRSDQDSWSFPAVKDSIMNLAWTSAQKELDDVARLLQLSAKPFLRNNAN
                     "
     gene            complement(<211581..>212093)
                     /gene="NDAI0E01060"
                     /locus_tag="NDAI_0E01060"
                     /db_xref="GeneID:11498640"
     mRNA            complement(<211581..>212093)
                     /gene="NDAI0E01060"
                     /locus_tag="NDAI_0E01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670117.1"
                     /db_xref="GeneID:11498640"
     CDS             complement(211581..212093)
                     /gene="NDAI0E01060"
                     /locus_tag="NDAI_0E01060"
                     /inference="similar to DNA sequence:INSDC:YOR253W"
                     /note="similar to Saccharomyces cerevisiae NAT5 (YOR253W);
                     ancestral locus Anc_8.697"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670165.1"
                     /db_xref="GeneID:11498640"
                     /db_xref="GOA:G0WB02"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G0WB02"
                     /translation="MGRDIVGLDNVYENNLGVVVKLAAIEENLTFPETFFQELFPKGN
                     AKKETFFTQLAYYSEIPVGCVKAKLFPKKKSDIFLKGVHIEFMTVLEQYRGNQIGTKL
                     LNYIEEQCQSHHQHNVYVHVPTDETNKIEWYKNHGFEIDTEVSPLQDFFKDFQPKGSA
                     DAVLLKKHIA"
     gene            complement(<212424..>213035)
                     /gene="NDAI0E01070"
                     /locus_tag="NDAI_0E01070"
                     /db_xref="GeneID:11498641"
     mRNA            complement(<212424..>213035)
                     /gene="NDAI0E01070"
                     /locus_tag="NDAI_0E01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670118.1"
                     /db_xref="GeneID:11498641"
     CDS             complement(212424..213035)
                     /gene="NDAI0E01070"
                     /locus_tag="NDAI_0E01070"
                     /inference="similar to DNA sequence:INSDC:YOR252W"
                     /note="similar to Saccharomyces cerevisiae TMA16
                     (YOR252W); ancestral locus Anc_8.695"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670166.1"
                     /db_xref="GeneID:11498641"
                     /db_xref="InterPro:IPR021346"
                     /db_xref="UniProtKB/TrEMBL:G0WB03"
                     /translation="MPVSKSLSKIKKNMNANGKKPTVHPKGRKFHQLNRATLREGKIA
                     SKKKAHNERKSNELSRVKFIQDVINMDEFKDIRAFSNDQTIIFIEQFISRDDAELDDL
                     KKKRRANRPPTNKQLILQGKRDLEMEEFKKGFLCPDLNDEKNVEFLRKWNHSFGSMST
                     LKLIRINSKGERVAGGNVATITADAKEAAANAAALAKEDVDME"
     gene            <213427..>214347
                     /gene="NDAI0E01080"
                     /locus_tag="NDAI_0E01080"
                     /db_xref="GeneID:11498642"
     mRNA            <213427..>214347
                     /gene="NDAI0E01080"
                     /locus_tag="NDAI_0E01080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670119.1"
                     /db_xref="GeneID:11498642"
     CDS             213427..214347
                     /gene="NDAI0E01080"
                     /locus_tag="NDAI_0E01080"
                     /inference="similar to DNA sequence:INSDC:YOR251C"
                     /note="similar to Saccharomyces cerevisiae YOR251C;
                     ancestral locus Anc_8.691"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670167.1"
                     /db_xref="GeneID:11498642"
                     /db_xref="GOA:G0WB04"
                     /db_xref="InterPro:IPR001307"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:G0WB04"
                     /translation="MATYKLLSPKSFVTLLQTETNSRIIPIDATWYLPNLKRDGHEEF
                     LTQERIPRALYFDIDGIKDRESPYPHMAPSLSTFNKAMSQLGVRRDDILVVYDRIGNF
                     SAPRCAWTLALFGHPTIYLLNNFNVYKKEGYPLDTTTISKDSPYHETNYASDVDLSKQ
                     EIVPYDQMFQLVQNDALAKEYNVFDARALGRFEGKDPEPRPGLPSGHIKGAQPLPFTE
                     VLDSNDKTYPEDEVKMNVKLQDAFRKLNNQFDPKKPTICMCGTGVTGAIIKNALEISG
                     VPNVKLYDGSWTEWALKAGDDSSLIAKNRE"
     gene            <214700..>216085
                     /gene="NDAI0E01090"
                     /locus_tag="NDAI_0E01090"
                     /db_xref="GeneID:11498643"
     mRNA            <214700..>216085
                     /gene="NDAI0E01090"
                     /locus_tag="NDAI_0E01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670120.1"
                     /db_xref="GeneID:11498643"
     CDS             214700..216085
                     /gene="NDAI0E01090"
                     /locus_tag="NDAI_0E01090"
                     /inference="similar to DNA sequence:INSDC:YOR250C"
                     /note="similar to Saccharomyces cerevisiae CLP1 (YOR250C);
                     ancestral locus Anc_8.690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670168.1"
                     /db_xref="GeneID:11498643"
                     /db_xref="GOA:G0WB05"
                     /db_xref="InterPro:IPR010655"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028606"
                     /db_xref="InterPro:IPR029007"
                     /db_xref="UniProtKB/TrEMBL:G0WB05"
                     /translation="MSILPGLTELTPELYLDVNKTHQLTLKESTEWKIDIPTSSKLTI
                     KIRSGIAEIFGTELANDIEYVFTNWKISLLAVEDVILEWKCPDISGNKALIIQQNTTS
                     KFVYNLHFALDKLRTASFNGPRIMIVGDTNSGKTALCRTLCSYAIKNMPYQPLFINLN
                     PNEGIFTPPGCLSATPISDLLEVQAQTWGQSMTSGATVLHNKQPIVKNFGLEEVTKNK
                     PLYLNCIDQLAKDVNERLQNDVIVQRSGCIINTPPLSQFYDNATNQYDSYDGLLKIIQ
                     CLNIGIVVILTNDTDEEQEKEKINKLFDKLKSIIDQNSIIRFPKLSGRFQDADDTYKR
                     SLQRAAIREYFYGTPRTVLSPYAAGADFDEIVIWKSMELNVNMQQDMINPFQLESVPI
                     EANVLQHALVAITYADRKASSEEVSKAPILGFGLITEVNEKRRKIWVLLPVPGRVPNK
                     AIILTSYRYLE"
     gene            <216418..>218382
                     /gene="NDAI0E01100"
                     /locus_tag="NDAI_0E01100"
                     /db_xref="GeneID:11498644"
     mRNA            <216418..>218382
                     /gene="NDAI0E01100"
                     /locus_tag="NDAI_0E01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670121.1"
                     /db_xref="GeneID:11498644"
     CDS             216418..218382
                     /gene="NDAI0E01100"
                     /locus_tag="NDAI_0E01100"
                     /inference="similar to DNA sequence:INSDC:YOR249C"
                     /note="similar to Saccharomyces cerevisiae APC5 (YOR249C);
                     ancestral locus Anc_8.689"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670169.1"
                     /db_xref="GeneID:11498644"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR026000"
                     /db_xref="UniProtKB/TrEMBL:G0WB06"
                     /translation="MGLGLPEQTGFEIVSNVNTYEVAILVLIYIYCYEDDIPFKPDLF
                     FDLISPTIHSPEFNPYLDSDRRLLKEVPIPIFEDVSKCVQKHCGRQAVVELLGYLYAI
                     KDLDTITQLIRTLYNKNIVEKYTDLNKREDKAFKCVTRKSFLGRFMERCYKKFHVADF
                     EENTRLWDDFKTVNESFRCSFLRRRRIDGDFPRRNFRHLNDVNDIMNNNSYDSIISIF
                     DVMENTIDAIKSGCERTICISPEHFQNLINWRIYENYKIENSSRPNVSSSSSRIDDFL
                     NNVSLNDMTKFPSLHILRYLKYVSNLYYKDALDSLHKYFDYMLSQNSNNYFHLSLLCL
                     ATFYSSFHDCEAAMKAFEEATKVARENKDTTTLNLIMIWMVNFIEEYPQYSKRFQVTI
                     DQIVKYMRRNSDNENVTVFENAYRFESLLLIMNNSNVIDILESSFKYMTIVLQHPRAE
                     STLLNMIRYRRNLWNTLGYTNVAKMYQTFLKEQYDETDTLQDMYVNGLEQIHEGNFND
                     FLHISDRLKNPTLTYQESMVLKDLEIKYLVAIQDYHLAMDKLNIRKDECTSLFFDKRW
                     EFEFDIEKCDLLIESTNGIRCLPNLLKLLDSSSVSRNQFQAMECLILLSELLLQLGKK
                     DEAQMLMNSNMVKVLQFPSIKERAFSILNA"
     gene            complement(<218851..>219561)
                     /gene="NDAI0E01110"
                     /locus_tag="NDAI_0E01110"
                     /db_xref="GeneID:11498645"
     mRNA            complement(<218851..>219561)
                     /gene="NDAI0E01110"
                     /locus_tag="NDAI_0E01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670122.1"
                     /db_xref="GeneID:11498645"
     CDS             complement(218851..219561)
                     /gene="NDAI0E01110"
                     /locus_tag="NDAI_0E01110"
                     /inference="similar to DNA sequence:INSDC:YOR247W,YPL163C"
                     /note="similar to Saccharomyces cerevisiae SRL1 (YOR247W)
                     and SVS1 (YPL163C); ancestral locus Anc_8.687"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670170.1"
                     /db_xref="GeneID:11498645"
                     /db_xref="UniProtKB/TrEMBL:G0WB07"
                     /translation="MLFQKSVLFGLLTSAASALYSNQTAQIDAVAQTTTLAPSFSLQP
                     IENTMTYADETTTFFITSTSYKTIWLTSASSTIAPVGATTTTSVGAAVAVAAEQKDAA
                     ASNVVEQTTTFTETETSTTITKTSTVFVTLGGNGASVTATIGSSSPIVTDDSFSPLKN
                     NNKNANDLEALPSSSSSNISAAFNACVPITKYITVSASPEIRYVTVTAQPSSVNSNVP
                     RFNSSNPTFKWSNTTTTI"
     gene            complement(<220866..>222758)
                     /gene="NDAI0E01120"
                     /locus_tag="NDAI_0E01120"
                     /db_xref="GeneID:11498646"
     mRNA            complement(<220866..>222758)
                     /gene="NDAI0E01120"
                     /locus_tag="NDAI_0E01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670123.1"
                     /db_xref="GeneID:11498646"
     CDS             complement(220866..222758)
                     /gene="NDAI0E01120"
                     /locus_tag="NDAI_0E01120"
                     /inference="similar to DNA sequence:INSDC:YPL161C"
                     /note="similar to Saccharomyces cerevisiae BEM4 (YPL161C);
                     ancestral locus Anc_8.685"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670171.1"
                     /db_xref="GeneID:11498646"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0WB08"
                     /translation="MDLETLAFDLQPLFVLEENSEDQISKEFHDKFVVLLDDLAISLR
                     EPNNRKVLYESGLLSKLINRLNSLLTRTFNAQDHNEKLWQLCSELIRCIANAIVDNDT
                     NRALLVQDEYNQFLKEHFSNVLKLSSNAFPGDNALLSELQLRSLILIKNLFIDNFQYC
                     ELFSPYIKTPLLNLLENSANTYLNEDSPILFTTDVLVDVIDVDNNNNNNNNDITLEYM
                     RFLAEFIEKVSKTVINIDISDTNDGTNSENDIEMTDENSIDDTSSEIIFNICQFFEKI
                     VESETDNIDLSNYPKSVTELQTALLDALNILADKEYPNKLIVMRRIVSIIGHISANPT
                     NTNKDQKQLYQEIILSSTKGYTLAASLIGLSNSILSRKDADKILQKITLEKFIQITKH
                     FKDPMQFQGFLHIFKKLLSLSNAMFLQNDDLLQLTTILKIAKDQSTYFKNLSQLLYSL
                     VQKLLTVLPSSTICQLIKEKTKYPFLDVIMNSEDLIICLTLDKILVNSNNGVPNETME
                     LLWSRFFKFEESGISRNNNKGDAVQLPLIYQLTKTLGIYYKNLVTQKQDIDSIIPQYG
                     SNILELLKFIIPLKNQTDNASRGVFNNGRFISGMLLKWFEERSSDMSLSPLEAEIKNV
                     SKSFFT"
     gene            <223174..>224160
                     /gene="NDAI0E01130"
                     /locus_tag="NDAI_0E01130"
                     /db_xref="GeneID:11498647"
     mRNA            <223174..>224160
                     /gene="NDAI0E01130"
                     /locus_tag="NDAI_0E01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670124.1"
                     /db_xref="GeneID:11498647"
     CDS             223174..224160
                     /gene="NDAI0E01130"
                     /locus_tag="NDAI_0E01130"
                     /inference="similar to DNA sequence:INSDC:YOR246C"
                     /note="similar to Saccharomyces cerevisiae YOR246C;
                     ancestral locus Anc_8.684"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670172.1"
                     /db_xref="GeneID:11498647"
                     /db_xref="GOA:G0WB09"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G0WB09"
                     /translation="MTKKMIDLESLPYYDPLTNKKVAVITGGNSGIGWYTVLHLYMHG
                     VIIYICGRNSHKVNRAMKDIQNEAFRRRSLEKHDFKEERSFGAMIYIHMDLTDLKTVE
                     RGCLKIIGLERQIDILINNAAVLALPYELTKDGFEIQLQTNYIAHFLLSLRLLPLLKK
                     GHGRIITLSSVGHLLEFKYWKLDIKWDYKPNMIFTWIRYAVAKTASIQYTKMLSIKHP
                     DVLCLSLHPGLVMNTNLFSYWTRLPLVGIFFWVLFQIIGYFFGVSNEEGSIATVRCAL
                     SADLTVEKDNGKYFTTGGVESTSSRVANNLDNAASTWIWTVRALKERGFDVK"
     gene            <224992..>228276
                     /gene="NDAI0E01140"
                     /locus_tag="NDAI_0E01140"
                     /db_xref="GeneID:11498648"
     mRNA            <224992..>228276
                     /gene="NDAI0E01140"
                     /locus_tag="NDAI_0E01140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670125.1"
                     /db_xref="GeneID:11498648"
     CDS             224992..228276
                     /gene="NDAI0E01140"
                     /locus_tag="NDAI_0E01140"
                     /inference="similar to DNA sequence:INSDC:YPL160W"
                     /note="similar to Saccharomyces cerevisiae CDC60
                     (YPL160W); ancestral locus Anc_8.683"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670173.1"
                     /db_xref="GeneID:11498648"
                     /db_xref="GOA:G0WB10"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR004493"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G0WB10"
                     /translation="MSTSKGLVLENTARRDALISIEKKYQKIWSEEHQFELDAPSLDD
                     APITMTSEELHAKYPKFMSSMAYPYMNGVLHAGHCFTLSKVEFSIGFERMNGKKALFP
                     LGFHCTGMPILACADKLKREAELFGTDYSNVPVEDETEEEETKEDSPKESEDVTKFKA
                     KKSKAQAKKGRGKYQFEIMLQLGIPRDELYKFADAKYWLSYFPPLCESDVRSFGGRVD
                     WRRSMVTTDANPYYDAFVRWQMNRLKQAGKIKFGERYTIYSEKDGQACMDHDRQSGEG
                     VTPQEYIGIKIEATEFAEGAQRIIDSVSTIDKSKKIYFVAATLRPETMYGQTCCFVSP
                     KINYGIFDAGDSYYITTERAFKNMSYQKLTPKRGDYKPVVTIPGKEFIGTKIHASSSI
                     YGELRILPMETVIATKGTGVVTCVPSNSPDDFMTTKDLLHKPEYYGIDPEWVKSDILP
                     IIRTEKYGDITAEAICKEMKIQSPKDINLLAEAKKAAYKEDFYSGTMIYGKYKGEKVE
                     VAKNKVKADLIAAGEAFVYNEPESLVVSRSGDECIVSLEDQWYVDYGEESWKKQAVEC
                     LESMELFAPEVKNAFEGVLDWLKNWAVCRTYGLGTKLPWDPKYLVESLSDSTIYQSFY
                     TISHLLFKDYFGKDIGPLNIKAEQMTDEVFDYIFQHVDDVKSDIPLRSLQTLRREFEY
                     FYPLDVSISGKDLIPNHLTFFIYTHVALFPKKFWPKGIRANGHLMLNNAKMSKSTGNF
                     MTLEQIVEKFGADASRIALADAGDTVEDANFDEANANAAILRLYILKEWAEEIVKNPD
                     GLRTGETHDFFDIAFEHEMNSLIEKTYEQYSLTNYKNALKYGLFDFQAARDYYREASG
                     SMHKDLVERYIEVQALMLAPIAPHFAEYIYREVLGREGSVQTTKFPRASKPIDHGVLS
                     SLEYVRNVQRSIREGEGQALKKKKGKAAEIDQSKPVKLNLLISESFPEWQSGCVEVVR
                     RMFAEHTLDDSKKIRENINPKDMKRAMPFISMLKQRLTTESPESVFDRDLQFDEVATI
                     KLTLKNLQKAAQSLDVQEISVMSFPNGAKVGKDIFTNEEVPLPNATKIVENAVPGAPG
                     VVFQNI"
     gene            complement(<228591..>229301)
                     /gene="NDAI0E01150"
                     /locus_tag="NDAI_0E01150"
                     /db_xref="GeneID:11498649"
     mRNA            complement(<228591..>229301)
                     /gene="NDAI0E01150"
                     /locus_tag="NDAI_0E01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670126.1"
                     /db_xref="GeneID:11498649"
     CDS             complement(228591..229301)
                     /gene="NDAI0E01150"
                     /locus_tag="NDAI_0E01150"
                     /inference="similar to DNA sequence:INSDC:YPL156C"
                     /note="similar to Saccharomyces cerevisiae PRM4 (YPL156C);
                     ancestral locus Anc_8.679"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670174.1"
                     /db_xref="GeneID:11498649"
                     /db_xref="UniProtKB/TrEMBL:G0WB11"
                     /translation="MSTIKSKTSQKSKRNLRVISSALLLLGVTSFLYFTWNDYSEKLS
                     NPSTNASSVISSTQSTLISQNILDESQLRNIQKVNDEILTIKNQIKTTSILSPIPTSS
                     SPIQSFNPEVNFFQILETSPMVLFIKSSERDSKIIRDILTKEYEISPELAVVDLDKHK
                     HGDELEEFIRLNKLNEQAIFSSSLASLPYLFVNEVSMEIDTATIKDLHSKNFLIKKFE
                     LMSNGKVLFERKNPPSNS"
     gene            <231321..>232568
                     /gene="NDAI0E01160"
                     /locus_tag="NDAI_0E01160"
                     /db_xref="GeneID:11498650"
     mRNA            <231321..>232568
                     /gene="NDAI0E01160"
                     /locus_tag="NDAI_0E01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670127.1"
                     /db_xref="GeneID:11498650"
     CDS             231321..232568
                     /gene="NDAI0E01160"
                     /locus_tag="NDAI_0E01160"
                     /inference="similar to DNA sequence:INSDC:YOR245C"
                     /note="similar to Saccharomyces cerevisiae DGA1 (YOR245C);
                     ancestral locus Anc_8.675"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670175.1"
                     /db_xref="GeneID:11498650"
                     /db_xref="GOA:G0WB12"
                     /db_xref="InterPro:IPR007130"
                     /db_xref="UniProtKB/TrEMBL:G0WB12"
                     /translation="MPVSAEEVLYRRNIRSDKDTNSTKNSIRRKNSITIKKPTLDYCT
                     PISTPFQRRLQTFAVAWHTSSFVLGTVFSLFVISKPRLWVFVIPYMIYFFIDRSPANG
                     GVVERYSLWFRSLPFWKAYCDYFPITLDKTCDLPPTFTKKIGNDPAKKETKRLRIKLW
                     PTKYYLNFEKKASAMDNMEATGPRYIFGYHPHGIGALGAFGAIGTEGRDWSQKFPGIP
                     VSLMTLVTQFHIPFYRDYLLALGVTSVSKKNSLKTLNKNQSICIVVGGARESLLSSMG
                     STEIILNKRKGFIKLAIETGNTSLVPVFAFGETNCYNILRTDDDSWLRKFQLWFKENC
                     GFTIPIFYARGIFNYDFGLLPFRTPLNVIVGKPIYVKEKIENPPTEVVDHYHNLYIEE
                     LKRLYYANNEKYGFGDEDLEIVG"
     gene            complement(<232767..>234182)
                     /gene="NDAI0E01170"
                     /locus_tag="NDAI_0E01170"
                     /db_xref="GeneID:11498823"
     mRNA            complement(<232767..>234182)
                     /gene="NDAI0E01170"
                     /locus_tag="NDAI_0E01170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670128.1"
                     /db_xref="GeneID:11498823"
     CDS             complement(232767..234182)
                     /gene="NDAI0E01170"
                     /locus_tag="NDAI_0E01170"
                     /inference="similar to DNA sequence:INSDC:YOR244W"
                     /note="similar to Saccharomyces cerevisiae ESA1 (YOR244W);
                     ancestral locus Anc_8.673"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670176.1"
                     /db_xref="GeneID:11498823"
                     /db_xref="GOA:G0WB13"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR016197"
                     /db_xref="InterPro:IPR025995"
                     /db_xref="UniProtKB/TrEMBL:G0WB13"
                     /translation="MVAEEISDSGIPRKIENVQEIMTKCQCWVKKDDDERLAEILSIN
                     TRRSPPKFYVHYVNYNKRLDEWIDVDRINLDKEVIFPRPPDLSEDAINKQKKKKKKSP
                     TTSLSSSVEPGASRGVTPDNTDVMDLDNLNVQGVKHEDISQEDEIKKLRTSGSMTQNP
                     HEVARVRNLNKIIMGEHEIEPWYFSPYPIELTDEDVVYIDDFSLQYFGSRKQYERYRK
                     KCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFY
                     CMTRRDELGHHFVGYFSKEKESADGYNVACILTLPQYQRMGYGRLLIEFSYELSKKEH
                     KVGSPEKPLSDLGLLSYRAYWADTLLVLLVEHGQEITIEEISSITSMTTTDILHTAKT
                     LNILRYYKAQHILYLSKDIADRYNELQRKKEEELIQRSWFGSHQSLLLPNYVLHGELF
                     YCNIVFTSALYGRLLILDNRP"
     gene            <234483..>236504
                     /gene="NDAI0E01180"
                     /locus_tag="NDAI_0E01180"
                     /db_xref="GeneID:11498824"
     mRNA            <234483..>236504
                     /gene="NDAI0E01180"
                     /locus_tag="NDAI_0E01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670129.1"
                     /db_xref="GeneID:11498824"
     CDS             234483..236504
                     /gene="NDAI0E01180"
                     /locus_tag="NDAI_0E01180"
                     /inference="similar to DNA sequence:INSDC:YOR243C"
                     /note="similar to Saccharomyces cerevisiae PUS7 (YOR243C);
                     ancestral locus Anc_8.671"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670177.1"
                     /db_xref="GeneID:11498824"
                     /db_xref="GOA:G0WB14"
                     /db_xref="InterPro:IPR001656"
                     /db_xref="InterPro:IPR011760"
                     /db_xref="InterPro:IPR017091"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="InterPro:IPR020119"
                     /db_xref="UniProtKB/TrEMBL:G0WB14"
                     /translation="MSEPTNSAKRTLENEAIVVEESAKKLKTEPLMVGGLREADVGIT
                     LFLSSGLPGFSGQIKQRYTDFLVNEINKADEVVHLTDKGFKMPKKPQPSREEVRAQRE
                     EEASRRQDFKVEPELRVQLVEIFGEDDVVKIEDVYRNAQTMETTKSFEEKSVRTKIHQ
                     LLRAAFNNELESVTSADNTFKIARSNNKSRVSKQVLVDQSKDANGVENWGYGPTKEFL
                     HFTLHKENKDTMEAVNTITKLMRIPNKLIRFAGNKDRRAVTCQRLSVSKIGVDRLNAL
                     NRTLKGLVIGGYKFEDTSLSLGDLNGNEFVIVIRDVSVSETSALSLEQILANGCQSLS
                     EKGFINYFGMQRFGTFSISTHEIGKELLLSNWENAVNLILSDQDNVLPKSKEARQIWA
                     ETKDPVLALQKMPRQSLAENSILHSLSTQKKEEDGTFSSFAYYTAIMKIPRNLRTMYV
                     HAYQSFVWNAIASKRIELHGVELVEGDLVIDTENTKSPSAQDEEDDFDEDLREDEFIR
                     AKPVTQADIDSGKFSITDVVLPTPGFDIIYPTNEELRKLYTEIMAKDNMDPFDMRRKV
                     REFSMAGSYRKIIEKPEQLDYRIVHYSSPTQQLVNTDLEILNNQVAKDNCQKYMKDKL
                     ERYIPDKGGDKTAVILKFQLGTSAYATMALRELMKLETSRRGDMCDIRN"
     gene            <237093..>238169
                     /gene="NDAI0E01190"
                     /locus_tag="NDAI_0E01190"
                     /db_xref="GeneID:11498825"
     mRNA            <237093..>238169
                     /gene="NDAI0E01190"
                     /locus_tag="NDAI_0E01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670130.1"
                     /db_xref="GeneID:11498825"
     CDS             237093..238169
                     /gene="NDAI0E01190"
                     /locus_tag="NDAI_0E01190"
                     /inference="similar to DNA sequence:INSDC:YOR242C"
                     /note="similar to Saccharomyces cerevisiae SSP2 (YOR242C);
                     ancestral locus Anc_8.670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670178.1"
                     /db_xref="GeneID:11498825"
                     /db_xref="UniProtKB/TrEMBL:G0WB15"
                     /translation="MHTNSNNKNIKSYGPTISSKSRSIEGLPKGKIWTTNPSKVRTPK
                     TISYLFPEHSPINRRRELFGFRRFTRTYILSSSKERKTGKKSGSSDISIIQCSSKSTN
                     YYNCLTGLPLSKRIKTDPKSKEILCHISLKAEPKIQAYTADDSKYIEESHFANVTDKQ
                     RRMIIIRNIPKETGIHSIVAQISGGPIENFNFYQQHKLSSPSNVLKIAFIASEGAQQF
                     MKYGNTNLFKVNGIHLKPEWFVDSNLCIPSKTVPSKTLLNYNGKCRCLFMKQLPLKDH
                     LVLNSLYLKRIRSDFECFGEIVDISPLISRRPCLYIQFYDIYSAVRVLEAYEDRHSRI
                     HQQYFEKWSIYYGKDLTDTACYQL"
     gene            complement(<238271..>239743)
                     /gene="NDAI0E01200"
                     /locus_tag="NDAI_0E01200"
                     /db_xref="GeneID:11498826"
     mRNA            complement(<238271..>239743)
                     /gene="NDAI0E01200"
                     /locus_tag="NDAI_0E01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670131.1"
                     /db_xref="GeneID:11498826"
     CDS             complement(238271..239743)
                     /gene="NDAI0E01200"
                     /locus_tag="NDAI_0E01200"
                     /inference="similar to DNA sequence:INSDC:YOR241W"
                     /note="similar to Saccharomyces cerevisiae MET7 (YOR241W);
                     ancestral locus Anc_8.669"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670179.1"
                     /db_xref="GeneID:11498826"
                     /db_xref="GOA:G0WB16"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="InterPro:IPR018109"
                     /db_xref="InterPro:IPR023600"
                     /db_xref="UniProtKB/TrEMBL:G0WB16"
                     /translation="MRVTLPLKMTTRTYRDAINSLNSLQSNYANIMAIRESGDRRNQM
                     NIWEMQEWSKRIGYNVSDFNKLNVIHITGTKGKGSTAAFTSSILRQYNDKLPKIGLYT
                     SPHLKTVRERIRINGEPISEDKFTKYFFEVWNKLGNTKSNLEKFPHMVDGSKPGYFKY
                     LTLLSFHAFMQEGCDACVYEVGVGGEFDSTNIIEKPLVCGVTLLGIDHTFMLGETIAE
                     IAWNKGGIFKEGSPAYTVMGQPEAGLRVLEERATERSTKLTQVPTFKALKNVKLGIAG
                     EFQRGNASLAVVLAAKALEKLNVIDKTIAVEEDAHIPSEALKGLELTRWEGRCQTIER
                     NGSNWYIDGAHTKDSIIAASGWFKNIVKSSFNKKILLFNQQSRDANALINYLHNVVSP
                     EVKFDHVIFTTNVTWKSGTYSPDLVSMNTSKDDVEKLKIQEALRKEWNRIDKHRPEVH
                     VTPTIEEAVSLIESLRQDSLDIFVTGSLHLVGGLLVVFDK"
     gene            complement(<240179..>241424)
                     /gene="NDAI0E01210"
                     /locus_tag="NDAI_0E01210"
                     /db_xref="GeneID:11498827"
     mRNA            complement(join(<240179..241252,241254..>241424))
                     /gene="NDAI0E01210"
                     /locus_tag="NDAI_0E01210"
                     /product="hypothetical protein"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_003670132.1"
                     /db_xref="GeneID:11498827"
     CDS             complement(join(240179..241252,241254..241424))
                     /gene="NDAI0E01210"
                     /locus_tag="NDAI_0E01210"
                     /inference="similar to DNA sequence:INSDC:YOR239W"
                     /artificial_location="low-quality sequence region"
                     /note="similar to Saccharomyces cerevisiae ABP140
                     (YOR239W); ancestral locus Anc_8.665"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670180.1"
                     /db_xref="GeneID:11498827"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="InterPro:IPR026113"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0WB17"
                     /translation="MAVADLIKKFENITEDSKNINSSIEMPEPQHKLPVDIDNSNIVD
                     DVKALEAVDPVTLGISNSHNKEELEALTQDVKEETLETLAHNAIPEPVKGINNSEQAG
                     NDNETSGDSRSNSRLGRDSPFEFGQRNLAEGADVWDHNAWDNVEWGEEQIQEAQEKIK
                     EQMKNPVPDFDKNLYNSNPARYWDIFYKNNKENFFKDRKWLQIEFPILYASTRKDSGP
                     VTIFEIGCGAGNTFFPILNDNENEDLKIVAADFAPKAVELVKNSENFDSKYGHATVWD
                     LANTEGTLPDGIEPRSVDIAVMIFVFSALSPAQWEQAMDNLHMIMKPGGKILLRDYGH
                     LDLAQVRFKKNRLLDENFYVRGDGTRVYFFSEDKLREVFTKKYFVENKIGTDRRLLVN
                     RKRQLKMYRCWVQAVFDVPAEN"
     gene            complement(<241842..>242651)
                     /gene="NDAI0E01220"
                     /locus_tag="NDAI_0E01220"
                     /db_xref="GeneID:11498828"
     mRNA            complement(<241842..>242651)
                     /gene="NDAI0E01220"
                     /locus_tag="NDAI_0E01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670133.1"
                     /db_xref="GeneID:11498828"
     CDS             complement(241842..242651)
                     /gene="NDAI0E01220"
                     /locus_tag="NDAI_0E01220"
                     /note="ancestral locus Anc_8.663"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670181.1"
                     /db_xref="GeneID:11498828"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G0WB18"
                     /translation="MLAFIINCYFHMYNNNTDLYYICRHPRALFLILLILIMTVENKY
                     STTLLHDGPAFSKPTVDKIEPLQFTLKNADIKATAFPIFKQSQLPKKLLTLMKNEFNK
                     EIENGDTYPQLEQLSDDEFAHYWLHSFCVVALKTDKLDLDELDVDGQDWEDLFLGTFY
                     IKPNYMPRCSHNCNAGFLINSEKRGLKIGYRLGQIYLQWAPLLGYTYSVFNLVFVTNV
                     GSWKIWDRLKFDRIGLVPKAAILKGHDEPVDAIIYGKDLTNIEPELLEDFA"
     gene            complement(<243135..>243998)
                     /gene="NDAI0E01230"
                     /locus_tag="NDAI_0E01230"
                     /db_xref="GeneID:11498829"
     mRNA            complement(<243135..>243998)
                     /gene="NDAI0E01230"
                     /locus_tag="NDAI_0E01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670134.1"
                     /db_xref="GeneID:11498829"
     CDS             complement(243135..243998)
                     /gene="NDAI0E01230"
                     /locus_tag="NDAI_0E01230"
                     /note="ancestral locus Anc_8.662"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670182.1"
                     /db_xref="GeneID:11498829"
                     /db_xref="InterPro:IPR013744"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0WB19"
                     /translation="MAFKGTLHQYDSTHVAFEFTPTDMKNVLIMIGGMTDGLATVPYV
                     TKLPQVMEPLGYSVINIQMSSSFKGFGISSLDKDIKEIKELVKYLKSEKGGSREKIII
                     MGHSTGAQDVMHFLLHYPDLVDAGILQGSCSDRESFDPSVDPKILKELNQFALNMVKQ
                     GKGDELLGSQFSKHIIDTPITAYRWCSLFTRGGDDDYFSSDLDDETFKGTFGKIRKPF
                     LVAYSGKDQFVPESVDKLALLKRWENVSDPKYWSKNTGIVEGASHFVEDHEPQLQLFQ
                     MITSFAKEFSL"
     gene            <244737..>247430
                     /gene="NDAI0E01240"
                     /locus_tag="NDAI_0E01240"
                     /db_xref="GeneID:11498830"
     mRNA            <244737..>247430
                     /gene="NDAI0E01240"
                     /locus_tag="NDAI_0E01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670135.1"
                     /db_xref="GeneID:11498830"
     CDS             244737..247430
                     /gene="NDAI0E01240"
                     /locus_tag="NDAI_0E01240"
                     /inference="similar to DNA sequence:INSDC:YPL147W"
                     /note="similar to Saccharomyces cerevisiae PXA1 (YPL147W);
                     ancestral locus Anc_8.661"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670183.1"
                     /db_xref="GeneID:11498830"
                     /db_xref="GOA:G0WB20"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010509"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WB20"
                     /translation="MPGRKQPLPSSDAINVREKIQQLIFSLHSHCIGLQLSNVTLKTY
                     INALIRHLWKLVSSKNTVTTPRKRRAQVLLLSIVLSSITTISGFSYLGYQLINKLRNT
                     VDSARNKNRYGIRRTKSQVLLGSGGRVMYIPEDDSLDVNNYNKEFDYHQEHKIKKIHI
                     PPKDDDMYDHDKFLFKNVEQEVGKNSQIFYSKFLNQMNVLSRILIPNIFHKNSMILTL
                     QIFFLIMRTWLSLFVARLDGQIVKDIIAGRGRRFLLDLAIWFSIALPASYTNSAIKLL
                     QRKLSLNFRVNLTRYIHDMYLDKRLAFYKLMFDSKANSSVIKNIDNSISNDITRFSDA
                     TCSVFANIAKPIIDLVFFSVYLRDNLGTLGVAGIFLNYFTTGYILRRYTPPLGKLTSA
                     SSAADGDYYSYHLNLINNNEEIAFYQGTTVERTKVKELYDILMIRMLNVSKRKFNYNM
                     LEDYILKYTWSGLGYVFASIPIVLTTLSTGINAEQRNMRDFIVNKRLMLSLADAGSRL
                     MHSIKDISQLTGYTNRIFSLICALHRVHSTKFNYGAISVLKKDMLEAAAASVTATDTN
                     TAGQLIGTGDRLAITRYQNKLQQDEIIRGTVQRNFNGIRLENIDVIIPSKAAKDGIKL
                     IKKLTFQIPPHIDPMTSKTDSTQDFKQINDMSSIPFIHGSGSSLLILGPNSSGKTSIQ
                     RIIAEIWPIYNKNGLLSVPSQENIFCIPQRPYFTSSGTLRDQIIYPMSSDEFFDRGLK
                     DSLLIQILKEVNLKYLMKRSKGLTYLDTVADWKDLLSGGEKQRINFARILFHKPRFIV
                     LDEATNAISQDMEDYLFNILKKYRFNFITISQRPSLIKYHDLLLEISDHNDGTWQIQT
                     LGTDEAITSIDHEIESLEKKLKNVNHWETERRELQKSLSVI"
     gene            complement(<247639..>248946)
                     /gene="NDAI0E01250"
                     /locus_tag="NDAI_0E01250"
                     /db_xref="GeneID:11498831"
     mRNA            complement(<247639..>248946)
                     /gene="NDAI0E01250"
                     /locus_tag="NDAI_0E01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670136.1"
                     /db_xref="GeneID:11498831"
     CDS             complement(247639..248946)
                     /gene="NDAI0E01250"
                     /locus_tag="NDAI_0E01250"
                     /inference="similar to DNA sequence:INSDC:YOR237W,YPL145C"
                     /note="similar to Saccharomyces cerevisiae HES1 (YOR237W)
                     and KES1 (YPL145C); ancestral locus Anc_8.658"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670184.1"
                     /db_xref="GeneID:11498831"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR018494"
                     /db_xref="UniProtKB/TrEMBL:G0WB21"
                     /translation="MSSYAGSSSWKSFLKSVATFRGDISTLTAPPFILSPVSLSEFSQ
                     YWGEYPELFLEPGFINDENYKSHSCGDKDIESAEVARMLAVTKWFIFALKSQYTSRNE
                     SMGSEKKPLNPFLGELFVGKWKMDEKPELGETVLLSEQVSHHPPKTAFTVFNDKNNVK
                     LEGYSQIKATFSKTLTLGVRQYGHSIFSIRDNESYLITPPPLHVEGILMASPFAELEG
                     KSFIQASTGMLAVLEFSGRGYFSGKKNSFKARIYRSSKDYHNNKEPMYTISGQWSGVS
                     KMIKHGAQEPSESLFHDATKIKPTYLHVKPIEEQHPLESRKAWKDVAKAITIGDYKLI
                     GETKSVLEERQRNMRKEEEAKGIDWERRWFKDVDYSKDSKNGKMKPEEGDKFLELAAL
                     LQLSTKNVPSGTLKATKEDIPTADAIHWRFQRNLWDEEKEVVL"
     gene            complement(<249563..>250198)
                     /gene="NDAI0E01260"
                     /locus_tag="NDAI_0E01260"
                     /db_xref="GeneID:11498832"
     mRNA            complement(<249563..>250198)
                     /gene="NDAI0E01260"
                     /locus_tag="NDAI_0E01260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670137.1"
                     /db_xref="GeneID:11498832"
     CDS             complement(249563..250198)
                     /gene="NDAI0E01260"
                     /locus_tag="NDAI_0E01260"
                     /inference="similar to DNA sequence:INSDC:YOR236W"
                     /note="similar to Saccharomyces cerevisiae DFR1 (YOR236W);
                     ancestral locus Anc_8.657"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670185.1"
                     /db_xref="GeneID:11498832"
                     /db_xref="GOA:G0WB22"
                     /db_xref="InterPro:IPR001796"
                     /db_xref="InterPro:IPR012259"
                     /db_xref="InterPro:IPR017925"
                     /db_xref="InterPro:IPR024072"
                     /db_xref="UniProtKB/TrEMBL:G0WB22"
                     /translation="MQSSKIPVVSIVACLLPEMGIGFQGSLPWRLSKEMKYFRQVTSL
                     TKDSQKKNAVIMGRKTWQSIPARFRPLPNRLNVVISRSFESTLREENDLPNKYFKVNS
                     LKGAFEQLHAQFGAELERIYIIGGGEVYNQCYDMIDHWLITALTPVETVVPEMDTFLD
                     KDRLNSLYQECNGDLASFVPPGTELPHVNEDGHFIDHEKGYEFEYTLYNRK"
     gene            <250498..>251010
                     /gene="NDAI0E01270"
                     /locus_tag="NDAI_0E01270"
                     /db_xref="GeneID:11498833"
     mRNA            <250498..>251010
                     /gene="NDAI0E01270"
                     /locus_tag="NDAI_0E01270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670138.1"
                     /db_xref="GeneID:11498833"
     CDS             250498..251010
                     /gene="NDAI0E01270"
                     /locus_tag="NDAI_0E01270"
                     /inference="similar to DNA sequence:INSDC:YPL144W"
                     /note="similar to Saccharomyces cerevisiae YPL144W;
                     ancestral locus Anc_8.656"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670186.1"
                     /db_xref="GeneID:11498833"
                     /db_xref="InterPro:IPR018854"
                     /db_xref="UniProtKB/TrEMBL:G0WB23"
                     /translation="MSTRTIHKQIVSDSSSFISLPAIELITTIPTSQESNKIPISLIV
                     SLGGDNFIDGNVSTLLENEGNIKRIDTQLGTLVSYYYALPRRTSRNKSDTSIQRDPEV
                     IGMPLLDTSYDTVADITRQLAILIVKKYHRPCYVAWSLKNGSDLSSLELNQLFIVKKC
                     MEILVPLLKE"
     gene            <252532..>253343
                     /gene="NDAI0E01280"
                     /locus_tag="NDAI_0E01280"
                     /db_xref="GeneID:11498834"
     mRNA            join(<252532..252550,253039..>253343)
                     /gene="NDAI0E01280"
                     /locus_tag="NDAI_0E01280"
                     /product="ribosomal protein L33"
                     /transcript_id="XM_003670139.1"
                     /db_xref="GeneID:11498834"
     CDS             join(252532..252550,253039..253343)
                     /gene="NDAI0E01280"
                     /locus_tag="NDAI_0E01280"
                     /inference="similar to DNA sequence:INSDC:YOR234C,YPL143W"
                     /note="similar to Saccharomyces cerevisiae RPL33B
                     (YOR234C) and RPL33A (YPL143W); ancestral locus Anc_8.655"
                     /codon_start=1
                     /product="ribosomal protein L33"
                     /protein_id="XP_003670187.1"
                     /db_xref="GeneID:11498834"
                     /db_xref="GOA:G0WB24"
                     /db_xref="InterPro:IPR001780"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR018266"
                     /db_xref="UniProtKB/TrEMBL:G0WB24"
                     /translation="MAESHRLYVKGKHVSYQRSKSVNNPNVSLIKIEGVATPQEAQFY
                     LGKRVAYVYRASKEVRGTKIRVMWGKITRSHGNSGVVRAKFRNNLPAKTFGASVRIFL
                     YPSNI"
     gene            complement(<255593..>257782)
                     /gene="NDAI0E01290"
                     /locus_tag="NDAI_0E01290"
                     /db_xref="GeneID:11498835"
     mRNA            complement(<255593..>257782)
                     /gene="NDAI0E01290"
                     /locus_tag="NDAI_0E01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670140.1"
                     /db_xref="GeneID:11498835"
     CDS             complement(255593..257782)
                     /gene="NDAI0E01290"
                     /locus_tag="NDAI_0E01290"
                     /inference="similar to DNA sequence:INSDC:YOR233W,YPL141C"
                     /note="similar to Saccharomyces cerevisiae KIN4 (YOR233W)
                     and YPL141C; ancestral locus Anc_8.654"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670188.1"
                     /db_xref="GeneID:11498835"
                     /db_xref="GOA:G0WB25"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0WB25"
                     /translation="MTSKLSPIRKSHIRNDTSNAKPRTEKRSSSRPLSRGKKEKLRFG
                     NYILGATLGEGEFGKVKLGWSTASPTASLDSNSKQIAIKLIRRDYVKKGSDKEIKIYR
                     EINALKLLTHPNIVRLEEVLQNSKYIGIVLEFASGGEFYKYLQRKRRLKEPHACQLFA
                     QLISGVTYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFFGSNELMKRSCGSPC
                     YAAPELVLSTEPYRARKVDIWSCGIILYAMLAGYLPWDDDSQNPNGDDIGKLYQYITK
                     TALKFPAYISPLARDLIRKILTANPSRRISISYICKHDWLKPHASFLAVEPREWDRMV
                     KKKSNASRDTSSSEMKSSSLRLHSKSYRHNTIILEPTMEHSPSPPLETQSYVLKNIRA
                     SDFGNTSSSMNHESTSPATKALHNVIPSSTDSLNYLTATRKRNTSVHIPENADIHPYI
                     NTDVKHSTPTISHTPVENVTVQDVNPSIDPIFHKRQQRPVTFMTSHNAYLSNGITSPV
                     SNISEVTNPKPKEAVSVSCNDTTEISSHRSAINSRILEDGEKENLVSEKQISIPEVTL
                     NSVKDVEKRNNSNIEKEKLVVLLRNRKISTQLSDGDPKRESTSKRFSFFSLISKNTTS
                     DSTGNTRNPSYRSASRQTNATEVSSQPLKGNPRRISHKSSMSNLANFNSQNTTSLRAS
                     KFRNNRASVMVSSLENPNPRVPIEKADTETSLSSKVINFFKRRSMRI"
     gene            complement(<259347..>260039)
                     /gene="NDAI0E01300"
                     /locus_tag="NDAI_0E01300"
                     /db_xref="GeneID:11498836"
     mRNA            complement(<259347..>260039)
                     /gene="NDAI0E01300"
                     /locus_tag="NDAI_0E01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670141.1"
                     /db_xref="GeneID:11498836"
     CDS             complement(259347..260039)
                     /gene="NDAI0E01300"
                     /locus_tag="NDAI_0E01300"
                     /inference="similar to DNA sequence:INSDC:YOR232W"
                     /note="similar to Saccharomyces cerevisiae MGE1 (YOR232W);
                     ancestral locus Anc_8.653"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670189.1"
                     /db_xref="GeneID:11498836"
                     /db_xref="GOA:G0WB26"
                     /db_xref="InterPro:IPR000740"
                     /db_xref="InterPro:IPR009012"
                     /db_xref="InterPro:IPR013805"
                     /db_xref="UniProtKB/TrEMBL:G0WB26"
                     /translation="MSALFPSMSRVAPRRLATQVAFRPTVYRTVNPRTVPLMMRLYSD
                     KAQEKSEKTEENANENLTEEQKKIKSLQEELSAKTKEAAELKDSLLRSVADFRNLQNI
                     TKKDIQKAKDFALQKFAKDLLESVDNFGHALSAFKEEDLEKSKEIADLYTGVRMTRDV
                     FEKTLKKHGLEKLDPMGETFDPNKHEATFEVAQPDKEPGTVFHVQQVGFTLNDRVIRP
                     AKVGIVKSTDDN"
     gene            complement(<260484..>262094)
                     /gene="NDAI0E01310"
                     /locus_tag="NDAI_0E01310"
                     /db_xref="GeneID:11498837"
     mRNA            complement(<260484..>262094)
                     /gene="NDAI0E01310"
                     /locus_tag="NDAI_0E01310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670142.1"
                     /db_xref="GeneID:11498837"
     CDS             complement(260484..262094)
                     /gene="NDAI0E01310"
                     /locus_tag="NDAI_0E01310"
                     /inference="similar to DNA sequence:INSDC:YOR231W,YPL140C"
                     /note="similar to Saccharomyces cerevisiae MKK1 (YOR231W)
                     and MKK2 (YPL140C); ancestral locus Anc_8.652"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670190.1"
                     /db_xref="GeneID:11498837"
                     /db_xref="GOA:G0WB27"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0WB27"
                     /translation="MASLFKPPETTRRNPKSPKLTLPPLLNHNNTTNSSSNSTNTLQL
                     SLNMNETPKSSLLPIYSSASSISLSPSIDGPKSSTSISSNKRRPIPPPLPPSVQRVIT
                     PTTNANKTPLYRPPPEMTPTDISHALKELQITGQNSRTSPPLSAQSDHENNTLEKNKP
                     LYQREDLNESVDSYYSTILSVYEQSNSNAASPIKSPTKHIPTITTTSIDTNLQQTITD
                     TTTDELLMNKDVDQLDEEIWNCPNMKDQIITLGVLGEGAGGSVEKCKLKHGSKIFALK
                     IVNTLNTDPEFQKQIFRELQFNKSFKSDYIVRYYGMFNDVNSSSIYIAMEYMSGKSLD
                     AVYKNLLNRGGRIGEKVLGKIAESVLRGLSYLHEQKVIHRDIKPQNILFNEMGQVKLC
                     DFGVSGEAVNSLATTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTILEVAQGRFPFGS
                     DKITANIAPIELLVLILTFSPQLKDEPESNISWSKAFKSFIHYCLKKEPHERPSPRQM
                     IQHPWIQGQMKKKVNMAHFIEKCWEETA"
     gene            complement(<262712..>263995)
                     /gene="NDAI0E01320"
                     /locus_tag="NDAI_0E01320"
                     /db_xref="GeneID:11498838"
     mRNA            complement(<262712..>263995)
                     /gene="NDAI0E01320"
                     /locus_tag="NDAI_0E01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670143.1"
                     /db_xref="GeneID:11498838"
     CDS             complement(262712..263995)
                     /gene="NDAI0E01320"
                     /locus_tag="NDAI_0E01320"
                     /inference="similar to DNA sequence:INSDC:YOR230W"
                     /note="similar to Saccharomyces cerevisiae WTM1 (YOR230W)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670191.1"
                     /db_xref="GeneID:11498838"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0WB28"
                     /translation="MTKTYKQSAYEHISSFKPKFVQRVDNILHHSKSLAFSTNVTPDT
                     DKGTLTTSVIYSQGSDIYEMQCSLPIAGDNDKKPKPGSEYGDAFAKVEKTALSPKWVY
                     SGETVAKMSYLDGNETTLLAMSKNGSLAWFQDGVKVPVHIVQEMMGPATSYAAMHSHV
                     RPDSLAVSDFSLSLDNETIVKSQSNGSEEDSILKIVDNAGKPSEILRTIHVPGTTVTH
                     TVRFFDNHMFASCSDDNVLRFWDTRTNDKPLWILSDPQNGRMTSFDASTVSSDLFVAG
                     FSTGVLKLWDARAVESATQDFTNRQNGEEPIQKEIANFYHSGGDSVVDVQFSPTSPSE
                     ILTVGGSGNVYHWDMEYALSNYDPEDTNRVPQDASEELQTESLRFVHRGGSRRNPQQH
                     GKRNTVAWHPVIDDFVGTVDEDSLVTVYKPFTISS"
     gene            complement(<266071..>267363)
                     /gene="NDAI0E01330"
                     /locus_tag="NDAI_0E01330"
                     /db_xref="GeneID:11498839"
     mRNA            complement(<266071..>267363)
                     /gene="NDAI0E01330"
                     /locus_tag="NDAI_0E01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670144.1"
                     /db_xref="GeneID:11498839"
     CDS             complement(266071..267363)
                     /gene="NDAI0E01330"
                     /locus_tag="NDAI_0E01330"
                     /inference="similar to DNA sequence:INSDC:YOR229W,YPL139C"
                     /note="similar to Saccharomyces cerevisiae WTM2 (YOR229W)
                     and UME1 (YPL139C); ancestral locus Anc_8.651"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670192.1"
                     /db_xref="GeneID:11498839"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0WB29"
                     /translation="MKPKFVSRVDDVLHFTKTMTFRSEIIPDKSKGTLSTSLLYSQGS
                     DIYEIDCALPLASFYQTISGGSRKDSSLAIPSPEYGDAFHDVEDTKLAPKWVYLGETI
                     AKMSYLESSMDDTTIIAMSKNGSLAWFKDGCKVPIHIVQEMMGPATRFSSIHSHVRPN
                     SLAVSDFCLSCNLETVVKSQSSGTEEDSILKIIDNSGRPGDVLRTIHVPGTTVTHSVR
                     FFDNHLFASCSDDNVLRFWDTRTAEKPMWILSDPQNGRMTSFDTSQVTNELFVTGFST
                     GIIKLWDVRAVETASNDLTHRQNGEEPIQNELINLYHSGGDSVVDIQFSPTSSSDFLT
                     VGGTGNVYHWDMEYFFSRNDDDNEDVTNVAPEELQGQCLKFFHTGGSKRTSGLFGKRN
                     TVAWHPIIDNLVGTVDADSLVTVYKPFTGRDLIQGEEK"
     gene            <268205..>269386
                     /gene="NDAI0E01340"
                     /locus_tag="NDAI_0E01340"
                     /db_xref="GeneID:11498840"
     mRNA            <268205..>269386
                     /gene="NDAI0E01340"
                     /locus_tag="NDAI_0E01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670145.1"
                     /db_xref="GeneID:11498840"
     CDS             268205..269386
                     /gene="NDAI0E01340"
                     /locus_tag="NDAI_0E01340"
                     /inference="similar to DNA sequence:INSDC:YGR046W"
                     /note="similar to Saccharomyces cerevisiae TAM41
                     (YGR046W); ancestral locus Anc_1.86"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670193.1"
                     /db_xref="GeneID:11498840"
                     /db_xref="InterPro:IPR015222"
                     /db_xref="UniProtKB/TrEMBL:G0WB30"
                     /translation="MFASQLRPCTSSIAISRKLARRLQSTIAKDNVHASTKHSQMDTI
                     IHDIVPTRDSTHQNPSEDILDSTVNNNSTGIPLLEKGIQKTDEITSKFQDYMYKFNKL
                     PANYAANQILELEDQELQFELESILNQFNAPIKYAFGYGSGVFEQTGYNIKEKPQIDM
                     IFGVTHPSHFHSLNMRQNPDHYSTLKYFGSEFIAKFQDIGAGIYFNPFVKINGHEVKY
                     GIVSMKMLLKDLATWNTFYLAGRLQKPVKILKNDLRVQYWNQLNLKAAATIAKHLTLQ
                     KNNGKFDEFEFYKEITGISYLGDIRYVLGAENPNKVQNIVDKNFTRFQSYYEPIYKDV
                     VINNSSYLPVGFTINNTTRKLRGRISRSSILQTLKGILTAGPAKSLRYAWAKKMKTFR
                     K"
     gene            <269952..>270899
                     /gene="NDAI0E01350"
                     /locus_tag="NDAI_0E01350"
                     /db_xref="GeneID:11498841"
     mRNA            <269952..>270899
                     /gene="NDAI0E01350"
                     /locus_tag="NDAI_0E01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670146.1"
                     /db_xref="GeneID:11498841"
     CDS             269952..270899
                     /gene="NDAI0E01350"
                     /locus_tag="NDAI_0E01350"
                     /inference="similar to DNA sequence:INSDC:YOR228C"
                     /note="similar to Saccharomyces cerevisiae YOR228C;
                     ancestral locus Anc_8.649"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670194.1"
                     /db_xref="GeneID:11498841"
                     /db_xref="InterPro:IPR012472"
                     /db_xref="UniProtKB/TrEMBL:G0WB31"
                     /translation="MVEPNFTVLPPEPVSQEELSSDELSDAASPVPKGIRKYIGILSL
                     NLQPSSIIGLKRIQKYSTWPMLLYFPLHSVNTLILPLIEPKSLPDKFLNTISEKIPSR
                     ILTSILLGSISIHLTSGIILRVSHWLYHKRQEKDDDIHSGRIARAKASGFRPFLQTED
                     TSQQAIGLSGGVLGYIIGFKKRFNHAPIVVSGYLLLPFLIYHLLILKYLPGTQIENNE
                     KFQFIRWILQNTDKSIRWIGGIVPLAILVGSGTYHIGSGMVQYAGVKDLQRRRKMATA
                     ITLLISSGIIALARLARADRVLFINKHRFLDVFKSISFR"
     gene            complement(<271039..>274872)
                     /gene="NDAI0E01360"
                     /locus_tag="NDAI_0E01360"
                     /db_xref="GeneID:11498842"
     mRNA            complement(<271039..>274872)
                     /gene="NDAI0E01360"
                     /locus_tag="NDAI_0E01360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670147.1"
                     /db_xref="GeneID:11498842"
     CDS             complement(271039..274872)
                     /gene="NDAI0E01360"
                     /locus_tag="NDAI_0E01360"
                     /inference="similar to DNA sequence:INSDC:YOR227W,YPL137C"
                     /note="similar to Saccharomyces cerevisiae YOR227W and
                     GIP3 (YPL137C); ancestral locus Anc_8.648"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670195.1"
                     /db_xref="GeneID:11498842"
                     /db_xref="UniProtKB/TrEMBL:G0WB32"
                     /translation="MSLSPKDRLPSTPTKDKISKHTKIAKSDIPADIDVPLDWLYKGK
                     RKTKAKTQQLSSPKVSRTNTNRSSSNSNINKPTNNENSRSLSNSSNKLSRTQSITNGM
                     IAKPNLNVTTNSINSSNDTGKDTSMLDKNASPFGTARRQRSSSIAVSSIPIRTPNKQP
                     NSNKASSPQSSLLSPSSSSNQRNSTPSSTLSSPLKRSVSLSEKPPKKSLLGSIFGRKH
                     SQSKSNKMNSLEPSSPQSPNRNNRSHSSSSADTNNNNNTINELQPVTMDKFNEQIMLN
                     DLKEMSLKRVRFAVDKFNDDPPQQLPSRKPKLGNILIPEDMVAEIPSISVGITISDNS
                     NSGGKPPLSANKSSVYTKDSKEYKLAVANFLKTQKEAMKHQQEAHRLAEELAHEVNHY
                     RPRSSSLSAVSKVAAKTLTGQLLKEPNKNNNNNNYNNNYVDECKEDVDTNVDIKASSL
                     SIDKPIHLNEHPFDSKEESKTQDSSQKENTKTQSSEITLDLVYTRCCHLREILPIPST
                     LRQVKGKTAPLQTLKFLNPRPTLIDILSFCDFISIIPIHNIIFDNVLLTSDMLRIILS
                     SLVDSITLEKLGLRNVIIDEEDWKFFCKFLLDNKSVTKLDISQTKLRSDMDESLSREN
                     MDWPLFCQVLRVRKGEPLEELLLNGVKFNRVPLGQFYDILHVFGKMNRSSTSLRLGLA
                     TSDISVGCLKVVFDWMSKYNVQGVDLAFNNLDQLVPIMVDKLSDLTFKNLQYFTLNST
                     NISSIDEMASMLERLSLLPNLKFLDLSNLPQLFPGLVPYLHKYLPRFLHLKRIHFDNN
                     DLTYKEIAMLCNILIKCKNISHVSLLSQNPVLPEKDTIITTNKAEESLLMDTAIREEE
                     KKEPDTGKAKVLFSRYTLWATLYGLVKDSPNLVSLDIDYDKMPEEMRSRIVLGLMRNM
                     QSVMDSNFTLDEKLLQDNLLFDGSLLSESAESLLKRLNSNSVIDVVDPTKKYLLTKYL
                     EKLETLHLNVQNTIDSMFEKRKSGELPLEEKENLLRLLLLEKNLSNILELFSKIPSLS
                     TVFASTSPSLNTTAQPTNATSITAEESPLQSRPILKHMDSGKLLQAAIVPPPENGNDN
                     DVQTRPHLIATESGRIIDTLTGKAILHKSLSNTSLYSKKQEEEEGELHKWGYFIQQQY
                     QPQQSASSSEQSNYEEGSASPLSPSDVNDQEQVKIEPLNILPKIPSGSQLREAIIQAK
                     GINSIDDLIRNVSKNRVEVRNVYDDVVPISSHATEHHPRTVAGANITVDNDEDVIEKY
                     DELLNNLSTVRASKV"
     gap             276425..276444
                     /estimated_length=20
     gene            <276534..>277022
                     /gene="NDAI0E01370"
                     /locus_tag="NDAI_0E01370"
                     /db_xref="GeneID:11498843"
     mRNA            <276534..>277022
                     /gene="NDAI0E01370"
                     /locus_tag="NDAI_0E01370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670148.1"
                     /db_xref="GeneID:11498843"
     CDS             276534..277022
                     /gene="NDAI0E01370"
                     /locus_tag="NDAI_0E01370"
                     /inference="similar to DNA sequence:INSDC:YOR226C,YPL135W"
                     /note="similar to Saccharomyces cerevisiae ISU2 (YOR226C)
                     and ISU1 (YPL135W); ancestral locus Anc_8.647"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670196.1"
                     /db_xref="GeneID:11498843"
                     /db_xref="GOA:G0WB33"
                     /db_xref="InterPro:IPR002871"
                     /db_xref="InterPro:IPR011339"
                     /db_xref="UniProtKB/TrEMBL:G0WB33"
                     /translation="MNSLIPKFTTRSIITLSNSATRPSVLLTKRLYHQKVIEHYTNPR
                     NVGSLDKSQGNVGTGIVGAPACGDVIKLQIQVNDDTGIIENVKFKTFGCGSAIASSSY
                     MTELVNGMSIDDAQKIKNIEIAKELSLPPVKLHCSMLAEDAIKAAIKDYRTKRTKATT
                     LH"
     gene            <277607..>278062
                     /gene="NDAI0E01380"
                     /locus_tag="NDAI_0E01380"
                     /db_xref="GeneID:11498844"
     mRNA            <277607..>278062
                     /gene="NDAI0E01380"
                     /locus_tag="NDAI_0E01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670149.1"
                     /db_xref="GeneID:11498844"
     CDS             277607..278062
                     /gene="NDAI0E01380"
                     /locus_tag="NDAI_0E01380"
                     /inference="similar to DNA sequence:INSDC:YOR224C"
                     /note="similar to Saccharomyces cerevisiae RPB8 (YOR224C);
                     ancestral locus Anc_8.646"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670197.1"
                     /db_xref="GeneID:11498844"
                     /db_xref="GOA:G0WB34"
                     /db_xref="InterPro:IPR005570"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:G0WB34"
                     /translation="MSNTLFDDIFTVTEVDAGRYNKVCRIEASSTTQEQCKLALDINT
                     ELFPVQNQDQLTITIASSLSIDNDDESSKNNKNSAATRSWRPPQPGDRSLADDYDYVM
                     YGTAYKFEEVSNDIIAVYYSFGGLLMRLEGNYRNLNTLKQENAYLLIRR"
     gene            complement(<278335..>279264)
                     /gene="NDAI0E01390"
                     /locus_tag="NDAI_0E01390"
                     /db_xref="GeneID:11498845"
     mRNA            complement(<278335..>279264)
                     /gene="NDAI0E01390"
                     /locus_tag="NDAI_0E01390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670150.1"
                     /db_xref="GeneID:11498845"
     CDS             complement(278335..279264)
                     /gene="NDAI0E01390"
                     /locus_tag="NDAI_0E01390"
                     /inference="similar to DNA sequence:INSDC:YOR223W"
                     /note="similar to Saccharomyces cerevisiae YOR223W;
                     ancestral locus Anc_8.645"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670198.1"
                     /db_xref="GeneID:11498845"
                     /db_xref="InterPro:IPR019413"
                     /db_xref="InterPro:IPR025390"
                     /db_xref="UniProtKB/TrEMBL:G0WB35"
                     /translation="MSKEPLLPSTNQHLSRSLPNSISSQQQQQQGTSSSLSRNGRINS
                     RYIVIRFSDERIKDIELNITNVSLDVINTAWLRRMCRELRPSETTSHRLKFIRNGVLL
                     NLHTNLKFQLSQYFNQVESEESDERENKIYVHCIVGTDILTPEELQDEDKMDEIGQNQ
                     DGTTTQAIGFDRLRAVGFSEQEVELLRQQFRATYGDLQNENDDYEQNQHPNNEQNNNN
                     DIRQLEEQWMESGTNGNNGNVFDTNSDRFNSIPITNFKHNKDLLIGIFIGFTFGIFSF
                     LLMKIDGLFNKRQKMSMFAGIMVNIIFCFVKGF"
     gene            complement(<279960..>280937)
                     /gene="NDAI0E01400"
                     /locus_tag="NDAI_0E01400"
                     /db_xref="GeneID:11498846"
     mRNA            complement(<279960..>280937)
                     /gene="NDAI0E01400"
                     /locus_tag="NDAI_0E01400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670151.1"
                     /db_xref="GeneID:11498846"
     CDS             complement(279960..280937)
                     /gene="NDAI0E01400"
                     /locus_tag="NDAI_0E01400"
                     /inference="similar to DNA sequence:INSDC:YOR222W,YPL134C"
                     /note="similar to Saccharomyces cerevisiae ODC2 (YOR222W)
                     and ODC1 (YPL134C); ancestral locus Anc_8.644"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670199.1"
                     /db_xref="GeneID:11498846"
                     /db_xref="GOA:G0WB36"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G0WB36"
                     /translation="MSNQPEKPLAFRYQFMAGAIAGISELTVMYPLDVVKTRMQLQIS
                     PPIMAAAAAGTSSSSTIPLSSSSKAAASTISENYTGVIDCLSKIVKKEGFSRLYKGIS
                     SPMLMEAPKRATKFACNDEFQKLYKNLFGETKLTQKISILSGASAGIIESIVIVPFEL
                     VKIKLQDVNCKFNGPVDVLKDTVKKNGIKGLYNGLESTIWRNGVWNAGYFGIIFQVRE
                     LLPTAKNKNDKNKNDLIAGFIGGTVGVMVNTPFDVVKSRIQSDANDMVNGVRKYNWTW
                     PSVVKIYNQEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNFFRELQA"
     gap             281217..281236
                     /estimated_length=20
     gene            <282309..>283514
                     /gene="NDAI0E01410"
                     /locus_tag="NDAI_0E01410"
                     /db_xref="GeneID:11498847"
     mRNA            <282309..>283514
                     /gene="NDAI0E01410"
                     /locus_tag="NDAI_0E01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670152.1"
                     /db_xref="GeneID:11498847"
     CDS             282309..283514
                     /gene="NDAI0E01410"
                     /locus_tag="NDAI_0E01410"
                     /inference="similar to DNA sequence:INSDC:YOR221C"
                     /note="similar to Saccharomyces cerevisiae MCT1 (YOR221C);
                     ancestral locus Anc_8.643"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670200.1"
                     /db_xref="GeneID:11498847"
                     /db_xref="GOA:G0WB37"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:G0WB37"
                     /translation="MRLITFPGQGTSISIPILKALIRNKSKQFQTILNQNGSNSNDLL
                     KYIFQNPSSPGSIAVCANLYYQLYKILSHESSIQNDMNKETKVPPPQQNIADQDSLLL
                     GHSLGELTCLSINNLFKLNDLFKIANYRNDLMIKYTEKYLVAHKINHSSKFEMWALSS
                     PNAIHLPNQVNDLITSLRINKNAQTIQVANANSIKQCVVTGLVEDLESLRIELHLDFP
                     RLRITELTNPNNIPFHNDTILRPIQEPLYDFIWNILKENGTTIVTELQHGIITNLDGS
                     VSRFLHHALEKFVKSSSNTVQFTKCYETINNKAFQINDAVCFGPGNVIFNLIKRNCQN
                     VTPFEYSSLTTVNAFHDYHNAKQQQSQQSQEAKGDDSGRKQNDHDHDHDHDHDHDDGI
                     VPEEEVHLE"
     gene            complement(<283637..>284452)
                     /gene="NDAI0E01420"
                     /locus_tag="NDAI_0E01420"
                     /db_xref="GeneID:11498848"
     mRNA            complement(<283637..>284452)
                     /gene="NDAI0E01420"
                     /locus_tag="NDAI_0E01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670153.1"
                     /db_xref="GeneID:11498848"
     CDS             complement(283637..284452)
                     /gene="NDAI0E01420"
                     /locus_tag="NDAI_0E01420"
                     /inference="similar to DNA sequence:INSDC:YOR220W"
                     /note="similar to Saccharomyces cerevisiae YOR220W;
                     ancestral locus Anc_8.640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670201.1"
                     /db_xref="GeneID:11498848"
                     /db_xref="UniProtKB/TrEMBL:G0WB38"
                     /translation="MNQETQVKKTQILITDIPKEKFVSKWPQELEEKIFDENFPNLKI
                     NLQYFTPLQFLSRIVIIMNDQESTDVIYEFLQKLMKELAPTPIKLYLTESLLVNNAKG
                     DSNRPPIRSRSFDDMEKINDNNDGKNSLQKPILSIDTDPVRTGIAVGSLALGGPSLSP
                     DRRTSIESPTLLKFAPDSKSIYYKEPAPKISPQSTKESSSSPVDGSQTKYLFQPPPPS
                     SDVVNSNAIRPNTLKVNTSSSTSSLSVASGKDSSSTPNTPPKSPTITLNEFAH"
     gene            <285244..>285837
                     /gene="NDAI0E01430"
                     /locus_tag="NDAI_0E01430"
                     /db_xref="GeneID:11498849"
     mRNA            <285244..>285837
                     /gene="NDAI0E01430"
                     /locus_tag="NDAI_0E01430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670154.1"
                     /db_xref="GeneID:11498849"
     CDS             285244..285837
                     /gene="NDAI0E01430"
                     /locus_tag="NDAI_0E01430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670202.1"
                     /db_xref="GeneID:11498849"
                     /db_xref="UniProtKB/TrEMBL:G0WB39"
                     /translation="MSNTSLSSSEDISSTNQEINNDLSLNLDELNEDFPTTRSDSIDL
                     EAKSKKKHPKPYHRRLLTKKTSIYLVILIVVCLGAILLFSPSFLPSFFKNKKTNGSNT
                     FKRKTLNITGETLISNTNKQLQFSIPKRKENPQNGENVSSSSSVSLVEHIEGQNQSIL
                     KEYQKYTMVIYNNTGFLLEDIEYSSDSGNFILKFTLI"
     gene            complement(<285903..>288581)
                     /gene="NDAI0E01440"
                     /locus_tag="NDAI_0E01440"
                     /db_xref="GeneID:11498850"
     mRNA            complement(<285903..>288581)
                     /gene="NDAI0E01440"
                     /locus_tag="NDAI_0E01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670155.1"
                     /db_xref="GeneID:11498850"
     CDS             complement(285903..288581)
                     /gene="NDAI0E01440"
                     /locus_tag="NDAI_0E01440"
                     /inference="similar to DNA sequence:INSDC:YOR217W"
                     /note="similar to Saccharomyces cerevisiae RFC1 (YOR217W);
                     ancestral locus Anc_8.637"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670203.1"
                     /db_xref="GeneID:11498850"
                     /db_xref="GOA:G0WB40"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR012178"
                     /db_xref="InterPro:IPR013725"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WB40"
                     /translation="MVNITDFFNKSAKRKIPSKTATKSSSSSSSGAPNSIPQEVINLD
                     DSDEDDIIIKKPARKKTKTTAEPPTIEKKKEADSDIINLSSSPIASKKEAKSATERIT
                     ESKSKPAAPKKTTKPSSISSATSHGSITAQDILDKLPSVDLSQVHAKENVGFDFSKAG
                     GATTGEEVDAEAPPDFPEGQPNCLLGLTIVFTGVLPNLEREVAESIAKRYGARVTKSI
                     SGRTSVVVLGDEAGPKKLEKIKQLKIKAIDEDGFRQLVSGMPAEGGDGEAAEKARQKR
                     EQEEAKAVQEAEELLKTENAKKERIKMAKGSGEFINKEDSVREEDKLWTVKYAPTSSV
                     GICGNKTSVTKLKNWLTNWETNKKNDFKTAGRDGTGIFRSAMLYGPPGIGKTTAAHLV
                     AKELGYDVLEQNASDVRSKSLLNAGVKNALGNMSVIGYFKNQPGMNVDINGNGKKFVI
                     IMDEVDGMSGGDRGGVGQLAQFCRKTTTPMILICNERNLPKMRPFDRICLDLQFRRPD
                     ANSIKSRLMTIAIREKFKLDPNIIDKLVQTTRGDIRQIINLLSTISKTTKNIGHENIQ
                     EISKAWEKNIALKPFDIAHKLLDGYIYTDVGSNTFTLNDKIALYFDDFDFAPLMIQEN
                     YLNCKPSNLPSGVSHLQAVADAAESISAADLVEKKIRSSEQLWGLLPLHAVLSSVRPS
                     SMIAGRMTGRINFSAWLGQNSKTNKYYRLLQELQYHTRLSTSTDKLGLRLAYLPTFKR
                     RLLEPLLHKGAEGVSDVIELMDDYYLTREDWDTIMDFMIGPDITTLQLKKIPTSVKTA
                     FTRKYNSMTHPVAIYKTGSSIGTGVGSAARSTPDFEDVVDADDAVPGAEDEDEGKEDT
                     DIKKDKLIKQKVRPTKRKKAVGAAGAAATKKRKTKA"
     gene            <288999..>290555
                     /gene="NDAI0E01450"
                     /locus_tag="NDAI_0E01450"
                     /db_xref="GeneID:11498851"
     mRNA            <288999..>290555
                     /gene="NDAI0E01450"
                     /locus_tag="NDAI_0E01450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670156.1"
                     /db_xref="GeneID:11498851"
     CDS             288999..290555
                     /gene="NDAI0E01450"
                     /locus_tag="NDAI_0E01450"
                     /inference="similar to DNA sequence:INSDC:YOR216C"
                     /note="similar to Saccharomyces cerevisiae RUD3 (YOR216C);
                     ancestral locus Anc_8.636"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670204.1"
                     /db_xref="GeneID:11498851"
                     /db_xref="GOA:G0WB41"
                     /db_xref="InterPro:IPR000237"
                     /db_xref="InterPro:IPR019459"
                     /db_xref="UniProtKB/TrEMBL:G0WB41"
                     /translation="MGKNKKKNNNNNNNNNNKKHANPSPKQDPIDDSKEQEQVNKQEQ
                     PPKIESTQEPKEPVEESGADDVEKDDKEEPKDTSVMGKEEQEDTKTRENNDIRNSFDS
                     SEKDEQIEKLQTEMADLKKELKDTQEKLAKSSSTSSSPSVDEMEKSEENDKNEELEKL
                     KEERDHFESQYNSLLNRISSMKNVFNKMKESQRDLEIVQDQVAEYESQNLKLKNKVEL
                     ITKEKTELATTMVTLNKELSSLEDKYEALENKSMKYEKQLKDFKRQEKENSNTYTHQL
                     EGYRKEKELLDTQLQELLIILDNNKQDIVNLKDEKEEMKQALHASENEKTAFEESLQQ
                     LSSKLEEQENDYAQSLREKAQEIKALSVQLESSADKNKALQTELQSLKDDIQSLKENS
                     SLKDKLEQETKEQALQIGKLRHESIVLNEHLTKAMAMLKRSSDSESVDKELISNLLIS
                     FVSIPRADPKKFEVLELLSSFLNWDDDKKQQAGLLLDPKERRSSTGPVSKTQSFVSMW
                     TDYLEKESER"
     gene            <290959..>291543
                     /gene="NDAI0E01460"
                     /locus_tag="NDAI_0E01460"
                     /db_xref="GeneID:11498852"
     mRNA            <290959..>291543
                     /gene="NDAI0E01460"
                     /locus_tag="NDAI_0E01460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670157.1"
                     /db_xref="GeneID:11498852"
     CDS             290959..291543
                     /gene="NDAI0E01460"
                     /locus_tag="NDAI_0E01460"
                     /inference="similar to DNA sequence:INSDC:YOR215C"
                     /note="similar to Saccharomyces cerevisiae YOR215C;
                     ancestral locus Anc_8.635"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670205.1"
                     /db_xref="GeneID:11498852"
                     /db_xref="GOA:G0WB42"
                     /db_xref="InterPro:IPR003789"
                     /db_xref="InterPro:IPR019004"
                     /db_xref="UniProtKB/TrEMBL:G0WB42"
                     /translation="MFLRVLRQPAVRRSIIPTSRRFLRFNSTEAYTNAISNLKKDLKE
                     AMSAKDEVKKTTIRSILSTVKNEEIANAKNDSTLNEFSLFDTFSRLITQRMESIENYK
                     KNDRQDLVNNEQKELDILKDYRAKLPVATEDEINAKVLALLNKLKETQEGLKINQVMS
                     KLDWKTIPTEWRASANSIKKSVVSQFKDVFERMK"
     gene            <291901..>292770
                     /gene="NDAI0E01470"
                     /locus_tag="NDAI_0E01470"
                     /db_xref="GeneID:11498853"
     mRNA            <291901..>292770
                     /gene="NDAI0E01470"
                     /locus_tag="NDAI_0E01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670158.1"
                     /db_xref="GeneID:11498853"
     CDS             291901..292770
                     /gene="NDAI0E01470"
                     /locus_tag="NDAI_0E01470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670206.1"
                     /db_xref="GeneID:11498853"
                     /db_xref="UniProtKB/TrEMBL:G0WB43"
                     /translation="MLFFPFIIFLLSLKYINATYSITLTSDYDSSSIDYGTNDFFELE
                     DFNETDKLITNDVVEEDFESVANILSPNQDGKEFSPKGVVVYEFKKSINELPMSEIGY
                     NKTFDNEFKLKPLSIKEILPELDNIFSREVTSHKKFKLIKEILREIDEESNDLGKLSL
                     EQGITLPSRKLVEQIKPTGVTFIPKEVLRKTLYQPTLSTPYSQRAESIFGITQAPFPI
                     KRVNTVDLDKLIPKDFKINPRVYFRLKSLQYTYIMLQRSKRCWLLTRYFLKDIIFPVL
                     LCVYAMLFQCLKF"
     gene            <293159..>294057
                     /gene="NDAI0E01480"
                     /locus_tag="NDAI_0E01480"
                     /db_xref="GeneID:11498854"
     mRNA            join(<293159..293167,293323..>294057)
                     /gene="NDAI0E01480"
                     /locus_tag="NDAI_0E01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670159.1"
                     /db_xref="GeneID:11498854"
     CDS             join(293159..293167,293323..294057)
                     /gene="NDAI0E01480"
                     /locus_tag="NDAI_0E01480"
                     /inference="similar to DNA sequence:INSDC:YPL129W"
                     /note="similar to Saccharomyces cerevisiae TAF14
                     (YPL129W); ancestral locus Anc_8.633"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670207.1"
                     /db_xref="GeneID:11498854"
                     /db_xref="GOA:G0WB44"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="InterPro:IPR016665"
                     /db_xref="UniProtKB/TrEMBL:G0WB44"
                     /translation="MVASVKRTIRIKTAQHILPDLPPVENFPMRQWSIEIVLLDKEGN
                     EIPATILDKVTYHLHPTFVNPNRTFTEIPFRIEEQGWGGFPLNISLFLLEKGGERKVT
                     HDLNFLQESYEVDHVIQVPVNKPGLAAELAKSGPADEINALLTSSASTKRKGAVTNTD
                     SKTKKPKLSSSPMVRGDVDIEKLAFGLTKLSEDDLVGVVQMVSDSWTPEESAANNVEE
                     GEFVFDLFTLKEDVLKNLWDYVMKNTEGK"
     gene            <294546..>295622
                     /gene="NDAI0E01490"
                     /locus_tag="NDAI_0E01490"
                     /db_xref="GeneID:11498855"
     mRNA            <294546..>295622
                     /gene="NDAI0E01490"
                     /locus_tag="NDAI_0E01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670160.1"
                     /db_xref="GeneID:11498855"
     CDS             294546..295622
                     /gene="NDAI0E01490"
                     /locus_tag="NDAI_0E01490"
                     /inference="similar to DNA sequence:INSDC:YOR213C"
                     /note="similar to Saccharomyces cerevisiae SAS5 (YOR213C);
                     ancestral locus Anc_8.632"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670208.1"
                     /db_xref="GeneID:11498855"
                     /db_xref="GOA:G0WB45"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="InterPro:IPR016665"
                     /db_xref="UniProtKB/TrEMBL:G0WB45"
                     /translation="MQEPSLEIPVVNDPLADALKDVYDVVKLILRVKTQQVIIQDPPL
                     TDQTIDEAIDSDDTVEETVSPSDDITILLQNSQGSERLHTIETSESGNGTQEELSKEG
                     LHFESGTHNGHLMENKLVINGGYENNKEAIDGREEEDHDNDEDDGEGDELPLRKWRVE
                     ICLLDKEGNEIEASILKSCTYYLHPTFANPVRKISSPPFTLDEQGWGEFEFKIICNLI
                     EQAGKFIVFHDLQFSEEAYAMDYSIYISCNTPLIRSFLESHHLLPDTSIENVDELIHK
                     EIYKAHSKWIKEVPYYDEDLVDEITQMIINHPSVMTEINKYPRKEAFVMGFYQLPLDL
                     LNSIRAHINKEHDVKQDVECSDGA"
     gene            complement(<295871..>297157)
                     /gene="NDAI0E01500"
                     /locus_tag="NDAI_0E01500"
                     /db_xref="GeneID:11498856"
     mRNA            complement(<295871..>297157)
                     /gene="NDAI0E01500"
                     /locus_tag="NDAI_0E01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670161.1"
                     /db_xref="GeneID:11498856"
     CDS             complement(295871..297157)
                     /gene="NDAI0E01500"
                     /locus_tag="NDAI_0E01500"
                     /inference="similar to DNA sequence:INSDC:YOR212W"
                     /note="similar to Saccharomyces cerevisiae STE4 (YOR212W);
                     ancestral locus Anc_8.631"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670209.1"
                     /db_xref="GeneID:11498856"
                     /db_xref="InterPro:IPR001632"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016346"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G0WB46"
                     /translation="MSAYPVDQPVYLIQQPQQQYLSYQDIQTLEDEIQQKIDQARNET
                     KHLYTQVNKIKSKIQDADLFQISQQIEPLIKPHINLKPTLTLRGHNNKISQFKWSLNS
                     KSILSSSQDGFMLIWDSATGLKQNAIPLDSQWVLSCAISPSGKLVASGGLNNNCTIYR
                     VSKENRVQQNVVSIFKGHTCYISDIEFWDNSHVITSSGDMTCALWNIPKAKRLREYSD
                     HLGDVLALAMPSRQGATETDGESNDSSIFASCGSDGYTYIWDTRSPSAVQKFFVSDSD
                     VTSIKFFKDGNSIITGSDDGIINMFDLRSDCSIASYSLQQGMQKELKHPTYTSATMEY
                     SKYSPQSPFANSITSSYLDNQGVVSLDFSGSGRLMYACYTDIGCVIWDLLKGEIVGKL
                     DGHSDRISGVETSPDGLAVCTASWDSTMKIWSPRYM"
     gene            complement(<297745..>298902)
                     /gene="NDAI0E01510"
                     /locus_tag="NDAI_0E01510"
                     /db_xref="GeneID:11498857"
     mRNA            complement(<297745..>298902)
                     /gene="NDAI0E01510"
                     /locus_tag="NDAI_0E01510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670162.1"
                     /db_xref="GeneID:11498857"
     CDS             complement(297745..298902)
                     /gene="NDAI0E01510"
                     /locus_tag="NDAI_0E01510"
                     /inference="similar to DNA sequence:INSDC:YPL127C"
                     /note="similar to Saccharomyces cerevisiae HHO1 (YPL127C);
                     ancestral locus Anc_8.629"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670210.1"
                     /db_xref="GeneID:11498857"
                     /db_xref="GOA:G0WB47"
                     /db_xref="InterPro:IPR005818"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:G0WB47"
                     /translation="MPIRRPNFPKKTQSVNKSESATTEKEGKAPLKRKASNGTPRTRG
                     TIRRGSKEDVIESESNDKDNETAPTKEEEANTEGESGGDEVKEGEKTQNDDEQQEVED
                     EEKITEKNGKRANDEMDEEDEIDDSKKKEDSTNEETDGKPKATKRKKASNKKSTEAET
                     LSESTKSYKNLIKDAIRDLNERKGSSRMALKKHLKSQNPNFETTTNFDHFFNSALKKG
                     VDGGEFIQPKGPSGTVMLPKPAGKVTKSKTPKSTNDSKSTKEHKSKVTKPKSTTNKKT
                     SMNKKVEKPKTKPKRPTSKGSNGGSQSDAPSYKEMIMKSLSDLNDGKGASRNTLKKFV
                     KGNFDSINPTRFDYLFNSTIKKCVDSGELLMPKGPLGTVKFPKSKKTAKSG"
     gene            <299348..>302059
                     /gene="NDAI0E01520"
                     /locus_tag="NDAI_0E01520"
                     /db_xref="GeneID:11498858"
     mRNA            <299348..>302059
                     /gene="NDAI0E01520"
                     /locus_tag="NDAI_0E01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670163.1"
                     /db_xref="GeneID:11498858"
     CDS             299348..302059
                     /gene="NDAI0E01520"
                     /locus_tag="NDAI_0E01520"
                     /inference="similar to DNA sequence:INSDC:YOR211C"
                     /note="similar to Saccharomyces cerevisiae MGM1 (YOR211C);
                     ancestral locus Anc_8.628"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670211.1"
                     /db_xref="GeneID:11498858"
                     /db_xref="GOA:G0WB48"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR019762"
                     /db_xref="InterPro:IPR020850"
                     /db_xref="InterPro:IPR022812"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WB48"
                     /translation="MSSALSLSRNTLQILTSNRLQHPSHVCMRRLMLSHFTRRFIHST
                     RSSSSLIINIPFPRQPYLHRTFRNHSTTYPYVITSRRFMSIFPKIITKVVKLPVYVGG
                     GLAAAGSYVAYKLEEANSFTWDKWNQLKDYSTNMRDKLNGYFGSDGSGVPPSENSSGS
                     SDSNGTVPTATLLASLVDDEEDKEKKSDDDEDEDEDDYLDSVDTTQDEMLNLTKQMIE
                     IRSIVSKVDSTSANLTLPSIVVIGSQSSGKSSVLESIVGKEFLPKGSNMVTRRPIELT
                     LVNTPGNSEITADFPTLRTYNLTDFKEVKRILMELNMAVPSTEAVSEEPIQLTIKAST
                     VPDLSLVDLPGYIQVEAADQPMELKSKIRLLCDKYLNEPNIILAISAADVDLANSSAL
                     RAAKLADPQGLRTIGVITKLDLVTPVLARNILNNKKYPLKMGYVGVITKTGPNGASLS
                     QHSSLGSGMSHLFGNKDRTSTALSTREEVSPEQLEARQFEKSYFKENRKTFQNCQVTT
                     KKLREKLIKILEISMSNALEPTSTVIQQELDDTSYLFKVEFNDRQLTPKSYLLNNIDI
                     LKLSIKEFQEKFNRNELKSILKADLDQKVLDFLATRYWKDENFIELSNNNRFIKNDDE
                     ILYWHKKLDLASSSLTKIGIGRLSTMLVTNSILKELGNVLECTQLKNHDLIKELVLNT
                     AVNVLNTKYYSTADQVENCVKPFKYEIDLEDRDWNIAREHSINLIKEELRQCNQRYET
                     IKNVIGNKKLQHVMHYLEQDTTQKETLGMSKMLLERGAEASFLDKRSKVLSFRLKLLK
                     NNCRSKDNKDFCPEVFLNAVSEKLTSTAVLFLNVELLSDFFYNFPIELDNRLNVLTSE
                     QIEMFAKEDPKISRHIELQKRKELLELALAKIDSILVFKRSYKSINK"
     gene            complement(<302535..>302747)
                     /gene="NDAI0E01530"
                     /locus_tag="NDAI_0E01530"
                     /db_xref="GeneID:11498859"
     mRNA            complement(<302535..>302747)
                     /gene="NDAI0E01530"
                     /locus_tag="NDAI_0E01530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670164.1"
                     /db_xref="GeneID:11498859"
     CDS             complement(302535..302747)
                     /gene="NDAI0E01530"
                     /locus_tag="NDAI_0E01530"
                     /inference="similar to DNA sequence:INSDC:YOR210W"
                     /note="similar to Saccharomyces cerevisiae RPB10
                     (YOR210W); ancestral locus Anc_8.627"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670212.1"
                     /db_xref="GeneID:11498859"
                     /db_xref="GOA:G0WB49"
                     /db_xref="InterPro:IPR000268"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR020789"
                     /db_xref="InterPro:IPR023580"
                     /db_xref="UniProtKB/TrEMBL:G0WB49"
                     /translation="MIVPVRCFSCGKVVGDKWESYLNMLQEDELDEGTALSRLGLKRY
                     CCRRMILTHVDLIEKFLRYNPLEKRD"
     gene            <303774..>305075
                     /gene="NDAI0E01540"
                     /locus_tag="NDAI_0E01540"
                     /db_xref="GeneID:11498860"
     mRNA            <303774..>305075
                     /gene="NDAI0E01540"
                     /locus_tag="NDAI_0E01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670165.1"
                     /db_xref="GeneID:11498860"
     CDS             303774..305075
                     /gene="NDAI0E01540"
                     /locus_tag="NDAI_0E01540"
                     /inference="similar to DNA sequence:INSDC:YOR209C"
                     /note="similar to Saccharomyces cerevisiae NPT1 (YOR209C);
                     ancestral locus Anc_8.625"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670213.1"
                     /db_xref="GeneID:11498860"
                     /db_xref="GOA:G0WB50"
                     /db_xref="InterPro:IPR002638"
                     /db_xref="InterPro:IPR006406"
                     /db_xref="InterPro:IPR007229"
                     /db_xref="UniProtKB/TrEMBL:G0WB50"
                     /translation="MADNGEQKCVIQSILDTDLYKITMQAAVLKHFPNVKVIYKYTNR
                     SPQFTFNKASIDWLNIQFKLLETIQVTPDEIKYLKDKVPYLPDSFMKYIGQKDFRLRP
                     SEQLDFQYELVPGTKDEYTLKLFVEGYWKDTIMYEIPLLALISEAYFRFIDKDWDYEG
                     QEQMAFEKANTLFEHNCSFTEFGSRRRRSLHGQDLVMQGIVRASKLSPNNEKLLLGTS
                     NVYFAKKYDILPVGTVAHEWFMGIAALTGDYINANKDAMDYWIETFGKEHAGLALTDT
                     FGTDDYLKNFKPPYTDYYFGVRQDSGDPIEFTEKIAHFYNDELKLPKFSKTICYSDSL
                     NVEKVIKYDEVARKYGFKATFGIGTSFTNDYRKKSDPAVKSEPLNIVIKLLTVDGKHA
                     IKLSDNLGKNMGDPETVQRVKKELGYIEREWEGISEAHRWS"
     gene            <305655..>309119
                     /gene="NDAI0E01550"
                     /locus_tag="NDAI_0E01550"
                     /db_xref="GeneID:11498861"
     mRNA            <305655..>309119
                     /gene="NDAI0E01550"
                     /locus_tag="NDAI_0E01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670166.1"
                     /db_xref="GeneID:11498861"
     CDS             305655..309119
                     /gene="NDAI0E01550"
                     /locus_tag="NDAI_0E01550"
                     /inference="similar to DNA sequence:INSDC:YOR207C"
                     /note="similar to Saccharomyces cerevisiae RET1 (YOR207C);
                     ancestral locus Anc_8.619"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670214.1"
                     /db_xref="GeneID:11498861"
                     /db_xref="GOA:G0WB51"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007646"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="UniProtKB/TrEMBL:G0WB51"
                     /translation="MVSATKKRKTTSKAHKHTHEHEKDETFDELLKPIYKGKKLTDEI
                     NTADDKWHLLPAFLKVKGLVKQHLDSFNYFVDVDLKKIIKANQLILSDVDPEFYLKYV
                     DIRVGKKSTSSARDYLTPPHECRLRDMTYSAPIYVDIEYTRGRNIIMHKDVEIGRMPI
                     MLRSNKCTLYGADEKQMAKLNECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVEADEK
                     KGIVQASVTSSTHERKSKTYVITKNGKIYLKHNSIAEEIPIVIVLKACGIVSDLEIMQ
                     LVCGNDSSYQDIFAVNLEEAAKLNLYTQQQALEFIGAKVKTMRRQKLSILQEGIEAIA
                     TTVVAHLTVEALDFREKALYMAMMTRRVVMAIHNPKMVDDRDYVGNKRLELAGQMVSL
                     LFEDLFKKFNSDFKATIDKVLEKPNRAMEYDALLSINVHSNNITSGLNRAISTGNWSL
                     KRFKMERAGVTHVLSRLSYISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTADT
                     PEGEACGLVKNLALMTHITSDDEEEPIKRVCYVLGVEDISLIDSASLHLNFGVYLNGT
                     LIGTTRFPIKFVSQFRHLRRTGKVSEFISIYTNSHQKAVHIATDGGRICRPLIIVTNG
                     KSHVTADHLRSLLEGKLVFDDFLKLGLVEYLDVNEENDSFIALYEKDINVASTHMEIE
                     PFTVLGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMIYPQQP
                     MVKTKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVINKASIDRGFGRCETRRKTT
                     TILKRYPNHTQDIISGMRVDENGDPIWQHKALGPDGLGEVGMKLDSGQIYINKAVPTN
                     PTSDLNAAPEQSQYRDTPVMYRAPEPSHIDQVMMSVSDNDQALIKVLLRQNRRPELGD
                     KFSSRHGQKGVCGIIVQQEDMPFNDQGIVPDIIMNPHGFPSRMTVGKMIELVSGKAGV
                     LNGSLEYGTCFGGSKLEDMSKILVDQGFNYSGKDMLYSGITGECLQAYIFFGPIYYQK
                     LKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLM
                     ISSDAFEVDVCDECGLMGYSGWCTTCKSAENIIKMTIPYAAKLLFQELLSMNIAPRLR
                     LEDIFVKA"
     gene            <309938..>310699
                     /gene="NDAI0E01560"
                     /locus_tag="NDAI_0E01560"
                     /db_xref="GeneID:11498862"
     mRNA            <309938..>310699
                     /gene="NDAI0E01560"
                     /locus_tag="NDAI_0E01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670167.1"
                     /db_xref="GeneID:11498862"
     CDS             309938..310699
                     /gene="NDAI0E01560"
                     /locus_tag="NDAI_0E01560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670215.1"
                     /db_xref="GeneID:11498862"
                     /db_xref="UniProtKB/TrEMBL:G0WB52"
                     /translation="MPENRSKTTTRRPAVYPLSTTEDQNSRLVSTNTLPGSKSKTNKH
                     LSKVKNDHSKNKTKTRSNLNVSADTNPSTSSIKPPKSNDRSTSNDGKRSNLGTRSTIK
                     TGSISTLEKSEGVWSDIDTLDDVKKMAQDYKGDGFPSNFESNLDQMRRSNAKLLTAMR
                     DRNERLQKEYEARTENECATFVDDGENFFEAKKENEIEENNTRSHYTAMCGNKDAVIN
                     EQEAQYVEGVIDIIKKLRLPITPGTTEGESSDSLA"
     gene            complement(<310812..>312917)
                     /gene="NDAI0E01570"
                     /locus_tag="NDAI_0E01570"
                     /db_xref="GeneID:11498863"
     mRNA            complement(<310812..>312917)
                     /gene="NDAI0E01570"
                     /locus_tag="NDAI_0E01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670168.1"
                     /db_xref="GeneID:11498863"
     CDS             complement(310812..312917)
                     /gene="NDAI0E01570"
                     /locus_tag="NDAI_0E01570"
                     /inference="similar to DNA sequence:INSDC:YOR206W"
                     /note="similar to Saccharomyces cerevisiae NOC2 (YOR206W);
                     ancestral locus Anc_8.617"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670216.1"
                     /db_xref="GeneID:11498863"
                     /db_xref="InterPro:IPR005343"
                     /db_xref="UniProtKB/TrEMBL:G0WB53"
                     /translation="MGKVSKATKKFQSKHLKHTLEHRKKIKDHKRKTQGRRGNKSEEE
                     KREGALTKDDQKLKKSSKEEVFKDMSVENFFEKGIELPKENKKLKKIKESKESEDDES
                     SSEEEGDMAANMATLSKEDPEFYKYLQENDKDLLDFAASNPLDAADEDDEGSGEEGEQ
                     EQLEQGPEKVELTLKLVKKWKKDLRESPSLKLLRNVVTAFKVAVNLNKDENVEDYKYT
                     VTDERAFHELMFVALKDLPQVIQKMAPYKTTKGSRTLPGGANVSKISSIVKSHSASLL
                     VLLNDITNTETAALILHSVDQLMPYLLSYRRVIKELIKNIVEIWATTREVETQIASFA
                     FLHSASKEFKKSILEVVLKTTYSTFIKSCRKTNLRTMPLINFQKNSAAELFGIDEVVS
                     YQVGFEYIRQLAIHLRNTMNATTKKTTRSDPAEVYKIIYNWQFCHSLDFWSRVLSFSC
                     NPERENGRESPLRQLIYPLVQVTIGVTRLIPTAQFFPLRFYLIKSLIRLSQNTGVFIP
                     IFPLLSEILTSTAFTKFSKRKENLEAFDFDHNIKCTQAYLGTKVYQEGLVEQFVDLVG
                     EYFTLYCKSVSFPELATPVIISLRRYIKTSKNIKFNKQLSNIVEKLNQNSTFIQTKRS
                     EVEFSPSNNTEVNRFLNDLPWEKTPLGAYVFVQREVKEEKAKLLRESLEEEDREKEEQ
                     KARNAEESEDEDVEMSDSE"
     gene            <313272..>314942
                     /gene="NDAI0E01580"
                     /locus_tag="NDAI_0E01580"
                     /db_xref="GeneID:11498864"
     mRNA            <313272..>314942
                     /gene="NDAI0E01580"
                     /locus_tag="NDAI_0E01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670169.1"
                     /db_xref="GeneID:11498864"
     CDS             313272..314942
                     /gene="NDAI0E01580"
                     /locus_tag="NDAI_0E01580"
                     /inference="similar to DNA sequence:INSDC:YOR205C"
                     /note="similar to Saccharomyces cerevisiae YOR205C;
                     ancestral locus Anc_8.616"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670217.1"
                     /db_xref="GeneID:11498864"
                     /db_xref="GOA:G0WB54"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WB54"
                     /translation="MFPTLCFRNHSRKFSTSLTRWINCNSCGIELQKKDPCQVGYYQE
                     PKTAKRPHIKSIEDLKYLLFSQDIQKLKEDEKEVIESKGANNSHLPHNPLFCKRCVDA
                     LHQNKYEMKDFQRMSFFDVVENIPRESNVLHCVPFPEFPFHLDKGILSNKHYTTSLLL
                     TKSDQLIRHKSTLNKDVQHFLKDFTHHYMSVKTNKAIAVSALKNWNMDVLYTNLKKNS
                     YFLGATNAGKSTLINSLLRKYLGYKVNIDKKGNIIHPEFPPDLQKNIKKFQKLQSAGV
                     SYIPNMTRKAQPYQIGDKLIFDLPGYTANVNEVLLEDIIEKDWLELIRKTELFTDRYV
                     KSQSYKSIKGSKNGACYTLGGIFFIVPPEGTINQIVKYIPGKPSTFRNVSKALEVFSN
                     VHSGNGTETKHPWEQYCGITQDFCDINKFERHVLPPFQGSIEIVLKDIGYILLRTTGT
                     YEFKGLHELWVPKGIEVCIRKPLLQLIKNNYSTNDSKVSYLSSRNDPIVSKTYVMDHD
                     EKDTLLKMQEIFKSSSEKGKVSRKYIHEDPKILLNSENPKCLFWYFDF"
     gene            complement(<315658..>317484)
                     /gene="NDAI0E01590"
                     /locus_tag="NDAI_0E01590"
                     /db_xref="GeneID:11498865"
     mRNA            complement(<315658..>317484)
                     /gene="NDAI0E01590"
                     /locus_tag="NDAI_0E01590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670170.1"
                     /db_xref="GeneID:11498865"
     CDS             complement(315658..317484)
                     /gene="NDAI0E01590"
                     /locus_tag="NDAI_0E01590"
                     /inference="similar to DNA sequence:INSDC:YOR204W,YPL119C"
                     /note="similar to Saccharomyces cerevisiae DED1 (YOR204W)
                     and DBP1 (YPL119C); ancestral locus Anc_8.614"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670218.1"
                     /db_xref="GeneID:11498865"
                     /db_xref="GOA:G0WB55"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WB55"
                     /translation="MADNLSDQMQNMNIKDNVYVPPRSRGANRGRGGNRGGSFGGNFG
                     NNDNRGSFFGGFNNRRGGSRGGRGGFGNRGGFGRGSWVDGKHVPGARNPKVELELFGT
                     ADDSSFQSSGINFDNYDDIPVEASGENVPEAITEFTSPPLDELLLENIQLARFTKPTP
                     VQKYSIPIVAAGRDLMACAQTGSGKTGGFLFPVLSESFKTGPTATHDQGSYYQKKAFP
                     TAVVMAPTRELATQIFDEAKKFCYRSWVQPCVAYGGAPIGNQMREMDRGCDLLVATPG
                     RLSDLIDRGKISLSNVKYLVLDEADRMLDMGFEPQIRAIVEGADMTPVGERQTLMFSA
                     TFPADIQHLARDFLADYIFLSVGRVGSTSENITQRVLYVENQDKKSALLDLLSASEDG
                     LTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQAERERALAAFKSGAATLLVATAV
                     AARGLDIPNVTHVINYDLPGDIDDYVHRIGRTGRAGNTGIATAFFNRDNTNIVKGLYE
                     ILTEANQEVPGFLNDAMADAAFSRGGRGGRSGFSSRNNSNRDYRKQGNGNGSWGSSRQ
                     SSNRSFGGNARSSGGWGNDSASRGQSSNGGWGAPSSGASSWW"
     gene            complement(<319712..>320377)
                     /gene="NDAI0E01600"
                     /locus_tag="NDAI_0E01600"
                     /db_xref="GeneID:11498866"
     mRNA            complement(<319712..>320377)
                     /gene="NDAI0E01600"
                     /locus_tag="NDAI_0E01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670171.1"
                     /db_xref="GeneID:11498866"
     CDS             complement(319712..320377)
                     /gene="NDAI0E01600"
                     /locus_tag="NDAI_0E01600"
                     /inference="similar to DNA sequence:INSDC:YOR202W"
                     /note="similar to Saccharomyces cerevisiae HIS3 (YOR202W);
                     ancestral locus Anc_8.612"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670219.1"
                     /db_xref="GeneID:11498866"
                     /db_xref="GOA:G0WB56"
                     /db_xref="InterPro:IPR000807"
                     /db_xref="InterPro:IPR020565"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:G0WB56"
                     /translation="MPEKQALINRITNETKIQISISLSGGPLKLENSILNKKNSTESI
                     ATQATNSQTIDIHTGIGFLDHMIHALAKHSGWSLIMECRGDLHIDDHHTTEDCGIALG
                     EAFKMAMGAIRGVKRFGTGFAPLDEALSRAVVDLSNRPYAIIDLGLKREKIGDLSCEM
                     IPHFLESFAEAARITIHVDCLRGKNDHHRSESAFKALAVAIREATSSNGTNDVPSTKG
                     VLM"
     gene            <320644..>322011
                     /gene="NDAI0E01610"
                     /locus_tag="NDAI_0E01610"
                     /db_xref="GeneID:11498867"
     mRNA            <320644..>322011
                     /gene="NDAI0E01610"
                     /locus_tag="NDAI_0E01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670172.1"
                     /db_xref="GeneID:11498867"
     CDS             320644..322011
                     /gene="NDAI0E01610"
                     /locus_tag="NDAI_0E01610"
                     /inference="similar to DNA sequence:INSDC:YOR201C"
                     /note="similar to Saccharomyces cerevisiae MRM1 (YOR201C);
                     ancestral locus Anc_8.611"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670220.1"
                     /db_xref="GeneID:11498867"
                     /db_xref="GOA:G0WB57"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR004441"
                     /db_xref="InterPro:IPR013123"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:G0WB57"
                     /translation="MIKNGNAIATLRLFRTNRFSFKRELSIKPGIVTTKGKNSRGNDG
                     SIKFEKNIPIYGRPKAWELAKEDKETWFKRKYAHVHARRKMERAEEEGGNRNVDPYGK
                     KEAHLERLRRYSDVKRSQYENHRTKFQKVNPLSGLQINPLMEYIYGTNCVLIALKQNK
                     REYFNRLWYHGRLNDELIQLCKERDVELIETDKHRLNLLTNYAVHNNVVLETKPLDIM
                     EISHLTMCDPTIGEFGFKEVGFDRNDLTDHTMKYICNFTEGEGDREEVSIKTRNRTKK
                     YPFGLFLDEVVDPHNMGAIIRSAYFLGVDFIVLTRKNCAPLSPVVLKTSSGSMECMPI
                     FCVDKPLQFFTDSQREGGWAFITSHVSDANGKIKDLKYIKDKILDLHDLSGKCLDFPI
                     MLVIGNEGAGVRTNLRMRSDFFVEIPFGRKQEILGPGNKMGLPIVDSLNVSVATALLI
                     NSILN"
     gene            <322737..>324200
                     /gene="NDAI0E01620"
                     /locus_tag="NDAI_0E01620"
                     /db_xref="GeneID:11498868"
     mRNA            <322737..>324200
                     /gene="NDAI0E01620"
                     /locus_tag="NDAI_0E01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670173.1"
                     /db_xref="GeneID:11498868"
     CDS             322737..324200
                     /gene="NDAI0E01620"
                     /locus_tag="NDAI_0E01620"
                     /inference="similar to DNA sequence:INSDC:YOR198C"
                     /note="similar to Saccharomyces cerevisiae BFR1 (YOR198C);
                     ancestral locus Anc_8.609"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670221.1"
                     /db_xref="GeneID:11498868"
                     /db_xref="UniProtKB/TrEMBL:G0WB58"
                     /translation="MSTNENSQKDNNKTNSNHRFVKRPDVSVRDKKLDTLNVQLKKID
                     NEIALLRKQIDHYQISDSVQQERKKLLDHNKEIIKNQADLKNRRNQIFESIKILDSNI
                     KRRNNEINEKLGKKHKFNTTAEAKQRIAEIDDLIGSGDLSIVEEKLLVKEAQSLNKLM
                     KDLIAIDPIKKAIDDDKAKIVNLKEELNSLNPKTLSSDFEKNQEKLNDLNAKNQGVYD
                     KKQSIFLKRTALYQKRDEIYSQIRQIRTDFDNEFKAFKNKLEKERLRREEDEKLSKLM
                     EEKDSSLGKLQEKLTHAKIPAFTFEIESIENTLVALDPTYVKPKKNTALDELTSSNEK
                     INSNTQIRKVEAAADLVLVPTKNEEDIFSNTAPSKSKKFKKKNQNKQAQNGDAFAKID
                     GKFTLEPTLIATLAQLDVKVPISKDDVAVSIEQLKSKHEDLINKQDEQTEKNIANVEK
                     EISQLQISFQKKEEQIKKELEEKRQQEAAEKEASVEA"
     gene            complement(<324500..>325870)
                     /gene="NDAI0E01630"
                     /locus_tag="NDAI_0E01630"
                     /db_xref="GeneID:11498869"
     mRNA            complement(<324500..>325870)
                     /gene="NDAI0E01630"
                     /locus_tag="NDAI_0E01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670174.1"
                     /db_xref="GeneID:11498869"
     CDS             complement(324500..325870)
                     /gene="NDAI0E01630"
                     /locus_tag="NDAI_0E01630"
                     /inference="similar to DNA sequence:INSDC:YOR197W"
                     /note="similar to Saccharomyces cerevisiae MCA1 (YOR197W);
                     ancestral locus Anc_8.608"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670222.1"
                     /db_xref="GeneID:11498869"
                     /db_xref="GOA:G0WB59"
                     /db_xref="InterPro:IPR011600"
                     /db_xref="InterPro:IPR029030"
                     /db_xref="UniProtKB/TrEMBL:G0WB59"
                     /translation="MFPGQGNHTYNNQNKNYSNNQYNNGPPQNNYNSAHAAYSRPGIP
                     VPGPRPHPSSNELNNNNNGIIGGRKRDEGGQYQQQYSRPPNPINNQNNYTNGSNSSNN
                     YSSAPLQQQQYQNYSENVPSNYVQPQNISRPPQQPQSFHLNNQQTQPSFQYSQCTGKR
                     KALIIGINYIGSSNALRGCINDAHNIFNFLSQRYGYSPQDIVILTDDQQDPVRQPTKA
                     NIIRAMQWLVRDAQPNDSLFFHYSGHGGQTKDLDGDEDDGMDDVIYPVDFQNAGELID
                     DDMHDIMVEPLPQGVRLTTLFDSCHSGTVLDLPYTYSTKGVIKEPNMWKDVGGEGLQA
                     AMAYATGNRAGLIRSLGSVFKTVKNSVGNNVDREKIKEVKFSQADIIMLSGSKDSQTS
                     ADAVEDGQNTGAMSHAFIKVLSSQPQQSYLSLLQNMRKELAAKYSQKPQLSASHPIDC
                     NLQFII"
     gene            <326163..>327353
                     /gene="NDAI0E01640"
                     /locus_tag="NDAI_0E01640"
                     /db_xref="GeneID:11498870"
     mRNA            <326163..>327353
                     /gene="NDAI0E01640"
                     /locus_tag="NDAI_0E01640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670175.1"
                     /db_xref="GeneID:11498870"
     CDS             326163..327353
                     /gene="NDAI0E01640"
                     /locus_tag="NDAI_0E01640"
                     /inference="similar to DNA sequence:INSDC:YOR196C"
                     /note="similar to Saccharomyces cerevisiae LIP5 (YOR196C);
                     ancestral locus Anc_8.606"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670223.1"
                     /db_xref="GeneID:11498870"
                     /db_xref="GOA:G0WB60"
                     /db_xref="InterPro:IPR003698"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G0WB60"
                     /translation="MLQTRTCTSLKTSLLLTKTISARSISNSTSTKEPATPTPRRRTR
                     ITEFKDALNVGPSFQDFLTGNAVNFKPDPLADAEFQKLPSWLKVPIPKGTNFTKLTND
                     VKKLKLSTVCQEAKCPNIGECWSGGTFGRKKQNKGKNVEGEHSKATATIMLLGDTCTR
                     GCRFCSVKTDRNPAPPDPMEPENTAEAIKKWGLGYVVLTTVDRDDLLDGGAHHLAETV
                     RKIKEKAPSIFVETLSGDFRGDMEMVDVMAKSGLDVYAHNMETVEALTPYVRDRRATY
                     RQSLAVLKRAKETVPTLITKSSIMLGFGETDEQVLQTLKDLREVGCDIVTFGQYMRPT
                     KRHMKVVEYVHPRKFDYWKDVAMGLGFLYCASGPLVRSSYKAGEIFIENILKHRKNSP
                     PQGI"
     gene            <327708..>328529
                     /gene="NDAI0E01650"
                     /locus_tag="NDAI_0E01650"
                     /db_xref="GeneID:11498871"
     mRNA            <327708..>328529
                     /gene="NDAI0E01650"
                     /locus_tag="NDAI_0E01650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670176.1"
                     /db_xref="GeneID:11498871"
     CDS             327708..328529
                     /gene="NDAI0E01650"
                     /locus_tag="NDAI_0E01650"
                     /inference="similar to DNA sequence:INSDC:YDL086W"
                     /note="similar to Saccharomyces cerevisiae YDL086W;
                     ancestral locus Anc_2.379"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670224.1"
                     /db_xref="GeneID:11498871"
                     /db_xref="GOA:G0WB61"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0WB61"
                     /translation="MLIEDSFKDIATSYDTTLRCYIIKPKLKNYPHAKFPAVIVYSEI
                     YQVTGPVRRLGQRIASKGFIVVMPAIYHNFVGPEALNYDVEGTDMGNEFKIKKPLKSY
                     DEDNKLCCDLIYSMNEFNGRGIGVTGMCLGGHLAFRGLLDKRISCATCFFPTDIHLKS
                     LGLGKNDDSLARVSQEIGKDQEMILIFGTLDTHVSPEGRDLIRQTLRDRSVNFTFLEV
                     LDAQHAFIRDESSKGRYDADITEACLGLMFEQFNRRLKNELGAFVSDNSAIEHVC"
     gene            <329688..>331382
                     /gene="NDAI0E01660"
                     /locus_tag="NDAI_0E01660"
                     /db_xref="GeneID:11498872"
     mRNA            <329688..>331382
                     /gene="NDAI0E01660"
                     /locus_tag="NDAI_0E01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670177.1"
                     /db_xref="GeneID:11498872"
     CDS             329688..331382
                     /gene="NDAI0E01660"
                     /locus_tag="NDAI_0E01660"
                     /inference="similar to DNA sequence:INSDC:YDL085W,YMR145C"
                     /note="similar to Saccharomyces cerevisiae NDE2 (YDL085W)
                     and NDE1 (YMR145C); ancestral locus Anc_2.382"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670225.1"
                     /db_xref="GeneID:11498872"
                     /db_xref="GOA:G0WB62"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:G0WB62"
                     /translation="MLSSNLVRGAIWNSTLRSSIVAKRSLTISTKLLQVHPIPPPPPP
                     SAFSSSVKDSPPVIKQTLMNRFGKLTLKVSLYGILAATLFTGYSLYSETLPTRNQLPQ
                     SATFSDGSPRKTIVILGSGWGSISLLKNLDTTKYNVIVVSPRNYFLFTPLLPSTPMRT
                     IELKSIIEPVRSITRRSKGEVTYYEAKATSINPRDKSVKIESSSQKGTDKFEVDLKYD
                     YLVVSVGAKSTTFNIPGVIEHANFLKEIEDSEKIRLKIINNIEMASFLLPDDPERKKL
                     LNFVVVGGGPTGVEFAAELQDYVRQDLKKWLPDISKEVKVTLVEALPNILNMFDKSLI
                     EHTEKFLKKEKINLKLKTMVKSVDDDNINAMVNDKVEKIPYGVLIWATGNAPSDLCKG
                     LMEQVEEQTSPRGLLINNQLQLLGFEDSIFALGDCTFHPGLFPTAQVAHQEGDYLADR
                     FKTMYKIDQLKWKINHLDDVKNHSKKIRLSDKLTKLESKLQDFEYLHRGTLSYIGNEK
                     AIVELKIGNSNYKISGPLAIWFWKSAYLNMCFSVRNRASVAFDWFKVYFFGRDSSV"
     gene            <332103..>333125
                     /gene="NDAI0E01670"
                     /locus_tag="NDAI_0E01670"
                     /db_xref="GeneID:11498873"
     mRNA            <332103..>333125
                     /gene="NDAI0E01670"
                     /locus_tag="NDAI_0E01670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670178.1"
                     /db_xref="GeneID:11498873"
     CDS             332103..333125
                     /gene="NDAI0E01670"
                     /locus_tag="NDAI_0E01670"
                     /inference="similar to DNA sequence:INSDC:YDL078C"
                     /note="similar to Saccharomyces cerevisiae MDH3 (YDL078C);
                     ancestral locus Anc_2.392"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670226.1"
                     /db_xref="GeneID:11498873"
                     /db_xref="GOA:G0WB63"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:G0WB63"
                     /translation="MTKVTILGASGGVGQPLSLLLKLSPYITELSLYDLRNVEGVSKD
                     LSHINTNSKCTGHGEIDIEKALKGANLVIIPAGVPRRPGMSRDDLFKINAKIVKSLVS
                     YTGKFAPGARILIISNPVNSMVPIAVEQLKLMGKFQPGNVVGVTMLDLVRAETFVVDF
                     LGEDSTLDKTKMDKDITVIGGHSGNTIVPVFLNKKLGETLKMKKCYDEFIHRVQFGGD
                     EVVKAKDGAGSATLSMALAGYKFAEEILRSLHKAKSTMTTIPAFVYLPGISNGKEVQE
                     KVGNKNLEYIALPVNLVYGSVASIDTTVLDNLTSEETKLLNIAVKELIGNIDKGKKFI
                     IGASKL"
     gene            <334229..>334765
                     /gene="NDAI0E01680"
                     /locus_tag="NDAI_0E01680"
                     /db_xref="GeneID:11498874"
     mRNA            <334229..>334765
                     /gene="NDAI0E01680"
                     /locus_tag="NDAI_0E01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670179.1"
                     /db_xref="GeneID:11498874"
     CDS             334229..334765
                     /gene="NDAI0E01680"
                     /locus_tag="NDAI_0E01680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670227.1"
                     /db_xref="GeneID:11498874"
                     /db_xref="UniProtKB/TrEMBL:G0WB64"
                     /translation="MSSSGGILKRISEMFHESKARPESSVSHTYIPKPNEDMLFDLPN
                     LKENLKTDTQLDTKSHICYYPHGTFIKKVEVEKLKEPYLYVDDFLALKNRISIEHVEE
                     ITKAITASEPESHSQSLTQLQPKDTLLKPTVTKNENAIKKRTKRLTEATIKKMINFDN
                     QFVKSNMKTSLSTRIRMY"
     gene            <335849..>337051
                     /gene="NDAI0E01690"
                     /locus_tag="NDAI_0E01690"
                     /db_xref="GeneID:11498875"
     mRNA            <335849..>337051
                     /gene="NDAI0E01690"
                     /locus_tag="NDAI_0E01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670180.1"
                     /db_xref="GeneID:11498875"
     CDS             335849..337051
                     /gene="NDAI0E01690"
                     /locus_tag="NDAI_0E01690"
                     /inference="similar to DNA sequence:INSDC:YDL079C,YMR139W"
                     /note="similar to Saccharomyces cerevisiae MRK1 (YDL079C)
                     and RIM11 (YMR139W); ancestral locus Anc_2.391"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670228.1"
                     /db_xref="GeneID:11498875"
                     /db_xref="GOA:G0WB65"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0WB65"
                     /translation="MSSQDNNTNFQDTIVRKQVYYGHVQHTVNNAKNDTNDNDKNNNN
                     DNDNNDSNNTNDNNKNPNEPITISFPTTEVIGKGSFGLVFCTTLRETNELVAIKKVLQ
                     DRRFKNRELEIMKLIQHPNVINLKYYFYEKDLDDEVYLNLILDYMPQSLYQRLRHFVH
                     QRQSMPRLEIKFYMYQMFKALNYLHNAKNVCHRDIKPQNVLVDPNSWNLKICDFGSAK
                     QLKPTEPNVSYICSRYYRAPELIFGATNYTNQIDIWSSGCVMAELLLGQPMFPGESGI
                     DQLVEIIKILGTPSKQEICAMNPNYMEHQFPQIKPIPLAKVFKKEDELTVNFLIQTLK
                     YDPLERFNALQCLCSPYFDELRYGEGRIKEITNDLKLLEFIVDEELAHLNPNELDIIK
                     NKLAIHPI"
     gene            <337856..>339721
                     /gene="NDAI0E01700"
                     /locus_tag="NDAI_0E01700"
                     /db_xref="GeneID:11498876"
     mRNA            <337856..>339721
                     /gene="NDAI0E01700"
                     /locus_tag="NDAI_0E01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670181.1"
                     /db_xref="GeneID:11498876"
     CDS             337856..339721
                     /gene="NDAI0E01700"
                     /locus_tag="NDAI_0E01700"
                     /inference="similar to DNA sequence:INSDC:YDL080C"
                     /note="similar to Saccharomyces cerevisiae THI3 (YDL080C);
                     ancestral locus Anc_2.390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670229.1"
                     /db_xref="GeneID:11498876"
                     /db_xref="GOA:G0WB66"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G0WB66"
                     /translation="MSYTNTNDIPSYITIAEYIFHRLKQLKIETIFGLPGEFNMPLID
                     KLYKIPQLRWAGDANELNAAYAADGYSRLKGLGVLVTTFGVGELSAINGVAGSFAEHV
                     GLLHIVGMPPTSAQTKQLLLHHTLGNGDYNVFWRIASEVACHTVIINDTDLCFMEVDK
                     CIEIAWKRQKPVYIGIPVNQVDIPVRSLHLNVPLTLSPDMNLNDIGNDVVQLLLQKIY
                     KSTHPVIIVDGCIIRHGCIDEMEEFIQRTKFPVFVTPMGKGAIDENNPNFKGVFTGSI
                     SSPSVREVVDFADFLMVMGCMLAAFNTSTFHFGYKSKNRALLYSDSIKFNNATYPDVY
                     LKPLLQSLLQNLDESQINYVPKETPKMIIPKRELPDDELLRQEWVWNEISHWFQEGDI
                     IITETGTSAFGINQTRFPNEAQGISQALWGSVGYSLGACLGSLFAVQEFQRDHNHDFH
                     HHTQKSEKHRVILFVGDGAFQLTMQELSTIVRWKLTPYIFILNNHGYSVDRILHHRSD
                     ASYYDIQQWDYLNLMNTFNATDADTRKIITVGDMKDMLRDPEFAVDNRIRMIEVMLPS
                     MDVPKALVDTWKKEKEKYKRALESPYSDYVTETPNSDGSLRNKRPRIGETPESDF"
     gene            <340829..>341152
                     /gene="NDAI0E01710"
                     /locus_tag="NDAI_0E01710"
                     /db_xref="GeneID:11498877"
     mRNA            <340829..>341152
                     /gene="NDAI0E01710"
                     /locus_tag="NDAI_0E01710"
                     /product="ribosomal protein P1"
                     /transcript_id="XM_003670182.1"
                     /db_xref="GeneID:11498877"
     CDS             340829..341152
                     /gene="NDAI0E01710"
                     /locus_tag="NDAI_0E01710"
                     /inference="similar to DNA sequence:INSDC:YDL081C"
                     /note="similar to Saccharomyces cerevisiae RPP1A
                     (YDL081C); ancestral locus Anc_2.388"
                     /codon_start=1
                     /product="ribosomal protein P1"
                     /protein_id="XP_003670230.1"
                     /db_xref="GeneID:11498877"
                     /db_xref="GOA:G0WB67"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:G0WB67"
                     /translation="MSTESALSYAALILADAEVEITSEKLITLTEAANVPVEGIWADI
                     FAKALLNQNLKELMVSFSAGAAAPAGAAGSSATAGAAGEAAEEKEEEEAKEESDDDMG
                     FGLFD"
     gene            complement(<341655..>342658)
                     /gene="NDAI0E01720"
                     /locus_tag="NDAI_0E01720"
                     /db_xref="GeneID:11498878"
     mRNA            complement(join(<341655..342250,342655..>342658))
                     /gene="NDAI0E01720"
                     /locus_tag="NDAI_0E01720"
                     /product="ribosomal protein L13"
                     /transcript_id="XM_003670183.1"
                     /db_xref="GeneID:11498878"
     CDS             complement(join(341655..342250,342655..342658))
                     /gene="NDAI0E01720"
                     /locus_tag="NDAI_0E01720"
                     /inference="similar to DNA sequence:INSDC:YDL082W,YMR142C"
                     /note="similar to Saccharomyces cerevisiae RPL13A
                     (YDL082W) and RPL13B (YMR142C); ancestral locus Anc_2.387"
                     /codon_start=1
                     /product="ribosomal protein L13"
                     /protein_id="XP_003670231.1"
                     /db_xref="GeneID:11498878"
                     /db_xref="GOA:G0WB68"
                     /db_xref="InterPro:IPR001380"
                     /db_xref="InterPro:IPR018256"
                     /db_xref="UniProtKB/TrEMBL:G0WB68"
                     /translation="MAISKNLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARAAKAA
                     KIAPRPLDLLRPVVRAPTVRYNRKVRAGRGFSLAEVKAAGLTAAYARTIGIAVDHRRQ
                     NTNQEIFELNVQRLKEYQSKIIVFPRNGKAPEVEQVLSAAATFPIAQPTTDVETRAVE
                     DNGESAFRTLRLARSEKKYRGIREKRAKDKAEAEAEKKK"
     gene            <343335..>344244
                     /gene="NDAI0E01730"
                     /locus_tag="NDAI_0E01730"
                     /db_xref="GeneID:11498879"
     mRNA            join(<343335..343358,343837..>344244)
                     /gene="NDAI0E01730"
                     /locus_tag="NDAI_0E01730"
                     /product="ribosomal protein S16"
                     /transcript_id="XM_003670184.1"
                     /db_xref="GeneID:11498879"
     CDS             join(343335..343358,343837..344244)
                     /gene="NDAI0E01730"
                     /locus_tag="NDAI_0E01730"
                     /inference="similar to DNA sequence:INSDC:YDL083C,YMR143W"
                     /note="similar to Saccharomyces cerevisiae RPS16B
                     (YDL083C) and RPS16A (YMR143W); ancestral locus Anc_2.386"
                     /codon_start=1
                     /product="ribosomal protein S16"
                     /protein_id="XP_003670232.1"
                     /db_xref="GeneID:11498879"
                     /db_xref="GOA:G0WFB1"
                     /db_xref="InterPro:IPR000754"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020574"
                     /db_xref="UniProtKB/TrEMBL:G0WFB1"
                     /translation="MSTVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEIL
                     RFKVYEPLLLVGLDKFSNIDIRVRVTGGGHVSQVYAIRQAIAKGLVSYHQKFVDEQSK
                     NELKKAFTSYDRTLLIADARRPEPKKFGGKGARSRFQKSYR"
     gene            <345054..>345776
                     /gene="NDAI0E01740"
                     /locus_tag="NDAI_0E01740"
                     /db_xref="GeneID:11498880"
     mRNA            <345054..>345776
                     /gene="NDAI0E01740"
                     /locus_tag="NDAI_0E01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670185.1"
                     /db_xref="GeneID:11498880"
     CDS             345054..345776
                     /gene="NDAI0E01740"
                     /locus_tag="NDAI_0E01740"
                     /inference="similar to DNA sequence:INSDC:YMR144W"
                     /note="similar to Saccharomyces cerevisiae YMR144W;
                     ancestral locus Anc_2.385"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670233.1"
                     /db_xref="GeneID:11498880"
                     /db_xref="UniProtKB/TrEMBL:G0WB70"
                     /translation="MTGLQTNEACSTVGTFTEVIISGTDDTKQLHDTPVNVKGSISHH
                     AQAKPGIENQVLSADEASATIVHLNKQLGRLQQLLNQKKLRNMLLENNAKSLKSNNEV
                     ERKLHKEQFDQMKYQSYLEKEKLLRNLRLKDMKIRKYKKRIISKNKEINRLTKILNDN
                     SVKDNLRNLSPSVDRKESISSNSEIYSSQYTGSTPTNKLRTLGVLATRVLNEESEGCS
                     DAHTILEESDPSPVDPNATELE"
     gene            complement(<346153..>347505)
                     /gene="NDAI0E01750"
                     /locus_tag="NDAI_0E01750"
                     /db_xref="GeneID:11498881"
     mRNA            complement(<346153..>347505)
                     /gene="NDAI0E01750"
                     /locus_tag="NDAI_0E01750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670186.1"
                     /db_xref="GeneID:11498881"
     CDS             complement(346153..347505)
                     /gene="NDAI0E01750"
                     /locus_tag="NDAI_0E01750"
                     /inference="similar to DNA sequence:INSDC:YDL084W"
                     /note="similar to Saccharomyces cerevisiae SUB2 (YDL084W);
                     ancestral locus Anc_2.384"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670234.1"
                     /db_xref="GeneID:11498881"
                     /db_xref="GOA:G0WB71"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WB71"
                     /translation="MSHEGEEDLLEYSDNEQEIQVDATNAATESTEGAAGATDASATT
                     EGDAAATTGADKRVPTLVSIPLDSKYFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIH
                     GTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVAVVVICNARELAYQIRNEYLRFSKY
                     MPDVKTAVFYGGTPINKDAELLKNKDTAPHIVVATPGRLKALVRDKYIDLSHVKNFVI
                     DECDKVLEELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDD
                     EAKLTLHGLQQYYIKLEEREKNRKLAQLLDDLEFNQVIIFVKSTNRANELTKLLNASN
                     FPAITVHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYDLTSEPD
                     QYLHRVGRAGRFGTKGLAISFVASKEEEEVLAKIQERFDVKIAEFPEEGIDPSTYLNN
                     "
     gene            <349744..>350280
                     /gene="NDAI0E01760"
                     /locus_tag="NDAI_0E01760"
                     /db_xref="GeneID:11498882"
     mRNA            <349744..>350280
                     /gene="NDAI0E01760"
                     /locus_tag="NDAI_0E01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670187.1"
                     /db_xref="GeneID:11498882"
     CDS             349744..350280
                     /gene="NDAI0E01760"
                     /locus_tag="NDAI_0E01760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670235.1"
                     /db_xref="GeneID:11498882"
                     /db_xref="UniProtKB/TrEMBL:G0WB72"
                     /translation="MKLHILLLIIQVWTMVSFAQTITLGAMEGKSDSDTSGTVYIFDQ
                     NVQSNTYLLHLPSTYNSTRTATQASLSYSEDALLSQLMDASSASSIKTSTIRGKISSE
                     FSTNTLASSSNLEENSISSSVNSKVSSPTRENIVKHTSNANSTSTNASFSSSRGDGNI
                     VTIPIFFTSLMGLMAFIL"
     gene            <351188..>351925
                     /gene="NDAI0E01770"
                     /locus_tag="NDAI_0E01770"
                     /db_xref="GeneID:11498883"
     mRNA            <351188..>351925
                     /gene="NDAI0E01770"
                     /locus_tag="NDAI_0E01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670188.1"
                     /db_xref="GeneID:11498883"
     CDS             351188..351925
                     /gene="NDAI0E01770"
                     /locus_tag="NDAI_0E01770"
                     /inference="similar to DNA sequence:INSDC:YLR040C"
                     /note="similar to Saccharomyces cerevisiae YLR040C;
                     ancestral locus Anc_2.398"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670236.1"
                     /db_xref="GeneID:11498883"
                     /db_xref="GOA:G0WB73"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:G0WB73"
                     /translation="MQTIHDLFQIITIWTICCIGILKVQAASVTKTSTNGATNTVTSF
                     ASQTITNSAQMVSARSEAANVDMPFFMAFLDDFGSQLPQYTSYMAQNHFTLPQAIADY
                     YYHIAFLPDTADLQADIANTFPFNQFQTFITAFPWYSSLLSHASVSTIYLPEDFIENT
                     AINNASIIQTSSSLDAPSSSITSRKASSTISSKSITSSPSSSSFVTTSTTTTTTSSST
                     TRSNNAANNELKVLNPTIMLLLIGLFL"
     gene            <352387..>355410
                     /gene="NDAI0E01780"
                     /locus_tag="NDAI_0E01780"
                     /db_xref="GeneID:11498884"
     mRNA            <352387..>355410
                     /gene="NDAI0E01780"
                     /locus_tag="NDAI_0E01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670189.1"
                     /db_xref="GeneID:11498884"
     CDS             352387..355410
                     /gene="NDAI0E01780"
                     /locus_tag="NDAI_0E01780"
                     /inference="similar to DNA sequence:INSDC:YLR039C"
                     /note="similar to Saccharomyces cerevisiae RIC1 (YLR039C);
                     ancestral locus Anc_2.402"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670237.1"
                     /db_xref="GeneID:11498884"
                     /db_xref="InterPro:IPR009771"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0WB74"
                     /translation="MHLWPFSPPQLLKVSPRSTALSNEQINDNEIKQCLTLPQSNVTI
                     FLHPCRVQIYNFKPFALVASHERTQKSIDEFGQNKFMVSSTSFSHPIKGLMNEEETIN
                     ITASLQRKSIVYVITEKNYILIYQILKNSSNVTIFQDYGILDLGSSFSKEPLSNEFAI
                     SQDSNDDGNDDTDDDTLTVYDKNNTSKIIQNGYIVSKAKGFLNFLTNTQDDLAELPVK
                     RLELRLKVVLKFDYEILDVVGFKRFAKIGDGKFEENLLILFPHGLQILNLIDFKLNKS
                     HLINIKDSKRICILQNQLFVIAEDKEKNKITIHEIDAENQKTEEITIDGTSKPFKSCF
                     TFNKRIVFIHENIVRFYDPIKKKLSHSWNTSTKNNICKPLNDDVLLVISEENNFYVFT
                     KFGNQLVSYEKTHESDKQPALNYSDFSFCNKTLITTSKNGDYKIWPYWEESKQPFSDF
                     RTTKPYILHNNKNEILLYSPTNESTSNKDIFQSIRLPTKTINNYYPLVRLNSTSKLLS
                     TFIANKNLLLIYNTDTNNWYNFPHVTILDMQWLGHTYLVCYAQKEDGSRSIQCLNFPL
                     QNLGNREFSDLIIWEYDLTEDMNVISIHVNSLFKYKLLKLKNKDEKNSTTPNEVFFKT
                     AEIILITNHELIVLDVISTIHLSGINIIKKLHQFARVTLPEDIDGRDIKWVTNYRDGL
                     LFLSDDKIFKIEKIASEEWLSVMLLEKVERIIDVLREEIYLIHENKYTIYRLDDLWDD
                     KEPILTIPVEENSYIISASPGTATAYTLECVFTEGSSRLVVKHDIYLDKVICAKIEQE
                     VDPEEITIEFRQLKHYNFALEKILSSKMLSDDPLDKIIALIKYSDEFGDPTKHTNLLE
                     IVSNCLRKIETKYWNKLFTSLQMTPRDLLGYCIDGNESRILGILFLVFLNYDETDLVQ
                     DLKKNASTSGTETIPEDETVTQYKTDNSVVSLVKDEELMLQILRVLVTSAATATDATK
                     AVDAWDMCFQLARLMKELDKENNTQLVQDAMKMFQ"
     gene            <355883..>356158
                     /gene="NDAI0E01790"
                     /locus_tag="NDAI_0E01790"
                     /db_xref="GeneID:11498885"
     mRNA            <355883..>356158
                     /gene="NDAI0E01790"
                     /locus_tag="NDAI_0E01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670190.1"
                     /db_xref="GeneID:11498885"
     CDS             355883..356158
                     /gene="NDAI0E01790"
                     /locus_tag="NDAI_0E01790"
                     /inference="similar to DNA sequence:INSDC:YLR038C"
                     /note="similar to Saccharomyces cerevisiae COX12
                     (YLR038C); ancestral locus Anc_2.403"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670238.1"
                     /db_xref="GeneID:11498885"
                     /db_xref="GOA:G0WB75"
                     /db_xref="InterPro:IPR003213"
                     /db_xref="UniProtKB/TrEMBL:G0WB75"
                     /translation="MSEVEDIQEFNKEDESPLHTVGFDPRFPQQNQTRHCWQAYVDYH
                     KCINIKGEEFAPCKVFWKTYQSLCPVDWIEKWDEQREKGIFAGDINP"
     gene            <356778..>359018
                     /gene="NDAI0E01800"
                     /locus_tag="NDAI_0E01800"
                     /db_xref="GeneID:11498886"
     mRNA            <356778..>359018
                     /gene="NDAI0E01800"
                     /locus_tag="NDAI_0E01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670191.1"
                     /db_xref="GeneID:11498886"
     CDS             356778..359018
                     /gene="NDAI0E01800"
                     /locus_tag="NDAI_0E01800"
                     /inference="similar to DNA sequence:INSDC:YLR035C"
                     /note="similar to Saccharomyces cerevisiae MLH2 (YLR035C);
                     ancestral locus Anc_2.405"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670239.1"
                     /db_xref="GeneID:11498886"
                     /db_xref="GOA:G0WB76"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:G0WB76"
                     /translation="MAIKEISTNSKWKIVSSSFILGPTSVVHELLDNSVDSGATTIYI
                     DVDSKTGGCEYISVKDNGSGVEKDDRSVMCLNHTTSKIENFEDLSNLSSLGFRGEALF
                     MIANLCTDKGSMEIATRTENEPIGEKWFVQKNGSILNDKRYKTSYGTGTTITVRKLLG
                     GLRARYIDMSEKSRKSIDEIKQMINHYSLNYRSIRFCFSLVSLDKNGKITQKQLQQSM
                     DIKLSKVRALSFLLKLRKPIATNFIGFDKLEVNDKVSLEVILPTMRPESDIINVKKPL
                     RFLSLNNRAMSLQLEIGHSINKLLNSLYKSFQMLNPIVWYINLNCDPKLIDFNIEPEK
                     NDALFKDFDFILEQIKACLKEFIMDKLDIGEEEDRSLEFRNTKPLPETETGSQAIPID
                     ISEPEKTTNRNISRHSPVFNEQSITMVDHIIDNEAEPHAFGKQIESRSGSGGSLSEIT
                     VIDAIETGVPNARINGRSITNGSMISEEGNWSHNLHDEPLSEDQDPRLDAQNKGSSSS
                     LTYNYQETELTNEDLELSKDASLSNPFIIAKMKNIGKKQNPKNKLNSISSFNVNSLPE
                     KPTTMINKDVQLKKLREVNGNGPNPSQKSLSQSVFNLDDTRIFKRQADGIEEHTEQEN
                     SITKRYRLADKLDTNVTGKRIGKTETQKVKVVATKKKHRNKKLSMFSEFTNSYSIRIL
                     YKSLNMMELSKVSKEAERILTAHEDERPSKMLLAQLRDTNKTIGKKYNLKRSNRGWYI
                     YGTGPP"
     gene            <359926..>361353
                     /gene="NDAI0E01810"
                     /locus_tag="NDAI_0E01810"
                     /db_xref="GeneID:11498887"
     mRNA            <359926..>361353
                     /gene="NDAI0E01810"
                     /locus_tag="NDAI_0E01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670192.1"
                     /db_xref="GeneID:11498887"
     CDS             359926..361353
                     /gene="NDAI0E01810"
                     /locus_tag="NDAI_0E01810"
                     /inference="similar to DNA sequence:INSDC:YLR034C"
                     /note="similar to Saccharomyces cerevisiae SMF3 (YLR034C);
                     ancestral locus Anc_2.407"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670240.1"
                     /db_xref="GeneID:11498887"
                     /db_xref="GOA:G0WB77"
                     /db_xref="InterPro:IPR001046"
                     /db_xref="UniProtKB/TrEMBL:G0WB77"
                     /translation="MSSSMDVLRKFAKFVGPGIMVSVAYMDPGNYSTSVSGGAQYKYK
                     LLFSIFISNLFAIVLQCLCVKLGTVTGYDLAENCRRNLPRKINLTLYFFAELAIIATD
                     LAEVVGTAIALQILFGIPLTWGVILTVLDVLVILLFYKPEEQSMKRVRLFELFVGTLV
                     IATCFCFLLELFKINIPHKKTLFEGFLPSKVIFEDKQALYISLGILGATVMPHSLYLG
                     SSLVKPRLQEHDMKKYGKVEARPSLSAIKYSLNYAYAELIISLFLIATFVNSAILIVA
                     GASLFGQPDAADADLLSIYELLVHYISPAAGLIFALAMLCSGQSAGIICTMAGQIVSE
                     GFLEWSLPPWATRLCTRLIAIIPCLFVTLTMGERGISDILNLSQVVLSLILPIVSAPL
                     IYFTACRKLMTVPDVYGENNGTLENNDAVIDEHTPLTLERKKLEADFTNSRWLTWLAV
                     LIWATIGGLNCYLVGSFLMGADVHF"
     gene            complement(<361700..>363346)
                     /gene="NDAI0E01820"
                     /locus_tag="NDAI_0E01820"
                     /db_xref="GeneID:11498888"
     mRNA            complement(<361700..>363346)
                     /gene="NDAI0E01820"
                     /locus_tag="NDAI_0E01820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670193.1"
                     /db_xref="GeneID:11498888"
     CDS             complement(361700..363346)
                     /gene="NDAI0E01820"
                     /locus_tag="NDAI_0E01820"
                     /inference="similar to DNA sequence:INSDC:YLR033W"
                     /note="similar to Saccharomyces cerevisiae RSC58
                     (YLR033W); ancestral locus Anc_2.408"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670241.1"
                     /db_xref="GeneID:11498888"
                     /db_xref="UniProtKB/TrEMBL:G0WB78"
                     /translation="MSPDDLLADLQIVLKAASTKCDVLDEKFPSKFYEEIPAKIYESY
                     FKFIKNRSNLEGVLRNEDKLALTTINEKFDNKEYIPEQHGIYKLYHDITLVCILLIHY
                     YPQGTKNYYMVDKFYHFATELILRECYKLGMIIDANDDIDSTDTSTNTELDDVIGKDF
                     IKVSMNYKLPLTQTYHIKTKDLDLFSSLISKSNLDKRPHELPNSNFEINNVIPQTNVQ
                     EEAPRLGFVAANTSNIPDPTLTPTTMLTNFSHPNWYNLPTTTWLNYDDYKSWAPTLKE
                     DGTVVDSTTRGITWLKKVAYMNILKEKKIVEEKETSEEKLDKEETIIEPANTADTTVA
                     AAITKTTNTPGTADAIETPTNTVNTPNITGSTNNTTTITTDTTTINARKMEGDMGAGA
                     GSETKMLDMTEVNGTKPTPDGIVADNAADKETSGKSGKSKVIKLENLFNWSPSNYLGQ
                     DEIESFKNGRQEKLVNETLLKIQNLRKKRVSNRVTKPTEEETQLYHKAKRLMKEIILA
                     KQVSDFFPSLCKSFPIVQATYSGNIPVIRAQHARKRRHRK"
     gene            complement(<363691..>367503)
                     /gene="NDAI0E01830"
                     /locus_tag="NDAI_0E01830"
                     /db_xref="GeneID:11498889"
     mRNA            complement(<363691..>367503)
                     /gene="NDAI0E01830"
                     /locus_tag="NDAI_0E01830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670194.1"
                     /db_xref="GeneID:11498889"
     CDS             complement(363691..367503)
                     /gene="NDAI0E01830"
                     /locus_tag="NDAI_0E01830"
                     /inference="similar to DNA sequence:INSDC:YMR128W"
                     /note="similar to Saccharomyces cerevisiae ECM16
                     (YMR128W); ancestral locus Anc_2.409"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670242.1"
                     /db_xref="GeneID:11498889"
                     /db_xref="GOA:G0WB79"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WB79"
                     /translation="MGTYRKRFNEKARAGHMAKLKELKKVRNKQFHREVEEESEEEDA
                     KNTSITDTNAEILEPLTEEEKSLKKRKLQEIFTPKESKISRLKKKRLDKFIDHQLKRE
                     EKKTIIEKLQDYKIDTSLLVSSKKLGEGRQTKKEEFAEALSLEKQGRSTDDTRAILYE
                     DHIVKEWKENDPAAKRELQYSSESEHDVNHDDENEDNEESDDFESKFGDVTTNSSTFI
                     DNRPAKFGGMGSGFGFANMKVINKGKKLSKRKYNWRQRVEMQELKKHNEEDELDFVSS
                     SEESDSTEESAGDEGEEEELKEESGVDSESASDDQGEEDDEREEHDDIDDEEKLHDIA
                     KDFKNWANQEIKKMEGRDVEPITPQMNIDYKPIIREEDLEDGLEVPNIPVDEKSVRKA
                     FYVPVERSDTIQEARMQLPVFGEEHAIMEAIHHNDVVIISGETGSGKTTQVPQFLYES
                     GFGSPDSPDNPGMIGITQPRRVAAVSMAKRVANELGNHGSKVAYQIRFDSTTKEDTRV
                     KFMTDGVLLREMMHDFRLTRYSSIIIDEAHERNVNTDILIGMLSRCVRLRAKEHMSNP
                     EKCKRLKLIIMSATLRVTDFSENTTLFSTPPPILKVEARQYPVSVHFNKRTPFNYSDE
                     AFRKTCKIHRRLPPGAILIFMTGQQEINHMVKKLRREFPFKKSKKNFSNSSTVRVNNK
                     TADLEVEDIEFSTKIIDEEQFNAELGSDEENLEDDFDNEEGFDETLEEGQSKDDPLYV
                     LPLYSLLPTKEQMKVFEESPKGSRLCIVSTNIAETSLTIPGVRYVVDCGRSKERKYNE
                     SNGVQSFEIGWISKAGANQRSGRAGRTGPGHCYRLYSSAVYERDFEEFSKPEILRMPV
                     ESIVLQMKSMAIHNIVNFPFPTPPDRVALTKAIQLLQYLGALDVREKITDDGKKMSLF
                     PLSPRFSKMLLVSDEHDCLPYIVSIVSALSVGDPFISENELGINEVKVKPTDNDEDEN
                     TDTRIDKEEEERKKTIRTQFYKNRAKFNKLDKESDVFRLLSVVSAFDYIPKNQKATFV
                     QNNFLRSKTLEEIVKLRMQLMYIIKSNTSKENIAVNVKSEDLKSNPPTEIQVKLLKQM
                     ICAGFVDHVAIRADYLFPEDAEITNKSSLINIPYVPVLTSKTPEITDCFVYIHPSSIL
                     SNLGELPPKFLVYHSLHLGGNAKTRMNTLCDIKSTPLANVARNGLLLDYSKPLTGQGL
                     KSIPISLNERYCYVVPRFGAFIDSDLKIGWDLNPIAVHQEKQNGKWVVTKFITNKNYK
                     TAEANQKK"
     gene            complement(<367943..>371395)
                     /gene="NDAI0E01840"
                     /locus_tag="NDAI_0E01840"
                     /db_xref="GeneID:11498890"
     mRNA            complement(<367943..>371395)
                     /gene="NDAI0E01840"
                     /locus_tag="NDAI_0E01840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670195.1"
                     /db_xref="GeneID:11498890"
     CDS             complement(367943..371395)
                     /gene="NDAI0E01840"
                     /locus_tag="NDAI_0E01840"
                     /inference="similar to DNA sequence:INSDC:YLR032W"
                     /note="similar to Saccharomyces cerevisiae RAD5 (YLR032W);
                     ancestral locus Anc_2.411"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670243.1"
                     /db_xref="GeneID:11498890"
                     /db_xref="GOA:G0WB80"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014905"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WB80"
                     /translation="MLKMNGEKKRFFDDELDSSEDAKVNFDQSLQNSESFLFSENSIS
                     KQEDNDQSNIPTIEIPSDPKDEFIADLRSVIPEMSLPVAEELYERFHKSEDNISNALT
                     YYFENYNDTNSLKTQELPSSPFSSRSSTRNSSVNSSSHEGSPVTHKRGKGYGFRREKR
                     LKANIQWKRFVGALQVTCMATRPTVRPLKYGSELSFTKSVSNLSPSKLYDSYGRRKTK
                     MSNYVRVFDSQLNREIGRVPEDIAQIVYPLIGKNEISFEATLIFCDNKRLSIGDTFVV
                     QLDCFLTSAIFEEKKPDKKPTTNHSANEWGNSRKTIVETDEELQNRSRMVALISLFDK
                     LKINPVTDENAILEKLNSGIDDQGEVIDLEDDKSFNELMSQDYEEQGMTQHHEDSMNL
                     NQLKTFYNAAQSLESLKNLPETEPSKDVFKLDLRRYQKQGLTWMLRREREFAKAASDG
                     KDPEIDGNLMNPLWKQFKWPKDMSWAAQKLSGSSILVDSDIFFYANLHTGEFSVNKPV
                     LKTMMKGGLLSDEMGLGKTVSTLSLILTCPHDSDVVDKTLFKEDNDDEIIGKSVKKPY
                     ASRTTLIVVPMSLLNQWSSEFTKANNSPDMRSEIYYGGNVSSLKKLLTATGNPPTVVI
                     TTYGIVQSEWLKLSKTKMNSGDIQASTGLFSVDFYRVVIDEGHTIRNRTTATSKAIME
                     LTSKCRWILTGTPIINRLDDLYSMVKFLQLEPWSQISYWKMFVSTPFENKNFRQAFDV
                     VNAILEPVLLRRTKQMKDIDGKPLVELPPKEIVVERIKLNKTQNAVYKYLLNRAESSV
                     QSGLARGDLLKKYSTILVHILRLRQVCCDVALLGAQDENDEDLSQGNKIVNDSKELDD
                     LIAQTNKENQSGGFTEEELAKAIADIQQKYENSEKFRSLECSICTTEPINVENVVFTE
                     CGHPFCENCLDEYFAFQSQKKLDFNCPNCREGISPSRLLTLYKDESQSLLLKHYDNDP
                     KSAKVGALLNHLKLLQDTSAGEQVVVFSQFSSYLDILERELTEALPADSSKVYKFDGR
                     LSLKERSVVLQDFQVKDLSRQKILLLSLKAGGVGLNLTCASQAYMMDPWWSPSMEDQA
                     IDRIHRIGQTNNVKVVRFIVENSIEEKMLRIQERKRTIGEAMDADEDERRKRRIEEIK
                     MLFE"
     gene            complement(<372031..>374616)
                     /gene="NDAI0E01850"
                     /locus_tag="NDAI_0E01850"
                     /db_xref="GeneID:11498891"
     mRNA            complement(<372031..>374616)
                     /gene="NDAI0E01850"
                     /locus_tag="NDAI_0E01850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670196.1"
                     /db_xref="GeneID:11498891"
     CDS             complement(372031..374616)
                     /gene="NDAI0E01850"
                     /locus_tag="NDAI_0E01850"
                     /inference="similar to DNA sequence:INSDC:YMR125W"
                     /note="similar to Saccharomyces cerevisiae STO1 (YMR125W);
                     ancestral locus Anc_2.413"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670244.1"
                     /db_xref="GeneID:11498891"
                     /db_xref="GOA:G0WB81"
                     /db_xref="InterPro:IPR015172"
                     /db_xref="InterPro:IPR015174"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR027159"
                     /db_xref="UniProtKB/TrEMBL:G0WB81"
                     /translation="MTLSNHTNTESSNNSSSRSKRSDESPVLQLCREMMADICTIGES
                     IKVFDDDVKFLTEAICDEFGRYNFFDNSLKETFFSVVTEQPHKQPAIGILVIVNXDFV
                     KKKEGREGILIVIISLLKLQENIDDSLDSNQKSGTKGTGCWNIIKLITRFLALISFTL
                     DPKEIISIYEALFQISIDLKVSCYPERNPLSEAIYVNLLLNIPYFFYFNHFREDLMMD
                     IIQLLTFVEKNFKTETQTQTLKLLKVFSYLGAFETLLLDITLQNVVNALKGGLRELDD
                     LFISLDHLLPSEINRLDNFPNLKYPCASTISSSNFIQNRGSIDYMWKLPRMHFRIYVP
                     NDDIDFETVVPITTYAGQLLNDIIIDVVESIEYNRKEVAKQVLTLDIFFKKGIFTAPG
                     EDMNKLKEAYEEVPSTSTFKIEDLVIETILSLVFKLPDTPQPLVYYYSLLVEICQISP
                     IAIAPVFGRAFRYFYNNIEGLDAELQLRYLDWFTLQISNFNFDWKWNEWTDYFYKYEK
                     SFYNPKVNFVKNLIKKAIRSTSNTTIVEAKLPELFKPYANAGLVSEKELHEYYQSFFS
                     HFKVAISDIKANDLYFLQENVPFETQVRDILKYMHKPNNQRDMDELQGILDEIRTRYQ
                     SMIREMDEFIVVLLTQCVTYSGNRSLSHSNKYINDLQQDLHIALSDLNLSTCTKEFIM
                     IESILRFWNNNSQTGFLVVDAFRYSGLVSSKAVIDFVLKSYNGKIYGLTDDTAIECIF
                     RTLTRGRITRVNNFLGAQYVFQKLYSVLFETVEEYEKRGYISIEVLPTFDSSLYVDSF
                     EKWNIKWKYNQTMLLMKSIIRRYASNLSNDAKVIKKPIQDSNLHEHTKQEILRWLTEI
                     SRNCF"
     gene            <375816..>376430
                     /gene="NDAI0E01860"
                     /locus_tag="NDAI_0E01860"
                     /db_xref="GeneID:11498892"
     mRNA            <375816..>376430
                     /gene="NDAI0E01860"
                     /locus_tag="NDAI_0E01860"
                     /product="ribosomal protein L15"
                     /transcript_id="XM_003670197.1"
                     /db_xref="GeneID:11498892"
     CDS             375816..376430
                     /gene="NDAI0E01860"
                     /locus_tag="NDAI_0E01860"
                     /inference="similar to DNA sequence:INSDC:YLR029C,YMR121C"
                     /note="similar to Saccharomyces cerevisiae RPL15A
                     (YLR029C) and RPL15B (YMR121C); ancestral locus Anc_2.417"
                     /codon_start=1
                     /product="ribosomal protein L15"
                     /protein_id="XP_003670245.1"
                     /db_xref="GeneID:11498892"
                     /db_xref="GOA:G0WB82"
                     /db_xref="InterPro:IPR000439"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR020925"
                     /db_xref="InterPro:IPR024794"
                     /db_xref="UniProtKB/TrEMBL:G0WB82"
                     /translation="MGAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRASRPSR
                     PDKARRLGYKAKQGFVIYRVRVRRGNRKRPVPKGATYGKPTNQGVNELKYQRALRATA
                     EERVGRRAANLRVLNSYWVNQDSTYKYFEVILIDPSHKAIRRDARYNWICNPVHKHRE
                     NRGLTATGKKSRGINKGHRYNNTKSGRSKIWKKHNTLSLWRYRK"
     gene            <378142..>380136
                     /gene="NDAI0E01870"
                     /locus_tag="NDAI_0E01870"
                     /db_xref="GeneID:11498893"
     mRNA            <378142..>380136
                     /gene="NDAI0E01870"
                     /locus_tag="NDAI_0E01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670198.1"
                     /db_xref="GeneID:11498893"
     CDS             378142..380136
                     /gene="NDAI0E01870"
                     /locus_tag="NDAI_0E01870"
                     /inference="similar to DNA sequence:INSDC:YMR119W,YNL008C"
                     /note="similar to Saccharomyces cerevisiae ASI1 (YMR119W)
                     and ASI3 (YNL008C); ancestral locus Anc_2.419"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670246.1"
                     /db_xref="GeneID:11498893"
                     /db_xref="UniProtKB/TrEMBL:G0WB83"
                     /translation="MLYNSTFFSYFRLWNTTQYASYSLSGSKYLNISDTTNIAKIVNM
                     ARMTNVTNVTNLAHMANITNKVDTTNVTIKLIDKNPPFPSSSEFFAWFMLYVLPHMIV
                     INAVIDRLKNIPVMKSNIKQINLPAWSRISLHLLALVPLTCGISVFYMRSCILQVYES
                     LFGASFESFFGGLYYILCLSHGVEVFYSSTTNSSQLLTPNFGVSQLGFEFYSLWAMAK
                     YEKYTPETSFLIRTDCTLLLVNRLIIHLVEVLNMRKKYSIFSTTVYLVYLPFFLKNFN
                     SLPFALKAREINKLLSVVMIFTSFIFHSFRYITNKDKNSIFKYMHMFKLLNLTGEENI
                     ELTLFKFATFLCDGNDIDEFPRQDPEIHSPLQEHSYIISGYLNEVNSNPEDYDTIIPD
                     VESSIFSSPTAMLVMLISLCCSVIISRTNLMIYGSTLEMKKRRAEGKRRTHSKHYDLN
                     NLITDNNYAMFMTRVLKTDKLCVHDPDKYLLPDTDTSPDYNPPINDPRSEDEDGVDSA
                     KEEEILSESIEEESRIFDLLVPVDDSFEAPDLNWYLSMWSIMKYTFQYDKRLTRTSYW
                     ELANKTILNEIIHERRTQSTKEPSQDEDLFSFSDDDDDEEELDLTCVLCKRHRRRIVL
                     WPCNCLTICDECRLAIGRRGTTKCICCAEPVKGYSKLNVV"
     gene            complement(<381374..>383152)
                     /gene="NDAI0E01880"
                     /locus_tag="NDAI_0E01880"
                     /db_xref="GeneID:11498894"
     mRNA            complement(<381374..>383152)
                     /gene="NDAI0E01880"
                     /locus_tag="NDAI_0E01880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670199.1"
                     /db_xref="GeneID:11498894"
     CDS             complement(381374..383152)
                     /gene="NDAI0E01880"
                     /locus_tag="NDAI_0E01880"
                     /inference="similar to DNA sequence:INSDC:YLR028C,YMR120C"
                     /note="similar to Saccharomyces cerevisiae ADE16 (YLR028C)
                     and ADE17 (YMR120C); ancestral locus Anc_2.418"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670247.1"
                     /db_xref="GeneID:11498894"
                     /db_xref="GOA:G0WB84"
                     /db_xref="InterPro:IPR002695"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="InterPro:IPR024050"
                     /db_xref="InterPro:IPR024051"
                     /db_xref="UniProtKB/TrEMBL:G0WB84"
                     /translation="MPKHTKTAILSVYDKTGLLDLAKGLVENNVRILASGGTAQLVRE
                     AGFPVDDVSSITHAPEMLGGRVKTLHPAIHGGILARNLESDENDLRAQNIEKVDFVIC
                     NLYPFKETVSKIGVTVPEAVEEIDIGGVTLLRAAAKNHTRVTILSDPNDYSVFLSELN
                     SNGEISQELRNRLALKAFERTADYDATISDFFRKQYSENKAQLPLRYGANPHQKPAQA
                     YITQEEELPFKVLCGTPGYINLLDAFNSWPLVKELSASLNLPAAASFKHVSPAGAAVG
                     VPMTEVEKQVYCVSDIKDLSPLACAYARARGADRMSSFGDFIALSNIVDVPTARIISK
                     EVSDGVIAPGYEPEALEILSKKKNGKYCILQVDPNYVPDCMESRQVYGITLQQKRNDA
                     IINKSSFKEIVSANQSLPEQAIIDLTVATLALKYTQSNSVCYAKNGMVIGLGAGQQSR
                     IHCTRLAGDKADNWWLRQHPKVLDFKWAKGTKRPDKSNVIDLFVTGQIPEDEPEKTDY
                     ESKFEQVPIPFTKEERKEWLSKLNNVSLSSDAFFPFPDNIYRAAKSGVKFIAAPTGSV
                     MDKVVLNAADSFDMVYVENPIRLFHH"
     gene            complement(<384211..>385410)
                     /gene="NDAI0E01890"
                     /locus_tag="NDAI_0E01890"
                     /db_xref="GeneID:11498895"
     mRNA            complement(<384211..>385410)
                     /gene="NDAI0E01890"
                     /locus_tag="NDAI_0E01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670200.1"
                     /db_xref="GeneID:11498895"
     CDS             complement(384211..385410)
                     /gene="NDAI0E01890"
                     /locus_tag="NDAI_0E01890"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670248.1"
                     /db_xref="GeneID:11498895"
                     /db_xref="GOA:G0WB85"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G0WB85"
                     /translation="MPLVKDYTPVPLANTDLFKALKVGNTTVEHRVVMAPLTRMRAHA
                     PGHIPNKDWEVVYYDQRSKRKGTMIITEAVSPSAQSSGIDNAPGIWTPEQIEQWTKIF
                     NKIHENGSFVWVQLCATGRQAFPDAMARDGLRYDSASDNLYMDDELKERAIKSNNPQH
                     GITKDEIKQYIKDFVQGTKNAVEAGADGVEIHSCNGCLLNQFLDPTSNHRTDEYGGSI
                     ENRSRFTLEVIDALIEAVGPERVGIRLSPWNRYAGMSGSADPTLLSQYCYVVGELEKR
                     AKAGKRIAFIHLIEPRVTDIFFDCTAVPEDDGTNDFIYSIWKGVVIRAGMFPSRPDSI
                     KAAVANDQTMIAAGRYFISTPDLVDRLEKGQPLNKYDRSTFYSFTKEGFTDYPTYEEA
                     VKLENSN"
     gene            complement(<386016..>387032)
                     /gene="NDAI0E01900"
                     /locus_tag="NDAI_0E01900"
                     /db_xref="GeneID:11498896"
     mRNA            complement(<386016..>387032)
                     /gene="NDAI0E01900"
                     /locus_tag="NDAI_0E01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670201.1"
                     /db_xref="GeneID:11498896"
     CDS             complement(386016..387032)
                     /gene="NDAI0E01900"
                     /locus_tag="NDAI_0E01900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670249.1"
                     /db_xref="GeneID:11498896"
                     /db_xref="GOA:G0WB86"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G0WB86"
                     /translation="MTEPAPPYSKLNVLCDIYYGFRPNKPTFLPQDYPDLTDKTAIVT
                     GSNTGIGLQVVKLLYSKNCNVLSVVRTKSKGDAARDETIAEFPASKGSITVIGGCDYL
                     DLTTVKPAASKIKDIIGDKPLNLIIHNAALMASVNTATSKQGYEAMFQTNVMGSQLLQ
                     HFLDPIFLKKDDDLKRIVWVSSGAHLLGFKEYGINWDDPTFENCTVEERPSANTLYGQ
                     SKAANIFQAKAWASKNKEKVDEIGCVSVSCYPGNLKTDLQRDWNGWLRILRRSLFWDG
                     IYGAYSELYAALSPKLTTKDQGAYVVPFGEVRDPREDVKVGLTNGSDLKLWDWVNDKI
                     KEFF"
     gene            <388217..>389482
                     /gene="NDAI0E01910"
                     /locus_tag="NDAI_0E01910"
                     /db_xref="GeneID:11498897"
     mRNA            <388217..>389482
                     /gene="NDAI0E01910"
                     /locus_tag="NDAI_0E01910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670202.1"
                     /db_xref="GeneID:11498897"
     CDS             388217..389482
                     /gene="NDAI0E01910"
                     /locus_tag="NDAI_0E01910"
                     /inference="similar to DNA sequence:INSDC:YLR027C"
                     /note="similar to Saccharomyces cerevisiae AAT2 (YLR027C);
                     ancestral locus Anc_2.420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670250.1"
                     /db_xref="GeneID:11498897"
                     /db_xref="GOA:G0WB87"
                     /db_xref="InterPro:IPR000796"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G0WB87"
                     /translation="MSATIFNNIEQLPPDALFGIKQRYSKDTRSHKVDLGIGAYRDNN
                     GKPWVLPSVKLAEHSIHSDPSYNHEYLNISGLNAFTTGASNILFGPDSIAIKESRIVS
                     NQSVSGTGALHIAAKFISKFFPEKKIYFSKPTWANHQAIFQAQNLQCDSYPYWDAATK
                     SIDMEGYLNAIKTAPRGSVFVLHACAHNPTGLDPTNEQWANILDMLNMGDHLVLFDSA
                     YQGFASGDLNKDAYAVRLGVEKLSDNVPIFVCQSFAKNVGMYGERVGCFHLVLPRQSN
                     EDETAKVKAALSSQLNKIVRSEISNPPAYGAKIVAQILNDENMTNQWHKDMVTMSSRI
                     IKMRHSLRDKLNELGTPGNWDHIVSQTGMFSFTGLTADMVKRLEEEHAIYMVSSGRAS
                     IAGLNEHNVDHVAKSIDEVVNHYSSEAKL"
     gene            <391319..>392428
                     /gene="NDAI0E01920"
                     /locus_tag="NDAI_0E01920"
                     /db_xref="GeneID:11498898"
     mRNA            <391319..>392428
                     /gene="NDAI0E01920"
                     /locus_tag="NDAI_0E01920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670203.1"
                     /db_xref="GeneID:11498898"
     CDS             391319..392428
                     /gene="NDAI0E01920"
                     /locus_tag="NDAI_0E01920"
                     /inference="similar to DNA sequence:INSDC:YLR026C"
                     /note="similar to Saccharomyces cerevisiae SED5 (YLR026C);
                     ancestral locus Anc_2.421"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670251.1"
                     /db_xref="GeneID:11498898"
                     /db_xref="GOA:G0WB88"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006011"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="InterPro:IPR021538"
                     /db_xref="UniProtKB/TrEMBL:G0WB88"
                     /translation="MTSLQPRNIRDRTSEFQQSVLTCKKRSKQSQQQQTQANTQRGKI
                     SDFQRNASLIANEISQTAQLLSKLAILAKRKPMVNDSPVEIAELSFLIKRKIYSIESS
                     LIELSKSRRNNKSVAGVNDFGRRNTGDEHSSNVVTLLNTKMKNISGDFKNVLEMRQQL
                     ELNNMDRWEKISKDEQLKQQQQQQQQIPQGHTQPGQQRERQNDGTIEDSNKTGGSNVM
                     GTSSYNSSNPFMTSLINDEEDDMLLTNQSNYNKDGSGGLTLPQSSDKELLLMEEGLVN
                     NNVYLQERNQAVETIESTIQEVGNLFQQLASMVQEQGEVIQRIDANVDDIDLNITGAQ
                     RELLKYFDRIKSNRWLAVKIFFIIFVFFLLWVLVN"
     gene            <392953..>393708
                     /gene="NDAI0E01930"
                     /locus_tag="NDAI_0E01930"
                     /db_xref="GeneID:11498899"
     mRNA            <392953..>393708
                     /gene="NDAI0E01930"
                     /locus_tag="NDAI_0E01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670204.1"
                     /db_xref="GeneID:11498899"
     CDS             392953..393708
                     /gene="NDAI0E01930"
                     /locus_tag="NDAI_0E01930"
                     /inference="similar to DNA sequence:INSDC:YLR025W"
                     /note="similar to Saccharomyces cerevisiae SNF7 (YLR025W);
                     ancestral locus Anc_2.422"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670252.1"
                     /db_xref="GeneID:11498899"
                     /db_xref="GOA:G0WB89"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:G0WB89"
                     /translation="MWSYFFGGSGNSNDFSKTSSKNKDLPKKAIIELREHINLLTKKQ
                     THLQTQILNQSNEAKTFLNKGNKIMAKNSLKKRKIYENQLGKIDSQIYSLEQQLFSIE
                     SANLNLETMKAMKQGSMAMKSIHKGLNIDKVDETMDEIRDQVELNEEISEAISRPVLT
                     SMNDIDEDELDEELDMLASESVQQNVERSKGRVHDMVEESARDNNNAVELPNVPSNKI
                     AQQATTESNEPAQEESEDEDERALRELQAEMGL"
     gene            <394249..>394956
                     /gene="NDAI0E01940"
                     /locus_tag="NDAI_0E01940"
                     /db_xref="GeneID:11498900"
     mRNA            <394249..>394956
                     /gene="NDAI0E01940"
                     /locus_tag="NDAI_0E01940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670205.1"
                     /db_xref="GeneID:11498900"
     CDS             394249..394956
                     /gene="NDAI0E01940"
                     /locus_tag="NDAI_0E01940"
                     /inference="similar to DNA sequence:INSDC:YKL141W,YMR118C"
                     /note="similar to Saccharomyces cerevisiae SDH3 (YKL141W)
                     and YMR118C; ancestral locus Anc_2.423"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670253.1"
                     /db_xref="GeneID:11498900"
                     /db_xref="GOA:G0WB90"
                     /db_xref="InterPro:IPR000701"
                     /db_xref="InterPro:IPR018495"
                     /db_xref="UniProtKB/TrEMBL:G0WB90"
                     /translation="MLVRLGLNSNLIKTRTPLSNGGGFNSMMTKLIAPYSQMATARTI
                     LLSSSSSSSSSIPILMKNTASRTTLQNMMTIRSFTQNSILNENVPSSKDTQDSTILRE
                     QRAKRPISPHLTIYQPQLTWYLSSLHRVTLVLMGFAFYLVTIAFGLTGLFQSNNSENK
                     LTSNSLINWYHNKMSNMTKWTVKGAFAYMFTLHYALSVRHLIWDMAKELSLKGVYRTG
                     YAAMGFAALVGTWLFSL"
     gene            <395504..>397513
                     /gene="NDAI0E01950"
                     /locus_tag="NDAI_0E01950"
                     /db_xref="GeneID:11498901"
     mRNA            <395504..>397513
                     /gene="NDAI0E01950"
                     /locus_tag="NDAI_0E01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670206.1"
                     /db_xref="GeneID:11498901"
     CDS             395504..397513
                     /gene="NDAI0E01950"
                     /locus_tag="NDAI_0E01950"
                     /inference="similar to DNA sequence:INSDC:YKL140W"
                     /note="similar to Saccharomyces cerevisiae TGL1 (YKL140W);
                     ancestral locus Anc_2.424"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670254.1"
                     /db_xref="GeneID:11498901"
                     /db_xref="GOA:G0WB91"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR006693"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0WB91"
                     /translation="MLVPFIGRISLADYLIIISLYIEFIMSFFLKLIPQPIINFLSSI
                     INYTTNLDDSTREQKLRLAPTIHEMCAQFDINIEDHLVRTEDDYILTLHRIPPKTNIT
                     GSGTGKIVYLHHGLLMCSDIWCCQLDKNKNLPFVLHNLGYDVWMGNNRGNKYSTAHLY
                     EMPKSKKFWDFSIDEFAFFDIPNSIDFILNHCQRDKLICIGFSQGSAQMFASFSINEY
                     LNSKVSQFIAIAPAMTPKGLHNRIVDTFAKSSPALMYLFFGRNILLPSATTIWQKTLH
                     PKIFNLCIDIGNRILFNWTSKNISEQQKLICYSKLYSTTSVKSVVHWFQILKSQKFQM
                     FEASDNMFNSITRPYQISRFPTRTNIKIPILLIYGGMDSLVDIKVMKKNLPQTGVFDI
                     KVENHEHLDLIWGEDTDTLVISKIIKFIDFFDGVSRRNSLLQKTLNKRIMSTKNYNTS
                     GISTNEEQHHPYVMDLEDNTPIIPYSNETLIINDNVSQKDESVMLENQFASTSSIGNT
                     PSMLRHVKTRSKTKLNSDKPVITSTMRNYINNTRSIINELDKKSLAENKNNNISNNND
                     NHEYSIGLSPTASSYNGEDDIVGKNDQGIYVEELEASPSNVKATLDNEFALNNDTCTD
                     DEDEDDDDGDESNSIDRINSNEKLKNKIQQRKLSKYLSNEVQANT"
     gene            <397897..>399717
                     /gene="NDAI0E01960"
                     /locus_tag="NDAI_0E01960"
                     /db_xref="GeneID:11498902"
     mRNA            <397897..>399717
                     /gene="NDAI0E01960"
                     /locus_tag="NDAI_0E01960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670207.1"
                     /db_xref="GeneID:11498902"
     CDS             397897..399717
                     /gene="NDAI0E01960"
                     /locus_tag="NDAI_0E01960"
                     /inference="similar to DNA sequence:INSDC:YKL139W"
                     /note="similar to Saccharomyces cerevisiae CTK1 (YKL139W);
                     ancestral locus Anc_2.425"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670255.1"
                     /db_xref="GeneID:11498902"
                     /db_xref="GOA:G0WB92"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0WB92"
                     /translation="MGHPTNNNHNTATSRSNNSKGLRRRLKNNSSSSSNRGVRTTNSN
                     QPKSMALQQSRYSAESTVNSSSSSSSSSQQQLQQRQHSRYHNDSTNNSRYNNVDDNNN
                     RYKRFPNKRVHPEDERETGHQQQHSNPNFIRNLPRGPKRRQPLPVSKQQQLPHSLPSG
                     PAASSRYDPNSKPKQMGTARTRLPPRPSFTKTLGPSAVSPNSIPVPSTTSRDHKKKLY
                     RLHRHQLLFLTQTRTSSIYEQISQVGEGTYGKVFKSKNKNTKQLVALKKLRLNSEKDG
                     FPITSIREIKLLQSFNHENIAVLREIMVESISSSSANSSPSMSSSSSSNSGQSNLLNG
                     SSNIGIINSIYMIFQYADNDLTGLLNDKNLQIKPSQCKHLLKQLLHGVQYLHDSFILH
                     RDIKGSNILVDNLGNLKITDFGLARKILPHSPSDKKDIINDYTNRVITLWYRPPELLM
                     GTTNYSTEVDMWGCGCILIELFNKVAIFQGMNEIEQLVSIFKILGSPTLENFPNFFSM
                     PWFFMIIPLLNEKYNDCFEEKFKNILPSEECLKLVRGLLLYDQSKRLSAHEALQSQYF
                     IEDPKPEPLILKGYGGSHEYEMKLARRLQKREEMKKHSKS"
     gene            complement(<400036..>400245)
                     /gene="NDAI0E01970"
                     /locus_tag="NDAI_0E01970"
                     /db_xref="GeneID:11498903"
     mRNA            complement(<400036..>400245)
                     /gene="NDAI0E01970"
                     /locus_tag="NDAI_0E01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670208.1"
                     /db_xref="GeneID:11498903"
     CDS             complement(400036..400245)
                     /gene="NDAI0E01970"
                     /locus_tag="NDAI_0E01970"
                     /inference="similar to DNA sequence:INSDC:YKL138C-A"
                     /note="similar to Saccharomyces cerevisiae HSK3
                     (YKL138C-A); ancestral locus Anc_2.426"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670256.1"
                     /db_xref="GeneID:11498903"
                     /db_xref="InterPro:IPR013183"
                     /db_xref="UniProtKB/TrEMBL:G0WB93"
                     /translation="MNPTKQRQYAHLAQQLKLLNQNLEKTTEELNIMSSQCNKNIVGQ
                     IGKIHSSWFIASNRYFEKEMLGEGR"
     gene            complement(<400618..>401019)
                     /gene="NDAI0E01980"
                     /locus_tag="NDAI_0E01980"
                     /db_xref="GeneID:11498904"
     mRNA            complement(<400618..>401019)
                     /gene="NDAI0E01980"
                     /locus_tag="NDAI_0E01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670209.1"
                     /db_xref="GeneID:11498904"
     CDS             complement(400618..401019)
                     /gene="NDAI0E01980"
                     /locus_tag="NDAI_0E01980"
                     /inference="similar to DNA sequence:INSDC:YKL138C"
                     /note="similar to Saccharomyces cerevisiae MRPL31
                     (YKL138C); ancestral locus Anc_2.428"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670257.1"
                     /db_xref="GeneID:11498904"
                     /db_xref="InterPro:IPR016340"
                     /db_xref="UniProtKB/TrEMBL:G0WB94"
                     /translation="MFGAFKSTSPSLGGLLWKIPWRLSSHQKYRQRNRLKHVDEVIKQ
                     ITTGLHVMRCEDKGIEYKKAISMPKKQMFKPRMASLRLLNKSSFFPKEFQMSSKDKYT
                     VFDKKVKGYRKGIHKVPKWTKISMRQNPKFF"
     gene            <401261..>401599
                     /gene="NDAI0E01990"
                     /locus_tag="NDAI_0E01990"
                     /db_xref="GeneID:11498905"
     mRNA            <401261..>401599
                     /gene="NDAI0E01990"
                     /locus_tag="NDAI_0E01990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670210.1"
                     /db_xref="GeneID:11498905"
     CDS             401261..401599
                     /gene="NDAI0E01990"
                     /locus_tag="NDAI_0E01990"
                     /inference="similar to DNA sequence:INSDC:YKL137W"
                     /note="similar to Saccharomyces cerevisiae YKL137W;
                     ancestral locus Anc_2.429"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670258.1"
                     /db_xref="GeneID:11498905"
                     /db_xref="InterPro:IPR013892"
                     /db_xref="UniProtKB/TrEMBL:G0WB95"
                     /translation="MEAIMPEEPKTSISNHNSKVPIWALSATDERTARKNLKAFTYQQ
                     CHEYVKAMADCAKLNGIKVFPNCDPEKAKMKNCLLFYQNDSKYLDDERDKLILERINK
                     LEEQFKQGKK"
     gene            complement(<401769..>403946)
                     /gene="NDAI0E02000"
                     /locus_tag="NDAI_0E02000"
                     /db_xref="GeneID:11498906"
     mRNA            complement(<401769..>403946)
                     /gene="NDAI0E02000"
                     /locus_tag="NDAI_0E02000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670211.1"
                     /db_xref="GeneID:11498906"
     CDS             complement(401769..403946)
                     /gene="NDAI0E02000"
                     /locus_tag="NDAI_0E02000"
                     /inference="similar to DNA sequence:INSDC:YKL135C"
                     /note="similar to Saccharomyces cerevisiae APL2 (YKL135C);
                     ancestral locus Anc_2.430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670259.1"
                     /db_xref="GeneID:11498906"
                     /db_xref="GOA:G0WB96"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016342"
                     /db_xref="InterPro:IPR026739"
                     /db_xref="UniProtKB/TrEMBL:G0WB96"
                     /translation="MPPLDKRIKKFLKNSIRIAPKISDKGELAELRTGLVSQYPQTRK
                     DAIKKTIQQMTVGKDVSTLFPDVLKNMATNDIEQKKLVYLYVMNYAETHPELCILAVN
                     TFVTDAQDPNPLIRCMAIRTMSMIRVEKILEYIEIPLRRTLQDDNPYVRKTAVICVAK
                     LFQLNKELCIELGVLEDLKSSLDDENPMVVANATASLAEINDMDPSIVDLKSLIQLHV
                     KQFLAVLNECTEWARITILGALSEYSARDGLEAQDIIDRVTAHLQHVNPAVVLATIKV
                     VIKNLPQTDFNPNSLIMKKLSSALVSLMSSPPEMQYVALKNIRIILEKYPEILSKELR
                     IFYIKFNDPLYVKLEKIDILIRLVDKGNLKQCSLLLTELKEYSMEFEPEFVSRAIQGL
                     SQLGIKFSGEKFLQKVLDILIELIDRDQNSIKDDCCIAMCNILRHLPENTDMASQICS
                     ILNAWESPDEYLRTDVAKCNYVWLLGQYPENFPSLKAKVNIFLELFNQEESLTQTSIL
                     ITVVRLHSKLPGSTLQSVLEKATKETTELDVRDMAIMYWRCLSMDDSEELVEELCKII
                     PPHLETTIDQFSPDLLEKLLLELGTISSIYFKPQANRRTRDVSYENVVKGKEINELQD
                     LAKNELASKANEEVLLDFGDDDEEDEDELDGDNLTSVRTNKKYSALDDLDDLFNFGTT
                     TGKPKSFKDDIGISQGINELNLRPSVDSNSRSQSNTQELLDLF"
     gene            complement(<404579..>406915)
                     /gene="NDAI0E02010"
                     /locus_tag="NDAI_0E02010"
                     /db_xref="GeneID:11498907"
     mRNA            complement(<404579..>406915)
                     /gene="NDAI0E02010"
                     /locus_tag="NDAI_0E02010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670212.1"
                     /db_xref="GeneID:11498907"
     CDS             complement(404579..406915)
                     /gene="NDAI0E02010"
                     /locus_tag="NDAI_0E02010"
                     /inference="similar to DNA sequence:INSDC:YKL134C"
                     /note="similar to Saccharomyces cerevisiae OCT1 (YKL134C);
                     ancestral locus Anc_2.432"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670260.1"
                     /db_xref="GeneID:11498907"
                     /db_xref="GOA:G0WB97"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="InterPro:IPR024077"
                     /db_xref="InterPro:IPR024079"
                     /db_xref="InterPro:IPR024080"
                     /db_xref="UniProtKB/TrEMBL:G0WB97"
                     /translation="MMVTRTELKQLRYLRIFRNQVLPTKFYRSSVRRNLWTKQQDPPL
                     KRVFDDSQYWVSINNPNNTYTGKILSQLVPNPATKTTGLFANPYLTTPSGLREFSDVS
                     LAKAKKIIDNLKSDRSLDGKVNFVIELDRLSDTLCRVIDLCEFIRSAHPEEGFIEAAQ
                     DCHEKLFEFMNVLNTDRELCELLNETLQDEQVLSKLSEEEKKVGYILLQDFIKSGIYM
                     DSGKKDQFITLSQDISVIGQEYINNINQLARNHIKVKRSELDNAGIEFDVACQLGKDI
                     TGKYYKIPTYGHLPFLILKACTDPEIRKKIWVAMHDCSKQQIERLTNLVKIRAFLAHT
                     MGRECYAAYAIDGKMAKNPKDVDEFLKSLMDFLKPKAAKELKFISDLIHNEKGEKPSD
                     DVDEILTAVRPWDREYYTAIHRNKQKHLLLDDYALDVYYPLGNVIQGLSDIFESIYGI
                     RFEPAVAGKGETWSSDVRRLNVVSEKEGLIGIIYCDLFRRQGKTNNAAHFTICCSRQI
                     YPHEDDFSTIQLGTNVDGTKFQLPIISLLCNFNTRCLNSGETICLLALNEIETLFHEM
                     GHAIHSMLGRTRLQNVSGTRCSTDFVELPSVLMEHFARDTRVLKRIGHHYKTGDRVPA
                     TLLNRYLEKARFLKDCETFSQAKMAMLDQRLYDKNIVQNIDSVDVVKIYHELEKELEV
                     LVDDESNWCAKFGHLFGYGATYYCYLFDRAIASKVWKKLFEKDPYSRSGGEKFKNDVL
                     KWGGLREPWNCVADVLDNPDLAHGGEKAMKFIGHVDDI"
     gene            complement(<407186..>408472)
                     /gene="NDAI0E02020"
                     /locus_tag="NDAI_0E02020"
                     /db_xref="GeneID:11498908"
     mRNA            complement(<407186..>408472)
                     /gene="NDAI0E02020"
                     /locus_tag="NDAI_0E02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670213.1"
                     /db_xref="GeneID:11498908"
     CDS             complement(407186..408472)
                     /gene="NDAI0E02020"
                     /locus_tag="NDAI_0E02020"
                     /inference="similar to DNA sequence:INSDC:YKL132C,YMR113W"
                     /note="similar to Saccharomyces cerevisiae RMA1 (YKL132C)
                     and FOL3 (YMR113W); ancestral locus Anc_2.435"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670261.1"
                     /db_xref="GeneID:11498908"
                     /db_xref="GOA:G0WB98"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="InterPro:IPR018109"
                     /db_xref="UniProtKB/TrEMBL:G0WB98"
                     /translation="MSIELGLTRIAKLLDHIGNPHTSLKVLHIAGTNGKGSVCSYLSS
                     ILGYNQVYKVGKFTSPHLIKITDSITVNNVPVSDLEFNKIRTDLKSINDQFSLDCSEF
                     ELLTCTALKYFHQANCKFCILEVGLGGRLDATNVVPGSSKYACGITKIGLDHESFLGN
                     SLPEIAKEKAGIITEGSKFAVVDGSNDPSVLEVVKKRCDAMNCNLMITNGSVDSNKIE
                     TKSWGLLNWKNLPLNGEYQIFNLRVAISILDHLQKINKINVSKNELQDGIFSVRWPGR
                     LQTIKYHYKNGDQDVTVPLLLDGAHNGSAAVELAKYLRKTFGDDELTFIMAVTNGKKL
                     SPLLDPILRSKDHVVITRFGSVEGMPWIKPIDPTELSDFIEKNYTKNVEVQPSIKQVL
                     VDVAYNYKSNKRPVVICGSLYLCGEILRVYNQQLQK"
     gene            complement(<408950..>409693)
                     /gene="NDAI0E02030"
                     /locus_tag="NDAI_0E02030"
                     /db_xref="GeneID:11498909"
     mRNA            complement(<408950..>409693)
                     /gene="NDAI0E02030"
                     /locus_tag="NDAI_0E02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670214.1"
                     /db_xref="GeneID:11498909"
     CDS             complement(408950..409693)
                     /gene="NDAI0E02030"
                     /locus_tag="NDAI_0E02030"
                     /inference="similar to DNA sequence:INSDC:YKL130C"
                     /note="similar to Saccharomyces cerevisiae SHE2 (YKL130C);
                     ancestral locus Anc_2.438"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670262.1"
                     /db_xref="GeneID:11498909"
                     /db_xref="GOA:G0WB99"
                     /db_xref="InterPro:IPR024261"
                     /db_xref="UniProtKB/TrEMBL:G0WB99"
                     /translation="MTASKKQQTKRKVESLRVTDEIITSLTSIIELYVEYVTHNIQLL
                     NKFIGHMRRVSTLRFERTTLIKFVKKLRFYNESLQNINIKEYTSAHDDLSFIVVFFGS
                     FSIKFLETLDLLKYFFTESLQKEILSKTLNSDLTLSSETILNMDITYNHFVKFTQWMI
                     ESINLQNNLLSLEIIEFTLKCAAEDGTSPEETDNIFLQQVATVEDEEEYQYLMDQWSQ
                     VLREKVQVLEDSFEVDAAVWQENLGKIKN"
     gene            complement(<410244..>413957)
                     /gene="NDAI0E02040"
                     /locus_tag="NDAI_0E02040"
                     /db_xref="GeneID:11498910"
     mRNA            complement(<410244..>413957)
                     /gene="NDAI0E02040"
                     /locus_tag="NDAI_0E02040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670215.1"
                     /db_xref="GeneID:11498910"
     CDS             complement(410244..413957)
                     /gene="NDAI0E02040"
                     /locus_tag="NDAI_0E02040"
                     /inference="similar to DNA sequence:INSDC:YKL129C,YMR109W"
                     /note="similar to Saccharomyces cerevisiae MYO3 (YKL129C)
                     and MYO5 (YMR109W); ancestral locus Anc_2.440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670263.1"
                     /db_xref="GeneID:11498910"
                     /db_xref="GOA:G0WBA0"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR010926"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WBA0"
                     /translation="MGLIRRGVRNKTAAEPVKRSAKIKKATFDATKKKEVGVSDLTLL
                     SKISDESINENLKKRFMNATIYTYIGHVLISVNPFRDLGIYTDAILDSYKGKNRLEVP
                     PHVFAIAESMYYNLKSYNESQCVIISGESGAGKTEAAKRIMQYIASASTSHSESIGKI
                     KDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNSQFEPCAGNITNYLLEKQRVV
                     GQIKNERNFHIFYQFTKGASDTYRQTFGVQKPEQYIYTSASGCTSVDTIDDLKDYQET
                     LKAMQTIGLAQEEQDQIFRMLAAILWIGNISFIENEEGNAQVRDTSVTDFVAYLLQVD
                     AAVLIKALVERIMETSHGMRRGSVYHVPLNIVQATAVRDALAKAIYSNLFDWIVGRVN
                     KSLQAYSGADKSIGILDIYGFEIFEHNSFEQLCINYVNEKLQQIFIQLTLKSEQETYE
                     REKIQWTPIKYFDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQAFSQRLNLF
                     STNPHFELRSNKFVIKHYAGDVTYDVNGITDKNKDQLQKDLVELMGTTTNTFLSTIFP
                     MEVDKESKRRPPTAGDKIIKSANELVETLSKAQPSYIRTIKPNETKSPNDYDDHQVLH
                     QVKYLGLQENVRIRRAGFAYRQVFDKFVERFYLLSPHCSYAGDYTWQGETLDAIKYIL
                     ADASIPATEYQLGTTSVFIKTPETLFALENMRDKYWHNMAARIQRAWRRFLQRRIDAA
                     IKIQRTIRERKSGNKYVQLRDYGTKILGDRKERRSMSLLGYRAFMGDYLACNQSKSKG
                     SYIKRQAGIKEKVIFSIHGEMLHSKFGRSAQRLKKTFILTPTTFYIVGQTMIQNAMKY
                     TQDYSINVNSIKQFSLSTLQDDWVGVVLSNSTLPDPFINTYFKTELITQIKKLNSKVQ
                     INVGPMIQYQKKPGKLHPVRATISDTAPKYGDLYKSSTIYVRRGHPAGSRSKKKPRGK
                     GSGSGSSTTATYKRQSIKSTPQAPSGMKPPVARSRSKKPAPPPPGSQQPSLAATAAQA
                     AYHPNGSSKNQAPSPVGIKPSARPQVHSRPKPKPKPQPPVQQQQPQQQRQPVAQAKSA
                     VVPPPPPPPPPQASSEPKFEAAYDFPGSGAPSELPLKKGEVVYITRQEQNGWSLAKTL
                     DGSKTGWVPTAYMTEAKITSSTSTPITVPNTTTTVTQQVQQTVQEQATTQAQPAAANF
                     SEGLASALAARANKMRNESGEEDAGEDDDDDDW"
     gene            complement(<414418..>416490)
                     /gene="NDAI0E02050"
                     /locus_tag="NDAI_0E02050"
                     /db_xref="GeneID:11498911"
     mRNA            complement(<414418..>416490)
                     /gene="NDAI0E02050"
                     /locus_tag="NDAI_0E02050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670216.1"
                     /db_xref="GeneID:11498911"
     CDS             complement(414418..416490)
                     /gene="NDAI0E02050"
                     /locus_tag="NDAI_0E02050"
                     /inference="similar to DNA sequence:INSDC:YMR108W"
                     /note="similar to Saccharomyces cerevisiae ILV2 (YMR108W);
                     ancestral locus Anc_2.441"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670264.1"
                     /db_xref="GeneID:11498911"
                     /db_xref="GOA:G0WBA1"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012846"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G0WBA1"
                     /translation="MIRQATIKNAVPRRYLSRLTKPYTHYQYLRFNHYSTSSPFLKND
                     CNSSATARAPVASVPSRSTPAPSFNVEPAPATKLSHKLRQDPAMDNSLIGLTGGQIFH
                     EMILRNNVDTVFGYPGGAILPVYDAIHDSSAFNFVLPKNEQGAGHMAEGYARASGKPG
                     VVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLGISRSCTK
                     WNVMVRSVEEMPRRINEAFEIAMSRRPGPVLVDLPKDVTAAILRNPIPVKTTLPSGAL
                     SQLTKLAHDEFILENIKKAADLINIAKKPVLYVGAGILNNMEGPRILKDLSQRAKIPV
                     TTTIQGLGAFDQEDPLSLDMLGMHGCATANLAVQNSDLIIAVGTRFDDRVTGNISKFA
                     PEARRAALEGNGGIIHFEISPKNINKVVEAQVAVEGDAAANIEKMLSMIFPVRARSEW
                     LNTIKQWKKEFPYDYMRETPESKLKPQTVITKLSKLANSTGKPVIVTTGVGQHQMWTA
                     QYWTWKNPRSFITSGGLGTMGYGLPAAIGAQVAKPEALVIDIDGDASFNMSLTELSSA
                     VQAGTAVKVLILNNGEQGMVTQWQSLFYEHRYSHTHQLNPDFMKLADAMGLKGIRVKK
                     QNELDSALKEFISYKGPILLEVEIEKKVPVLPMVPSGKGLDEFINYDPKVEVEQTRLR
                     RERTGGKH"
     gene            complement(<417276..>418205)
                     /gene="NDAI0E02060"
                     /locus_tag="NDAI_0E02060"
                     /db_xref="GeneID:11498912"
     mRNA            complement(<417276..>418205)
                     /gene="NDAI0E02060"
                     /locus_tag="NDAI_0E02060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670217.1"
                     /db_xref="GeneID:11498912"
     CDS             complement(417276..418205)
                     /gene="NDAI0E02060"
                     /locus_tag="NDAI_0E02060"
                     /inference="similar to DNA sequence:INSDC:YKL128C"
                     /note="similar to Saccharomyces cerevisiae PMU1 (YKL128C);
                     ancestral locus Anc_2.442"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670265.1"
                     /db_xref="GeneID:11498912"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G0WBA2"
                     /translation="MPFKSLPGYFHAYPTHESIKTPIDSSKEDHLKLTNNFKSWQQLY
                     NSIPNDTPTTSYKLVILARHGQGYHNAAIDRYGMARWDEYWSFLNGDEFGEWLDSKLT
                     PLGVRQVQTIGEEVLLPIFKDLGILPHVFFSSPMRRCLETFIESWTCIFNEVAHNHQD
                     GGDGGRNVKEKVKIHILENIRETLGEHTCDKRVTHSIAVDEYQNYELKSGHVIKWKYG
                     QDYPEEDTLWLPDHRETKEEMDIRIHGGLTELFSRLTDEQRFVSITCHSGVIGSALRN
                     LKHPPILNLDTGKIVATVVEIKKSNLNAYERVN"
     gene            complement(<418751..>419080)
                     /gene="NDAI0E02070"
                     /locus_tag="NDAI_0E02070"
                     /db_xref="GeneID:11498913"
     mRNA            complement(<418751..>419080)
                     /gene="NDAI0E02070"
                     /locus_tag="NDAI_0E02070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670218.1"
                     /db_xref="GeneID:11498913"
     CDS             complement(418751..419080)
                     /gene="NDAI0E02070"
                     /locus_tag="NDAI_0E02070"
                     /inference="similar to DNA sequence:INSDC:YMR107W"
                     /note="similar to Saccharomyces cerevisiae SPG4 (YMR107W);
                     ancestral locus Anc_2.443"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670266.1"
                     /db_xref="GeneID:11498913"
                     /db_xref="InterPro:IPR020485"
                     /db_xref="UniProtKB/TrEMBL:G0WBA3"
                     /translation="MGFWDAFSVYNRKKHVDDIGMYGTNHSNIGSSNTSYAYSKEYYV
                     PKDGKILKNNEKVTMDSNGKVINRENNFISQDVPHMVDVSNLSQQEFKELYDNARKGE
                     PNNRVNF"
     gap             420529..421075
                     /estimated_length=547
     gap             421474..422473
                     /estimated_length=1000
     gene            <422474..>423314
                     /gene="NDAI0E02080"
                     /locus_tag="NDAI_0E02080"
                     /db_xref="GeneID:11498914"
     mRNA            <422474..>423314
                     /gene="NDAI0E02080"
                     /locus_tag="NDAI_0E02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670219.2"
                     /db_xref="GeneID:11498914"
     CDS             <422474..423314
                     /gene="NDAI0E02080"
                     /locus_tag="NDAI_0E02080"
                     /inference="similar to DNA sequence:INSDC:YKL127W,YMR105C"
                     /note="similar to Saccharomyces cerevisiae PGM1 (YKL127W)
                     and PGM2 (YMR105C); ancestral locus Anc_2.445"
                     /codon_start=2
                     /product="hypothetical protein"
                     /protein_id="XP_003670267.2"
                     /db_xref="GeneID:11498914"
                     /db_xref="GOA:G0WBA4"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="UniProtKB/TrEMBL:G0WBA4"
                     /translation="DGDGDEYDYGAVQHSXPRVDSVAIIAEYASEIPYFKKQGIYGLA
                     RSFPTSAAIDRVAAKHGLKCYEVPTGWKFFCALFDAKKLSICGEESFGTGSNHIREKD
                     GLWAIVAWLNVLAIYNKHNPEKDASIKTIQHEFWNKYGRTFFTRYDYEHISNEDASKV
                     VKLLQEFVSKPNVIGSAFPGDETLTVADCGDFSYTDLDGSVSDHQGLFFKLSNGARIV
                     LRLSGTGSSGATIRLYIEKYTDDKNKYEDSADEFLKPVIATVVKFLKFKEFIGTEEPT
                     VRT"
     gene            complement(<423630..>425687)
                     /gene="NDAI0E02090"
                     /locus_tag="NDAI_0E02090"
                     /db_xref="GeneID:11498915"
     mRNA            complement(<423630..>425687)
                     /gene="NDAI0E02090"
                     /locus_tag="NDAI_0E02090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670220.1"
                     /db_xref="GeneID:11498915"
     CDS             complement(423630..425687)
                     /gene="NDAI0E02090"
                     /locus_tag="NDAI_0E02090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670268.1"
                     /db_xref="GeneID:11498915"
                     /db_xref="GOA:G0WBA5"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:G0WBA5"
                     /translation="MIQKNSPPTRRGSLRSTPSHTNNVSMQSPSIRSTSSFSNIRRNI
                     TRTSSNSPANSRSSSPLRSVSSISDHFHAPRRFNTIRRTNSQTYNTKSEHSTYTGTIT
                     VAIRPKPTSNPSDVSTSSWLVTDEKTIAHDDVGEFKFDHVFNSFVSNLEIYQVINRPM
                     IDKLFQGFNSTIFAYGMTGSGKTYTMMGCPEREQKDGLIPLSVSYLFTKIMEETLDGD
                     KKFEIVLSYLEIYNEKIYDLLGDENNNNNNNNGTLAFGTPTRNNNNICFQNELKIRDD
                     SKYGVRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTTSD
                     MKDGTSISSTLSLCDLAGSERATGQQERRKEGAFINKSLLALGTVISKLSTESNKNRS
                     PTLPSPPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNES
                     SAETLNTLRFASRAKNISLHVNRKPLVHTGEDSDDKNYKIMQLTKKLQEQQQLISTLR
                     QDDKSLNKVSSSVYDHMPGTTSGNLIDPTIALIYAENKVLKHKLTNCEKLLDKDTVEL
                     DDPEIIEIVEMLPYEVGSLLETKIQGLQSQLRQYKEYTNELESKIRDFENANKGTSRQ
                     YPNKGSPSISNSNKENIIQDKENQILELQKMLNRKDKMIDALQSVRRLRDRALKPISS
                     ANN"
     gene            complement(<426032..>427936)
                     /gene="NDAI0E02100"
                     /locus_tag="NDAI_0E02100"
                     /db_xref="GeneID:11498916"
     mRNA            complement(<426032..>427936)
                     /gene="NDAI0E02100"
                     /locus_tag="NDAI_0E02100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670221.1"
                     /db_xref="GeneID:11498916"
     CDS             complement(426032..427936)
                     /gene="NDAI0E02100"
                     /locus_tag="NDAI_0E02100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670269.1"
                     /db_xref="GeneID:11498916"
                     /db_xref="InterPro:IPR021988"
                     /db_xref="UniProtKB/TrEMBL:G0WBA6"
                     /translation="MMRRLLNINIPRNLVRSLTMKNSVYKLSIFVLLITTFIIIATRS
                     DTSKYVVTNYFNSNESLPTKNDLPNVDVSKQLRFQKLNKSPITEKVLHQYYENFDVEG
                     VVTNLDLSKHYSKDHKRGKQQQQEHKSYQDLSCNDLGYHANIGYSTDLIPIEDNLLKL
                     RRQLLKNENKDYANFFRHEESEKNWSEEEIIEKHWSRFGPAPVWLESEQCFVSYSRVM
                     YRHTDQKNQPLVSLIRAQAFDKEWNEIVGKRIPYSDVIIPSDVTKELEMLGDQFQEHA
                     CDKLKDSSEYEQCITKHNKSLLENKRRKEKILNRYFQSYPSLIEVPFNIKAEGCKGPE
                     DPHVVLKKTSKGEEPVIIFNMLDDTDKKRKMYAIMPHRKVDPIVTFRINGQEPKKVEK
                     NWTPFFNDDSEGSGLSRGTIHFIYSFKPLEILKCSLTDGLCDIVFDKKFLDIGREDDF
                     QDIHGGTQFIPLPNILPEVQDQKMWLGLPKIHLKDTACSYHYYRPMVMLMIEDKGIYH
                     IEMTVPILDFGLDVTSWDMKGTYCFFNQILSPHSIAYWEVISQDPQTKEYEDYMAITM
                     SEADALSKVMVIKGMLNYILGIYKEKALKPTFEVNGDTGTILKKSLGCVVDIAKKNSK
                     QYNDKHPRPS"
     gap             428074..428094
                     /estimated_length=21
     gene            complement(<429293..>430519)
                     /gene="NDAI0E02105"
                     /locus_tag="NDAI_0E02105"
                     /db_xref="GeneID:11498917"
     mRNA            complement(<429293..>430519)
                     /gene="NDAI0E02105"
                     /locus_tag="NDAI_0E02105"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670222.1"
                     /db_xref="GeneID:11498917"
     CDS             complement(429293..430519)
                     /gene="NDAI0E02105"
                     /locus_tag="NDAI_0E02105"
                     /inference="similar to DNA sequence:INSDC:YPL154C"
                     /note="similar to Saccharomyces cerevisiae PEP4 (YPL154C);
                     ancestral locus Anc_8.677"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670270.1"
                     /db_xref="GeneID:11498917"
                     /db_xref="GOA:G0WBA7"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:G0WBA7"
                     /translation="MFQLQSLVPLALLLLNTFNVADAKVHTAKIHKQELRLNDDIPFE
                     ESVANLGQKYLHQFEKFNPEVSFSRDHPFFTQGKNSGHNIPLSNYLNAQYFADITLGT
                     PPQSFKVILDTGSSNLWVPSVECGSLACYLHSKYDHDKSSSYKPNGTDFAIRYGTGSL
                     EGYISQDTLNIGDLNIPKQDFAEATSEPGLTFAFGKFDGILGLAYDSISVNKVVPPFY
                     NAIEQELLDEKKFAFYLGDANKKSEDGGEITIGGIDKTKFKGDIDWLPVRRKAYWEVK
                     FEGIGLGDQFAELENHGAAIDTGTSLIALPSGLAEIINTEIGAKKGWTGQYTVECDAR
                     PNLPDLTFNFNGKNFTIGPYDYTLEVSGSCISAIMPMDFPEPVGPMAIIGDAFLRKYY
                     SIYDLENNAVGLAEAI"
     gene            complement(<430989..>433700)
                     /gene="NDAI0E02110"
                     /locus_tag="NDAI_0E02110"
                     /db_xref="GeneID:11498918"
     mRNA            complement(<430989..>433700)
                     /gene="NDAI0E02110"
                     /locus_tag="NDAI_0E02110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670223.1"
                     /db_xref="GeneID:11498918"
     CDS             complement(430989..433700)
                     /gene="NDAI0E02110"
                     /locus_tag="NDAI_0E02110"
                     /inference="similar to DNA sequence:INSDC:YPL153C"
                     /note="similar to Saccharomyces cerevisiae RAD53
                     (YPL153C); ancestral locus Anc_8.676"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670271.1"
                     /db_xref="GeneID:11498918"
                     /db_xref="GOA:G0WBA8"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0WBA8"
                     /translation="MDYTTQPTQQATQATQKFLIQKFSQEQIDENIVCRIICTNGTIP
                     IRDLKVKSIATILTMETPIKKIWTFGRNANIVDYHLGDISRLSNKHFQILLGEDGNLL
                     IKDTSTNGTWLNGDRLRKDKNQLLSQGDEITVGVGVKDDILSLVLFINEKFKKALMER
                     KHHGVSTLNSNSNSNSNSEDSKKSIDSIGEDAKFQGIFKDYEIQDEVVGQGAFATVKK
                     AVERSTGKTFAVKIISKRKVMGSNMDGVSRELEVLQRLDHPRIVRLKGFYEDHENYYM
                     LMEFVSGGDLMDFVAAHGAVGEDAGREISRQILEAIKYIHSMGISHRDLKPDNILIEQ
                     DDPVLVKITDFGLAKVQDNGTFMKTFCGTLAYVAPEIISGKNDGELRENADANSERNE
                     YSSLVDMWSMGCLVYVILTGHLPFSGSTQKQLYKQISRGSYHEGPLKDFRISDEARDF
                     IDSLLQVKPNDRLTAEKALEHPWIKMAQFSQSFVKNNSVNSVNETDDKDSCFQVSLTD
                     SLSQQKLLENMDDAQYEFLKAQRKEQLRQFEDMNKPSQPKGFKIPGNPLIRYTQQPKV
                     PRQSQSQSQSNEKGKLDNVLKNNPRHNNSGNSKKTKKKADGKFLTLRPLRESRIQESI
                     PLSQGINPFFFGRSDDCNCRIEDSRLSRVHCFILKKRHAVGDSIYESPAQGLDDIWYC
                     HSGSNVSYVNDIKLEQGSKCLLQHGDEIKIICDWQHNFVIGFKVEINDSTGLFNDGMS
                     PFETSKTIRAIVSQTDDEKSLVKRLIQMMAIQRAEKSKIKNEGIIEAMSSPYNKKESH
                     THFGKLATAFPNHIDNASLKVNNSNEQNIHVDQIKSNIDDEVLSSIEHNNDNKENEII
                     TSPPQGNKLLKRVHSVSLSQSQNDPAKKVKRAKLDQPTQKPDNLQFL"
     gene            <434474..>435334
                     /gene="NDAI0E02120"
                     /locus_tag="NDAI_0E02120"
                     /db_xref="GeneID:11498919"
     mRNA            <434474..>435334
                     /gene="NDAI0E02120"
                     /locus_tag="NDAI_0E02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670224.1"
                     /db_xref="GeneID:11498919"
     CDS             434474..435334
                     /gene="NDAI0E02120"
                     /locus_tag="NDAI_0E02120"
                     /inference="similar to DNA sequence:INSDC:YPL121C"
                     /note="similar to Saccharomyces cerevisiae MEI5 (YPL121C);
                     ancestral locus Anc_8.618"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670272.1"
                     /db_xref="GeneID:11498919"
                     /db_xref="InterPro:IPR018468"
                     /db_xref="UniProtKB/TrEMBL:G0WBA9"
                     /translation="MEDTTINLSTTAISTTATTTTTTKKENKTLSSKFKSPFKSPKLD
                     DATLINISTLSTPIRSCSTPKATTTTTTTTTTAHPMIYKKITKTDQEEIILKKKNMLL
                     HNELVNQIKSYERENNELKRMQKFITNDYSRGGGEGSTQQLIKKWRSISQMTMSYLLN
                     SISCKIDKMGGYEEFIRKEFNMEKQKLEYHLDDGIRESYEEVMESEEFQNLNKDEQLE
                     YQEQMENKLVELENFKTKQLERLENEFQSIIKNDSQGGLDMKQLAKRLKVDYSLVFPS
                     EDGEDIQSQH"
     gene            <435627..>437195
                     /gene="NDAI0E02130"
                     /locus_tag="NDAI_0E02130"
                     /db_xref="GeneID:11498920"
     mRNA            <435627..>437195
                     /gene="NDAI0E02130"
                     /locus_tag="NDAI_0E02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670225.1"
                     /db_xref="GeneID:11498920"
     CDS             435627..437195
                     /gene="NDAI0E02130"
                     /locus_tag="NDAI_0E02130"
                     /inference="similar to DNA sequence:INSDC:YPL122C"
                     /note="similar to Saccharomyces cerevisiae TFB2 (YPL122C);
                     ancestral locus Anc_8.620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670273.1"
                     /db_xref="GeneID:11498920"
                     /db_xref="GOA:G0WBB0"
                     /db_xref="InterPro:IPR004598"
                     /db_xref="UniProtKB/TrEMBL:G0WBB0"
                     /translation="MTENVLKISVTQYLEEIPQQVQSRLYESPATCLAIYRLLPQLSK
                     FFVMSMVFNNNEVSLRDLDRWVKPDAKLQFQDAIKSMKSLHLIIPSKGNGGPLMIILN
                     PTFRESFKNALTGGQINNSFGIISDEDENGVVTSTLLNEYSANKWETILHFMVGTPMS
                     SIPSGSVLNLLKHTKLMEEVENTGEFKITNEGFQFLLQELNSQLWTLLLQYLKLSETL
                     NMDPVDVLNFIFMLGALEVGKGYSIDGLSETQKIMLKDMRDYGLVFQKVSNSKTFYPT
                     NLALMLTSDTKSIVRTASGAIESVLNENRSGSNANENGYEPGTKKKNENTIMGTIDQV
                     GMKNQDVPDGSLIVETNFKLYSYSNSPLQIAILSLFVHLKFRFVNMVTGQITRESIRR
                     ALINGITAEQIIAYLETHAHPQMRRLAEEKLEKKLELDANCKDSLQILPPTVVDQIRL
                     WQLELDRVIAYEGSLYSDFENNTEYTTLYKYAQDIGVLLWKDDKKRKFFVSKEGNSQV
                     LDYAKRKLKKKQEP"
     gene            <437900..>439300
                     /gene="NDAI0E02140"
                     /locus_tag="NDAI_0E02140"
                     /db_xref="GeneID:11498921"
     mRNA            <437900..>439300
                     /gene="NDAI0E02140"
                     /locus_tag="NDAI_0E02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670226.1"
                     /db_xref="GeneID:11498921"
     CDS             437900..439300
                     /gene="NDAI0E02140"
                     /locus_tag="NDAI_0E02140"
                     /inference="similar to DNA sequence:INSDC:YPL123C"
                     /note="similar to Saccharomyces cerevisiae RNY1 (YPL123C);
                     ancestral locus Anc_8.621"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670274.1"
                     /db_xref="GeneID:11498921"
                     /db_xref="GOA:G0WBB1"
                     /db_xref="InterPro:IPR001568"
                     /db_xref="InterPro:IPR018188"
                     /db_xref="UniProtKB/TrEMBL:G0WBB1"
                     /translation="MRFWLDISIPYFSLLPNFQSDGQQQAVELTDPSIDRSIVQNQIS
                     CPVSPLTCENKTTIPDQCCFEYPGGIFLQSQFWNYKPRKRGMNETQLIEQLGPLDSFT
                     VHGLWPDDCFGSYEQFCDSKLFIDDVYHLLKGFGAGEGQKLLNKLELLWKSNNGDHES
                     LWIHEFNKHGSCIRNIRPECYERWDHDGDGSTKVNFRGQSQSLYAKKGVFDYFNITFN
                     LFEKINTFEFLEKHDIIPSVENRYSKSQIEKALKNEFQNRDVFINCDSNNVLNEVWYY
                     HLLNGTILNKDFIPIDSIRRLQFSKCKEEGIKFYPKGYLPSGDGDKGPSNPSKLRGII
                     KVDNLHENNDDDTRGFLIRDGKWMMKGTPANFEIIKSTFGNYNLKTRHGYCTVDEGKS
                     NELTCHQKNVKYASQFDFEKDEKTGLNYIGYSGLYDWGAVSKPSGRVRKPIFLYNDKD
                     EGTDLKMKFKLRFVET"
     gene            complement(<439501..>440682)
                     /gene="NDAI0E02150"
                     /locus_tag="NDAI_0E02150"
                     /db_xref="GeneID:11498922"
     mRNA            complement(<439501..>440682)
                     /gene="NDAI0E02150"
                     /locus_tag="NDAI_0E02150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670227.1"
                     /db_xref="GeneID:11498922"
     CDS             complement(439501..440682)
                     /gene="NDAI0E02150"
                     /locus_tag="NDAI_0E02150"
                     /inference="similar to DNA sequence:INSDC:YPL124W"
                     /note="similar to Saccharomyces cerevisiae SPC29
                     (YPL124W); ancestral locus Anc_8.622"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670275.1"
                     /db_xref="GeneID:11498922"
                     /db_xref="UniProtKB/TrEMBL:G0WBB2"
                     /translation="MYDNLQASPERDDTLENLKNECNLYMNRIDSNDDEYENGNELYQ
                     DRGSQEYMERKNKRYNISANDTSEGGPNEAMRNNSILKGTYIDDLNQNPPRRYNDMKL
                     KRNPIGEPSSRLSSTATYVEQQPAFQPSLSSKTSSRTSSKPTTSHSPYSYSHGSNNNS
                     INNNSNQYDINTILKELEKFKSNLYSQQLEIENLKRDFNMEKNKNYSLQTELEINKSN
                     NIKLSTKNSKLELKINTLERSINEMRNNFYLQPSLIQSPNLSPIRAVRNINSTGTTYS
                     NPNGIPSSSSTSTRNGLLYNRREESEHPYNYYYNNDNNTSSNYQPPTRWKSNMRNIQP
                     DIDTDPIPPSRNNYHHNDHKLPYNTRSLDRRNNTKNAVRMNAINEDSTEALMAKVPTR
                     L"
     gene            <441606..>444959
                     /gene="NDAI0E02160"
                     /locus_tag="NDAI_0E02160"
                     /db_xref="GeneID:11498923"
     mRNA            <441606..>444959
                     /gene="NDAI0E02160"
                     /locus_tag="NDAI_0E02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670228.1"
                     /db_xref="GeneID:11498923"
     CDS             441606..444959
                     /gene="NDAI0E02160"
                     /locus_tag="NDAI_0E02160"
                     /inference="similar to DNA sequence:INSDC:YOR208W"
                     /note="similar to Saccharomyces cerevisiae PTP2 (YOR208W);
                     ancestral locus Anc_8.623"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670276.1"
                     /db_xref="GeneID:11498923"
                     /db_xref="GOA:G0WBB3"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G0WBB3"
                     /translation="MDRYDKNTITTSNLFQYSPKKVVDINQENMDPSYSLNIVPQMNT
                     GYHPHPLLDRSKPFPMQQRKGKNVLDLTTAQYHIEGLTTISGPKILTKFSKEMDKLLI
                     FDLTCHERVLLSPDNSNSNHLDTNSISLSNLIRNGSHAHNIETVTNTNINTNTSTKDK
                     NDDVVYCVHLTFPSTLLKRPSFNFEKLLKTTLSERKIPEILNLINKFQYFIFYDDNSN
                     NLQNCNPSTYFLITKFKTFLDEKYPNISKHIFLLDHSSDDDLDLSNKSTQSNNITPCY
                     LSRTPIVQQNSASAIKPTTNNSRKFNLKLQIPPPNPTNRLFVQSLKKDSVIYSPTSLR
                     RYFTFVIPKSIKDNDSSLPLWLRKYTQRDQINHILESLCNKFNLLENLEVQRLSKSLR
                     TGITHTPTGSNINNYNNNKDISLKEKKNDENNNIVNEYTKNTNTTQANHTGQKQSLSS
                     VSSYHKIYSLLHLQKQFKKVKKEQTHTTEPETNNNNDISKDGDDNIKYNCMKHIKSDQ
                     NKDKKVNEYQPKLPPLVITIEDIPNEAGTKATSNTNSSSSTISSSSSTTSQKSLLSPY
                     SDPYSNRTGSNTVDILATTPSDNYEVSQGIQSFAKNRYSNILPYEHTRVKLQPSPIGS
                     KTNSKSSLMSLMENNNNTYSHNKNNISSSSSPSSSSSLSSSSSSIKYSMTKAPTMMMN
                     KNNDIGEVTSNSNNVLMRNNSSSTQLFEQNLPNNNDRRSLSGEPTGNNIDTSSSVTNS
                     SNSILTLVRKRRNSSYFNRDSIPPPLLTSSSFSSSASSKFPLSSSYTSKSTVTPSDKS
                     TTANLVPPGSHHFSVSSSSSSSSTQNSNRRISSDGLSNYPQLNIDRKSVSFDDYFNAN
                     YLKLPQINPDFNYLATQAPLPSTMDDFWKVVISNNIKIIISLNSDDELAMKKWDIYWN
                     NQNYSNYKVKVIKCLQNFSKLDGLILRIFQVTKCKSNTSSCCSSIVFQLQYTKWLDSC
                     SIVMTDLLKILKIKDVLLLENPLTFIEQWEKNSINDDNLHEIYSKMQKDGTIIKKYDS
                     PLLVHCSAGCGRTGVFITLDFLINILTNSKNSSNNIDVWNMKHDLIFIVVNELRKQRI
                     SMVQNLTQYITCYESILQYFALSRENIIT"
     gene            complement(<445219..>448308)
                     /gene="NDAI0E02170"
                     /locus_tag="NDAI_0E02170"
                     /db_xref="GeneID:11498924"
     mRNA            complement(<445219..>448308)
                     /gene="NDAI0E02170"
                     /locus_tag="NDAI_0E02170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670229.1"
                     /db_xref="GeneID:11498924"
     CDS             complement(445219..448308)
                     /gene="NDAI0E02170"
                     /locus_tag="NDAI_0E02170"
                     /inference="similar to DNA sequence:INSDC:YPL125W"
                     /note="similar to Saccharomyces cerevisiae KAP120
                     (YPL125W); ancestral locus Anc_8.624"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670277.1"
                     /db_xref="GeneID:11498924"
                     /db_xref="GOA:G0WBB4"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0WBB4"
                     /translation="MSNTATLTELAVLQTLEQAGNPQQAGSQVQKSAEQQLKQWEIQP
                     GYHYYLQSIYLDLSNTLQSRWLAAIQFKNGVDRYWRSSRVHAINKDEKASIRARLFEL
                     IDEQNNQLGIQYAQAIAKIARLDFPAEWPDLFEHLESLLSDHNVRCNNVKVYNMLMYI
                     NQIIKVLGTARIGRCKPAMQSKVPLIFPLIVRIYLESFDDWTKSKSLSDDDLSKLQVS
                     YLSLKVLRRIVCEGYERPQKDESVCEFMKLSITHFELLLANQEFFNKFDLYEKFIKCY
                     GKLYYNLVTSSPANFILLPCSTSILIVYTKLLFEKAQIVYQENVDVTGDFWEHAAIRG
                     FLLLKRVINFTNKKGVITLKVRSDKASIESSIMKINNEFLHENLVKKLLDVLMDWYLK
                     LRPSELESWFLDPEEWINEQIVASYEYQIRPCAENFFQDLINSFPELLVPYLLNKIEN
                     EANHLGDDLDGFLKKDAIYASFQLSASAVSDMVDFDRLLVQVFLPEASNNNTQPDQLK
                     IIRRRVALIIHEWSTVKCSEQSKALCYEFFKNVLASDEDKVVQLTVVQSLRTMIDDWN
                     FNKDVFEPFLTDIVTVLLRKILPSVSLTETRMYVLNTLSDIISQTKPLIDQKLLIEIL
                     QVVPNLWEHAANNTSESILANTLLRLLKYLAISLGPHSYLTWDIAIPIISVACNPESS
                     HYQLLNEDGYELWGALLQNYSPKEQSFNTTFIDLLPYLEFGIEAHTEILPTLLELIRS
                     YMLILTQEQIFACESFQRIFTEIARFLLKLREDSFELILQIWEILVLANESDYENALL
                     TNFYQANILSSLFDSVFKEERLSNYQCGQILQIIARISYANPDALLEFLQNYHSQLPT
                     MNENSLLPIHDRRCVYGDMTFEQVIQRFISIWIVCFKDIYDPKFKKVHILGISSLLRS
                     KILVVLTEFENIISLWIDILEEINETSDGDCEKYHLNDIVTEQSMSYHPLTSEQLREH
                     ELSKNNDPVHNISLKEFIEQTLRFLEDFLGMGRYNELLSNVNPNLIENLKLFLSLKK"
     gene            complement(<448929..>450221)
                     /gene="NDAI0E02180"
                     /locus_tag="NDAI_0E02180"
                     /db_xref="GeneID:11498925"
     mRNA            complement(<448929..>450221)
                     /gene="NDAI0E02180"
                     /locus_tag="NDAI_0E02180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670230.1"
                     /db_xref="GeneID:11498925"
     CDS             complement(448929..450221)
                     /gene="NDAI0E02180"
                     /locus_tag="NDAI_0E02180"
                     /inference="similar to DNA sequence:INSDC:YOR209C"
                     /note="similar to Saccharomyces cerevisiae NPT1 (YOR209C);
                     ancestral locus Anc_8.625"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670278.1"
                     /db_xref="GeneID:11498925"
                     /db_xref="GOA:G0WBB5"
                     /db_xref="InterPro:IPR002638"
                     /db_xref="InterPro:IPR006406"
                     /db_xref="InterPro:IPR007229"
                     /db_xref="UniProtKB/TrEMBL:G0WBB5"
                     /translation="MSEPVITSLLDTDMYKITMHAAVFTNFPNANVIYKYTNRSSQMS
                     FNEPAINWLKEQIKYLADLRFQPDEIAYLKEVIPYLPNDYLEYIGSENFALDPSSQIK
                     FSSTQKPGTNHYDINLLIEGNWKDTILYEIPLLALVSEAYFKFVDTDWDYTNQIENAQ
                     QKAKKLFQGGLQFSEFGTRRRRSLKTQDLVLQGILKAINEDISKGYDKLLLGTSNVLF
                     AKNFGLKPIGTVAHEWVMGVAAISNDYINANKDSMDYWIKTFGAQNAGLALTDTFGTD
                     DFLKSFYPPYSDAYVGVRQDSGDPEKYAEKIAHHYLDVLKLPKFSKSICFSDSLNVEK
                     AIKYNDAAQRNGLLATFGIGTHFTNDFQKKSNPNEKSEPLNIVIKLLKVNGNHAVKIS
                     DNLGKNMGDPATVRRVKEELGYIEHKWSGDNEAHRWTT"
     gene            complement(<450769..>453492)
                     /gene="NDAI0E02190"
                     /locus_tag="NDAI_0E02190"
                     /db_xref="GeneID:11498926"
     mRNA            complement(<450769..>453492)
                     /gene="NDAI0E02190"
                     /locus_tag="NDAI_0E02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670231.1"
                     /db_xref="GeneID:11498926"
     CDS             complement(450769..453492)
                     /gene="NDAI0E02190"
                     /locus_tag="NDAI_0E02190"
                     /inference="similar to DNA sequence:INSDC:YPL126W"
                     /note="similar to Saccharomyces cerevisiae NAN1 (YPL126W);
                     ancestral locus Anc_8.626"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670279.1"
                     /db_xref="GeneID:11498926"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0WBB6"
                     /translation="MPQSQVQPTVSQQYKLSLVSGGTPSLPRASYSSSCNKNISCLTA
                     DQLNYIVPFNNQIKLFSIETRQCVKTLKFNNNEILSKIFDSTSVAHIALGDLLTLSAD
                     EGKNEEKFITIFTKNGQIIVLNYKGKLIESPKIVNLNLSPEQSIFKVFQSTDGKGKAI
                     LKILTIVDKPSSSLATYHLYDSSDDKPTLALIKSFENVISLTWSSNDHYIAILSQNKE
                     STSDKKMIHIQSIFDDSYQREFPLASVLSKTTTQHQPATTSNNSRYVSSMAIDNNASQ
                     LALGFVSGVISIVNLGENANLQTRLLKWHIDSVLSLAFNEDGTYLLSGGWEKVLIFWQ
                     LSTNLQQFLPRLNGIIVDCQIIGSKYYSISLQMIENPTMSQYQILLLNSSDLISKLSI
                     NGPLPIFANPIKSTIQPISSINTKMSNSISKLISFQEKQQRKLHNLKRQDFTTCIKIN
                     PITKNLYFPHVSSLQIFNFYKNDQISYQNMTSTLSNSMGKVKTELNIKEPTIANLTFT
                     HNGDWLITYEIEYQPSDLLSSNDQTHILKFWSLIPESNQWELKTKIINPHGINVPIIK
                     LIPSPIAFPGKEIGILTADNNGGLKYWSIVEEENNEDARVANWSLTKMLPPNFNHFSN
                     CVSVAWSHDGSLIFHGFEYKLQILEFNHDKDGSEGFVKVGHEFNFDSEIQTITLSNDS
                     NLIVVTKTNLVVINLLLGAVVTTLDIYPFVDGAYKNGNLERLIACDQNSGNVALVLNG
                     KAQDEKDEVKYNSKIIVFNSDLSVKIDIFNHDEYISWIGWNYDSDFIFLDMSLRLGVI
                     GTTVNNEMIDEVNKEGIFDGLMTTTGSEVITSNENNLNTGDKFVEQLRKLSNKTNTNI
                     DAEAGDDMVTDLINGEKKEKSLNMKSFTGMFDNIQNIQMDTLFDSVMKVIS"
     gene            <454195..>455229
                     /gene="NDAI0E02200"
                     /locus_tag="NDAI_0E02200"
                     /db_xref="GeneID:11498927"
     mRNA            <454195..>455229
                     /gene="NDAI0E02200"
                     /locus_tag="NDAI_0E02200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670232.1"
                     /db_xref="GeneID:11498927"
     CDS             454195..455229
                     /gene="NDAI0E02200"
                     /locus_tag="NDAI_0E02200"
                     /inference="similar to DNA sequence:INSDC:YPL127C"
                     /note="similar to Saccharomyces cerevisiae HHO1 (YPL127C);
                     ancestral locus Anc_8.629"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670280.1"
                     /db_xref="GeneID:11498927"
                     /db_xref="GOA:G0WBB7"
                     /db_xref="InterPro:IPR005818"
                     /db_xref="InterPro:IPR005819"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:G0WBB7"
                     /translation="MAPKKSTTTATTANKKKESSSSPSGSKSYKEIIIEGLNALKSRK
                     GVSRPSLKKYVKENYPNMASSTAFDHHFNSAIKRGVESGVFAQPKGPSGTLKLVAPTP
                     TSSSTAKKSTTPSATSSSAEESDKEKKPVKKAKKTTTTTTTTTTGATTKTTTATKNTK
                     GAATTTKKVSKPSTAKKGKSSLSSSGSPSYREMIIKSILALNEGKGSSRPALKNYIKD
                     EYSNTKDKSNFDNLFNAAIRKGVENGELSQPKGPSGVIKVSKKGKSLISDLKKKKNKK
                     VILIIFLFLILSLFFRQAILMFYYLFLFFSLTLLWPLIVLCIIYYCSLNPQMDMLVFI
                     HICIFCYLTF"
     gene            <455784..>457847
                     /gene="NDAI0E02210"
                     /locus_tag="NDAI_0E02210"
                     /db_xref="GeneID:11498928"
     mRNA            <455784..>457847
                     /gene="NDAI0E02210"
                     /locus_tag="NDAI_0E02210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670233.1"
                     /db_xref="GeneID:11498928"
     CDS             455784..457847
                     /gene="NDAI0E02210"
                     /locus_tag="NDAI_0E02210"
                     /inference="similar to DNA sequence:INSDC:YPL128C"
                     /note="similar to Saccharomyces cerevisiae TBF1 (YPL128C);
                     ancestral locus Anc_8.630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670281.1"
                     /db_xref="GeneID:11498928"
                     /db_xref="GOA:G0WBB8"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR013867"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:G0WBB8"
                     /translation="MDTSVSATTTTTLVAPAAGSGTGTAVNEPTRNNTNNSEASPIPS
                     GTANANANADADDNATDPANTTSTSAPTTAATRTNIHPSLEGTRSRHRTTTTNSAIIH
                     AELNSENLNRFNNIIRALPLRTRLTISSLCLLDNISTQLLRLLIFNAGSPQILALLTD
                     KSTYLNSGETDIFQTLLKLFKQVRNIYNSRDPLLTVHDVAPGLWFPNSPPPSLLRGHE
                     PYIITAIRKTNLLTFLLTAVGCFNYGFELLQSSFLDIFCPNTLYTHGSGENNGKFLKS
                     QSILYLDLKTQAFISALKEFENNSNDIPKDKQTELLDTIFPSDLDTQLIHRRTGNMIT
                     DSQPLNELLTPSEKDFVERCDRRKENLMNFTTFNDLVINYDWNHFIRELLEYCNKNMG
                     LIIWGKKGRGKSPLYCFDNTEFDNQILYASGATTEGMTSHNTTAAAAAAAVGVGSQSY
                     PLVDSFNLPEMEEDNATAGGAGNTTGTQGYLHHEDSMGPYSQPFDGTNVQMDNDTNVN
                     NNTVDAAVANSNIPAASIKKLKPKRVWSKDEEDALIEGIKEVGPSWSKILDLYGPGGK
                     VSESLKNRTQVQLKDKARNWKLHYLKNNKPLPDYLQKVTGNIEKAYKSKKKQKQQLQE
                     SNVPSGVSSQSNTPVPDNNNNNNNNNNNNNNNNNNTNNVDDAGGLFGNNDDTSGFDPN
                     LEANM"
     gene            complement(<458128..>459056)
                     /gene="NDAI0E02220"
                     /locus_tag="NDAI_0E02220"
                     /db_xref="GeneID:11498929"
     mRNA            complement(join(<458128..458919,459048..>459056))
                     /gene="NDAI0E02220"
                     /locus_tag="NDAI_0E02220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670234.1"
                     /db_xref="GeneID:11498929"
     CDS             complement(join(458128..458919,459048..459056))
                     /gene="NDAI0E02220"
                     /locus_tag="NDAI_0E02220"
                     /inference="similar to DNA sequence:INSDC:YPL129W"
                     /note="similar to Saccharomyces cerevisiae TAF14
                     (YPL129W); ancestral locus Anc_8.633"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670282.1"
                     /db_xref="GeneID:11498929"
                     /db_xref="GOA:G0WBB9"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="InterPro:IPR016665"
                     /db_xref="UniProtKB/TrEMBL:G0WBB9"
                     /translation="MVPSVRRTIRIKTKQDILPDVPPVEGFPVRKWSIEIVLIDEETK
                     QEIPATIFDKVIYHLHPTFENPNRTVTEVPFKIEEQGWGGFPLDISVFFLEKAGDLKI
                     SHDLNFLKNTYEVDHIIQVPINKPLLVTELAKSGPVEDTSNSTVISENGVIGTPANVI
                     VNNSNKRKGSSITSGMENGNEPLKKKSKTSTISTIRGGVDMEKLAVAMTKLNEDDLVG
                     VVQMVIDNKTPEMIVTNNVDEGEFVIDLYSLPEGLLKSLWEYVKKNTE"
     gene            complement(<459364..>460215)
                     /gene="NDAI0E02230"
                     /locus_tag="NDAI_0E02230"
                     /db_xref="GeneID:11498930"
     mRNA            complement(<459364..>460215)
                     /gene="NDAI0E02230"
                     /locus_tag="NDAI_0E02230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670235.1"
                     /db_xref="GeneID:11498930"
     CDS             complement(459364..460215)
                     /gene="NDAI0E02230"
                     /locus_tag="NDAI_0E02230"
                     /inference="similar to DNA sequence:INSDC:YPL130W,YOR214C"
                     /note="similar to Saccharomyces cerevisiae SPO19 (YPL130W)
                     and YOR214C; ancestral locus Anc_8.634"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670283.1"
                     /db_xref="GeneID:11498930"
                     /db_xref="UniProtKB/TrEMBL:G0WBC0"
                     /translation="MWNQLSFSIINSILISSVLTERVNLYLTTDDLGGDSVTGLDHKP
                     LTLHIDKESLTPELSTILSHSPNIIFADMPGQPEFINIREVEDAIEDNTVIQEENVDD
                     IDADEADDNDDENEDEHDVRNENENFDEDFDMETNESGLENENENESDLENEKEKENS
                     DEEEEYGDLQLFNVDPSLTKIKDKKFNETEINISEIFGSTTTFEINTATTVVSSPRSS
                     ETDFKNGGSKQTNTNATSSDASSSNNTSSNNNPGIVQEGESSNLKVGMTTAMVITLTT
                     LLFVQCY"
     gene            complement(<460601..>463396)
                     /gene="NDAI0E02240"
                     /locus_tag="NDAI_0E02240"
                     /db_xref="GeneID:11498931"
     mRNA            complement(<460601..>463396)
                     /gene="NDAI0E02240"
                     /locus_tag="NDAI_0E02240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670236.1"
                     /db_xref="GeneID:11498931"
     CDS             complement(460601..463396)
                     /gene="NDAI0E02240"
                     /locus_tag="NDAI_0E02240"
                     /inference="similar to DNA sequence:INSDC:YOR219C"
                     /note="similar to Saccharomyces cerevisiae STE13
                     (YOR219C); ancestral locus Anc_8.638"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670284.1"
                     /db_xref="GeneID:11498931"
                     /db_xref="GOA:G0WBC1"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002469"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0WBC1"
                     /translation="MSTFIKTHKRKNSHKFLGPQATSGASMRSDFEMDDMGDIPPPLN
                     LHQQTQEEEQRQRQRQEQQEQDGYSYFTETIPDIDLEQQSLREQPSSFLLDDDDERLS
                     SSPTPDRNLSWESWYIHKKYSHNKNKLLCISTSALLLVFFIVIIPMLNTPSDSSRSNG
                     KNGNLSRKRNKFTINDIFNGDFSVDHKTFHFIEPASRLQSHDMDPGLYYTVEDKDLGR
                     HFVAKQLFNKDFEQDLGSTKFFYDDKEYTVMNVIFNYRLDRAILMTDIVPEFRHSSKG
                     YYFLKDLNTNKITPITPPASNSLEKLSYAAFSPSYNYVYFVYENNLYLKSAYNDGKVT
                     QITNDGSSNILNAKTGWIYEEEVLASDKGIWWAPDDSKFVFAKINETDVPSYQFPLYT
                     TGNQFPLTKEIKYPKPGTPNPKIQLYMLDLINSVLYQINTGNKDYDFILYDAQWVSSD
                     FFLFKETDRASKIMNVKSYNAKESKLEIVRKIDSTKYNGWIEKTFKILPIPPKKSLDR
                     TEFGYVDIAVDQEGYNHLFYFPTVNSTEGKQLTKGQWEVTDRGIVGFEYESDTIFFTA
                     NQIGPMAQHLYAVSLSDERGDDHYTVQTLQDPNQKNDYYDFELSSSGRFAMAKYLGSS
                     TPQYRVGPLSDVLDANSESGRVINLTDDSEFKEALEKYNLPVTSYKNIVLDDGVTINY
                     IEIKPAFMDPKKKYPVLVNVYGGPGSQTFTTKSSFLLEQAVASGLDAIVLQIEPRGTG
                     TKGWKFRSWAKKKLGFYEPRDVTEVVQKFIKMNEPHIDRKRVAIWGWSYGGFTTLKTI
                     EYDKGETFTYAMAVAPVTNWTFYDSIYTERYMDAPLNNEEGYRDISVVKDVEPFKNLN
                     RFLIIHGTADDNVHIQNSYEFLDKLNLAGIRNYDMHIFPDSDHSIRYHNAQVIIYQKL
                     YYWLETAFNGKFDNVNM"
     gene            complement(<463847..>464740)
                     /gene="NDAI0E02250"
                     /locus_tag="NDAI_0E02250"
                     /db_xref="GeneID:11498932"
     mRNA            complement(<463847..>464740)
                     /gene="NDAI0E02250"
                     /locus_tag="NDAI_0E02250"
                     /product="ribosomal protein L5"
                     /transcript_id="XM_003670237.1"
                     /db_xref="GeneID:11498932"
     CDS             complement(463847..464740)
                     /gene="NDAI0E02250"
                     /locus_tag="NDAI_0E02250"
                     /inference="similar to DNA sequence:INSDC:YPL131W"
                     /note="similar to Saccharomyces cerevisiae RPL5 (YPL131W);
                     ancestral locus Anc_8.639"
                     /codon_start=1
                     /product="ribosomal protein L5"
                     /protein_id="XP_003670285.1"
                     /db_xref="GeneID:11498932"
                     /db_xref="GOA:G0WBC2"
                     /db_xref="InterPro:IPR005484"
                     /db_xref="InterPro:IPR005485"
                     /db_xref="InterPro:IPR025607"
                     /db_xref="UniProtKB/TrEMBL:G0WBC2"
                     /translation="MAFQINQKNSAYHSRYQTPFRRRREGKTDFYQRKRLVSQHKAKY
                     NSPKYRLVVRFTNKDIICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATG
                     LLVARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVF
                     GALKGASDGGLYIPHSENRFPGWDFEAEELDPDLLRTYIFGGHVSQYMEELADDDEER
                     FSELFKGYLADDIDADSLEDIYTEAHAAIRADPAFKATEKKFTKEQYAAESKKFRQVK
                     LTKEERDARVAAKIAALAGQQ"
     gene            complement(<465377..>466288)
                     /gene="NDAI0E02260"
                     /locus_tag="NDAI_0E02260"
                     /db_xref="GeneID:11498933"
     mRNA            complement(<465377..>466288)
                     /gene="NDAI0E02260"
                     /locus_tag="NDAI_0E02260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670238.1"
                     /db_xref="GeneID:11498933"
     CDS             complement(465377..466288)
                     /gene="NDAI0E02260"
                     /locus_tag="NDAI_0E02260"
                     /inference="similar to DNA sequence:INSDC:YPL132W"
                     /note="similar to Saccharomyces cerevisiae COX11
                     (YPL132W); ancestral locus Anc_8.641"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670286.1"
                     /db_xref="GeneID:11498933"
                     /db_xref="GOA:G0WBC3"
                     /db_xref="InterPro:IPR007533"
                     /db_xref="InterPro:IPR023471"
                     /db_xref="UniProtKB/TrEMBL:G0WBC3"
                     /translation="MLHFSRIAGVSGRINSLTSKILLLQRCNGDTILRQTVLKRTPIS
                     TLPITRLYSLSQRLQQEQKNEGIPLQFDINKLTRSQIQQLRNMKRVEEQRKKGRSIAL
                     YFSSVAIVFLGLAYAAVPLYRAICARTGFGGIPITDRRKFTDDKLIPVDTEKRIRVSF
                     TSEVSQILPWKFVPQQREVYVLPGETALAFYKAKNNSDKDIIGMATYSISPGEAAQYF
                     NKIQCFCFEEQKLAAGEEIDMPVFFFIDPDFASDPAMRNIDDIILHYTFFRAHYGDGS
                     AVSDGASVIPEGSILVKDPDDDDYGGE"
     gene            <466651..>468141
                     /gene="NDAI0E02270"
                     /locus_tag="NDAI_0E02270"
                     /db_xref="GeneID:11498934"
     mRNA            <466651..>468141
                     /gene="NDAI0E02270"
                     /locus_tag="NDAI_0E02270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670239.1"
                     /db_xref="GeneID:11498934"
     CDS             466651..468141
                     /gene="NDAI0E02270"
                     /locus_tag="NDAI_0E02270"
                     /inference="similar to DNA sequence:INSDC:YPL133C"
                     /note="similar to Saccharomyces cerevisiae RDS2 (YPL133C);
                     ancestral locus Anc_8.642"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670287.1"
                     /db_xref="GeneID:11498934"
                     /db_xref="GOA:G0WBC4"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G0WBC4"
                     /translation="MGQSSKTNNNSSNPTNKKKERTIRSCIFCRRSHVVCDEGRPCSR
                     CIKRDIAHLCKLDEDAPTVTGTLPSSTKNPSSSSLNNTPNDPNIQSPAASFVNNNNNT
                     NTNMHVDNILAGLETGIPSLFLQQQPNFISENVGSEFSSLNEFLTMLENPLLVNPAAL
                     PPDLNTNTNTSTNGISVPHTKVDPNTNYPAIQPKQPTIDNATTKNNSMLSSTSIVPNI
                     STTTTTDTNVNLPYNTNNDMNVSNNNITSRNEQVVQEQETENGNNISSRRGSSRSTSY
                     EQAPTPREQFFLTAADPSTEITPEDRLKLVINAKLEAGLLKPYDYAKGYGRLQRYMDD
                     HMDIISKQRILKPLSSIRPAFRSIARSLKDLDLMLVEENFERLLLSYDRVFTSMSMPA
                     CLWRRTGEIYRANKEFAMLVDCTVDELRDGKLAVYELMTEESAVNFWEKYGSIAFDKG
                     QKAVLTSCHLKTRNGDKECNCCFSFTIRRDRYNIPICIVGNFIPIT"
     gene            complement(<469907..>470464)
                     /gene="NDAI0E02280"
                     /locus_tag="NDAI_0E02280"
                     /db_xref="GeneID:11498935"
     mRNA            complement(<469907..>470464)
                     /gene="NDAI0E02280"
                     /locus_tag="NDAI_0E02280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670240.1"
                     /db_xref="GeneID:11498935"
     CDS             complement(469907..470464)
                     /gene="NDAI0E02280"
                     /locus_tag="NDAI_0E02280"
                     /inference="similar to DNA sequence:INSDC:YOR226C,YPL135W"
                     /note="similar to Saccharomyces cerevisiae ISU2 (YOR226C)
                     and ISU1 (YPL135W); ancestral locus Anc_8.647"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670288.1"
                     /db_xref="GeneID:11498935"
                     /db_xref="GOA:G0WBC5"
                     /db_xref="InterPro:IPR002871"
                     /db_xref="InterPro:IPR011339"
                     /db_xref="UniProtKB/TrEMBL:G0WBC5"
                     /translation="MLPLLRSSAFVRTASITLTKPLFRYSPSSILSRTLLTQSIKNKT
                     AHQWSPGKRFYHPKVIDHYTHPRNVGSLDKKASNVGTGLVGAPACGDVMRLQIQVNDK
                     TGIIENVKFKTFGCGSAIASSSYMTEMVNGMSINDAERIKNTQIAKELSLPPVKLHCS
                     MLAEDAIKAAIQDYKSKRKQNTVLN"
     gene            <471433..>475596
                     /gene="NDAI0E02290"
                     /locus_tag="NDAI_0E02290"
                     /db_xref="GeneID:11498936"
     mRNA            <471433..>475596
                     /gene="NDAI0E02290"
                     /locus_tag="NDAI_0E02290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670241.1"
                     /db_xref="GeneID:11498936"
     CDS             471433..475596
                     /gene="NDAI0E02290"
                     /locus_tag="NDAI_0E02290"
                     /inference="similar to DNA sequence:INSDC:YOR227W,YPL137C"
                     /note="similar to Saccharomyces cerevisiae YOR227W and
                     GIP3 (YPL137C); ancestral locus Anc_8.648"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670289.1"
                     /db_xref="GeneID:11498936"
                     /db_xref="UniProtKB/TrEMBL:G0WBC6"
                     /translation="MSSNLIDATNIRQIHNPSDFDVPLEWLYKGKSKRKSKSSSRLKS
                     SSSSNKLKKLKNSSSNDPFASSTTDNQKQRSTSISNAALSSNHIPILQKPGLVDSNEN
                     AIDDDDDDEDDNNVQKDDLNNLHALTPTTTATTMEPTMVNSTSKKLVDEEKSNLPSRS
                     SKRNRSISISNAIASSNNSKSKNTPSTISSTSDPPPTIASAIPTFNSIKRNNSTNSNN
                     GSTKKSLFGSIFGRGSSTSNSKTKPQLATPSASAPTPTPKLNTALPSNSKTLKKISKL
                     NSMPQSDHPKETTPISAIYTSSSESTDSTPSNDSAIVSTGTPATSMNTLSSIPSIPSM
                     TIKDLSNVTLKRVSFAVDKFDNDPAQQLPSRTPKTGKVLVPDDMISDLPSISIGISNT
                     IIDDGKFMNQRKITKNSKEYKIAMENHRFALKEAAKHQQEAHFAAKRIANEVSNFKSN
                     GTSNSNNNPVNELRSHLNDKINKIDNPIHIHEHHFEEKINNNEETQEITLDIIYTRCC
                     HLREILPIPSTLRQVVGKTSPLQILKFLNPKPTLIDVLSFADFISIVPINTIIFDNVT
                     LTSNMLKIIITSLVKSQNLEKLGLRNVIIDNENWKLLCKFLLNNKSLTKLDISQTKIR
                     SEISSSSSSPSQTLASSSNMIPVDEIYRHNKDWSLFVDVLRNRDGKPLEELLLNGIKF
                     NKIPLTILQNLLNGLTNQKNSPPKGIRLGLATSDLSLDCVKILLSWWSKNTVQGIDLS
                     FNDLSEYVKPMISKLASLSFESLEYFTLNNTSISTGYDMALFLKYLSRLPNLKFLDLS
                     NLPQIFPDVLPYMHKYLPKFKHLKRIHLDNNNLSFKELTVVCNILLKCQSLAHVSMLS
                     QGTSSITNVAIKSAGSDQIGIQETSSSSTPSQFAKNTFCATLYAFAKDSSNLVGLDID
                     YDQIPDEIQQRIALCLMRNMNRAMDSTFQLDELTSQDDLLFDGTLITENAEDVLAKLN
                     KLNAQNQTGTNVNGTNGTGQSSKDDVTKRYLLKKYVEKIHKVHYNVQEKIDSMFEKRN
                     SGELTLVEKENLLRLILLDKNLSNIIEILSDLTRGSDFLGMSTNNSKGSISSIKSNDH
                     ADDTINNHTMTNDTVAYADGDIDSQRKPILRHVECNNPEEIQTPETETMARPHLMATD
                     SGRTIDVLTGKPVLFRRSSTTSVVGKRQEMEEGELHKWGFFVQQQRAIYPDNDTSIKK
                     DTIVPAIAPPVKPTLPVITTATANVEITPVTKTLTTPTTPTTTTRILPKIPSGAELRN
                     AIIKAKGIDSIDDLIQNVTENEVELLDIYGKSVQSKLHLDTASSAVGNEDKKKAIVDS
                     PTITTPTKKSVIVAKLKPVMPIMKKLDNDDDSGNDGCNGNGKNCEKTVTEAYDKLLND
                     LSVNRPSKT"
     gene            <475977..>477110
                     /gene="NDAI0E02300"
                     /locus_tag="NDAI_0E02300"
                     /db_xref="GeneID:11498937"
     mRNA            <475977..>477110
                     /gene="NDAI0E02300"
                     /locus_tag="NDAI_0E02300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670242.1"
                     /db_xref="GeneID:11498937"
     CDS             475977..477110
                     /gene="NDAI0E02300"
                     /locus_tag="NDAI_0E02300"
                     /inference="similar to DNA sequence:INSDC:YPL138C"
                     /note="similar to Saccharomyces cerevisiae SPP1 (YPL138C);
                     ancestral locus Anc_8.650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670290.1"
                     /db_xref="GeneID:11498937"
                     /db_xref="GOA:G0WBC7"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:G0WBC7"
                     /translation="MQARLSSLPVWCPPYSKTKKDPITGEDVYCICKKQDTGELMVGC
                     DGCDDWFHFSCMRIPIKYQKLVASFYCPYCQAGITGMDKSEAEEKTVEDETGDAIKVR
                     KTLWKKKCRLEDCYEPCTERSKYCSRQHGKEFLQEVLSKLDISGLNVGESVDKEAFVK
                     TLIQQNDRDDFQSFIRAGQSEFIDKDVPKSLDNQLYESLIANDRKVNELINQQSIIET
                     GTLPKAKERVELLEKYIDWISQVNIKFNEDQNSSGTTDENSSSKIDKGGKKSKKKKGL
                     KTKPKKRICGYISNFTELPSSVDKFVEEYELHKDDGLTTLQSVCIKTRCIKHSEWSSM
                     LLDRYLQEVELAERHQERIQLLLQTRKRQLHIQYYEKVTKKQS"
     gene            <477468..>478811
                     /gene="NDAI0E02310"
                     /locus_tag="NDAI_0E02310"
                     /db_xref="GeneID:11498938"
     mRNA            <477468..>478811
                     /gene="NDAI0E02310"
                     /locus_tag="NDAI_0E02310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670243.1"
                     /db_xref="GeneID:11498938"
     CDS             477468..478811
                     /gene="NDAI0E02310"
                     /locus_tag="NDAI_0E02310"
                     /inference="similar to DNA sequence:INSDC:YOR229W,YPL139C"
                     /note="similar to Saccharomyces cerevisiae WTM2 (YOR229W)
                     and UME1 (YPL139C); ancestral locus Anc_8.651"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670291.1"
                     /db_xref="GeneID:11498938"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0WBC8"
                     /translation="MTYSPTMAVPSSTIIANKVKNEEFKIWKKTVPSLYQHISNLKPE
                     FAAQEPHSIRTISFIDELVPNVERGILTVTLLYTQSDKIFKVRSSLPLGAYVSDLQQV
                     SQPICDPNYYGIDNEPLFQYDWIFKGEDIIKLVTLDSESFVALTANGSLGWFTTFGME
                     PTKIITDETCTRGNGYDFTVSRDKKQIIKTSGAGDVLKMYDIVSGELLKEWKEEGSST
                     QHSKINNVQFVGTDFVGACYDDCVKFWHLKSEDKKPKLILKEPSDIDQGNYSEFAMSP
                     LIDTLFITGTNSGVIKVWDLRTLFGTTWQDENKTSCNPIAEFIHFDGEAVIDLKFSPT
                     DATNFLTVGSSGQVYHWSLEGIYSMFDSGANNIDSDENKDDEEHSTDGTPKVFDEDLQ
                     NECLLFLHTGGFNAAESTTTCRKNMVVYQESIPDLIAALDRGGLLTVYKPFTGKI"
     gene            <480203..>483001
                     /gene="NDAI0E02320"
                     /locus_tag="NDAI_0E02320"
                     /db_xref="GeneID:11498939"
     mRNA            <480203..>483001
                     /gene="NDAI0E02320"
                     /locus_tag="NDAI_0E02320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670244.1"
                     /db_xref="GeneID:11498939"
     CDS             480203..483001
                     /gene="NDAI0E02320"
                     /locus_tag="NDAI_0E02320"
                     /inference="similar to DNA sequence:INSDC:YOR233W,YPL141C"
                     /note="similar to Saccharomyces cerevisiae KIN4 (YOR233W)
                     and YPL141C; ancestral locus Anc_8.654"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670292.1"
                     /db_xref="GeneID:11498939"
                     /db_xref="GOA:G0WBC9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0WBC9"
                     /translation="MASVQHRHTYYGGGSSTFKVNADPSQMLTTNHENPTSITKFNDI
                     NSPNSTKYSNQQVSMRRKHIAFGPYIIGSTIGQGEFGKVKLGWSKNPPSSPPNNLGIS
                     KQVAIKLIKRDAISKDSSKELKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYA
                     SGGEFYRYIQRKKRLKETAACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLV
                     ITDFGFVNEFYSHNELMKTSCGSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAG
                     YLPWDDDSGNPDGDDISRLYYYITKTPLKFPDYINPIPRDLLRKILVSDPRRRITMKQ
                     IEKHEWLKPHTAFLSITPEEWDTIMHPKSNTSFIRPVPLHSRNMNRPGSTCSMSSSGS
                     KNGDKRDSLIIDSTLIQLPAPPHESQSHVITKPAPTSRTPDLRHSPVRKSHTRNNSAA
                     SIALQAAVENTRDYGSTNSSEIIPTNRTRSSSFTFERKSPLHLQRTNLMSRDNTIIET
                     SPVIPKMRSTNNRYSLYNECDTLVELPSNMKTDKLFASNNDSAEFNRKKLNNIHSNMN
                     SDNNSYITNQEKNYNKFPTRLNHRKPRPTSYHPSSTLSPISPTPIFIKKTETPLLSSS
                     PVLLSPSTTTSPNHNHPVLHPVPHLAPVSSSPISKSSKVITNNNDSPTMLACRSFSMS
                     KPSLHLQSASGNLIKSNVDQKSVTTMMHEQVDIPQVLRIEVDSSANIIKETSNAAKLE
                     MDENVFIGTTPKIPPINIEPTNNTDLSPKNIDTNIELQKKEKKRFSFLSFYSMYNTSK
                     SSLNSEDSKGGKLSKVASSKAQHSANHHANNNSRKLSMNKEVESQLTTKNVLRDTTNI
                     QHNGALRSVSGKPVYPHPDRINTDGKNKNIRASIMISALNDRPSQTQVPKEQIRQPHE
                     QSTARKVIDFFKRRSTRL"
     gene            <487742..>489043
                     /gene="NDAI0E02330"
                     /locus_tag="NDAI_0E02330"
                     /db_xref="GeneID:11498940"
     mRNA            <487742..>489043
                     /gene="NDAI0E02330"
                     /locus_tag="NDAI_0E02330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670245.1"
                     /db_xref="GeneID:11498940"
     CDS             487742..489043
                     /gene="NDAI0E02330"
                     /locus_tag="NDAI_0E02330"
                     /inference="similar to DNA sequence:INSDC:YOR237W,YPL145C"
                     /note="similar to Saccharomyces cerevisiae HES1 (YOR237W)
                     and KES1 (YPL145C); ancestral locus Anc_8.658"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670293.1"
                     /db_xref="GeneID:11498940"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR018494"
                     /db_xref="UniProtKB/TrEMBL:G0WBD0"
                     /translation="MSQYASSSSWTSFLKSIASFNGDLSSLSAPPFILAPISLSEFSQ
                     YWAEHPDLFLDPSFINKDNYANYLGAEIECESPEMTRMLSVTKWFISTLKSQYCSRNE
                     SMGSEKKPLNPFLGEVFVGKWENKDHPEFGETVLLSEQVSHHPPVTAYTIFNDKNKVK
                     LQGYNQVKATFTKSLMLTVKQYGHTLLEVNDESFLITPPPLHIEGILMASPFVELEGK
                     SYIQSSTGMLCVVEFSGRGYFSGKKNSFKARIYKDAADSKDKENALYTISGQWSGISK
                     IVKNNSKEEVLFYDAGKVAAEHLYVKPLEEQHPLESRRAWQHVAEAITLGDFDLIAKT
                     KTELEESQRELRKVEEAKGISWQRRWFHDVDYSEEPDESSYVPQSNDIFLKLASAFSL
                     STKNVPSGTLIGDREDKKEGLTSVHWRFKRHLWEDEKEIVL"
     gene            <489675..>491027
                     /gene="NDAI0E02340"
                     /locus_tag="NDAI_0E02340"
                     /db_xref="GeneID:11498941"
     mRNA            <489675..>491027
                     /gene="NDAI0E02340"
                     /locus_tag="NDAI_0E02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670246.1"
                     /db_xref="GeneID:11498941"
     CDS             489675..491027
                     /gene="NDAI0E02340"
                     /locus_tag="NDAI_0E02340"
                     /inference="similar to DNA sequence:INSDC:YPL146C"
                     /note="similar to Saccharomyces cerevisiae NOP53
                     (YPL146C); ancestral locus Anc_8.659"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670294.1"
                     /db_xref="GeneID:11498941"
                     /db_xref="InterPro:IPR011211"
                     /db_xref="InterPro:IPR011687"
                     /db_xref="UniProtKB/TrEMBL:G0WBD1"
                     /translation="MAPVSAKERPSQYKQSSRKGKKAWRKNIDLTDIEKSIETKIEQE
                     ISHGVSDISTLQDTALFQVDIEGDNVLKNKLIKRKQIKKNLKSKEILDSIKTTSKIGA
                     VTHRNHHLTEDEKLAKKKVQGVSKKELNKLLALAGRVQGEYKLKARLAKDGLVKSQSF
                     VFMGFKKILKVQLPSGIKLDASVKEKIPEELLTMSTTSWSVASVKPETLKKAPLQLRE
                     FQELPHAGKSYNPDKKEWSSLIDKEYQVEKIKEENRIALEEYRERIKHLIETLDDNEE
                     EESSNDEKEEEFDEDEDNTSDVVKLSINTPVQNKKKTKYQRNKAKRHEEKMKLQQELK
                     KLKQQVHELEKLENIEEEVLLKFIEDKNKKQTTAGGKIKKTKKFGTKYGLLDERLEVK
                     FSDELSDSLRKLKPEGNLLYDNVRKLQSSGKIESRVPVKRGRRYKQKITEKWTHKDFK
                     "
     gene            <491337..>491858
                     /gene="NDAI0E02350"
                     /locus_tag="NDAI_0E02350"
                     /db_xref="GeneID:11498942"
     mRNA            <491337..>491858
                     /gene="NDAI0E02350"
                     /locus_tag="NDAI_0E02350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670247.1"
                     /db_xref="GeneID:11498942"
     CDS             491337..491858
                     /gene="NDAI0E02350"
                     /locus_tag="NDAI_0E02350"
                     /inference="similar to DNA sequence:INSDC:YPL148C"
                     /note="similar to Saccharomyces cerevisiae PPT2 (YPL148C);
                     ancestral locus Anc_8.664"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670295.1"
                     /db_xref="GeneID:11498942"
                     /db_xref="GOA:G0WBD2"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="UniProtKB/TrEMBL:G0WBD2"
                     /translation="MQKLQMLRQARNLLGIGTDIVYLPRFQRLLMKYTNDDDVYAIKS
                     SSALDRINDKFMHPIERATFRSLANESLSKRAKYLAGVWATKEATLKALHCYIPSEHI
                     PPAQVIYTKLLYKTNNTSTGSPQLQFDKNFSTTTPLYSQFFRDYINGKISTLLSISHD
                     EQYLVSFVCLTSK"
     gene            <492237..>493004
                     /gene="NDAI0E02360"
                     /locus_tag="NDAI_0E02360"
                     /db_xref="GeneID:11498943"
     mRNA            <492237..>493004
                     /gene="NDAI0E02360"
                     /locus_tag="NDAI_0E02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670248.1"
                     /db_xref="GeneID:11498943"
     CDS             492237..493004
                     /gene="NDAI0E02360"
                     /locus_tag="NDAI_0E02360"
                     /inference="similar to DNA sequence:INSDC:YOR239W"
                     /note="similar to Saccharomyces cerevisiae ABP140
                     (YOR239W); ancestral locus Anc_8.665"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670296.1"
                     /db_xref="GeneID:11498943"
                     /db_xref="UniProtKB/TrEMBL:G0WBD3"
                     /translation="MGVADLIKKFEKIAKNDGDDSITPARSPTRPHFELNKEVDHNDE
                     IEVPTNDSAAANEEEETAADGPGFEVKSEETVAEQDTATATVEEERAPQEEIKVDEVK
                     PTTPVVETPPQNESDIEVESKQEPEIETPIVEEKQQDKDENNEVEVEEVATTEAEDSE
                     ELQDQVETPIEDEPTVETPIYEEQTEPAATALAENEVEVEDVTANPEKKKETEAQIEM
                     ETKAGEEKKLLQARKRLVSPKLNSLVKLRIILQYQMK"
     gene            complement(<493488..>494315)
                     /gene="NDAI0E02370"
                     /locus_tag="NDAI_0E02370"
                     /db_xref="GeneID:11498944"
     mRNA            complement(<493488..>494315)
                     /gene="NDAI0E02370"
                     /locus_tag="NDAI_0E02370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670249.1"
                     /db_xref="GeneID:11498944"
     CDS             complement(493488..494315)
                     /gene="NDAI0E02370"
                     /locus_tag="NDAI_0E02370"
                     /inference="similar to DNA sequence:INSDC:YPL149W"
                     /note="similar to Saccharomyces cerevisiae ATG5 (YPL149W);
                     ancestral locus Anc_8.666"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670297.1"
                     /db_xref="GeneID:11498944"
                     /db_xref="GOA:G0WBD4"
                     /db_xref="InterPro:IPR007239"
                     /db_xref="UniProtKB/TrEMBL:G0WBD4"
                     /translation="MNAIRKLVWDGALNVEVTIDPELVIKGIPKNKTMVNLRIPRDSY
                     IMNYLDYILTRLEAYIRVNLKDLKELNFWFEYDGIPLSWNYPTGVLYDIMNTKDVITA
                     ARDTNHLNMWRINLTCGSQVPRNVIPIIEGTKQIEKYWMHQWKQVCFILRGSSKQIMS
                     ISRKEGQSFWESILRRDMETFNNISTRIIPKKARFIPVVIHINDKFIQPVAPSLNDDG
                     IENKVINITEGLSSSEIAIISHGVVIPKKSSLKEVYDRFLSFDGFLHLIIQEQPANT"
     gene            <494543..>496147
                     /gene="NDAI0E02380"
                     /locus_tag="NDAI_0E02380"
                     /db_xref="GeneID:11498945"
     mRNA            <494543..>496147
                     /gene="NDAI0E02380"
                     /locus_tag="NDAI_0E02380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670250.1"
                     /db_xref="GeneID:11498945"
     CDS             494543..496147
                     /gene="NDAI0E02380"
                     /locus_tag="NDAI_0E02380"
                     /note="ancestral locus Anc_8.667"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670298.1"
                     /db_xref="GeneID:11498945"
                     /db_xref="InterPro:IPR010770"
                     /db_xref="UniProtKB/TrEMBL:G0WBD5"
                     /translation="MLKIVKPTTPIDHEWLWQYDDGEKDINVFDAPTKVYLVFGIFYL
                     DRFAKETFAKVEGILQQVQANIQEWNTLYPWSEYNGISMELKYMNDGLPYIFGQLCEE
                     DNIQNEESLVVAMLQEVSLQLGSQLFIKISATDGDNILAEFNECIPEEYEYPVANNRF
                     WIYEGKFVMIPTYFYEGRGLKPNEALEFLTKAPFKCIEIDKLSQCIRDKIINPHPNAT
                     FAELGKLMLVIEDQDFLTILKDNSQIISYLVKSLIKDEITNVQDIIKKENVSDQDKNQ
                     PTEFLIPKNHANLLSLYLDIHKLKDDPLKIPMYCGRILHQVFKSLIDNSELKINEVSS
                     ATVKWKESNLLKDYKFETIALEEPFKPQSDVEPTEELMDKLGNFFKSDMDKEFNDSSL
                     KENKLSNVDSEDEFSDEREGNDQAKKYFEDENISIDEDDFFEFFLKEALKLKEEEIET
                     FRKQDSKKEQTVGDLQKKTNLDVEDDGESELRELVAELDTDSQEGAIDAFTNLFDSLS
                     VDGAPSGPFQTMLRNLSEQNGHKNET"
     gene            complement(<496256..>498907)
                     /gene="NDAI0E02390"
                     /locus_tag="NDAI_0E02390"
                     /db_xref="GeneID:11498946"
     mRNA            complement(<496256..>498907)
                     /gene="NDAI0E02390"
                     /locus_tag="NDAI_0E02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670251.1"
                     /db_xref="GeneID:11498946"
     CDS             complement(496256..498907)
                     /gene="NDAI0E02390"
                     /locus_tag="NDAI_0E02390"
                     /inference="similar to DNA sequence:INSDC:YPL150W"
                     /note="similar to Saccharomyces cerevisiae YPL150W;
                     ancestral locus Anc_8.668"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670299.1"
                     /db_xref="GeneID:11498946"
                     /db_xref="GOA:G0WBD6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0WBD6"
                     /translation="MNNVTQLEQNNIKSIIGASYNRLYGQFTSPDLKEVGNYKILDQI
                     GEGSFGKVYLASHRLTHCKVVLKTSNKSDPNIVREVFYHRQFDYPYITQLYEVIVTES
                     KVWMAQEYCPGKDLYDHVLSLQRVPSSACIELFTQIVGAVYYAHSLNCVHRDLKLENI
                     LLDKNGNAKLTDFGFTRECMTKTSLETICGTTVYMAPELIKRESYDGFKIDIWSLGVI
                     LYTMLNGSMPFDEDDETKTEWKIMNEMPVFNDTILSEDAKDLLIKLLSKDPNERPSMQ
                     EILHHPFLQPYGSLLLEKTDRLLRKQRNGTIHFHSKLERKLLKNLKRTGFDTQAMKVS
                     VQKRKSDLLSATWTLLLQREKRHEKVNQPKRSRSLLSVRKVFESSSPNIGQDLLKETD
                     DLRELKLVKSISRRISKRIDPSLPSGKKSFTSLDDQEQKENTASKPLSRIDSSVSKET
                     TPGKNNIFKKMSKFFKQKKYLNNSTPDSNTLTSNYGDTRSPSTSISNSYRRKNSESPV
                     KDITSVKTSETTIKKNSPINSKTSPSKSLKNAKAQTDDSARHKMQGTKLKESITIAEP
                     NLKKLKSIVSSDFSRSSLANYDSESVDNSYFLPNEDKRAGRSGSGRARPLSFVSQISN
                     DTYNSEYSTDGNTSSIKFEDPMKGTNDTSGTLQQSPKLGDNIITGYHRKFIRRDLSVI
                     SGASSTSERSSRTDSFYDITTTTLPITKNVRMIKSGSLKESVLPRFGSQRSWTGKRSY
                     IGSRHGGTLGRRNSKRYFLASPPNETDNVIQEESSSEESVPISRNNGLSLTNRLNSNP
                     QQIRDNTLDSDDENIGPHSDSEAVNSNIRSAMGRSNIFSAGTERSTSGEIIWSPHNDD
                     SKSVISEGTDHCEVDNADNEDNILSDN"
     gene            <499223..>500527
                     /gene="NDAI0E02400"
                     /locus_tag="NDAI_0E02400"
                     /db_xref="GeneID:11498947"
     mRNA            <499223..>500527
                     /gene="NDAI0E02400"
                     /locus_tag="NDAI_0E02400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670252.1"
                     /db_xref="GeneID:11498947"
     CDS             499223..500527
                     /gene="NDAI0E02400"
                     /locus_tag="NDAI_0E02400"
                     /inference="similar to DNA sequence:INSDC:YPL151C"
                     /note="similar to Saccharomyces cerevisiae PRP46
                     (YPL151C); ancestral locus Anc_8.672"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670300.1"
                     /db_xref="GeneID:11498947"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G0WBD7"
                     /translation="MDNYGNYETPIPIQRINDYYSSLRWRNQFSYMERLPQHLKEKVD
                     SQDPVLQRYRLQISEGNDTTSQDLAKVDSSSTKINATLEKTFGNSMEDSILGRHQQYI
                     SQRPEWHAPWKLKRVINGHLGWVRCVAVDPIDNEWFVTGSNDATIKIWDLAKGHLKLT
                     LAGHAMTVRDIAISERHPYMFSASEDKLVKCWDLEKNTAIRDYHGHLSGVHSVDIHPT
                     LDLIATAGRDSVVRLWDIRARVSVMTLIGHKSPINKVHCLPVDPQIVSCSTDATIRLW
                     DIIAGKSRKVLTHHKKSVRDMSFHPREFSMVSASTDDIRSWRLPEGALLTNFNSEKSG
                     IINSLSVNQDNVLCAGGDNGTLSFYDYKSGHKYQTLATKEIPGSLGSERGILCSTFDQ
                     TGLRLITGETDKSIKIWHQDDIATPETNPGLPWNPKLSSQRF"
     gene            complement(<500623..>501702)
                     /gene="NDAI0E02410"
                     /locus_tag="NDAI_0E02410"
                     /db_xref="GeneID:11498948"
     mRNA            complement(<500623..>501702)
                     /gene="NDAI0E02410"
                     /locus_tag="NDAI_0E02410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670253.1"
                     /db_xref="GeneID:11498948"
     CDS             complement(500623..501702)
                     /gene="NDAI0E02410"
                     /locus_tag="NDAI_0E02410"
                     /inference="similar to DNA sequence:INSDC:YPL152W"
                     /note="similar to Saccharomyces cerevisiae RRD2 (YPL152W);
                     ancestral locus Anc_8.674"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670301.1"
                     /db_xref="GeneID:11498948"
                     /db_xref="GOA:G0WBD8"
                     /db_xref="InterPro:IPR004327"
                     /db_xref="UniProtKB/TrEMBL:G0WBD8"
                     /translation="MLPEKRLLTEDDMKLWEASSTKKELLDFISTLAEAVKGCENSQI
                     SEPISPAINTLEQILVSIDKIIDKHPVLEDKEISRFGKKEFRGFYDEINEVSEKLIHE
                     NFPSLTHEQLEQLTIYLDESWGNKQRIDYGSGHELNFMCFLFGLYKYDVLKLDIDARN
                     MVLIIFIKYLDIMRSLETKYWLEPAGSHGVWGLDDYHFLPFLFGAYQLATHKHLKPLS
                     IHNEELVEMFAKKYLYFGCIAFINSVKTTASLRWHSPMLDDISGVKRWSKVAEGMVKM
                     YNAEVLSKLPIMQHFYFSEFLKCPEGVSPPGEKGHIHDGKEDDECLAEGHTHSTWGDC
                     CGIKLPSAIAATEINKKKHRPLPFD"
     gene            <501925..>503391
                     /gene="NDAI0E02420"
                     /locus_tag="NDAI_0E02420"
                     /db_xref="GeneID:11498949"
     mRNA            <501925..>503391
                     /gene="NDAI0E02420"
                     /locus_tag="NDAI_0E02420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670254.1"
                     /db_xref="GeneID:11498949"
     CDS             501925..503391
                     /gene="NDAI0E02420"
                     /locus_tag="NDAI_0E02420"
                     /inference="similar to DNA sequence:INSDC:YPL120W"
                     /note="similar to Saccharomyces cerevisiae VPS30
                     (YPL120W); ancestral locus Anc_8.615"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670302.1"
                     /db_xref="GeneID:11498949"
                     /db_xref="GOA:G0WBD9"
                     /db_xref="InterPro:IPR007243"
                     /db_xref="UniProtKB/TrEMBL:G0WBD9"
                     /translation="MSSSKLAKDEQSLKCQQCHLPLQFDDSLLDLSLNQKSSLIDSVP
                     MDQQQLASQPIFKIPKDRLQKLQSIKNINDLPPALKAGTTLDSYVYLKKSQLGKEERE
                     RQDVEEEEGDNESIPSGNGKTLSSQINALSNIFNILSSKTKIDYPVCQDCCNSMIQDL
                     KNQYDEAIKERETYTAFLNKLEMKVTTEPENSSDKKSASTDSLISIEDLKSTRNSLFE
                     ELLKLEKEDEELDRQIEDLKDELEQKGMKDLNEMAEVNKTHLEQLQFIQEVQSLQNQY
                     DSALTDLDELRKINIYNETFKIDHNGPFGTINGLRIGGFEECKVPWRERNAGIGQIIL
                     LLATIGNRLNFKLKGYRLRPMGSYSKIMKLSTESQDWISYEAFHEENFKIGRLFRKET
                     DFDKALECLLDIVQQMADRLPNSPTDTTNDESSLVAPSSAVNETVELPYIMHKDKINA
                     ISVKLYGAEPNLPWTTAMKFFLTNVKWLLAFSSSKLAS"
     gene            complement(<503901..>505886)
                     /gene="NDAI0E02430"
                     /locus_tag="NDAI_0E02430"
                     /db_xref="GeneID:11498950"
     mRNA            complement(<503901..>505886)
                     /gene="NDAI0E02430"
                     /locus_tag="NDAI_0E02430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670255.1"
                     /db_xref="GeneID:11498950"
     CDS             complement(503901..505886)
                     /gene="NDAI0E02430"
                     /locus_tag="NDAI_0E02430"
                     /inference="similar to DNA sequence:INSDC:YOR204W,YPL119C"
                     /note="similar to Saccharomyces cerevisiae DED1 (YOR204W)
                     and DBP1 (YPL119C); ancestral locus Anc_8.614"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670303.1"
                     /db_xref="GeneID:11498950"
                     /db_xref="GOA:G0WBE0"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WBE0"
                     /translation="MTDLTEQVHDFNIQGENATSANSSQHSYVPPHMRGKSSGGKMRP
                     SNGSNGSNNYGRRAPLGESYGGYRDGGGPPSSRRGGSYFRGGSSSGSFRGGGGGRGGG
                     FFDRDSSFMSRDRGFGTGGGLGRGTGGRWVDGKQIPGQKNERLEKELFGVADDPHVLS
                     SGINFDHYDDIPVEASGTKVPDPIDKFTAPQLDDLLLENINLARFSKPTPVQKYSIPI
                     IANGRDLMACAQTGSGKTGGFLFPVLSEAFKSGPSPTPEQGRNFYSKKGYPTSLILAP
                     TRELATQIFEEAKKFTYRSWVKPCVVYGGAPIGNQMREIDHGCDLLVATPGRLSDLLE
                     RGKISLQNIKYLVLDEADRMLDMGFEPQIRHIVEGVDMPQVGERQTLMFSATFPIDIQ
                     QLARDFLNDYVFLSVGRVGSTSDNITQKILYVEDQDKYSALLDLLSATSDGLTLIFVE
                     TKRMADQLTDFLIMQNFRATAIHGDRTQAERERALSAFKAGTANLLVATAVAARGLDI
                     PNVTHVINFDLPSDIDDYVHRIGRTGRAGNTGVATSFFNAGNQNIVRGMIEILTEANQ
                     EVPDFLKELSRDSGRSRSTRGGGGGGGYSNRGHGSRDYRKHGNGSFGSSNVGSGRSNG
                     SWGSGGGGGGFRGGYDSNSWGNNSADSGRSSGNSSWW"
     gene            <506418..>507542
                     /gene="NDAI0E02440"
                     /locus_tag="NDAI_0E02440"
                     /db_xref="GeneID:11498951"
     mRNA            <506418..>507542
                     /gene="NDAI0E02440"
                     /locus_tag="NDAI_0E02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670256.1"
                     /db_xref="GeneID:11498951"
     CDS             506418..507542
                     /gene="NDAI0E02440"
                     /locus_tag="NDAI_0E02440"
                     /inference="similar to DNA sequence:INSDC:YPL118W"
                     /note="similar to Saccharomyces cerevisiae MRP51
                     (YPL118W); ancestral locus Anc_8.613"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670304.1"
                     /db_xref="GeneID:11498951"
                     /db_xref="InterPro:IPR016712"
                     /db_xref="UniProtKB/TrEMBL:G0WBE1"
                     /translation="MSISPAPYSRISNLIRTTKLSHVPQNSRPLNPTTSHKYYPTHQI
                     IETKPSSLYRQDWGLKASIPSKIKSRYLIFNEMDTLERLTSFEPRGDTQWIRRRFNEM
                     GININFNTGKINPLFDTNNSAAMEADISNPLSSMLNIDAKSKAAGHETTKKLKLNDVV
                     VAFQYLKKYRNEFKKWLLERNPEVFLGKKFSPKDMKNDALEFLQEKLASNKSSSSQLN
                     NIPRKIVGSGGLTYSLRGRLKNSPNGIVEKNIFAGRCLNSLSNERYTLAVGGFITTVN
                     SQRIENKLRVSNNVSIRECVVPVDVKDATLDSEGRIFIRANVIDSPNQKTVENIKSKS
                     FSMKSIRLGSRRNPKQAPRNTSDSTRYANELLKIIKDNGR"
     gene            complement(<507803..>508633)
                     /gene="NDAI0E02450"
                     /locus_tag="NDAI_0E02450"
                     /db_xref="GeneID:11498952"
     mRNA            complement(<507803..>508633)
                     /gene="NDAI0E02450"
                     /locus_tag="NDAI_0E02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670257.1"
                     /db_xref="GeneID:11498952"
     CDS             complement(507803..508633)
                     /gene="NDAI0E02450"
                     /locus_tag="NDAI_0E02450"
                     /inference="similar to DNA sequence:INSDC:YPL117C"
                     /note="similar to Saccharomyces cerevisiae IDI1 (YPL117C);
                     ancestral locus Anc_8.610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670305.1"
                     /db_xref="GeneID:11498952"
                     /db_xref="GOA:G0WBE2"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR011876"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:G0WBE2"
                     /translation="MTYSQLVENMSSHDILDKFPDIIPLRRRPNSKSSESSSAQDAIF
                     TGHDEEQIKLMNENCIVLDWNDNAIGSATKKMCHLMTNINRGLLHRAFSVFLFNSENK
                     LLLQQRASEKITFPCLWTNTCCSHPLCIDDEIGSNHHLDKKIQGAIVAATRKLNHELG
                     IPTEEIERMGKFHFLNRIHYMAPSNEPWGEHEIDYILFYKLNYTGTKEDLTVNPNVNE
                     VRDYKWVSMDELKSMLEDPNLKFTPWFNIICESYLFKWWAQIDDIEKVENDTKIHRML
                     "
     gene            <509417..>510877
                     /gene="NDAI0E02460"
                     /locus_tag="NDAI_0E02460"
                     /db_xref="GeneID:11498953"
     mRNA            <509417..>510877
                     /gene="NDAI0E02460"
                     /locus_tag="NDAI_0E02460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670258.1"
                     /db_xref="GeneID:11498953"
     CDS             509417..510877
                     /gene="NDAI0E02460"
                     /locus_tag="NDAI_0E02460"
                     /inference="similar to DNA sequence:INSDC:YOR198C"
                     /note="similar to Saccharomyces cerevisiae BFR1 (YOR198C);
                     ancestral locus Anc_8.609"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670306.1"
                     /db_xref="GeneID:11498953"
                     /db_xref="UniProtKB/TrEMBL:G0WBE3"
                     /translation="MTTGSKEQVQAKPANTELKEPIRPNFAERDRLVEEIQSKVQEYD
                     SELTTLNKRIKSTKANYKKLIKERNEVQEEYKKYLKTQLDLKGSRQKIQDQIKIVDTN
                     IKKKNTEINTKLGKNKSRFGSAAGVSIRIKEIEDSISSGKLTLVEEKVLEKQLKSLNK
                     VYNDFKSVVPIVKSIGSDEKKVTALKEEFSSLNPREVTAKVEQLQNKLKELQNQVEKT
                     YSKEEAVILQRDKLHQVREDKYAEIQKTKRHYNKMFKNFKKQEGVYKTAMKEQLLNKE
                     ERKRLRNLAEAKESIVTKIQERLIQAKIPAFRDEVKAIEGCLVALDQDFKPETRHLFD
                     NDMMNETVSKPVEKDDDIVLVEYDDDEAFLNTAPSKSKKIKKKQQQQNEGTHDKTFLT
                     KIDGKITLEPLLISTLAEFEIVIPISQEELEKTISQLREKRKDYIERQKEVTEKNILT
                     VEKELERVEQDFAKKEATIKGEMEKKKLQRQMEKAN"
     gene            complement(<511057..>512169)
                     /gene="NDAI0E02470"
                     /locus_tag="NDAI_0E02470"
                     /db_xref="GeneID:11498954"
     mRNA            complement(<511057..>512169)
                     /gene="NDAI0E02470"
                     /locus_tag="NDAI_0E02470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670259.1"
                     /db_xref="GeneID:11498954"
     CDS             complement(511057..512169)
                     /gene="NDAI0E02470"
                     /locus_tag="NDAI_0E02470"
                     /inference="similar to DNA sequence:INSDC:YOR197W"
                     /note="similar to Saccharomyces cerevisiae MCA1 (YOR197W);
                     ancestral locus Anc_8.608"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670307.1"
                     /db_xref="GeneID:11498954"
                     /db_xref="GOA:G0WBE4"
                     /db_xref="InterPro:IPR011600"
                     /db_xref="InterPro:IPR029030"
                     /db_xref="UniProtKB/TrEMBL:G0WBE4"
                     /translation="MYSNGQQYNYAYDPNQYQYQQPMYNAPPPPPQQYYQYEPDPIYQ
                     SYSSDPYYGTQVAYEAYPPPPQESSYSYGKRKALLIGINYFGSRNQLSGCINDTQNMY
                     NFLVQRYGYSPDDIVRLTDDQANPVCVPTRYNMLRAMSWLVKDVQPGDHLFLHYSGHG
                     GQTPDLDGDEEDGMDDVIYPVDFETQGFIVDDLMHDIMVRPLMQGVTFTALFDSCHSG
                     TVLDLPFTYSTKGVIKEPNMWKNIGSSGLGAAMAYATGNTSDLLGSLRSIGNTVGGGN
                     NGYDRQRVIQMKFSPADIIMLSGSKDNQTSADTFEDGQNIGAMSHAFIKVMSYQPQQS
                     YLSLLQNIRAELMNKYSQRPQLSTSHPIDINAAFNI"
     gene            <512966..>515020
                     /gene="NDAI0E02480"
                     /locus_tag="NDAI_0E02480"
                     /db_xref="GeneID:11498955"
     mRNA            <512966..>515020
                     /gene="NDAI0E02480"
                     /locus_tag="NDAI_0E02480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670260.1"
                     /db_xref="GeneID:11498955"
     CDS             512966..515020
                     /gene="NDAI0E02480"
                     /locus_tag="NDAI_0E02480"
                     /inference="similar to DNA sequence:INSDC:YPL116W"
                     /note="similar to Saccharomyces cerevisiae HOS3 (YPL116W);
                     ancestral locus Anc_8.607"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670308.1"
                     /db_xref="GeneID:11498955"
                     /db_xref="GOA:G0WBE5"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:G0WBE5"
                     /translation="MSTQDPLENFYRQFQIFVKNNPNVISAARAASQIPESAKAVIIL
                     SPYSLQHQFPRDWVSSSYKKTIVERPERLLACSMGISAAITMYPALFTLKSSHNKMGS
                     LLSPHVYKVHGSQWPKEILRLCKEADSKLAQGKLEVPDSWNSGDIYLSSKTVQALQGS
                     IGALETAVDSIFKGPSPEHISNRAFVAIRPPGHHCHFATPSGFCVLNNAHVAIEYAAD
                     SYDVTHVAVLDFDLHHGDGTQDICWKRAGFKPDEETKENEEYDGFGKKLAEFPRVGYF
                     SMHDINSFPTESGFATKENIKNASTCIMNSHDLNIWNIHLSSWSNEEEFSKLYRSKYR
                     LLFAKADEFFKTAKSEMADMGKPFKGLILLSAGFDASEFEQKTMQRHSVNVPTEFYTM
                     FTKDALKLAQMHCQGKVLSLMEGGYSDKAITSGVFAHLIGLQNQDWIKEWGSEHVVKE
                     IVRGCKPAWKPYKTKRSKDVIRVWAEEVIRLGRSMIPEFEDVIFKSKEKIRQKTDVAP
                     TISQRVTRSHGHYQPTSPVKDSDVKLDRHSPEKTTTVDKDRNVPFIEQHFSDEDENED
                     DDYVYDEELNETFNKTVEDITIDDISRHLETLEIVQSDDEEEEQQSRSRSQRSSHQQQ
                     QQQPRRLQSNGMYKIPSRTTTQHLRQSRNPNAPGYEDSDISMISHISTTRKHTTRSGG
                     RW"
     gene            complement(<515493..>518861)
                     /gene="NDAI0E02490"
                     /locus_tag="NDAI_0E02490"
                     /db_xref="GeneID:11498956"
     mRNA            complement(<515493..>518861)
                     /gene="NDAI0E02490"
                     /locus_tag="NDAI_0E02490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670261.1"
                     /db_xref="GeneID:11498956"
     CDS             complement(515493..518861)
                     /gene="NDAI0E02490"
                     /locus_tag="NDAI_0E02490"
                     /inference="similar to DNA sequence:INSDC:YPL115C"
                     /note="similar to Saccharomyces cerevisiae BEM3 (YPL115C);
                     ancestral locus Anc_8.605"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670309.1"
                     /db_xref="GeneID:11498956"
                     /db_xref="GOA:G0WBE6"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G0WBE6"
                     /translation="MSEQPNGSATLELLAQYDNHISERDKTIEYIERTTDPTNDNKPT
                     YDELFKENVKLKLLVQEYETEIDSLKKTISLLRENRKSVNSESLDVILDQSSSISKDS
                     DATRQSLTLPPRSDRRSNTKNLSIPIPQSTSTSSQLDSAQKPQVDIITTTTNNDSHHN
                     TKLLNAARFISSPHKITKLQESLSSPATSVTYTTSRITIKSPRNSVESPLQNKMGSPQ
                     NPNRVTSVINNHIHSPLRGNSQFSTDDLNNGAFKEEILDTRRTLSNEVISSVRSPSTY
                     SDSKSPLAHLRRSTSSGKKSMEFSPNSKAKLNNFAQLLDTSFGEEEEAEMEEAKEEKE
                     RLKEHEELVGTAPLLPKENNDDQPLPKNLEKDLETNNSVNPYRDGKPQLSRISAPVLT
                     PVSEKHINMTPTFNRLGSPLILNRKTNMINGTPSSNNTTGTSPRQGFSNFSISEGTED
                     TNASTISSSTKKQNILNDLLHVKISSHHSDSNASTPNTTEDTASNQTLSVQQEKSKTE
                     NVRSVSDTASSLKSDIPLFVQPTELFTVRIEILSTLYNENKEEHDLNRYEENYILFGI
                     IDKNTGKEMFKFSKTINKVRELDVYLKSHLTSNKLVTIPNLPDRSFFNSNLPIRIDQR
                     REILNKYFESLFDAVPKLPPNVSLKIAQFISTDTAMNPLDLGDTIKEGYLLIRKPKTL
                     SNANNWKTRYCILTENTLQFFNKGQLFETIRLKGAMMELLPNLPDDKYGTKNGFLINE
                     HRKSGLSSTTKYFLCTETSKERELWISAISQFLENSFSLNIAERRLSTGSDRLYVTDL
                     TSEVTSNSTESNTGISSQTATYEPFLESIEDDKEVRRNKKRSFFPFKKLTGIDYDNIP
                     PHDLELKSPTKSSVRSVDLNNQTLVPSISGTNSHSYMPQSATVFGSSLNDCLKLSSHT
                     YQRKYEIPSVVYRCLEYLYKNRGVQEEGIFRLSGSSTLIKTLQEKFDQEYDIDLCQYN
                     ETIADPNGDEVSTLVSVNTISGLLKLYLRKLPHMIFGDEQYLPLKKIIDDNHDDPLNT
                     ALQLREVVANGEIPKENLSLMYALFELLVKINANNKLNKMNVRNLCIVFSPTLNIPIT
                     LLQPFIVDFACIFQGAEPIDGSQREQLDINIPQL"
     gene            <519604..>520422
                     /gene="NDAI0E02500"
                     /locus_tag="NDAI_0E02500"
                     /db_xref="GeneID:11498957"
     mRNA            <519604..>520422
                     /gene="NDAI0E02500"
                     /locus_tag="NDAI_0E02500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670262.1"
                     /db_xref="GeneID:11498957"
     CDS             519604..520422
                     /gene="NDAI0E02500"
                     /locus_tag="NDAI_0E02500"
                     /inference="similar to DNA sequence:INSDC:YOR194C"
                     /note="similar to Saccharomyces cerevisiae TOA1 (YOR194C);
                     ancestral locus Anc_8.603"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670310.1"
                     /db_xref="GeneID:11498957"
                     /db_xref="GOA:G0WBE7"
                     /db_xref="InterPro:IPR004855"
                     /db_xref="InterPro:IPR009083"
                     /db_xref="InterPro:IPR009088"
                     /db_xref="InterPro:IPR013028"
                     /db_xref="UniProtKB/TrEMBL:G0WBE7"
                     /translation="MSNSEASKVYELIVSSVINEVREDFENAGIDEQTLQDLKRVWQS
                     KLTETKVTNFTWDEEVFPHVAATEGQQLPGAPQLIDSNLDANGNPVTIVKEEEGQNLV
                     LPGLIYDSNSTNGVKTENEKMNIPEPLMKKEESHSINQVINNASSANDTQDTEREQTD
                     DVPESTSPQQIELTIENANDKTIDQLRLQEKKAKRSALLDNDEVGSELDDSDDDYLIS
                     EGEDDGPDENLMLCLYDKVTRTKARWKCSLKDGIVTIAHKDYSFQKAQVEAEWV"
     gene            complement(<520699..>521928)
                     /gene="NDAI0E02510"
                     /locus_tag="NDAI_0E02510"
                     /db_xref="GeneID:11498958"
     mRNA            complement(<520699..>521928)
                     /gene="NDAI0E02510"
                     /locus_tag="NDAI_0E02510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670263.1"
                     /db_xref="GeneID:11498958"
     CDS             complement(520699..521928)
                     /gene="NDAI0E02510"
                     /locus_tag="NDAI_0E02510"
                     /inference="similar to DNA sequence:INSDC:YPL113C"
                     /note="similar to Saccharomyces cerevisiae YPL113C;
                     ancestral locus Anc_8.602"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670311.1"
                     /db_xref="GeneID:11498958"
                     /db_xref="GOA:G0WBE8"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G0WBE8"
                     /translation="MTINQKKNLVTDKEINLSNPTVIIPYKFQWEVYQHHKNDDEEET
                     DPLNWENICDKINFITYEMSTPDAFIQFINDPSYEVQIDCIWITEEFLSIMGDINEYI
                     KKFPSSITSLMVPWVGCEFLNLKLLNEKNIKVCNIGPHAANYVCEVAIHLVLSCFRMT
                     SFWEHCFKYVDVGEIKECKKYIGSKQQSTHGKNDWPTKIDPKNELVIPTRWDTSYGVG
                     GYDTKLFESPTNKSVLILGFGSIGQAIGSKLKTLFNMEVNYYKRSGPISKSQLGYAAT
                     YWDSLDNKETWYSSHLIILCLPSNESTTNLINKKTLQMCRDGVRIINVGRGACIDEDA
                     LLEGLSNGKIASCGLDVYKDETTLVRKDLIQRWDVTALPHIGSTSLQEIKEQTEITLK
                     NIESFFIKGEGGLYPIN"
     gene            complement(<522256..>523515)
                     /gene="NDAI0E02520"
                     /locus_tag="NDAI_0E02520"
                     /db_xref="GeneID:11498959"
     mRNA            complement(<522256..>523515)
                     /gene="NDAI0E02520"
                     /locus_tag="NDAI_0E02520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670264.1"
                     /db_xref="GeneID:11498959"
     CDS             complement(522256..523515)
                     /gene="NDAI0E02520"
                     /locus_tag="NDAI_0E02520"
                     /inference="similar to DNA sequence:INSDC:YPL112C,YOR193W"
                     /note="similar to Saccharomyces cerevisiae PEX25 (YPL112C)
                     and PEX27 (YOR193W); ancestral locus Anc_8.601"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670312.1"
                     /db_xref="GeneID:11498959"
                     /db_xref="UniProtKB/TrEMBL:G0WBE9"
                     /translation="MSLDEPGLIIGNEKGNNILNPIIKDFDDNNLRLPISLNQVDPTK
                     NDSELTLLAATNISPSSSPELNIPNSWAKPESKIKKVVRNVDILKYLINSLAGKDKFV
                     KIIKCILDLLKSWILTDLSSTETNIKMKKLLLSLSTTSSGTSIIPLKSILVHPVKFVR
                     LFTLSFLQNLNHNVSFITSQLSIFRYMIRFGSSPFKLLTFVKKLRSTTKATNLNDIEK
                     LWLNEKSLQDSIDLYYTIFDELDLLYKLKIWNPQERTYSWVTKHETIAWQYDILLSWK
                     QNWFKLKDIQRKILELQIQLKIRNDTMLASNYFNNNNNSNDNTDNTSPLRKQLISEIQ
                     QNGNNNDLSSLEIELDNQLVNLNHEKRIVYLDLTRLSFDCLANTTDLLNIKTPKGTYA
                     ALSLCSGITGFIKLWINTKTDLQNGAQ"
     gene            complement(523903..523974)
                     /gene="NDAI0Etrna8M"
                     /locus_tag="NDAI_0Etrna8M"
                     /db_xref="GeneID:11498960"
     tRNA            complement(523903..523974)
                     /gene="NDAI0Etrna8M"
                     /locus_tag="NDAI_0Etrna8M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:11498960"
     gene            <525463..>526443
                     /gene="NDAI0E02530"
                     /locus_tag="NDAI_0E02530"
                     /db_xref="GeneID:11499093"
     mRNA            <525463..>526443
                     /gene="NDAI0E02530"
                     /locus_tag="NDAI_0E02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670265.1"
                     /db_xref="GeneID:11499093"
     CDS             525463..526443
                     /gene="NDAI0E02530"
                     /locus_tag="NDAI_0E02530"
                     /inference="similar to DNA sequence:INSDC:YPL111W"
                     /note="similar to Saccharomyces cerevisiae CAR1 (YPL111W);
                     ancestral locus Anc_8.600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670313.1"
                     /db_xref="GeneID:11499093"
                     /db_xref="GOA:G0WBF0"
                     /db_xref="InterPro:IPR006035"
                     /db_xref="InterPro:IPR014033"
                     /db_xref="InterPro:IPR020855"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="UniProtKB/TrEMBL:G0WBF0"
                     /translation="MTVTTAPSYKYYESQRLSIITAPFSGGQSRSGVEKGPKYMLNHG
                     LQNSLTKLGWSTVITEPLSSAILQIKKDEMDQNDRMGIVKRPNLVGKVTKLIYETVTK
                     SLSNERFPLTLGGDHSIAMGTVSAVIDKFPDAGLLWIDAHADINTLTSTDSGNLHGCP
                     VSFLMGLNDKKMVPESMEWIPGNLKPNKIAYIGLRDIDEGEKKILKNLGIAAFSMYHV
                     DRLGINEVIEMAMRAIHPETNGDGPIMCSYDVDALDPLYVPATGTPVRGGLTLREGLF
                     LVERLAETGNLVGLDIVEVNPDLASKDDHVSDTIATSCSIARCALGETLL"
     gene            complement(<526907..>530512)
                     /gene="NDAI0E02540"
                     /locus_tag="NDAI_0E02540"
                     /db_xref="GeneID:11498961"
     mRNA            complement(<526907..>530512)
                     /gene="NDAI0E02540"
                     /locus_tag="NDAI_0E02540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670266.1"
                     /db_xref="GeneID:11498961"
     CDS             complement(526907..530512)
                     /gene="NDAI0E02540"
                     /locus_tag="NDAI_0E02540"
                     /inference="similar to DNA sequence:INSDC:YPL110C"
                     /note="similar to Saccharomyces cerevisiae GDE1 (YPL110C);
                     ancestral locus Anc_8.599"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670314.1"
                     /db_xref="GeneID:11498961"
                     /db_xref="GOA:G0WBF1"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G0WBF1"
                     /translation="MKFGKTFSSYQTPKYSTQYLDYKGLKQIIKEIIIQQEELYQEEH
                     SNKENETNPQRKIRDVSNEEKNYFGNEKVRKLILQFSFKLDRNLEKIDNFYNNRFAEY
                     SRQLQRLLDSPQFANVALLFRNGEDEGTPIGGSNTSIASFSRRSILNLEKIVLLDPHQ
                     RIDDLRDVQTVLMDLQKQFNDLNKYAQLNKRGIIKILKKFDKKVGTSQQQSYLASRVF
                     TLPFAEDEESRNINTMINEYLEILDLKANKFQNVPPIEERKSRQYKQLQFPGSIDCCI
                     KEDNVEDLEEEIKRIKDRTENTIPLRTFVKLLLKASLNESQKCIDYLLEIVPTLNDET
                     DINNRNFFHHYVILMNKNPLYAKNNVVDVLSSILGKLKREQSIYLLQRDDYKRTPLHY
                     ACQYGLYDLTKVLLIYMKEWNLWPENFTSSNLKEWEDYESLVPLHLAILSGDVETLQV
                     ILDSTTCEKGVLDNLQLTHLAIKLNQECLVERLLQSNKFDVNYQEEESQETALYLACK
                     LNCPTTVKLLLQHGVDTELKEGIFGWTPLFIAATEGYFEITKHLIDYNCKMEVFDEGG
                     WTPMEHAVLRGHLEIAELLTIENIEEVNNPKITGATDATAETGESLPKTTDSSESSSL
                     GASKNSKSSTNLLSFKTISKPVKSFGHKYLKENETILLITLGSSDTRRDNRGIIFKED
                     SQLFKKLSSNELEYALSLVISCEDDLNQTPVVFDLPFEEEIPDSISFKVPFKEDNSYI
                     IYFDLVPTYDKVLKEEGKEDEEGKLGTEKRLRGRSIAVVNHLQTFVGDNRRSLTDLCT
                     LPIMSTSSPFDIVGTVNFEIMLVKPFIHENVTFGRTKTYWKSLTSTRVIGHRGFGMNR
                     KLSNSLQLGENTMESFIAASSLGAAYVEFDVQLTKDNIPVIYHDFTIAETGVDIPMHE
                     LTLEQFLELNNMDKHMKGGKSGSVFEKKRRHSLADFDIEHSNNDKNDPDYNNNNNENN
                     GDDPTQYADIFSRNWIGDRMRLTKTFKAKQFKGNSRGHSIASSFVTLPELFKKLPPHV
                     GFNIECKYPMIDEAEEEGIGPITIEMNHWVDTVLRHVYDNMNGRDIILSSFHPDVCIM
                     LSLKQPSLPVLFLTEAGCMKMVDARAASLQNAIKFAHHWNLLGIVSAAKPIIKAPRLV
                     EVIKGNGLVCVTYGVENNDPNNAQIEIDAGVDAVIVDSVLAVRRGLTKGSDQSMN"
     gene            complement(<530887..>532986)
                     /gene="NDAI0E02550"
                     /locus_tag="NDAI_0E02550"
                     /db_xref="GeneID:11498962"
     mRNA            complement(<530887..>532986)
                     /gene="NDAI0E02550"
                     /locus_tag="NDAI_0E02550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670267.1"
                     /db_xref="GeneID:11498962"
     CDS             complement(530887..532986)
                     /gene="NDAI0E02550"
                     /locus_tag="NDAI_0E02550"
                     /inference="similar to DNA sequence:INSDC:YPL109C"
                     /note="similar to Saccharomyces cerevisiae YPL109C;
                     ancestral locus Anc_8.598"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670315.1"
                     /db_xref="GeneID:11498962"
                     /db_xref="GOA:G0WBF2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G0WBF2"
                     /translation="MSQLRIHLNQSWRYFNRSSFKLKYPSPRHTLLPTACILYYNREK
                     ILQRSNRSLLLNDTLKSDPNGDTFEMGLYLSSQREIRDKLENDRQSKLEGSRNLLIRL
                     SRVFIYQIKDSLIEPIFTLLRFLELSTIFLPVLLIYPITYLGRPIQLPDGEVDTRGSL
                     LWCKLVKIALEYAGPSFIKLGQWAGSRNDIFSKTLCDALSQLHSNVSPHPFKYTKKVL
                     CEMLNVGELGEAFDEINEKPLGVGAIAQVYVAKLSELFVKKHNVITNNGNGNGNDANN
                     RWCAIKIIHPNVRKQISRDLKIMDFFARCINSLPNMEWLSLPDEVEQFSILMNLQLDL
                     RIEALNLKRFNENFKNDLQIKFANVFLNLCNKDVLFEEYIYGFPMGDFLKIKTKINDD
                     NLCRRVSDPFVDAFLKMLILDDFIHADLHPGNVLIRFVKTNKYGTSILSSEVDDFKVT
                     HSLRKKFEKQDPEFILELKHVLENYTPQVCFIDTGLVTELNDKNRVNFIDLFNALARF
                     NGYRAGELMIERSRTPETAIDKELFALKVKKLTDKVKQRTFTLGTVSIGDLLEQMLTM
                     VRSHHVRMEGDFVSVVVAILLLEGIGRQLDPDLDLFERFVFFALIKGLKNKTNKKHLL
                     TKSCCVFILLVYTYSSLPILREYGFSGGDKTSLLKDTNTFTMLKIWLGLEIRKLMTLS
                     IKELYNLVKWDELCPNY"
     gene            complement(<533331..>533882)
                     /gene="NDAI0E02560"
                     /locus_tag="NDAI_0E02560"
                     /db_xref="GeneID:11498651"
     mRNA            complement(<533331..>533882)
                     /gene="NDAI0E02560"
                     /locus_tag="NDAI_0E02560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670268.1"
                     /db_xref="GeneID:11498651"
     CDS             complement(533331..533882)
                     /gene="NDAI0E02560"
                     /locus_tag="NDAI_0E02560"
                     /inference="similar to DNA sequence:INSDC:YBR164C"
                     /note="similar to Saccharomyces cerevisiae ARL1 (YBR164C);
                     ancestral locus Anc_8.597"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670316.1"
                     /db_xref="GeneID:11498651"
                     /db_xref="GOA:G0WBF3"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WBF3"
                     /translation="MGSYFSSMFDRLWGVNKELRILILGLDGAGKTTILYRLQIGEVV
                     TTKPTIGFNVETLTYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMA
                     TASKELHLMLQEEELQDAALLVFANKQDQPGALSASEVSRELNLVELKDRSWSIVASS
                     AIKGEGITEGLDWLIEVIKEEQL"
     gene            <535654..>536139
                     /gene="NDAI0E02570"
                     /locus_tag="NDAI_0E02570"
                     /db_xref="GeneID:11498652"
     mRNA            <535654..>536139
                     /gene="NDAI0E02570"
                     /locus_tag="NDAI_0E02570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670269.1"
                     /db_xref="GeneID:11498652"
     CDS             535654..536139
                     /gene="NDAI0E02570"
                     /locus_tag="NDAI_0E02570"
                     /inference="similar to DNA sequence:INSDC:YPL108W"
                     /note="similar to Saccharomyces cerevisiae YPL108W;
                     ancestral locus Anc_8.594"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670317.1"
                     /db_xref="GeneID:11498652"
                     /db_xref="UniProtKB/TrEMBL:G0WBF4"
                     /translation="MSNPTRNTNGIKDQAVTKPESLNATTGEVLVKKSTGKSRVRKGQ
                     TEEQYQTQLYEYFELEEGPIRTEVDWMNNIKEPDDILSWEKFDLEVKHARLVLNGVCY
                     RLYFQRRYKECLEFGTKLLDLYKPYNENHKNKLKKEIDELEYMQKQCLSKDFSSINLQ
                     K"
     gene            <536294..>537055
                     /gene="NDAI0E02580"
                     /locus_tag="NDAI_0E02580"
                     /db_xref="GeneID:11498653"
     mRNA            <536294..>537055
                     /gene="NDAI0E02580"
                     /locus_tag="NDAI_0E02580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670270.1"
                     /db_xref="GeneID:11498653"
     CDS             536294..537055
                     /gene="NDAI0E02580"
                     /locus_tag="NDAI_0E02580"
                     /inference="similar to DNA sequence:INSDC:YPL107W"
                     /note="similar to Saccharomyces cerevisiae YPL107W;
                     ancestral locus Anc_8.591"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670318.1"
                     /db_xref="GeneID:11498653"
                     /db_xref="InterPro:IPR019180"
                     /db_xref="UniProtKB/TrEMBL:G0WBF5"
                     /translation="MLLKPTLLRFSQYNNDLRLCRLKVPILQMRCIVQTVTPKMTFEG
                     NTEGISTSEEAQMSRIFGGRIKGEAPKSTSRILTGGTRNIAGVKVPEKPIAPDNCCMS
                     GCVNCVWEIYNEDIRYWKKKRREAADKIKLTHEVWPARWNPPLGLLEMKNVPRSLRET
                     KLNYDRQKAEQVEKTPSDLFTKRDTPLPKAVIEAKKRHIKERATKNKMKEQESGEKIV
                     NKIDDDTEGWAGVPVYIKVFAEFESRQRDKKIRKS"
     gene            complement(<537501..>539558)
                     /gene="NDAI0E02590"
                     /locus_tag="NDAI_0E02590"
                     /db_xref="GeneID:11498654"
     mRNA            complement(<537501..>539558)
                     /gene="NDAI0E02590"
                     /locus_tag="NDAI_0E02590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670271.1"
                     /db_xref="GeneID:11498654"
     CDS             complement(537501..539558)
                     /gene="NDAI0E02590"
                     /locus_tag="NDAI_0E02590"
                     /inference="similar to DNA sequence:INSDC:YBR169C,YPL106C"
                     /note="similar to Saccharomyces cerevisiae SSE2 (YBR169C)
                     and SSE1 (YPL106C); ancestral locus Anc_8.590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670319.1"
                     /db_xref="GeneID:11498654"
                     /db_xref="GOA:G0WBF6"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:G0WBF6"
                     /translation="MSTPFGLDLGNNNSVLAVARNRGIDVVVNEVSNRATPSLVGFGP
                     KNRYLGETGKTKETSNVKNTVGNLKRIVGLDYAHPDFSTESEYFTSKLVKTDDEKIGA
                     EVRLAGEKHTFNATQLAAMFIGKVKNTVQQETKANINDVCVAVPAWYTEEQRYTIADA
                     ARVAGLNPVRIVNDVTAAAVSYGVFKTDLPEGEEKPRIVAFVDIGHSTYTCSIMAFKK
                     GELKVLGTAYDKHFGGRNFDRAITEHFADEFKGKYKIDIRENPKAYNRVLTASEKLKK
                     VLSANTAAPFNLESVMNDVDVSSQLTRDELEELVKPLLERVTEPVTNALAQAKLTPED
                     VDFVEIIGGTTRIPTLKNSISEAFGKPLSTTLNQDEAIAKGAAFICAIHSPTLRVRPF
                     KFEDIHPFSVSYSWDKQVEEEDHMEVFAAGSTFPSTKLITLNRTGDFTMAAQYTNIDQ
                     LPKGTGADIAKWEITGVEVPEGEESVPVKVVLRCDPSGLHIIEEAYTVHDIKVQEVVP
                     LPADAPEDAEPEFREVTKTVKKDSLTVVAHTFALDDKTLNELIEKENAMFAKDKLVAE
                     TEDRKNTLEEYIYTLRGKLDEEYAPFASGAEKTKLKDMLAKAEEWLYDEGYDSIKAKY
                     IAKYEELASLGNMIRGRYLAKEEEKKQALRANKEASQMADLSAKLAAQRKAEAEAKEN
                     AKE"
     gene            complement(<540099..>542687)
                     /gene="NDAI0E02600"
                     /locus_tag="NDAI_0E02600"
                     /db_xref="GeneID:11498655"
     mRNA            complement(<540099..>542687)
                     /gene="NDAI0E02600"
                     /locus_tag="NDAI_0E02600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670272.1"
                     /db_xref="GeneID:11498655"
     CDS             complement(540099..542687)
                     /gene="NDAI0E02600"
                     /locus_tag="NDAI_0E02600"
                     /inference="similar to DNA sequence:INSDC:YBR172C,YPL105C"
                     /note="similar to Saccharomyces cerevisiae SMY2 (YBR172C)
                     and YPL105C; ancestral locus Anc_8.587"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670320.1"
                     /db_xref="GeneID:11498655"
                     /db_xref="InterPro:IPR003169"
                     /db_xref="UniProtKB/TrEMBL:G0WBF7"
                     /translation="MIDSVYTAAKMNQELPTATPTTHSQYFPIDPMVNGLSDLHIVAS
                     HTEAANGQTQGTDPLEKLVNMNIGVTATNSGTSSLTASTQSASANSLNKKSRLLDSMN
                     IQRSGSPFLGKENMQSPSLDNNNSNNAGNSTWPSANYMGSHSTTSLSALQSQSKSELA
                     LQMSHLTQNRPFSFVQQHPNITSSLPVNLVVDTSQPHAGYFGPPAPPGIGNPALNAIR
                     PIHVISQWRYIDIHGQQQGPFPSTSMSQWLQAGYFQPSLQIQRVNTSMEPFGINEKYI
                     TLNDLIAKVNNFQDPFDTFDKIASHYAIGKNIATTNNSDLPSSEAHDADEQIKQKAKE
                     LANIRSDDYTLDEILNLKFDDGSYYREVVVQIPMNTRKIVTKLDDSFEVPTLAAAPIS
                     VQYPDMTAQDEPQSQPQVEQHIESLQETVPAIEEEQVVTKEEKAPVQQDYVEGATEEV
                     ENIPEEVSTSKKKKKKKKTDNAEEIEKKRKEKAELMAKKLLEEQEEEARKERSKKVKK
                     QEKEEKKKLKHLRKEEKERQRKMKKEDAELEELKSDSVSADNVAPWADSNSANNVTST
                     KKGLSIGEYLKQEELKKAQEKKERERQNRENLLKLNQQLVEEEQKANEMKSVLSWADK
                     PTQEPIQVNITPSVSKKLETKTKLKIKSSSKKSKSTFIEEQQKIWEQLQGNSQSTAAT
                     ESVNSNAWTTVSSSTKSTTSVPAATPMPAITKAMKKKSKASTTKQIGSSTSIPGLKLK
                     SNSPGVSPSYPGNASISARQTFLKWCRSQMHLNPGISVNSVLEVLLSLPAGLETKEII
                     ADTIYSNSSIMDGRRFATDFIKKRIDCEKQLMDPLTWKEALALPEGSKDDWEFQIVSK
                     KKGRKH"
     gene            <542991..>544979
                     /gene="NDAI0E02610"
                     /locus_tag="NDAI_0E02610"
                     /db_xref="GeneID:11498656"
     mRNA            <542991..>544979
                     /gene="NDAI0E02610"
                     /locus_tag="NDAI_0E02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670273.1"
                     /db_xref="GeneID:11498656"
     CDS             542991..544979
                     /gene="NDAI0E02610"
                     /locus_tag="NDAI_0E02610"
                     /inference="similar to DNA sequence:INSDC:YPL104W"
                     /note="similar to Saccharomyces cerevisiae MSD1 (YPL104W);
                     ancestral locus Anc_8.584"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670321.1"
                     /db_xref="GeneID:11498656"
                     /db_xref="GOA:G0WBF8"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004115"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004524"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:G0WBF8"
                     /translation="MLSQLITGNRCFLSTRTQFIRSLTKLPDSQKIRSQFVFQRKGSI
                     KAINELYKENAENIEVSINGWIDNKPKHIGKNISFGVLRDPNGDTIQLVDSHSLLKGI
                     SRETVVQVKGTISSKKNSNLYSNRLEYELKLNELSVLNLSNDKPSQLQDFKERGNYPP
                     QYRYLQLRNPKYSDFLKKRYEISRIVRDILNKENFLEIETPILFKPTPEGAREFLVPT
                     RVKKAKKGIPTFYSLTQSPQQYKQLLMASGFSNYFQVARCFRDEDLRADRQPEFTQID
                     LEMSFASGNDVMQLLEQLVPKTWDELSITGELFTLDHSGKKLIPVHENRNEIYRLTYQ
                     QAMSLYGIDKPDLRAPDLKIVDLSEFRATANRNKKFPTFEVIVLRNAFDSIENYKENW
                     HFLDNAQNYTYRTPLVVPITNDEAKTTWFEKFQSIAAFENPKMISKFLNLKQGDIICG
                     STREPNGSIFENPTPLGTLRKLVLQSEIGKRLYRETDHDVASWVIDFPLFSPLTNEPA
                     PNDDFPIYQHDRLMSTHHPFTMVNLSDYNKLNKNPTKCRGQHYDLVINGIELGGGSTR
                     VHDPELQNFIFESILKIENSEELFGHLLNAFAMGTPPHAGFAIGFDRMCAMLCGTESI
                     RDVLAFPKSITGTDLVVKSPSLVDEDVLKLYNIEYKKN"
     gene            complement(<545171..>546595)
                     /gene="NDAI0E02620"
                     /locus_tag="NDAI_0E02620"
                     /db_xref="GeneID:11498657"
     mRNA            complement(<545171..>546595)
                     /gene="NDAI0E02620"
                     /locus_tag="NDAI_0E02620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670274.1"
                     /db_xref="GeneID:11498657"
     CDS             complement(545171..546595)
                     /gene="NDAI0E02620"
                     /locus_tag="NDAI_0E02620"
                     /inference="similar to DNA sequence:INSDC:YPL103C"
                     /note="similar to Saccharomyces cerevisiae YPL103C;
                     ancestral locus Anc_8.582"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670322.1"
                     /db_xref="GeneID:11498657"
                     /db_xref="GOA:G0WBF9"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR024884"
                     /db_xref="UniProtKB/TrEMBL:G0WBF9"
                     /translation="MRLCSVGMRRIIPSYKGSRILRECSSKGFTRFYSYNFQGTIKKT
                     KIPPKQKRRYILGTFLTFLFPYTGYALYVTISTAKEIEERYRDSQLVEAYDKENKEKG
                     NFKSTLIKYSPLQVLGRYENPFVEYRIQTIYEFFFNRFVEIFEVNRGGLPPTKEQMDQ
                     LMPIHKPDWCKRQVDPPPSRVSPKKLIKHKIVDDPLSFETSPSAEESNVNIPIYNTWL
                     GQSCNFTTYNGLKILTDPIFSDFLIHEKLGPKRITFRPCEISDVPTPDIILVSHNHPD
                     HLDPKSLEYWKDANTLWIIPKGMKPFMDKHKVQNVIEISWWQSVQLTKNNENYFISST
                     PAMHWSGRSILDTNQSLWCSFLLSHKGKPILFHAGDTGYVKDLYQRIKNRFGGGCKLA
                     LLPCGQYCPEWHQKPRHINSKEVIDIMQDLEIKNVLGVHWGTFLLSGEYFLEPKQKLE
                     MLAEWKGIKDHCFCPELGKTIKFE"
     gene            <547015..>548424
                     /gene="NDAI0E02630"
                     /locus_tag="NDAI_0E02630"
                     /db_xref="GeneID:11498658"
     mRNA            <547015..>548424
                     /gene="NDAI0E02630"
                     /locus_tag="NDAI_0E02630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670275.1"
                     /db_xref="GeneID:11498658"
     CDS             547015..548424
                     /gene="NDAI0E02630"
                     /locus_tag="NDAI_0E02630"
                     /inference="similar to DNA sequence:INSDC:YPL100W"
                     /note="similar to Saccharomyces cerevisiae ATG21
                     (YPL100W); ancestral locus Anc_8.580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670323.1"
                     /db_xref="GeneID:11498658"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0WBG0"
                     /translation="MKVLNFNQDATCCVVYTAPHIVSIYNCDPFGKCFELDSRLKSTN
                     TNKHADNANNSMDGSNTSGNLRDEEVENEIIEESLTNLSNNNNNLTSMDDSVVVEMLF
                     STSLVAIADRSQSSIKSKRLKIVNTKRKSTICEISFSHAIVDVVMNRKRMCILLESDQ
                     IFVYDISCMKPLETIDLWEDHIKNNTAAAGIVSNIRETSDPKSHTQRKRRNSLRSRLR
                     PRMVLSNDDRSILCYTSYSSTKNQSDSFVLNDIVVYDALNVTPLNYLNSVHKGNIACL
                     AINYDGKLIATGSDKGTIIRIYSTGVDCEFNASKALKYEFRRGSRTCNLYQLSFDRKS
                     SMLGCVGDTDTIHIFKLDPESSDEFPGLNSQEEQLLDQNDEIQKHTNGDDKKFVRDPS
                     KQLSHFFSKRIKASIPNQNLRRDYAHISMNESLRYCLGFPGEFPNQVYVASDDGTFKV
                     YSLPSTPGECILMKTSKFD"
     gene            complement(<548583..>549179)
                     /gene="NDAI0E02640"
                     /locus_tag="NDAI_0E02640"
                     /db_xref="GeneID:11498659"
     mRNA            complement(<548583..>549179)
                     /gene="NDAI0E02640"
                     /locus_tag="NDAI_0E02640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670276.1"
                     /db_xref="GeneID:11498659"
     CDS             complement(548583..549179)
                     /gene="NDAI0E02640"
                     /locus_tag="NDAI_0E02640"
                     /inference="similar to DNA sequence:INSDC:YPL099C"
                     /note="similar to Saccharomyces cerevisiae YPL099C;
                     ancestral locus Anc_8.579"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670324.1"
                     /db_xref="GeneID:11498659"
                     /db_xref="UniProtKB/TrEMBL:G0WBG1"
                     /translation="MFLKHFCTKGSTISNVRRVLPINNSHFTKIAYRTITNTPYYLKS
                     KRSKHQQNKVEVNSLEDLVKFDSLDDVDPAVIKKLIDEKTQELNLKDELKMLKDFQEN
                     EKSLTNKDIPLKKFWRPFWIFLLLSSSVYLTCHYFWWKYMYEEREIDLQNQVNDLEFK
                     LKELMRNANINGELNTERNVSLDNSEEVAAKKRWFWNR"
     gene            <549982..>551088
                     /gene="NDAI0E02650"
                     /locus_tag="NDAI_0E02650"
                     /db_xref="GeneID:11498660"
     mRNA            <549982..>551088
                     /gene="NDAI0E02650"
                     /locus_tag="NDAI_0E02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670277.1"
                     /db_xref="GeneID:11498660"
     CDS             549982..551088
                     /gene="NDAI0E02650"
                     /locus_tag="NDAI_0E02650"
                     /inference="similar to DNA sequence:INSDC:YPL096W"
                     /note="similar to Saccharomyces cerevisiae PNG1 (YPL096W);
                     ancestral locus Anc_8.575"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670325.1"
                     /db_xref="GeneID:11498660"
                     /db_xref="GOA:G0WBG2"
                     /db_xref="InterPro:IPR002931"
                     /db_xref="InterPro:IPR018325"
                     /db_xref="UniProtKB/TrEMBL:G0WBG2"
                     /translation="MFSMEEDKVTRSSTNDSKKEINYKRTAEMFLTRYKDFIIKKFQL
                     NSDERRFNFLLRSNAFARELVSLSERYCTVYENGEWYSIVLETLDLETIYENVDSVKI
                     EEPLEYSDVLVKELLRYFKNDFFTWCDKPKCRKCHDSSKQIFDSIQGATREESLYGCG
                     AVEVFKCSECNELARFPRYNDPIKLLETRTGRCGEWCNLFTLILRSFGLEARYIWNKE
                     DHVWCEYYSPFLKRWVHVDSCEQSFDEPFIYSVNWNKKMSYCIAFNKDGMTDVSKRYI
                     LQNALPRNLISELDLKFLCMYVTKKLRRGLPSDDIYRSFCRDENERFEWLNKEKREAD
                     KREASSNDASKTSGITGRQSGAPDWKAQRNEDGR"
     gene            complement(<552771..>553631)
                     /gene="NDAI0E02660"
                     /locus_tag="NDAI_0E02660"
                     /db_xref="GeneID:11498661"
     mRNA            complement(<552771..>553631)
                     /gene="NDAI0E02660"
                     /locus_tag="NDAI_0E02660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670278.1"
                     /db_xref="GeneID:11498661"
     CDS             complement(552771..553631)
                     /gene="NDAI0E02660"
                     /locus_tag="NDAI_0E02660"
                     /inference="similar to DNA sequence:INSDC:YPL094C"
                     /note="similar to Saccharomyces cerevisiae SEC62
                     (YPL094C); ancestral locus Anc_8.572"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670326.1"
                     /db_xref="GeneID:11498661"
                     /db_xref="GOA:G0WBG3"
                     /db_xref="InterPro:IPR004728"
                     /db_xref="InterPro:IPR011553"
                     /db_xref="UniProtKB/TrEMBL:G0WBG3"
                     /translation="MSELNPASTLAIAKLLRHHKELKQRQGLFQSRTVDFFRYKRFVR
                     ALESPEYKKKSSNQPDLYPPVTSSEDARTVFILLIKSQLVVPATKLHNHECKANGLKP
                     NKDYPNLVLSNKATLSPNEYYVWNYNPKSFTDYVIVIAVIAILLALVCYPLWPRSMRR
                     SSYYVSMGSLGLIVALLVIAVLRLILYVMSLLFVSKKTGGFWIFPNLFEDCGVLDSFK
                     PLYGFGEVDSYSYQKKMKRIKRNLDKKNKIAQTPSTDKEDIEKEEKNNDDDTTKISKT
                     PKLEEIPEKK"
     gene            <554979..>556499
                     /gene="NDAI0E02670"
                     /locus_tag="NDAI_0E02670"
                     /db_xref="GeneID:11498662"
     mRNA            <554979..>556499
                     /gene="NDAI0E02670"
                     /locus_tag="NDAI_0E02670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670279.1"
                     /db_xref="GeneID:11498662"
     CDS             554979..556499
                     /gene="NDAI0E02670"
                     /locus_tag="NDAI_0E02670"
                     /inference="similar to DNA sequence:INSDC:YPL092W"
                     /note="similar to Saccharomyces cerevisiae SSU1 (YPL092W);
                     ancestral locus Anc_8.569"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670327.1"
                     /db_xref="GeneID:11498662"
                     /db_xref="GOA:G0WBG4"
                     /db_xref="InterPro:IPR004695"
                     /db_xref="UniProtKB/TrEMBL:G0WBG4"
                     /translation="MKYLPEFINHFEPFFFVMVMGTGISSDLLHSFPYPACWLKICSY
                     IMFAIACIIFVILQIFAILHLFIYSSENGFQAYFNHYFRNLNHNVFWGTYPMGLVTLI
                     NYISMIAIKEAAGTVHAKRLMYLVYIMWWYDVLISLLSAWGISFIIWQDYNYTENKNK
                     NKDCRSNSNQENLEITRSFLSRKTAHSQLKSILLLAVIPIVVVASSSGIFTMTDLFSI
                     HFNRNIQLLTLFVTALLWLHAIIFVFILISIYFWNLYVNKIPAMSQVFTLFLVLGPLG
                     QGSFGILLLTENVRKYVQRYYQTNTGTAISLEQQILTLSIPWSFKVMGLVLALGLLAM
                     GYFFSFISFISIISYSQKREIDPETGKYKRIYHFHKGFWAMTFPMGTMSLGSTEIFVQ
                     YNEYVPTGAFRVIGTIYAVICILWTIFCLLGSAYIYWIPGMKSLLQSAYNNNKENSGN
                     NDPSISDSTTMDKPSIELPYYEGSDNEDNDENDENDRDRNDSDIITNNCMYSPNMV"
     gene            <557376..>558827
                     /gene="NDAI0E02680"
                     /locus_tag="NDAI_0E02680"
                     /db_xref="GeneID:11498663"
     mRNA            <557376..>558827
                     /gene="NDAI0E02680"
                     /locus_tag="NDAI_0E02680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670280.1"
                     /db_xref="GeneID:11498663"
     CDS             557376..558827
                     /gene="NDAI0E02680"
                     /locus_tag="NDAI_0E02680"
                     /inference="similar to DNA sequence:INSDC:YPL091W"
                     /note="similar to Saccharomyces cerevisiae GLR1 (YPL091W);
                     ancestral locus Anc_8.568"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670328.1"
                     /db_xref="GeneID:11498663"
                     /db_xref="GOA:G0WBG5"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR006322"
                     /db_xref="InterPro:IPR012999"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR016156"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:G0WBG5"
                     /translation="MLSHSINQSRIITRIMSTTIKKHYDYLVIGGGSGGVASSRRAAS
                     YGAKCLVIEGKALGGTCVNVGCVPKKVMWYASDLATRISHANEYGLYQDFKLNKENLT
                     FNWPEFKTKRDAYVHRLNGIYENNLKKEGVDVVFGWAQFNKDGNVEVKTRSGETEVYS
                     ADRYLIATGGKPVYPKGIPGFEYGTDSDGFFRLENQPKKVVVVGAGYIGTELAGVFHG
                     LGSDTHLIIRGETLLRKFDDSIQETITDHYVKEGINVHKSSQIEKIEKDEMTKKLTIH
                     LNTSEVLEDVDELIWTIGRRSFLGLGLENIGIELNSKQEIITDEYQNTNVPNVYSLGD
                     VQGRVELTPVAIAAGRKLANRLFGPEKFRNDKLDYENVPSVVFSHPEAGSIGLSEKEA
                     ISKYGKENIKLYNTKFTAMYYAMLTEKSPTRYKIICVGPEEKVVGLHIVGDSSAEILQ
                     GFGVAIKMGATKSDFDNCVAIHPTSAEELVTMR"
     gene            complement(<559162..>560234)
                     /gene="NDAI0E02690"
                     /locus_tag="NDAI_0E02690"
                     /db_xref="GeneID:11498664"
     mRNA            complement(join(<559162..559866,560229..>560234))
                     /gene="NDAI0E02690"
                     /locus_tag="NDAI_0E02690"
                     /product="ribosomal protein S6"
                     /transcript_id="XM_003670281.1"
                     /db_xref="GeneID:11498664"
     CDS             complement(join(559162..559866,560229..560234))
                     /gene="NDAI0E02690"
                     /locus_tag="NDAI_0E02690"
                     /inference="similar to DNA sequence:INSDC:YBR181C,YPL090C"
                     /note="similar to Saccharomyces cerevisiae RPS6B (YBR181C)
                     and RPS6A (YPL090C); ancestral locus Anc_8.567"
                     /codon_start=1
                     /product="ribosomal protein S6"
                     /protein_id="XP_003670329.1"
                     /db_xref="GeneID:11498664"
                     /db_xref="GOA:G0WBG6"
                     /db_xref="InterPro:IPR001377"
                     /db_xref="InterPro:IPR014401"
                     /db_xref="InterPro:IPR018282"
                     /db_xref="UniProtKB/TrEMBL:G0WBG6"
                     /translation="MKFNISYPVNGTQKTIEIDDEHRIRVFYDKRIGQEVDGETVGDE
                     FKGYTFKISGGNDKQGFPMKQGVLLPTRVKLLLSKGVSCYRPRRTGERKRKSVRGAIV
                     GPDLAVLSLVITKKGEQEFEGVTDSTVAKRLGPKRANNIRKFFGLSKEDDVRDFVIRR
                     EVTKGEKTYTKAPKIQRLVTPQRLQRKRHQRALKVKNAQAQREAAAEYAQLLAKRLAE
                     RKAEKAEIRKRRASSLKA"
     gene            complement(<561006..>562994)
                     /gene="NDAI0E02700"
                     /locus_tag="NDAI_0E02700"
                     /db_xref="GeneID:11498665"
     mRNA            complement(<561006..>562994)
                     /gene="NDAI0E02700"
                     /locus_tag="NDAI_0E02700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670282.1"
                     /db_xref="GeneID:11498665"
     CDS             complement(561006..562994)
                     /gene="NDAI0E02700"
                     /locus_tag="NDAI_0E02700"
                     /inference="similar to DNA sequence:INSDC:YBR182C,YPL089C"
                     /note="similar to Saccharomyces cerevisiae SMP1 (YBR182C)
                     and RLM1 (YPL089C); ancestral locus Anc_8.566"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670330.1"
                     /db_xref="GeneID:11498665"
                     /db_xref="GOA:G0WBG7"
                     /db_xref="InterPro:IPR002100"
                     /db_xref="UniProtKB/TrEMBL:G0WBG7"
                     /translation="MGRRKIEIQPIHDERNRTVTFIKRKAGLFKKAHELAVLCQVDVA
                     VIILGSNNTFYEFSSVDTNDLIKYYQHDKDLNHDVKDPSSYGAYTKKKKVTLNPKYHG
                     RSKKARVGKHDQKKDEEIELGADFEGNDGEDEDEEGQEFSRDDIEDSNTTSSNNMIPQ
                     SSTSVVSDDDRTANTLRNITIHSTSNKRSRSENNIGPTFIYERTKKPDLNNNKRLKKE
                     SSVLNPLQQHVQKQFQNLYHMTSNSPTELPKLSKYQETAPMVPSPTASSSSPNNSTNN
                     HNVSLKPSFAKTENDSKGSPLNRLNMQFSPPIGNSGKEPFSSLDKDKNSLRIGSRPVL
                     RVQIPTNNNTYNTSVYSEPSSATSITRSMNNNGSPSRIDTNFQNDSLNRNDGSKISKT
                     PTNTSYSFTAGLPPIFSATSALPQYVATPLQSAAAANSVHPNGNTTNIQNNSHGNDFI
                     QNSSSYFLQRQSQNSQQQQQHQQRQQSQPQQHQQQPQQPQNIPKRLQLKSGQTGLYDR
                     LFSPILAEDPSGPRTGSLPSKFVHDLIIPSPSANMPMFQDWSLGPESAKLGANNSSLR
                     GSFNNSRIGPNNNKENITNNNSNNNNVNNTTTNNSTNINASTQYSFSGSTGLTPYITS
                     QTPLSNRFFNFSTEVDDDKKKMNKTDTVADLNIDGKKN"
     gene            <564611..>565603
                     /gene="NDAI0E02710"
                     /locus_tag="NDAI_0E02710"
                     /db_xref="GeneID:11498666"
     mRNA            <564611..>565603
                     /gene="NDAI0E02710"
                     /locus_tag="NDAI_0E02710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670283.1"
                     /db_xref="GeneID:11498666"
     CDS             564611..565603
                     /gene="NDAI0E02710"
                     /locus_tag="NDAI_0E02710"
                     /inference="similar to DNA sequence:INSDC:YBR183W,YPL087W"
                     /note="similar to Saccharomyces cerevisiae YPC1 (YBR183W)
                     and YDC1 (YPL087W); ancestral locus Anc_8.564"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670331.1"
                     /db_xref="GeneID:11498666"
                     /db_xref="GOA:G0WBG8"
                     /db_xref="InterPro:IPR008901"
                     /db_xref="UniProtKB/TrEMBL:G0WBG8"
                     /translation="MDYLRWPYPEESQSGFWGETTAIIDWCEENYVVSNYIAEWSNTL
                     TNLGFVMAASYSIYCAYRNKLEKRFILIGLGFALVGVGSWLFHMTLKFHFQLLDELPM
                     VYATSIPSWSLFSEIYHLKKNENNTSDGNSVAVNVNNSENKKIPLKEQLIFGGLITAF
                     VSFLTWVYLVKQDPIIFQVLYGFLNVLVVSTSGYIAYKNMQTPTTKRNLFATMGLGIS
                     LFLAGFIFWQLDVHFCSFWIGIRRKYLLLPLGVLLELHGWWHLLTGAGVYAYVVFLQY
                     LRVLSLGELNDFDFIWRWKFCPELVRKDASIGTKYSYQFLGPYVDKPFDSLPTH"
     gene            <566219..>572509
                     /gene="NDAI0E02720"
                     /locus_tag="NDAI_0E02720"
                     /db_xref="GeneID:11498667"
     mRNA            <566219..>572509
                     /gene="NDAI0E02720"
                     /locus_tag="NDAI_0E02720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670284.1"
                     /db_xref="GeneID:11498667"
     CDS             566219..572509
                     /gene="NDAI0E02720"
                     /locus_tag="NDAI_0E02720"
                     /inference="similar to DNA sequence:INSDC:YPL085W"
                     /note="similar to Saccharomyces cerevisiae SEC16
                     (YPL085W); ancestral locus Anc_8.562"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670332.1"
                     /db_xref="GeneID:11498667"
                     /db_xref="GOA:G0WBG9"
                     /db_xref="InterPro:IPR024340"
                     /db_xref="InterPro:IPR024880"
                     /db_xref="UniProtKB/TrEMBL:G0WBG9"
                     /translation="MTPEAKKRKQQKKKLRQKQKKAAERVAPLGDHQQDLSPEPENND
                     LINDSSSNEETGLDESALNINDNSPSNELSVTDNTAATTVGEEMLKQIPVETQDPTYE
                     PVISTDHSTNKGYAANAMGFESLENPDLQYEDDRAVDENANQPTSETKMEATHDTRQF
                     SKNEPAQTPSYNDDMDINILQPPSELDTKTPEEIIDTDTQKELSNVESVDFEQKLDQS
                     IGEQQQPLIQDKILTVSPTVSPIEASTTGNHLEQPEEITTLGKASDFDLFPSQEPTEP
                     LPWESQHSEQAQQAVVNPTSHESIIQQEHLTGAQPPPTDHQQQQGSLNGPLPGFSPDV
                     PKWTHSEVPDAQLNPVRDNLEPGTASNDAKKDSNNGAEQFATSEQLSFVEQIQADDHP
                     SDENDVSNSLDKEGMFWENSDNSTEKLQEDTIDEPSEPTIILNNEREMGHMQEETELQ
                     EKPKVIPKKFSFLEEDDDLLDDDADSFLGSDEELLPNKDSIANVTEKPVQNNYEMGNA
                     ITPQKSKYQPTLSQPSLQTHRIPSPQNQNAFITAGSSSVSINAGLIPPQSFNNFITND
                     RSLSQQSQAQAVLPTSNFPRSVEQTKILKLKEEKKKSDAYDFPLEIISDDTKRGHAKP
                     VNVPSRFGPNTFKTAPSITPHSRVSSMSGPSKPGFDPSKGIPLAQPLRSSIASPPVKN
                     PYAVPDVIPTQGMVMPVGITSPTIPFQQPGPNVFTSIPSRQYLGNNVSQTASTSIASD
                     IHGRQHSNNYMPQLQSTPGLHGSKPPTRNKYAPPSTHVAPSATTPIGNAVQPGLQINI
                     PTQMGAAVRATSYDNTQQVISPMLAMAPALPMNSNNGSLPGSTFVPQGQRLSVVGSTP
                     TAANAIPLLTPGQPSVVPKGRTHARSNSSVYAPAQNMQASRYAPTVHPQFQQDIPINQ
                     HAQFPPTSFPLQTQTSQLSQAPPSSFPPQSQISQLPQVPTATYPSQTQHYQQVPQSMN
                     RERDAEVVDHQPIDNQALLSRQFPIFHWTNSNKVLYGIPKNTGSNYGSGNSLECINIV
                     NYESSIQPNLVLKSFVGPLINGKTRVKDLEAWLDNVIDDLSSKDPSKDLTVWRLLRLQ
                     LSAKTTLKDISSVLYDSTQLLAYLSQPLPNIELTPNAFKIDQASQMKVLSCLQTGNHN
                     AALQLSLEKKDYAMALLLGSLAGKNKWSEVVQQYLSQEFTATAPEQNEWANLLSLIFQ
                     AFIGNSKMAMDKFYRNSADGHWAINNWKQIVAAVLMNVNAENDSTPSNTAKMPLVVTE
                     FLLEFGIFLKQKSQDLAASIVFMIARIPLSLSPVMPDTMFTFDTIGKSSTIESCLWSE
                     VYEFSFSSAPKFAGFPCILPQKMFHAYCLQEQGFISNASKYCDYLTNILKTQPKTDIT
                     VMNLTLSLTDLTTRVSDSNTGWLTKPKLGSVWGQLDKSFNRFIGGDDIEMDAKVKKKV
                     FDGFTPSSSNNSSVVDLSLKGAAPQLQSHITMRSDSTKENHAFLPNPHVSAHISSSNH
                     PNPNTVHNNRQVYGFQNQSDLSLLPPKVGNSLQGSPQRLPVLQPSEQPAETSMHDLRR
                     VQTEELTLESLSSNVGVGHPVIKTKSTEPMQSSNKKIDLPDRSSMTPLATDHQTVLPS
                     DNETPIVPRKPAFVAPLNAPVLPVERTDFVIATTSDANVVEGSEPELIPKRESAVSSS
                     ENVNDKHSEELPSTTMMDQFIPKEVETHEEPTPDASLITESEANVKPPSTEAVSEQCN
                     TTVEDNQEQFNKPTITPINTDAQRNVATKPIVPPPSFVAAESPKRLASNNGYAAVKPI
                     QNRYAPSPSLSPSQGHSGDVNKYTPSAPYTNPIQNVEMNEHLSNPDVIPAVPFVSRPS
                     MFAPVQKPEVITDSTFEPVVKIPPPNTSFNPIATKVDETQYNDIVEDESDDEDDTEHA
                     PKSEQDDIKQEKEKEKAKNKNRSSEGGTWLRWLKKDSDGKKPIKATLGTTNQLRYDEQ
                     LGRWISKNATEEEKAKIAADANALPPPPPIVKRKDTVPKTSPRPSFSAGHTVGSIMPT
                     NSLTGEQLLSPTLSQGSSMTPSLPPSRNHTLPPPHTNLSGKKANDLDDLMSLSRVRRT
                     TGRKPGKGYVNVLESLNSTQKK"
     gene            <573056..>574771
                     /gene="NDAI0E02730"
                     /locus_tag="NDAI_0E02730"
                     /db_xref="GeneID:11498668"
     mRNA            join(<573056..574554,574636..>574771)
                     /gene="NDAI0E02730"
                     /locus_tag="NDAI_0E02730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670285.1"
                     /db_xref="GeneID:11498668"
     CDS             join(573056..574554,574636..574771)
                     /gene="NDAI0E02730"
                     /locus_tag="NDAI_0E02730"
                     /inference="similar to DNA sequence:INSDC:YBR186W"
                     /note="similar to Saccharomyces cerevisiae PCH2 (YBR186W);
                     ancestral locus Anc_8.558"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670333.1"
                     /db_xref="GeneID:11498668"
                     /db_xref="GOA:G0WBH0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WBH0"
                     /translation="MHFIIDVELRYCTIKIVQDNILKEQDTAKNVQAKEGSKMQVFSD
                     ILKMAIERSLNKFKEETAENCAIKLNDLLADGQQGMEVKALSTEPQRRIIESLFKVLF
                     HQYSNSPKEFNIEDGHVNLLLPLFVQKITVECVSEDLVQQIASDDKKPLHDEILDILT
                     KKEPNNKTYNKNQNRTYGIHLFYYSPLEMEKRSAFGLSEDFDKIDLDDDEDTLRSIDQ
                     EISAINIPFSNTTFGKTRISFLPSVNFDSLWESLYFKDDIKQRMFNYSTISLKVAKLS
                     NQEAQHGYEDEQLMTNKLLLIHGPPGTGKTTLCRALCQKLAIRNGSDLDNMDLVYKCI
                     LVEISSSSIFSRWFGESAKNITTLFDDIEKLVREAEKKDIFVCVLIDEVEAIASSRTD
                     ILSKSESTDGVRVVNALLTHLDKLKYYNNFLLLATSNLLDNIDSAFLDRADGIFHIGN
                     PVEEAITKILWTSIGELISAGIIIGYKSYRYILNSEIYKDIICTIAKNANGRTLRKIP
                     LLCLSEHFRDLPIHLDAFLVGLAHTVVALDKNESDK"
     gene            complement(<574925..>580507)
                     /gene="NDAI0E02740"
                     /locus_tag="NDAI_0E02740"
                     /db_xref="GeneID:11498669"
     mRNA            complement(<574925..>580507)
                     /gene="NDAI0E02740"
                     /locus_tag="NDAI_0E02740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670286.1"
                     /db_xref="GeneID:11498669"
     CDS             complement(574925..580507)
                     /gene="NDAI0E02740"
                     /locus_tag="NDAI_0E02740"
                     /inference="similar to DNA sequence:INSDC:YPL082C"
                     /note="similar to Saccharomyces cerevisiae MOT1 (YPL082C);
                     ancestral locus Anc_8.555"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670334.1"
                     /db_xref="GeneID:11498669"
                     /db_xref="GOA:G0WBH1"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR022707"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WBH1"
                     /translation="MTSKVSRLDRQVILLETGSTQVVRNVAADQMGDLAKQHPEDILN
                     LLSRVYPFLLSKKWETRVTAARAVGGIVSHAPLWDPNEDDDVLQNINTDKNSNDVPNA
                     KVKIEQDIQLKLEELSGSNAMDFLQDDKELYSLSHWDLHALFKSGKVLLASNMNDFMT
                     NSPNEENQKKQVKLESDNQVKPEQTRAPSTGSKKSARMLAMAKRKKKMNAKNLTSNPV
                     DITESSISKTLMSQNSTNGKSPSPTTLTNPKLDITEQSDPNKIMIESVMTPILEKQER
                     VAGLIWQFQGIYELLLENITSDVWEIRHGAALGLRELMKKHTSSVSRVKGKSKTENES
                     RNKKSLEDLATRLLTVFALDRFGDYVYDTVVAPVRESAAQTLAALLLHLDDDLSSKIF
                     SALRQLVLQDPKVVGLPNKIWEATHGGLLGIRYFVSIRTEFLLSNDLLNDVVDIVLYG
                     LKQTDDDVQSVAAAILTPITDSFVKMEPRKIDTVVTTIWASLTHLDDDLSSSVGSVMD
                     LLANLCKHQEVLDILKSKAIEHPSEWSFKSLVPKLYPFLRHSISSVRKAVLNLLSAFL
                     SIKDDSTKNWLNGKIFRLLFQNILLEQHPDILQLSFNVYTELLSHYKSKHTEKTLDHV
                     FSKHLQPILHLLNTPIGENGKNYSMEAQYILKPSQHYQLHPEKKRSITEATQESSIPP
                     PKYAERINIDAPMIAGDITLLGPEVIINTRVLAAKAFGITLAMFQDSTLQSFFEKVLV
                     RCLELAFATPRLFAAIILTQFCKSWLEYHTEQTQLPPFVSTIFGDILNDQLSFPEKLP
                     TFRELVPCLRALRTQCQSLLTTFVDVGMLSQHKLPGIAIVVQGETEAGPQAFGIATAE
                     KVHNEYYEKMFKAMGNSYKLLAKKPLEDARYRVALGLEATKESMKGRTCSIMSSYAAA
                     LLLIKGIPKKLNPIIRALMESVKEEKNKKLQMMAGDAIIHLIDELLKNNKSAVANKIV
                     KNLCGFLCVDTSEVPDFHSNIQYSDRILTLIKEDDSLKIQDDIALKKLAESAQLKRDG
                     GVYTLSKLLQIFGKFTLEQIPQLKDVLFAPLEKLDEIENISPPDEIIGQHIVDSLGVM
                     RAIFLYMDPYLQKTEIFSRFPVFLNSLRSKLSVVRYSTARTFADFAKISPIDVMPFII
                     REVLPLMNSSGSMADRQGATELIYHLSLSMGTDVLPYLIFLIVPLLGRMSDSNEDIRT
                     IATTTFASIIKLVPLEAGIADPEGLPEDLMAGREKERDFIHQMMDPSKAKPFKLPVAI
                     KATLRKYQQDGINWLAFLNKYGLHGILCDDMGLGKTLQTICIIASDQYLRQEDYEKTH
                     SVETRKLPSLIVCPPSLTGHWENEFEQYSPFLKTIVYAGGPSARIPLRSHLDSADIVI
                     TSYDVARNDLQILGKYDYNYCVLDEGHIIKNAQSKLAKAVKQLRANHRLILTGTPIQN
                     NVVELWSLFDFLMPGFLGTEKMFQERFAKPIAASRNSKTSSKEQEAGVLALEALHKQV
                     LPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQKQLYQDFAKKQKNVVVKDVENTAEVE
                     SKQHIFQALQYMRKLCNHPALVLSPNHPQLAQVKSYLKQTGLDLHDLINAPKLNALRN
                     LLFECGIGEEDMERKSVPNQYLTGQNVISQHRALIFCQLKDMLDMVENDLFKKYMPSV
                     TYMRLDGSIDPRDRQKVVRKFNEDPSIDCLLLTTKVGGLGLNLTGADTVIFIEHDWNP
                     MNDLQAMDRAHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVVNQQNSGLDS
                     MDTHQLLDLFDTDNVPSQDNEDKTTQGANKPGMEDIANETGLTGKAKEALGDLKELWD
                     PSQYEEEYNLDNFIKTLR"
     gene            <581673..>582817
                     /gene="NDAI0E02750"
                     /locus_tag="NDAI_0E02750"
                     /db_xref="GeneID:11498670"
     mRNA            join(<581673..581679,582243..>582817)
                     /gene="NDAI0E02750"
                     /locus_tag="NDAI_0E02750"
                     /product="ribosomal protein S9"
                     /transcript_id="XM_003670287.1"
                     /db_xref="GeneID:11498670"
     CDS             join(581673..581679,582243..582817)
                     /gene="NDAI0E02750"
                     /locus_tag="NDAI_0E02750"
                     /inference="similar to DNA sequence:INSDC:YBR189W,YPL081W"
                     /note="similar to Saccharomyces cerevisiae RPS9B (YBR189W)
                     and RPS9A (YPL081W); ancestral locus Anc_8.554"
                     /codon_start=1
                     /product="ribosomal protein S9"
                     /protein_id="XP_003670335.1"
                     /db_xref="GeneID:11498670"
                     /db_xref="GOA:G0WBH2"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005710"
                     /db_xref="InterPro:IPR018079"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="UniProtKB/TrEMBL:G0WBH2"
                     /translation="MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKREIYR
                     ISFQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRVGVLSEDKKKLDYVLALKIE
                     DFLERRLQTQVYKLGLAKSVHHARVLISQRHIAVGKQIVTIPSFMVRLDSEKHIDFAS
                     TSPFGGARPGRVARKNSVKKSEGTDDAEAADEE"
     gene            <583392..>584325
                     /gene="NDAI0E02760"
                     /locus_tag="NDAI_0E02760"
                     /db_xref="GeneID:11498671"
     mRNA            join(<583392..583402,583854..>584325)
                     /gene="NDAI0E02760"
                     /locus_tag="NDAI_0E02760"
                     /product="ribosomal protein L21"
                     /transcript_id="XM_003670288.1"
                     /db_xref="GeneID:11498671"
     CDS             join(583392..583402,583854..584325)
                     /gene="NDAI0E02760"
                     /locus_tag="NDAI_0E02760"
                     /inference="similar to DNA sequence:INSDC:YBR191W,YPL079W"
                     /note="similar to Saccharomyces cerevisiae RPL21A
                     (YBR191W) and RPL21B (YPL079W); ancestral locus Anc_8.553"
                     /codon_start=1
                     /product="ribosomal protein L21"
                     /protein_id="XP_003670336.1"
                     /db_xref="GeneID:11498671"
                     /db_xref="GOA:G0WBH3"
                     /db_xref="InterPro:IPR001147"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR018259"
                     /db_xref="UniProtKB/TrEMBL:G0WBH3"
                     /translation="MGKSHGYRSRTRYMFQRDFRKHGAIALSTYLKVYKVGDIVDIKA
                     NGSIQKGMPHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRIEHIKHSKCR
                     QEFLDRVKSNAAKRVEAKAKGEAVQLKRQPAQPREARVVSTEGNVPQTLAPVPYETFI
                     "
     gene            complement(<584748..>585476)
                     /gene="NDAI0E02770"
                     /locus_tag="NDAI_0E02770"
                     /db_xref="GeneID:11498672"
     mRNA            complement(<584748..>585476)
                     /gene="NDAI0E02770"
                     /locus_tag="NDAI_0E02770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670289.1"
                     /db_xref="GeneID:11498672"
     CDS             complement(584748..585476)
                     /gene="NDAI0E02770"
                     /locus_tag="NDAI_0E02770"
                     /inference="similar to DNA sequence:INSDC:YPL078C"
                     /note="similar to Saccharomyces cerevisiae ATP4 (YPL078C);
                     ancestral locus Anc_8.549"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670337.1"
                     /db_xref="GeneID:11498672"
                     /db_xref="GOA:G0WBH4"
                     /db_xref="InterPro:IPR008688"
                     /db_xref="InterPro:IPR013837"
                     /db_xref="UniProtKB/TrEMBL:G0WBH4"
                     /translation="MNCSSLALKASARPLFTHGIRRLPIYSSIRYNSSSSTPTPQKDP
                     KTQAQSLINALPGSNVLSKTGILATSVAATVYAISNELYVINDESILLATFLTFTALS
                     AKFLAPMYNEFAEARLKKVSDILNASRGRHVDAIKERINMVSELQNVTETTKVLFDVS
                     KETIELEAKNFELKQKVDLANQAKSVLDSWVRHETALRQLQQKQLTSSLLSKVESQLN
                     DPKFQDKVLQQSISDVERLFTNLK"
     gene            complement(<585902..>586678)
                     /gene="NDAI0E02780"
                     /locus_tag="NDAI_0E02780"
                     /db_xref="GeneID:11498673"
     mRNA            complement(<585902..>586678)
                     /gene="NDAI0E02780"
                     /locus_tag="NDAI_0E02780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670290.1"
                     /db_xref="GeneID:11498673"
     CDS             complement(585902..586678)
                     /gene="NDAI0E02780"
                     /locus_tag="NDAI_0E02780"
                     /inference="similar to DNA sequence:INSDC:YBR197C,YPL077C"
                     /note="similar to Saccharomyces cerevisiae YBR197C and
                     YPL077C; ancestral locus Anc_8.546"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670338.1"
                     /db_xref="GeneID:11498673"
                     /db_xref="UniProtKB/TrEMBL:G0WBH5"
                     /translation="MDDLTRITSVRRQKTQEDPDEDYEENHSIREIPRTIPNIDVYMQ
                     SKLNASKQGRTVSTVQNPFFKTRSNAFSEPSDDVSKFDTYYSDVDNLHDTVNENGPNN
                     IFKDYVKKNSGYAQITNIDKPIRLESKPKVDNQDKLWEELDALNDVRKTAQQNDLYGG
                     FSDEFRDSIQKIRQAHSKLIQFLREKNAKLEEKQRREVAAAGVMGTVGSTSDSGSSNL
                     RPSPTKAAAEDGLSAIGATVDPEEGKYTEQLVSTIRALHP"
     gene            <587128..>588027
                     /gene="NDAI0E02790"
                     /locus_tag="NDAI_0E02790"
                     /db_xref="GeneID:11498674"
     mRNA            <587128..>588027
                     /gene="NDAI0E02790"
                     /locus_tag="NDAI_0E02790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670291.1"
                     /db_xref="GeneID:11498674"
     CDS             587128..588027
                     /gene="NDAI0E02790"
                     /locus_tag="NDAI_0E02790"
                     /inference="similar to DNA sequence:INSDC:YPL076W"
                     /note="similar to Saccharomyces cerevisiae GPI2 (YPL076W);
                     ancestral locus Anc_8.545"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670339.1"
                     /db_xref="GeneID:11498674"
                     /db_xref="GOA:G0WBH6"
                     /db_xref="InterPro:IPR009450"
                     /db_xref="UniProtKB/TrEMBL:G0WBH6"
                     /translation="MPEEESQLKKPWTRLLWLKQDYPDNYTDPTFLKFMENLRERKSK
                     PKDYILKKDDYEKIRLNFLGFYHILLNTCFIFICFTYIYEYKANPVPLTGCVSFLLLC
                     LSISNRFQTNELSALLNFKSSIILIFIMLTVSPILKSLSKTTASDSIWTLSFWLTIFY
                     TFAIASTSLQNREKKTNEIRRPSNLSTNILLANVSVLASRLSSTTDVFCFLTLCIELN
                     IILPSILKSGWNFTSLTISNLIVYVFLNISLGLSYTLLILAFSLFYLVVLPRWFFYWR
                     VHYHRDDVEILTIWDPKTPIVDL"
     gap             590217..590250
                     /estimated_length=34
     gene            <590985..>595265
                     /gene="NDAI0E02800"
                     /locus_tag="NDAI_0E02800"
                     /db_xref="GeneID:11498675"
     mRNA            <590985..>595265
                     /gene="NDAI0E02800"
                     /locus_tag="NDAI_0E02800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670292.1"
                     /db_xref="GeneID:11498675"
     CDS             590985..595265
                     /gene="NDAI0E02800"
                     /locus_tag="NDAI_0E02800"
                     /inference="similar to DNA sequence:INSDC:YPL075W"
                     /note="similar to Saccharomyces cerevisiae GCR1 (YPL075W);
                     ancestral locus Anc_8.543"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670340.1"
                     /db_xref="GeneID:11498675"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:G0WBH7"
                     /translation="MNLINQLTSTQSPSRINQLNGFQRPRATTSPFNVLQSPYNLNTN
                     RLKHLLSQQEQQSSITSSNTTSNFYAITQFILQLYFKVDINSLASLRLIDLIVDQTYS
                     DSLTLRKLNDGDAYQYFNTISRDPDISKCPIFALAIYFIIRWSHPNPPITIFNYFNIP
                     LLDPNFILLDSNPLLYMQNEDVLNGINNSNIRIPRAELFEPSRDLIDIVFPWLPSLRQ
                     DMLQIDRTNYKLHSLCELFEFMGKVVIQDLRYLNQHSLLLPNILSFIAKFIPELFQMD
                     QFKNIEAYNTTNNNMVNGNINIEPWLSSNTTYDPSIRNNTSRSQFTNVYNNTISYNAD
                     PALTAISSSIDNNFNNSNTTYQIPEEIESRFLELSKKLTVENIRLSQQVTQLKTDLSS
                     VTTMCNEILKLQKAMATNPNTIRTDAVTDSVTGVTPITVPDSSAMEKPTPKIPQGAPI
                     KPTFKSPPIISPAANLSDKIQKRELPPISPNDHLDQMSPYSPQSPGIIGSPYSRKRYR
                     LDDKPTPSQTALDSLLSTSIQSPHIQVDPLIAAKTANATTTKITKSKTKKPKNAPTLN
                     QIRKNQFNSPVTFAMADSTSTSSSNSSITNRDSASVPTQSKKDKEAVLVVDSPQPKVT
                     NTIKKTPLVPMRKVLERPLLVRNDSTTSMPMSPSEQPAAKVIDARAPASAIEPFSPKT
                     LVKELDKRNMTKKADYNGKSTNEDIRVGEDENTIKGILDKDVSETAENKKTEKNNELR
                     ENINKIEKDSKDKDDHEHKEDNKDKDEDKDRDEDKDKKTKTNIDNGSDKIKSTPSEVK
                     EDTPVLSIPLQPVTKSVSSIPLIKRSSALPHLTNINRALQNFPNMASLGTFINNLSAS
                     NLTPSDISSLSHKASTPQIGKRQSTTPASRTGQGPNDNIKYKLSRENKTIWDLYTEWY
                     IGLNGKPSIKKLIEKYGWRRWKVTEDSHFFPTRRIIMDYIETECDRGIKLGRFTKPDQ
                     PREEIRKIIVSDLEKFRINNGLTLNSLSLYFRNLTKHNEEICVFENFKSWSVGSMTEE
                     EKVKYCKRQHLSNAALAAQEAARQAKLARKKEKQGTARSSKSTTANIQDSLSKLNEPN
                     EIDKNVNLVLESPKRTVEHQDDTSTQTNLKRINQLQSNSGIVNDLKRHQDAEIRSNTT
                     LNTLPPKTDLPTQATQRFIQASQINDIQESVAKLNANLSKPVSTTKSSIQTTAQLQNE
                     GRSSVTKGTDKHSNTNDKVSPKALQKEVANCDNDIRLDKLPATQATECKLPELPKSPE
                     DLNNVTHPTTTTIKTTADNSVRTNTNNDLMNTNSLSKPISEGTIVETKAIPNKSPTEI
                     ILNFKKEIVAEHGYSPSTKPIPGIITDSANVINSDTEESAVESQKLDSPVSTGKPNDA
                     TTELIAVTTTNSDSKSATPRSTMEKLALQTDSEPKHTSGTPGHTSSIV"
     gene            <595594..>597864
                     /gene="NDAI0E02810"
                     /locus_tag="NDAI_0E02810"
                     /db_xref="GeneID:11498676"
     mRNA            <595594..>597864
                     /gene="NDAI0E02810"
                     /locus_tag="NDAI_0E02810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670293.1"
                     /db_xref="GeneID:11498676"
     CDS             595594..597864
                     /gene="NDAI0E02810"
                     /locus_tag="NDAI_0E02810"
                     /inference="similar to DNA sequence:INSDC:YPL074W"
                     /note="similar to Saccharomyces cerevisiae YTA6 (YPL074W);
                     ancestral locus Anc_8.542"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670341.1"
                     /db_xref="GeneID:11498676"
                     /db_xref="GOA:G0WBH8"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WBH8"
                     /translation="MPHDKFEIPGNLTLIQAIELLYNIIKSQYGNLKHPTNPRADPPL
                     AERYKSLNHLLNYLHDAIKKIERHYGLGKHYFWNVPEYYPEYKVQMDDLKILRQDIIT
                     EENEVQEEIISNNADKKTPTTLEYGNNILKLSQLWRNNSKKEKKKAMETKMIEEEVAQ
                     IKEARRLEEERKIRENKLQQERIEIQNKKMLELKIKDQVETEVNAKLEQEERRRKKME
                     CELERRRKQQLAKQKEKQVIVEGSEAYRSSRSKSPSPPIRTKTLGRRSVDVKRRSHEL
                     TMSNSESLRRRSFDIKTNPNISGKKDPILSQERNNDIGIAAIVAWQKHAQLEVPKKTL
                     PSISLQNNNRKQSTKAVSPGTHNRPRHSKPSMAKMHGTNTQTKNLGSKDARINNADIE
                     RSGIKTTVNRRPSSRKQVHERKLPAVLKDEVDKTQEIPDKARETSLLDQRIKYIMTTL
                     QGVDERACEQIINDILIMDEKIHWDDIAGLNNTKNILKETVVYPFLRPDLFKGLREPV
                     RGMLLFGPPGTGKTMIAKAVATESHSTFFSISASSLLSKYLGESEKLVRALFYMAKRL
                     SPSIIFLDEIDSLLTTRSDNENESSRRIKTELLIQWSSLSKAIPHSDPNGKSNNVLLL
                     AATNLPWAIDEAARRRFSKRLYIPLPDSETRLYHLKKLMSSQKNILTVSDFKIISIAT
                     EGFSGSDITALAKEAAMEPIRDLGDELMNTNFDTIRGVSKQDFDTALSTIKKSVSKES
                     LSHYEHWALQFGSTGS"
     gene            <598119..>599606
                     /gene="NDAI0E02820"
                     /locus_tag="NDAI_0E02820"
                     /db_xref="GeneID:11498677"
     mRNA            <598119..>599606
                     /gene="NDAI0E02820"
                     /locus_tag="NDAI_0E02820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670294.1"
                     /db_xref="GeneID:11498677"
     CDS             598119..599606
                     /gene="NDAI0E02820"
                     /locus_tag="NDAI_0E02820"
                     /inference="similar to DNA sequence:INSDC:YPL072W"
                     /note="similar to Saccharomyces cerevisiae UBP16
                     (YPL072W); ancestral locus Anc_8.540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670342.1"
                     /db_xref="GeneID:11498677"
                     /db_xref="GOA:G0WBH9"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G0WBH9"
                     /translation="MTKYTYLVPNDRQTQWLNVLLAKNGGALKKITGLTILGVSLYIV
                     SPTLIISLLRTLGLRDKDTKESCRLDRTTMGLINARNDCFINSSLQALVPLSSFTVYL
                     NSILSKLQEDKNLSLPLHKNLAKTVYELQKLIVDSESYSAELIISTMEHIFKGTISRQ
                     QNDAHEFTQLLLETLFKELAVLPKGVIEVPMKGVVGNHLICIRCGHISQIKEEMFSIY
                     ELNVPQCSSSKLTDIIHNNQLEKIEGYSCLYCEINMILKNENYRNSDGFTGDDEEKRK
                     LRYLKEVFLNNLMINQELPDDIMHYIKSYKRGYCDISKMEKSDIFRKRRLLQCPKVLL
                     IHLSRSMYNGMAYTRNPCNVEFENILELEEEQMLQSSPGEKTFINSNSKIRYELKSLV
                     KHTGSHYQGHYQCYRHKPKLRINKENGEIINRSSVIDNNLLKDDEVEVEVKEENTVPS
                     QSFKKIKSVETYPFWKLSDTSIEESTVKKVLNEKKSVYMLYYERI"
     gene            complement(<599656..>600210)
                     /gene="NDAI0E02830"
                     /locus_tag="NDAI_0E02830"
                     /db_xref="GeneID:11498678"
     mRNA            complement(<599656..>600210)
                     /gene="NDAI0E02830"
                     /locus_tag="NDAI_0E02830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670295.1"
                     /db_xref="GeneID:11498678"
     CDS             complement(599656..600210)
                     /gene="NDAI0E02830"
                     /locus_tag="NDAI_0E02830"
                     /inference="similar to DNA sequence:INSDC:YPL071C"
                     /note="similar to Saccharomyces cerevisiae YPL071C;
                     ancestral locus Anc_8.538"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670343.1"
                     /db_xref="GeneID:11498678"
                     /db_xref="UniProtKB/TrEMBL:G0WBI0"
                     /translation="MNNQYGLKRCRSNELYGNLDISHYKKQKLIQDLQNLSLQDNTAS
                     ASITTRTSTSFPHRIKDFKILPNSITFKPINLLTSISSSVDRKKKNFKNRPTRDKHED
                     DKDRDLSLYDSNYYIYSKILNDQNINSSQLIKWIDLSKFLYFIWYNWYYNLPKENITI
                     LIMMILIWTNNPFMKILIWISIRI"
     gene            <601068..>603260
                     /gene="NDAI0E02840"
                     /locus_tag="NDAI_0E02840"
                     /db_xref="GeneID:11498679"
     mRNA            <601068..>603260
                     /gene="NDAI0E02840"
                     /locus_tag="NDAI_0E02840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670296.1"
                     /db_xref="GeneID:11498679"
     CDS             601068..603260
                     /gene="NDAI0E02840"
                     /locus_tag="NDAI_0E02840"
                     /inference="similar to DNA sequence:INSDC:YPL070W"
                     /note="similar to Saccharomyces cerevisiae MUK1 (YPL070W);
                     ancestral locus Anc_8.537"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670344.1"
                     /db_xref="GeneID:11498679"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="InterPro:IPR013995"
                     /db_xref="UniProtKB/TrEMBL:G0WBI1"
                     /translation="MRQLFTPPISNTKFDTTQSIKESYKSSSSLSSLSSSLKHEIHQE
                     DYEIDPGHLKENINRNNTDNNNENENDNFSQSVDTALTQLEIDQEVNSIHELPLDLSN
                     LITIFIDDLKQPKYIKPLSIIQLASIFQSFYMKFDRSAFQYLTSTGPSGFVNNNSTSS
                     FLNAKESLSSGLSGIFSRSRSSSGSGNSIGNNNNGTTRRQRRSSSLFSMGPNIINNNN
                     NNNNNNSNNHRPPQQLLSPEEINKQLKVNKLNNLKLEKFMILCERNIFIKILKVGTAV
                     PSPIKNTTSNSNNTNNLYSANTNINTRINLREFKVVNLFRNSPEFIQYDRALNEKINC
                     LSTLLSTSSSPSATPTEIEENEATATATATAADSDAPISLFAFLDIDSVKMKSNESIS
                     LEIEHLFKKFLLYSISPFDKIEILLKIHNLMTFYNEEMSNDEFLSLLIYYIIKFNTKR
                     IFLNIEFIKFFRYKKKLVENELYVLTNMEAALMFIDGLTINDFSKKLTNTLNSDQLAL
                     LNDSISSKIQLPLSVMNYSNNNNSNDNDTHIRITESAKALLINDNNFNFLDQSTNITS
                     VNQDVLRSNSYGRFKTIFDSSLRNVIGKIKSYTPPVTVPPSDEDDVDSISNNSKINGD
                     ETTNDVDKEKQQVEEDNTSIEKELSLTNSPEKKVRTKTIKISGSNMSLHSNITSSDDM
                     ITNISSSSSLPSSNEIPADWKKFKDLDFEDLKISDLKQIFDIYQKIIQ"
     gene            complement(<603310..>604350)
                     /gene="NDAI0E02850"
                     /locus_tag="NDAI_0E02850"
                     /db_xref="GeneID:11498680"
     mRNA            complement(<603310..>604350)
                     /gene="NDAI0E02850"
                     /locus_tag="NDAI_0E02850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670297.1"
                     /db_xref="GeneID:11498680"
     CDS             complement(603310..604350)
                     /gene="NDAI0E02850"
                     /locus_tag="NDAI_0E02850"
                     /inference="similar to DNA sequence:INSDC:YPL069C"
                     /note="similar to Saccharomyces cerevisiae BTS1 (YPL069C);
                     ancestral locus Anc_8.536"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670345.1"
                     /db_xref="GeneID:11498680"
                     /db_xref="GOA:G0WBI2"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR017446"
                     /db_xref="UniProtKB/TrEMBL:G0WBI2"
                     /translation="MTSNDNINNNSSTMNEINSMICNTPQWSIEDEDTIARPYKHITL
                     HQGKRFRSKLIQTFNKIYEIPNEQLQILMEIIETLHNSSLIIDDIEDNSDLRRGNPSS
                     HVVFGMPMSLNTANYMYFKSMNLIWKMSADQTSILELLQIFNEELMNLHRGQGLDIHW
                     RDSLNELRYDGVPNEQMYFKMVMNKTGGLFRLTIRMMEKISPNFNRKKKTLVPLGNLL
                     GIIYQIRDDYQNLVNNTMIANKGFAEDLSEGKLSFPIIHGLRFESLNNVSGPTLLNIL
                     LKRTDDDELKKVALKFLQDTSKSIEYTRKVIEDLVRLIKNSEFLPSLDDVNGNEDAIN
                     EINFIIDHISNI"
     gene            complement(<604902..>605936)
                     /gene="NDAI0E02860"
                     /locus_tag="NDAI_0E02860"
                     /db_xref="GeneID:11498681"
     mRNA            complement(<604902..>605936)
                     /gene="NDAI0E02860"
                     /locus_tag="NDAI_0E02860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670298.1"
                     /db_xref="GeneID:11498681"
     CDS             complement(604902..605936)
                     /gene="NDAI0E02860"
                     /locus_tag="NDAI_0E02860"
                     /inference="similar to DNA sequence:INSDC:YPL068C"
                     /note="similar to Saccharomyces cerevisiae YPL068C;
                     ancestral locus Anc_8.534"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670346.1"
                     /db_xref="GeneID:11498681"
                     /db_xref="UniProtKB/TrEMBL:G0WBI3"
                     /translation="MQLRKRKRIDYGDTKATRIKKEDLTSSNENNTNNDESSKKKDKL
                     MVAVVDTESCTKTSDSEITNTSIELETNKRIHKARHRARVRPVLNLNLDDEYVKKRSG
                     EETGGWALSVASLLQRPPPHAPSKRNEGAEEEEEEDVTLIDISILQDCLTSLNAQLSK
                     TPSPKQCQIVKLLPDTFTENMKQISIGLTELIGFEGHLGEFLNNEKENKGNKERKDKK
                     TEHDEQPYKINPLLKERLITLAKGLKSVQRKPIAEDELDYEWERDLILKVALIHNIDI
                     SDLSDLRPIPSPMFNEVRSISKRLDKPLQKERNHLLTWPVKQLNKKKKNRTRDDTNGI
                     FDDVPLYNQA"
     gene            complement(<606331..>606981)
                     /gene="NDAI0E02870"
                     /locus_tag="NDAI_0E02870"
                     /db_xref="GeneID:11498682"
     mRNA            complement(<606331..>606981)
                     /gene="NDAI0E02870"
                     /locus_tag="NDAI_0E02870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670299.1"
                     /db_xref="GeneID:11498682"
     CDS             complement(606331..606981)
                     /gene="NDAI0E02870"
                     /locus_tag="NDAI_0E02870"
                     /inference="similar to DNA sequence:INSDC:YPL067C"
                     /note="similar to Saccharomyces cerevisiae YPL067C;
                     ancestral locus Anc_8.533"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670347.1"
                     /db_xref="GeneID:11498682"
                     /db_xref="InterPro:IPR022036"
                     /db_xref="UniProtKB/TrEMBL:G0WBI4"
                     /translation="MTNITNNIAKKVITWKEVKQYINSGELYMLRRSELQNTDYQIHK
                     KKFVNVDMAQFMLDKLGWKSEELQKLNDIVYNTDEKRINGAFKDKSLFKLAVNDFPYY
                     FEPDVIHVLIWSKIKLPIYKTDKKTSDVKIGDPNNNFPEFNKPMKKVIASFLKHTITD
                     KYCITEENYCWFINYVNLQSIQAVSHIHLIIKLPAKYKGNHEAFFQELKGGFEPLP"
     gene            <607669..>608727
                     /gene="NDAI0E02880"
                     /locus_tag="NDAI_0E02880"
                     /db_xref="GeneID:11498683"
     mRNA            <607669..>608727
                     /gene="NDAI0E02880"
                     /locus_tag="NDAI_0E02880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670300.1"
                     /db_xref="GeneID:11498683"
     CDS             607669..608727
                     /gene="NDAI0E02880"
                     /locus_tag="NDAI_0E02880"
                     /inference="similar to DNA sequence:INSDC:YPL060W"
                     /note="similar to Saccharomyces cerevisiae LPE10
                     (YPL060W); ancestral locus Anc_8.522"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670348.1"
                     /db_xref="GeneID:11498683"
                     /db_xref="GOA:G0WBI5"
                     /db_xref="InterPro:IPR026573"
                     /db_xref="UniProtKB/TrEMBL:G0WBI5"
                     /translation="MLYGYGSSAIKCTIFDSFGNMGIPSKEVKREELVSIQGLLPRDL
                     RKIEKSKGNDLVPSLVTRRKSILISLLTVKALIKPDMVILFDSIGNGITLNSRANNSF
                     IRDMQLRLKNQTDSSGLKQDPLPYEFRALEAIFISALSNLTSEMKVLLTVSQGILQDL
                     ENNITRDRLRFLLVQNKKLSIFCKKATLVREMIDDLLEQDDILCSMYLTDNNFGKART
                     EDDHTEIEMLLETYHNHIDEIVQKSENAISNVKTTEEIINIILDSNRNQLMLLGLRFS
                     LSMLSMGIVLYVGSIYGMNLNNFIEESSYGFASTAILSTLCMIWIYARGIKRLHSLQK
                     MSLLDNTKINKSLLAKLK"
     gene            complement(608920..608991)
                     /gene="NDAI0Etrna5C"
                     /locus_tag="NDAI_0Etrna5C"
                     /db_xref="GeneID:11498684"
     tRNA            complement(608920..608991)
                     /gene="NDAI0Etrna5C"
                     /locus_tag="NDAI_0Etrna5C"
                     /product="tRNA-Cys"
                     /note="codon recognized: UGC"
                     /db_xref="GeneID:11498684"
     gene            <610133..>610600
                     /gene="NDAI0E02890"
                     /locus_tag="NDAI_0E02890"
                     /db_xref="GeneID:11499091"
     mRNA            <610133..>610600
                     /gene="NDAI0E02890"
                     /locus_tag="NDAI_0E02890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670301.1"
                     /db_xref="GeneID:11499091"
     CDS             610133..610600
                     /gene="NDAI0E02890"
                     /locus_tag="NDAI_0E02890"
                     /inference="similar to DNA sequence:INSDC:YPL059W"
                     /note="similar to Saccharomyces cerevisiae GRX5 (YPL059W);
                     ancestral locus Anc_8.519"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670349.1"
                     /db_xref="GeneID:11499091"
                     /db_xref="GOA:G0WBI6"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR004480"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:G0WBI6"
                     /translation="MFLSRFSKTKTFIPLKTILYRPQLKLFMSTEMKKALQDAIGSAP
                     VVLFMKGTPEFPKCGFSKATIQLLGQQGVDPAKFAAYNVLEDPELRDAIKEFTEWPTI
                     PQLFVNKEFVGGCDVITSMSRSGELAEVLEEADALVPEEEEESTHDNKKESQE"
     gene            complement(<611498..>613000)
                     /gene="NDAI0E02900"
                     /locus_tag="NDAI_0E02900"
                     /db_xref="GeneID:11498685"
     mRNA            complement(<611498..>613000)
                     /gene="NDAI0E02900"
                     /locus_tag="NDAI_0E02900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670302.1"
                     /db_xref="GeneID:11498685"
     CDS             complement(611498..613000)
                     /gene="NDAI0E02900"
                     /locus_tag="NDAI_0E02900"
                     /inference="similar to DNA sequence:INSDC:YPL061W"
                     /note="similar to Saccharomyces cerevisiae ALD6 (YPL061W);
                     ancestral locus Anc_8.525"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670350.1"
                     /db_xref="GeneID:11498685"
                     /db_xref="GOA:G0WBI7"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:G0WBI7"
                     /translation="MTKFNFEHADPVTITLPNGLTYDQPTGLFINNEFIKSQDYKTTK
                     IENPSTQEIICEVASGTPEDVEYAVQCAENAFFNTEWATQDPKVRARYLNKLADVIES
                     EQELMASIETADNGKTLELSRGDVSIVINCIRDAASYADKINGRTIDTGDGYMNFTMK
                     EPIGVCGQIIPWNFPLMMLAWKIAPALAMGNVVILKPAAVTPLNALYFASLCKRVGIP
                     AGVVNIIPGPGRSLGAAITTHPKIRKAAFTGSTEVGKDIAMRASESNLKKITLELGGK
                     SAHMVFDDAIIEKTLPNLVNGIFKNAGQICSSGSRIYVQEGIYDELLAAFKEYIDNTI
                     KVGDPFNPDNFQGAITNKEQYNTILKYIDIGKDEGAKILTGGETVGDKGYFIRPTVFY
                     DVNEDMRIVKEEVFGPVVTISKFKTIEEGVAMANDSEFGLGAGIETENISTALRVAKM
                     LKAGTVWINTYNDFDSRVPFGGVKQSGYGREMGEEVYECYTEVKAVRIKL"
     gene            complement(<615208..>616533)
                     /gene="NDAI0E02910"
                     /locus_tag="NDAI_0E02910"
                     /db_xref="GeneID:11498686"
     mRNA            complement(<615208..>616533)
                     /gene="NDAI0E02910"
                     /locus_tag="NDAI_0E02910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670303.1"
                     /db_xref="GeneID:11498686"
     CDS             complement(615208..616533)
                     /gene="NDAI0E02910"
                     /locus_tag="NDAI_0E02910"
                     /inference="similar to DNA sequence:INSDC:YPL063W"
                     /note="similar to Saccharomyces cerevisiae TIM50
                     (YPL063W); ancestral locus Anc_8.527"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670351.1"
                     /db_xref="GeneID:11498686"
                     /db_xref="GOA:G0WBI8"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR027111"
                     /db_xref="UniProtKB/TrEMBL:G0WBI8"
                     /translation="MLSSVIKRNAGISRLSMVKSTRVLLINKHENVAKRNFNSYISLL
                     LKEDQGSKEPATNKKANTGQKSILTDDILAKAGLDIDELNAKKQAKSEEEQEGREGHE
                     TDAQQEGAPKRERRKRARKSSTDLKREKYANWFYIFSFGALAGTGLYMTRDWEDSESE
                     DVKKDIANGYTPGLMFQRFRARFNSMFTYFQEPPFPDLLPPPPPAPYQRPLTLVLTLE
                     DLLVHSEWSQKYGWRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDPLHA
                     FISYSLFKEHCVYKDGVHIKDLSKLNRDVNKVLIIDTDPNNYKLQPENAIPMEPWKGE
                     ADDKLLRLIPFLEYLATQQVDDVKPILNSFKDKKQLPEEFNNRVAKLKEKFIKEQKEK
                     RDGNWFLKALGVPTNLGSQTSKFPLDMIREEGEKNYVRFMKLIDEERKK"
     gene            <616809..>617759
                     /gene="NDAI0E02920"
                     /locus_tag="NDAI_0E02920"
                     /db_xref="GeneID:11498687"
     mRNA            <616809..>617759
                     /gene="NDAI0E02920"
                     /locus_tag="NDAI_0E02920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670304.1"
                     /db_xref="GeneID:11498687"
     CDS             616809..617759
                     /gene="NDAI0E02920"
                     /locus_tag="NDAI_0E02920"
                     /inference="similar to DNA sequence:INSDC:YPL064C"
                     /note="similar to Saccharomyces cerevisiae CWC27
                     (YPL064C); ancestral locus Anc_8.528"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670352.1"
                     /db_xref="GeneID:11498687"
                     /db_xref="GOA:G0WBI9"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:G0WBI9"
                     /translation="MSSSEPKTTAKCTIVTTKGVLQVELWAHEIPKTCRKFLQLCLNG
                     SFEKCQLNDIDTGSIGLSSTFYTNLTREHNSRLKVVTDGILCWDTKKGTWIVSTLDWS
                     HTFHSNTNIFGKIAGNSIYTFREIVSGEKNPDDPKKYLYPAEIEHIEVSVPYFKDLDV
                     GRLKRPIKAIEDDDKLRRGKVKQMMKVRLSYDDLDGENSEDEGSDNNIDTAPIKMKLP
                     RWIESANDNKLSKKEENKLISVCTDVETRDDLTHHLPINSDLIKEITEPDEVGSLEEE
                     DTKSKHVNSDDISERERETLKVLALFQDEVKDKKILSRKT"
     gene            complement(<617891..>618640)
                     /gene="NDAI0E02930"
                     /locus_tag="NDAI_0E02930"
                     /db_xref="GeneID:11498688"
     mRNA            complement(<617891..>618640)
                     /gene="NDAI0E02930"
                     /locus_tag="NDAI_0E02930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670305.1"
                     /db_xref="GeneID:11498688"
     CDS             complement(617891..618640)
                     /gene="NDAI0E02930"
                     /locus_tag="NDAI_0E02930"
                     /inference="similar to DNA sequence:INSDC:YPL065W"
                     /note="similar to Saccharomyces cerevisiae VPS28
                     (YPL065W); ancestral locus Anc_8.529"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670353.1"
                     /db_xref="GeneID:11498688"
                     /db_xref="InterPro:IPR007143"
                     /db_xref="InterPro:IPR017898"
                     /db_xref="InterPro:IPR017899"
                     /db_xref="UniProtKB/TrEMBL:G0WBJ0"
                     /translation="MSGIAPINHFGTQNSTRPFPQELYQEVPLFDSTTTNSQQRETIE
                     SLSEIYSIIITLDHVEKAYLRDSITSSQYTNTVNKLLAQYKTYLSNEDVSKAFQSLND
                     FKTRFNIVASNAITRLERGIPVTVEHAIEEDVEEDESSETQGGQNTNRKKGKFTGKNV
                     AEATGNFITVMDALKLNYRAKDQLHPLLAELLLSINRVTNVDFEHRKKLIEWIVKINK
                     MDVNQDLSDNQARELLFDLDLAYKSFYALLE"
     gene            complement(<618966..>620432)
                     /gene="NDAI0E02940"
                     /locus_tag="NDAI_0E02940"
                     /db_xref="GeneID:11498689"
     mRNA            complement(<618966..>620432)
                     /gene="NDAI0E02940"
                     /locus_tag="NDAI_0E02940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670306.1"
                     /db_xref="GeneID:11498689"
     CDS             complement(618966..620432)
                     /gene="NDAI0E02940"
                     /locus_tag="NDAI_0E02940"
                     /inference="similar to DNA sequence:INSDC:YPL066W"
                     /note="similar to Saccharomyces cerevisiae YPL066W;
                     ancestral locus Anc_8.530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670354.1"
                     /db_xref="GeneID:11498689"
                     /db_xref="UniProtKB/TrEMBL:G0WBJ1"
                     /translation="MFHHSHSTSRYVHTRPIISLKPSYNSVIRGCPGISDTLPRIECQ
                     LQIRSNNGKLFRIEKIEVTLKTIESLITTTSNNVRSLTKSKLKSKNEKHNTHYKKNIL
                     ISEKDLIGIDIPLTIGLPDDIKETNYNKEFGKCITVLECNVSYIGNDNASGSTSAKIE
                     SFSQIINVERYVYIPSKRLFPPITKKVSSPDKRLLISYSIENPCLSIDDLLKLEIEIK
                     PDLFQESTHNSPHIPNDNDRIFNKRKTKIKSVTFRLKEFLEVHNPEFPSDETKENILK
                     EVSTPVNQVVTNNGITFKTNVRVCSKDSLFKNFESTMQEPAFLFKLPPEHSIPFIKQG
                     TLQNQTTRQINTKLLQNKTNDVPIQYHNSITTMGTLFSIFHSLEMKFKLGNGKSFQLH
                     QRLDIARWPVSQVKYIEQIIQKEKQTANYAKQFYNNFGSIKRNKHSGNLEYPPLPPVV
                     YYPDAETFDKFGIIYDSTSDNEYVTSKARLPRRIAVIE"
     gene            complement(<620841..>625379)
                     /gene="NDAI0E02950"
                     /locus_tag="NDAI_0E02950"
                     /db_xref="GeneID:11498690"
     mRNA            complement(<620841..>625379)
                     /gene="NDAI0E02950"
                     /locus_tag="NDAI_0E02950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670307.1"
                     /db_xref="GeneID:11498690"
     CDS             complement(620841..625379)
                     /gene="NDAI0E02950"
                     /locus_tag="NDAI_0E02950"
                     /inference="similar to DNA sequence:INSDC:YPL058C"
                     /note="similar to Saccharomyces cerevisiae PDR12
                     (YPL058C); ancestral locus Anc_8.517"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670355.1"
                     /db_xref="GeneID:11498690"
                     /db_xref="GOA:G0WBJ2"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029481"
                     /db_xref="UniProtKB/TrEMBL:G0WBJ2"
                     /translation="MSSSGEEKERYSKSHDDSHSDAGSYADSAVSYEVPREIDENQDV
                     NTQLSRHLSNILSNEEGIERLQSMARVISTKTKKEMDKFEVNELDFDLRSLLNYLRSR
                     QLEQGIEPGDSGVAFRNLTSIGVDASAAYGPSVEEMLRDIGNLPAHLLNVFKKKGDVP
                     LRKIIQNCTGVVESGEMLFVVGRPGAGCSTLLKTISGETGDMVEVQGDFSYDGLDQQE
                     MMSKYKGYVVYCPELDFHFPKITVKETIDFALKCKTPRTRIDNMTRKEYVDSLRDLWC
                     TVFGLRHTYATNVGNDFVRGVSGGERKRVSLVEAQAMGASIYSWDNATRGLDASTALE
                     FAQAIRTATNMMNNSAIVAIYQAGENIYELFDKTTVLYNGRQIYFGPADQAVGYFERM
                     GWVKPNRMTSAEFLTSVTVDFENRTLDIKPGFEDKVPKSGSEFETYWLNSAEYQQVLQ
                     EYEDYHNRHAPEETRDRLEVAKKQRLQKGQRGSSQFVVNYWTQVYYCMIRGFQRVKGD
                     STYTKVYLSSFLIKGLIVGSMFHNIDNKKQSTTEGAYSRGGLLFYVLLFASVTSLAEI
                     GNSFATRPIVVKHKSYSMYHISAESLQAIITEFPVKFLAILILSFVSYWIPVLKYEAG
                     AFFQYILYLLTVQQCTSFIFKFVATTTTDGVTAHATWGVYGFLILCIYAGFVLPMGQM
                     HHWIKWIHFINPLTYAFESLMSTEFHGREMLCSQLIPSGPGYENVSIANQICNSAGAV
                     KGQLYVNGDAYIDKSYHFGYDHAWRSWGINIVWTFFYIVLNVILSEYSKPLAAGGDLL
                     LYKRGHMPSFGTESADAKTASREEMMAALNGPDVDLEKVIASKDVFTWNHLNYTIPYD
                     GATRQLLSDVFGYVKPGKMTALMGESGAGKTTLLNVLAQRINMGVITGDMLVNAKPLP
                     ASFNRSCGYVAQADNHMAELSVRESLRFAAQLRQPNSTPLEEKMEYVEKIITLLGMQN
                     YAEALVGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMRA
                     LADSGQSILCTIHQPSATLFEQFDRLLLLKKGGKMVYFGDIGPNSATLLNYFERQSGV
                     KCGVSENPAEYILNCIGAGATASASADWHDLWQASPECAAAREEVEELHRVLPSRPTT
                     DDPELAGRFAASFSTQMKCVLHRTYLQFWRSPVYIRAKFLECGSCALFIGLSYLHVKH
                     TVGGATAAFSSIFMVLIIALAMINQLHVFAYDSRELYEVREAASNTFHWSVLLLCHFL
                     VECGWTMVCQFVCWICYYWPAGYNGSAPHAGFFFFFYVLVFPIYFVSYGLWILYFSPD
                     VPSASMINSNLFAAMLLFCGILQPKSKMPGFWWFMYRTSPLTYVVEALVGPLVHGKKV
                     ICDPHELAVMDPPSGQNCGDYLNRYITDNTGYLLNPSATENCEYCPYSVQDEVVARFD
                     VKWHHRWRDFGFMWIYICFNIFAMLACYYIMRVKVWSLKSVLDFKSWFNGPRKERHEA
                     DTNVFKATPADEQKVKKQ"
     gene            complement(<629658..>630806)
                     /gene="NDAI0E02960"
                     /locus_tag="NDAI_0E02960"
                     /db_xref="GeneID:11498691"
     mRNA            complement(<629658..>630806)
                     /gene="NDAI0E02960"
                     /locus_tag="NDAI_0E02960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670308.1"
                     /db_xref="GeneID:11498691"
     CDS             complement(629658..630806)
                     /gene="NDAI0E02960"
                     /locus_tag="NDAI_0E02960"
                     /inference="similar to DNA sequence:INSDC:YBR161W,YPL057C"
                     /note="similar to Saccharomyces cerevisiae CSH1 (YBR161W)
                     and SUR1 (YPL057C); ancestral locus Anc_8.514"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670356.1"
                     /db_xref="GeneID:11498691"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G0WBJ3"
                     /translation="MRKELKFLIYSNILLWVFIVYYTFDLLMICIDDTTKEAFTDDDL
                     NNIPTKISNKPQLIPKIIHQTYKTTDIPKHWKAGQQRCIDLHPDYEYILWTDEMALDF
                     IKENYHWFLPTFKNYKYPIQRADAIRYFILLHYGGVYIDLDDGCERRLDPLLTAPVFL
                     RKTSPIGVSNDVMGSVPRHPFFLRAIKSLEHYNKSWYIPYMTIMSSTGPLFISIVWKQ
                     YKRWTKQSIVDNVIRIIQPDDYKMTSHSFFSISKGSSWHMDDAAFMKSLENHILSCVV
                     AGFIAAFFVLYFQYCFYCFLCASKNSYSVYFFKLINLIKNISRALWTKFNSYTKSSSS
                     LASSSSFNGNYSISNESLQMKRLRKDSNAITLVDLEKNPNTGQLIIYS"
     gene            complement(<632968..>634170)
                     /gene="NDAI0E02970"
                     /locus_tag="NDAI_0E02970"
                     /db_xref="GeneID:11498692"
     mRNA            complement(<632968..>634170)
                     /gene="NDAI0E02970"
                     /locus_tag="NDAI_0E02970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670309.1"
                     /db_xref="GeneID:11498692"
     CDS             complement(632968..634170)
                     /gene="NDAI0E02970"
                     /locus_tag="NDAI_0E02970"
                     /inference="similar to DNA sequence:INSDC:YPL055C"
                     /note="similar to Saccharomyces cerevisiae LGE1 (YPL055C);
                     ancestral locus Anc_8.511"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670357.1"
                     /db_xref="GeneID:11498692"
                     /db_xref="UniProtKB/TrEMBL:G0WBJ4"
                     /translation="MSDNSNDRSTGNGTAASNGTPTNTTNTHHTSRYSSESAPITTTS
                     TSNDSINGPMSRTSNNNGFQSRYPSSHYQISGGRDNNTRGGRGRGDYYRRPDNRYPIN
                     TPPFEHPGFSSSHYNVPNDNKYYSNDMDYYNNNTNMTRGRGRGISGRGLPRGISRGRG
                     GRGRGRSSYYSSVSYHHTQVPYPPPPPPPPPPSSSLIASQYTDSSFTSRQREEKNHET
                     SLTSNNIEHFQETFNTSSSSSSSPSHRAQSSHERDNRSVFPSRFQRNNDINNNNNNTN
                     DAQEQRQYGHPSHSFDQRQPRQQQQQQGGMDLSTITQDNVNKMDENESPFFYLTNLNQ
                     FEDTNKIEEIKETLNENNILNSKLNENHLKMIKIQLDLNLLINQHERDSLNVQLTQEK
                     LDSLLLMQ"
     gene            <635998..>637395
                     /gene="NDAI0E02980"
                     /locus_tag="NDAI_0E02980"
                     /db_xref="GeneID:11498693"
     mRNA            <635998..>637395
                     /gene="NDAI0E02980"
                     /locus_tag="NDAI_0E02980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670310.1"
                     /db_xref="GeneID:11498693"
     CDS             635998..637395
                     /gene="NDAI0E02980"
                     /locus_tag="NDAI_0E02980"
                     /inference="similar to DNA sequence:INSDC:YPL054W"
                     /note="similar to Saccharomyces cerevisiae LEE1 (YPL054W);
                     ancestral locus Anc_8.509"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670358.1"
                     /db_xref="GeneID:11498693"
                     /db_xref="GOA:G0WBJ5"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:G0WBJ5"
                     /translation="MFKSSTDQDQLNSSILKNWKEQQQQQQEQDQSLPLSSPLHSTNN
                     SSSSPSSNMNNNINNINNMDMDIDMDFEADIDIDIDNEIDNDNDSDFSPEHEELIKQH
                     LRITKENKASNNSKNYSHVPCKFFKNGNCQAGNACPFSHSLDYLTANRTPCKYFKMGN
                     CKFGNKCANSHIINPSQYNNSTNTNVNIDRRNYPLHPYVPKSSSLPSDYNDINNTNIP
                     MSNPQQQISSTYYSNTLSPPLTAPGNGNQNYNYNYNYNSTSLQNYSQQQQQPYYPTST
                     RTTNMNMDMMTPRNYEYRHPPPLQPGPHYSYPSSSSSQPLYNNNELANTKVSPRTSSS
                     SSTSAYSNSRNMNSQEEHYQSYQYPSFSGTNGNINNDDNNNNYTDIEWVRNNLFNMRI
                     SNNITTSVLPPPQASTGTNTTVTNSNNNNNLDNHEFQENLLLSMTEEDDEEQQRQNAT
                     VDNNRKNMENRTVET"
     gene            complement(<637860..>639419)
                     /gene="NDAI0E02990"
                     /locus_tag="NDAI_0E02990"
                     /db_xref="GeneID:11498694"
     mRNA            complement(<637860..>639419)
                     /gene="NDAI0E02990"
                     /locus_tag="NDAI_0E02990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670311.1"
                     /db_xref="GeneID:11498694"
     CDS             complement(637860..639419)
                     /gene="NDAI0E02990"
                     /locus_tag="NDAI_0E02990"
                     /inference="similar to DNA sequence:INSDC:YDR483W,YPL053C"
                     /note="similar to Saccharomyces cerevisiae KRE2 (YDR483W)
                     and KTR6 (YPL053C); ancestral locus Anc_8.505"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670359.1"
                     /db_xref="GeneID:11498694"
                     /db_xref="GOA:G0WBJ6"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G0WBJ6"
                     /translation="MSKKKLFISKRHLRYSVLLGIILTILLMTLRSPDNDTEVTSRAL
                     KLTQQQSQRESRPGSGSGKSFFSFDEIPSLNKNEGGFMGTGNTNELDSTLNFDLNDDD
                     LSFDKIPKYDEFGELIDYSKYIPKLANYTNATLSQFTAKELIRFKQDYDNEQENLKMK
                     TREEKRAKFIKSQTERYGGPDTLMSAMVPSWANVGDRPKACLFAYIEDDDHDGIMKSI
                     NEMEDMFNRQFNYPWVFLTRYGISEEFKQDINDTLRVDFQIGQIDEKDWNGYPSFIDD
                     IKAEEAKIKMAGLEFGDSLEFRLKNRYFAGLFWKHALFKDFDWYWRVEPNMELRCEID
                     YDVFRWLQDKQKSFGFSISKKENKDTLPGLWDEVKKFKDENKKLIHDKNFMRFVSDDD
                     GNSFNQCSFWSNFEVANLNFFRSSAFNKFFESLDNNGGFFYERWATDPLHTIAVSLLV
                     SRDTFVIFFLDFGFYSEPYENCPLDDIKWRESKCKCDQGNDFTFMGGSCTKKFYEVME
                     WPKPDGWNKRT"
     STS             639454..639472
                     /standard_name="AU048745"
                     /db_xref="UniSTS:145195"
     gene            <641224..>642112
                     /gene="NDAI0E03000"
                     /locus_tag="NDAI_0E03000"
                     /db_xref="GeneID:11498695"
     mRNA            join(<641224..641481,641483..>642112)
                     /gene="NDAI0E03000"
                     /locus_tag="NDAI_0E03000"
                     /product="hypothetical protein"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_003670312.1"
                     /db_xref="GeneID:11498695"
     CDS             join(641224..641481,641483..642112)
                     /gene="NDAI0E03000"
                     /locus_tag="NDAI_0E03000"
                     /inference="similar to DNA sequence:INSDC:YPL052W"
                     /artificial_location="low-quality sequence region"
                     /note="similar to Saccharomyces cerevisiae OAZ1 (YPL052W);
                     ancestral locus Anc_8.504"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670360.1"
                     /db_xref="GeneID:11498695"
                     /db_xref="UniProtKB/TrEMBL:G0WBJ7"
                     /translation="MNQSTKKQNLLQKKQDSIFKTLGGQNNLNEKLSNPSISAISLSF
                     PIKNLIKRKQKNHTLNTPTSTSINPNIYTYSLTPNGYKDWSADISRENSDPSNTEADT
                     DKLIELYWDIILLTESQFLYDISHLKKFQNHLVNLMNSKLNQSYKKNTIQDTNNNQGS
                     IWRCLNDNYMIVYLPLIFNDLLWCKFNSVYLNIIIPDFPTSSTINTKDWLLSLLELTS
                     SLDLQYLRLFLRRNTNGNTNLITTLLRNLNWIGGKIIPNENRNNLSFDNDELTMSDKS
                     SFNELMRGDENFIILEFEC"
     gene            <642507..>643181
                     /gene="NDAI0E03010"
                     /locus_tag="NDAI_0E03010"
                     /db_xref="GeneID:11498696"
     mRNA            <642507..>643181
                     /gene="NDAI0E03010"
                     /locus_tag="NDAI_0E03010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670313.1"
                     /db_xref="GeneID:11498696"
     CDS             642507..643181
                     /gene="NDAI0E03010"
                     /locus_tag="NDAI_0E03010"
                     /inference="similar to DNA sequence:INSDC:YPL051W"
                     /note="similar to Saccharomyces cerevisiae ARL3 (YPL051W);
                     ancestral locus Anc_8.502"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670361.1"
                     /db_xref="GeneID:11498696"
                     /db_xref="GOA:G0WBJ8"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WBJ8"
                     /translation="MFHLAQGLYNNWTRKEQYSILILGLDNAGKTTFLETCKKEYNMT
                     SKDLNKITPTVGQNVATIPVDNNKRLLKFWDVGGQETLRAMWSEYYSQCHGIIFVVDS
                     CNSLRLDECSETLRSIVMDEDIESVPILMLANKQDKPERMEVQDIKEIFNKIAEHLSA
                     RDSRVLPVSALTGEGVKDAIDWMVIRVQRNKKIDLQFIDDTKDDHKMCYIINIIKDSI
                     TDRSIS"
     gene            complement(<643198..>644388)
                     /gene="NDAI0E03020"
                     /locus_tag="NDAI_0E03020"
                     /db_xref="GeneID:11498697"
     mRNA            complement(<643198..>644388)
                     /gene="NDAI0E03020"
                     /locus_tag="NDAI_0E03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670314.1"
                     /db_xref="GeneID:11498697"
     CDS             complement(643198..644388)
                     /gene="NDAI0E03020"
                     /locus_tag="NDAI_0E03020"
                     /inference="similar to DNA sequence:INSDC:YPL050C"
                     /note="similar to Saccharomyces cerevisiae MNN9 (YPL050C);
                     ancestral locus Anc_8.500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670362.1"
                     /db_xref="GeneID:11498697"
                     /db_xref="InterPro:IPR005109"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G0WBJ9"
                     /translation="MKASARLSYKLRKNLVLAILLPFTIIITIYLTFFHNRGGSSSFT
                     LNITKNRWTRETQASSSYLPFTSKFRIPKYSYKKVQNWMFNEHIDEIISEGHIAEFDL
                     NKLHSTKDASINKEKVLILTPLQKFHQEYWENILQLSYPRELIELGFIVPRTQTGDLA
                     LQSLEKAVEKTQTDKKNQRFAKVTILRQDSESFNKLAEKERHALNVQKERRSSMALAR
                     NELLFSTIGPHTSWVLWLDADIVETPSTLIQDMTAHDKSVLAANVFQRYYDDEKKASA
                     TRPYDFNNWQESEIGLELASKMNDDEIIVEGYSEIATYRPLMAYFHDTTKPVSEEMIL
                     DGVGGGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMAKRLGYEIFGLPNYLVYHIE
                     ETNI"
     gene            <645888..>647144
                     /gene="NDAI0E03030"
                     /locus_tag="NDAI_0E03030"
                     /db_xref="GeneID:11498698"
     mRNA            <645888..>647144
                     /gene="NDAI0E03030"
                     /locus_tag="NDAI_0E03030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670315.1"
                     /db_xref="GeneID:11498698"
     CDS             645888..647144
                     /gene="NDAI0E03030"
                     /locus_tag="NDAI_0E03030"
                     /inference="similar to DNA sequence:INSDC:YPL048W"
                     /note="similar to Saccharomyces cerevisiae CAM1 (YPL048W);
                     ancestral locus Anc_8.498"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670363.1"
                     /db_xref="GeneID:11498698"
                     /db_xref="GOA:G0WBK0"
                     /db_xref="InterPro:IPR001662"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:G0WBK0"
                     /translation="MSQGTLYANFRIRTVVPRALVKTFNLDVKLVEPEKAQEQFARDF
                     PLKKVPAFVGPKGFKLTESMAINFYLISLSDDEKLKAQLLGPENDIKARAEIIRWESF
                     ANSDFISQIIRAFGPLRGDVPYNKKKVDAALVKIEEMVTIFEARLRNYTYLATESISL
                     ADLVCAAIFTRGFNYLFGKQWRDEHPIIMRWFNTIIASPILKDEYVDFKFIDVPLAPP
                     QNKKKEKKAAEPKPATAKKEKKPDTEAEADVEAAPAKKPKHPLELLGKSTFILDEWKR
                     QYSNEDTRPVALPWFWEHYNPEEYSLWKVDYKYNDELTLTFMSNNLVGGFFNRLSAST
                     KYMFGCLVVYGENNNNGITGAIMVRGQDNVPAFNVAPDWESYSYSKLDPTKEEDKEFI
                     NNMWAWDKPVVVNGESKEIVDGKVLK"
     gene            <647592..>647891
                     /gene="NDAI0E03040"
                     /locus_tag="NDAI_0E03040"
                     /db_xref="GeneID:11498699"
     mRNA            <647592..>647891
                     /gene="NDAI0E03040"
                     /locus_tag="NDAI_0E03040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670316.1"
                     /db_xref="GeneID:11498699"
     CDS             647592..647891
                     /gene="NDAI0E03040"
                     /locus_tag="NDAI_0E03040"
                     /inference="similar to DNA sequence:INSDC:YPL047W"
                     /note="similar to Saccharomyces cerevisiae SGF11
                     (YPL047W); ancestral locus Anc_8.496"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670364.1"
                     /db_xref="GeneID:11498699"
                     /db_xref="GOA:G0WBK1"
                     /db_xref="InterPro:IPR013246"
                     /db_xref="UniProtKB/TrEMBL:G0WBK1"
                     /translation="MSNQTEAVDSVSNGILHNLLTSIIQDIVARERVKVQVLETRYPN
                     HPSYHIDNTGTLDIHGAPKRQESSQYFNCLNCGREISANRFAAHLQRCSNRGSRR"
     gene            complement(<648248..>648547)
                     /gene="NDAI0E03050"
                     /locus_tag="NDAI_0E03050"
                     /db_xref="GeneID:11498700"
     mRNA            complement(<648248..>648547)
                     /gene="NDAI0E03050"
                     /locus_tag="NDAI_0E03050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670317.1"
                     /db_xref="GeneID:11498700"
     CDS             complement(648248..648547)
                     /gene="NDAI0E03050"
                     /locus_tag="NDAI_0E03050"
                     /inference="similar to DNA sequence:INSDC:YPL046C"
                     /note="similar to Saccharomyces cerevisiae ELC1 (YPL046C);
                     ancestral locus Anc_8.494"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670365.1"
                     /db_xref="GeneID:11498700"
                     /db_xref="GOA:G0WBK2"
                     /db_xref="InterPro:IPR001232"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR016073"
                     /db_xref="UniProtKB/TrEMBL:G0WBK2"
                     /translation="MSELKFIKLIGEGDKEYKVSYEAAMVSPVLKTMLQSPFKENAGK
                     VDLTKYSGDTLEKVCEYLEYKLRYQNADETEDIPEFDIPTELSVELLMVADYLNI"
     gene            <648822..>651215
                     /gene="NDAI0E03060"
                     /locus_tag="NDAI_0E03060"
                     /db_xref="GeneID:11498701"
     mRNA            <648822..>651215
                     /gene="NDAI0E03060"
                     /locus_tag="NDAI_0E03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670318.1"
                     /db_xref="GeneID:11498701"
     CDS             648822..651215
                     /gene="NDAI0E03060"
                     /locus_tag="NDAI_0E03060"
                     /inference="similar to DNA sequence:INSDC:YPL045W"
                     /note="similar to Saccharomyces cerevisiae VPS16
                     (YPL045W); ancestral locus Anc_8.493"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670366.1"
                     /db_xref="GeneID:11498701"
                     /db_xref="GOA:G0WBK3"
                     /db_xref="InterPro:IPR006925"
                     /db_xref="InterPro:IPR006926"
                     /db_xref="InterPro:IPR016534"
                     /db_xref="UniProtKB/TrEMBL:G0WBK3"
                     /translation="MSKRNPSLNWEKLQDVFYRNNLLCEFPESLKSKAAQLDNKNVIV
                     SSMFIGIKNKENIQIYNRQQGLIDTVRFDKSEQIIDACFEPLFNEKLVIVTATDLKIV
                     NKLDPLEIINISLPEDVVRNDHIWDYRNGVVILRNSKDIYKLRNGKLELVLKNNNRFT
                     LLTKDNWDCNGEYIILLDIDNVYKVSLTTSRNYXXXXXXXXYEKLQVFKNPEKILMEH
                     NLDKLPFQIQWCANDVVACSFEDEVYLMGPDGVYVTFWYPNDVIAISTAIDGLQVITG
                     NETFFISKIVDCTSNVFRIGSTEPGAILFDSWNLVTEHPAEAVEGLKNLGSENLMKGV
                     IDCIDASMYEWDSEIQKALLSTASFGKNSLPYKTFDSSIFVEACVTVKMLIQLRRIGI
                     FLTKVQFDNITIIGIVKTLLWIGKYSEATELCKLASRIDLFSNIFQNWATSIIKSKSN
                     REDEEILSLLTNQLKMLQEKVPQKFNIPMAILARVAFLEGRFKLARSLALLESSPELK
                     IAGLLKLDDNNLALTESLKVQSPELTLSLLLNLEEKLSKVQLTKLLILDMPHYQLYPY
                     FQRHNYEYLFDFYRQMDKLIDLGQLMMQQGKELNSLQTFLPPIQDLYRKMSNNPLIRQ
                     DAELLERQEKLLQYQDSLTNIFGINFVIMTLDQTLSKLIEMEQHKYIKELTKKFKIND
                     LKFYHIKCRVLVKHNRLDELKEFATHKKSPIGYYPFYKCLRSKGYNQEAATYVELMTA
                     APYAKKKELYLACKGYKELIAMAGKESDIVTLKELYKIIPPNEPEIKALITETLARI"
     gap             649403..649423
                     /estimated_length=21
     gene            <651544..>653649
                     /gene="NDAI0E03070"
                     /locus_tag="NDAI_0E03070"
                     /db_xref="GeneID:11498702"
     mRNA            <651544..>653649
                     /gene="NDAI0E03070"
                     /locus_tag="NDAI_0E03070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670319.1"
                     /db_xref="GeneID:11498702"
     CDS             651544..653649
                     /gene="NDAI0E03070"
                     /locus_tag="NDAI_0E03070"
                     /inference="similar to DNA sequence:INSDC:YPL043W"
                     /note="similar to Saccharomyces cerevisiae NOP4 (YPL043W);
                     ancestral locus Anc_8.491"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670367.1"
                     /db_xref="GeneID:11498702"
                     /db_xref="GOA:G0WBK4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G0WBK4"
                     /translation="MSERKERHRAAKNGDYKQNDNGLDMKTLFVRSIPMDVTDEELTD
                     YFSNFAPTKHAVVVKDVNKKSRGFGFVSFAVEDDTKEALKKARQTKLKGHLLRVDIAK
                     RRDRSSKSDDKNEGKVKTDTIAVGTRGDDNGDEPEEVDEESLLKGKPKLIIRNMPWSC
                     RDPEKLKKVFGRFGNVVEATIPRKRDGKLCGFAFVTMKKLSNCHLALENTKDLKIDGR
                     PVAVDFAVQKNRWEDYKKGHENKEESKVNADREDEDMDVSSEEPANNEGDKHTEDSEG
                     DEEEEEEELEVKEERPRKGKNKREDYSIFVRNVPYDATEESLAAHFSKFGLVKYALPV
                     IDRATGLAKGTAFVAFKDAMTYKYCIDNAPKAGATSLLIGDDVLPEYVYEGRVLSISP
                     TLVREDADRMAEKNAEKRKEILGKAPGERDKRNLYLLNEGKIVEGSKMASLLSAKDME
                     IREKSYKLRVEQLKKDPSLYLSMTRLAIRNLPRAMTDKALKALGRKAVVEFATQVRNG
                     ERHPLSKEELDRSTKEKYRYMSPDEIERQDKKDKKSGLVKQAKIIMEVKGSSAGRSRG
                     YGFIEYKDHRSALMGLRWMNCHSVTEDEILECLTEEERKLIDADATKGRRLCVEFAIE
                     NSNVVKRRRELTQYSRENSKRRREEDTKPEVAETSNKKAKKDAAKQVEASDNKKSSGM
                     SDDVKRLIGIKRKRRQGKK"
     gene            complement(<653882..>655798)
                     /gene="NDAI0E03080"
                     /locus_tag="NDAI_0E03080"
                     /db_xref="GeneID:11498703"
     mRNA            complement(<653882..>655798)
                     /gene="NDAI0E03080"
                     /locus_tag="NDAI_0E03080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670320.1"
                     /db_xref="GeneID:11498703"
     CDS             complement(653882..655798)
                     /gene="NDAI0E03080"
                     /locus_tag="NDAI_0E03080"
                     /inference="similar to DNA sequence:INSDC:YPL042C"
                     /note="similar to Saccharomyces cerevisiae SSN3 (YPL042C);
                     ancestral locus Anc_8.490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670368.1"
                     /db_xref="GeneID:11498703"
                     /db_xref="GOA:G0WBK5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G0WBK5"
                     /translation="MYNGNNPYQQSNLRSTENQQQQNQAAQQNQQLMQQPSQQYPTGR
                     DLWQSQGRNLYPQPQFQIQQHQVTNKKHPLSNATISTGAMHGKQPMLMANNDVFSIGP
                     YKARKDSCRISVIEKYEIIGYIAAGTYGKVYKAKRKVQQASSDSNCSNVSSSLDSSNN
                     SPMKNIDEVPISQTNSTNVTNFDPKTERIRTASTKQASMFTYNNANTNNNSSSNSDSI
                     DFSTSNGPNSSNDISTTAPMQINTGMGPPKSMVKKSLSQIIMLLKKFKTEKEGLEQLH
                     YTGISQSACREMSLCRELNNKHLTKLVEIFLERKSIYMVYEYAEYDLLQIIHFHSHPE
                     KRMIPPRMIRSIMWQILDGVSYLHQNWVLHRDLKPANIMVTVDGCVKIGDLGLARKFF
                     NMVQTLYTGDKVVVTIWYRAPELLLGARHYTPAIDLWAVGCIFAELIGLQPIFKGEEA
                     KMDSKKSVPFQANQIQRILEVLGSPTLKTWPNINKYPEYDQLMKFQRYKDNLPTWYHS
                     TGGRDKSALDLLYQLLRYDPISRIDAVDALDHHYFTNGEAPVSENVFEGLSYKYPARR
                     IHTNDNDIMNLGIHRNKNLLQQPQSNTNSKSTSTTLGGLGVNRKILAAAAAAAAAVSG
                     LNSKLNEPSKKKRR"
     gene            complement(<656678..>657472)
                     /gene="NDAI0E03090"
                     /locus_tag="NDAI_0E03090"
                     /db_xref="GeneID:11498704"
     mRNA            complement(<656678..>657472)
                     /gene="NDAI0E03090"
                     /locus_tag="NDAI_0E03090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670321.1"
                     /db_xref="GeneID:11498704"
     CDS             complement(656678..657472)
                     /gene="NDAI0E03090"
                     /locus_tag="NDAI_0E03090"
                     /inference="similar to DNA sequence:INSDC:YPL041C"
                     /note="similar to Saccharomyces cerevisiae YPL041C;
                     ancestral locus Anc_8.489"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670369.1"
                     /db_xref="GeneID:11498704"
                     /db_xref="InterPro:IPR018811"
                     /db_xref="UniProtKB/TrEMBL:G0WBK6"
                     /translation="MSARFYSKNMMLSVSEGLGQYNKHNFFIKDLGLFIKCDLLYITN
                     RSRFCSTMFQNLLRTNVKGSLCNFQVPSRLLVTSFRQQQPNTNGITFRLCYSTKPEIT
                     KDQRRKDEYNDKLHKMIKKSKVLTRLNDNPKFSHYFNRLSETGTIPTVTSFLLLHELT
                     AIAPLLLLWWIFYNLDFEGESTSFELPDYIHDLLERCNKAIDKLVGDKYDGKFDRKKL
                     VLTGAISYTIVKLLYPARILLSLWGAPYFGRWMMIPFQRLKMYLKK"
     gene            complement(<657710..>660751)
                     /gene="NDAI0E03100"
                     /locus_tag="NDAI_0E03100"
                     /db_xref="GeneID:11498705"
     mRNA            complement(<657710..>660751)
                     /gene="NDAI0E03100"
                     /locus_tag="NDAI_0E03100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670322.1"
                     /db_xref="GeneID:11498705"
     CDS             complement(657710..660751)
                     /gene="NDAI0E03100"
                     /locus_tag="NDAI_0E03100"
                     /inference="similar to DNA sequence:INSDC:YPL040C"
                     /note="similar to Saccharomyces cerevisiae ISM1 (YPL040C);
                     ancestral locus Anc_8.488"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670370.1"
                     /db_xref="GeneID:11498705"
                     /db_xref="GOA:G0WBK7"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002301"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR023585"
                     /db_xref="UniProtKB/TrEMBL:G0WBK7"
                     /translation="MLRLYPLFTKTILRNLSKHAYQKTLNLPKSKFPSHSNLQRTINE
                     LIPQCSQEQYKTQLSEFIDKVNQIDNDQDKLAFIKKNLFILHDGPPYANGDLHLGHAV
                     NKILKDIIIRYQKSTGKYIFYKPGWDCHGLPIELKVLKNFSKDELQNVSPLKIRSLAK
                     KHALKTIKDQKRQFEQFGIFTDWDDPYITLNKDYELNQLRIFHKMFKLGLIKRQNKPV
                     FWGTETKTALAESELEYNKEHKSTSAYVQFPLSRKSQTLFLEKLGMTVGSMNSIDCLI
                     WTTTPWTLFSNKAICFNKHFEYSLVTSSKSAENYNKPDLLIIETNLISQVYKQKEDYT
                     ILKTFSGEILENLHYTNPLLSNNLEYPLLHADHVTKEAGTGLVHTAPGHGADDYLLGI
                     QNNLIIYSPIDHEGRYKLSELPDNVQQLLSDNESSSPIPVGRSVLDPRTTKLILNKLD
                     ELEMLFGCKELVHSYPYDWRSKKPVILRATPQWFLNLNKVKTLAMESLDKKGVEFFPE
                     RGKTRLLSFIKNRNEWCISRQRVWGVPIPAFYKISNPDELLMTEEIIEHVIKTIESNG
                     IDRWFNESVPTEEWLPEKYQNIANEYKRGFDTMDVWFDSGSSWKVIEDFYKNTLKLNP
                     AYRPKHLFDLCLEGSDQHRGWFQSLLLTNIAMTMKKVAPYSEVITHGFTLDENGIKMS
                     KSIGNTISPKDVIEGNAKIDILPLGVDGLRYFVAYSNFTTDITIGPNVMKHVAEALKK
                     IRISFKFMQGNLEKSEDFKLIPIDDLRPIDKFVLSNLNELLVNTKQLYEEYNFSKILT
                     LLQHHLTNELSAVYFDISKDSLYSDSMTSKKRQSIQTVLFSILQVYCNILYPILPTLV
                     QEVRNNIRKEWINNNNTAFIPWEGFQLSHNNSTHFQEKEMQILKKFQELMGSMTDPPI
                     DSTQVCAILSTNNPKELPFTLEEISDLLQVAEVRICSSEIASMHDVPHSKILLNNGTE
                     LQLSLTKSSLHKCPRCWKQSSNEADTLCHRCKEAVNEQGNT"
     gene            <661293..>662195
                     /gene="NDAI0E03110"
                     /locus_tag="NDAI_0E03110"
                     /db_xref="GeneID:11498706"
     mRNA            <661293..>662195
                     /gene="NDAI0E03110"
                     /locus_tag="NDAI_0E03110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670323.1"
                     /db_xref="GeneID:11498706"
     CDS             661293..662195
                     /gene="NDAI0E03110"
                     /locus_tag="NDAI_0E03110"
                     /inference="similar to DNA sequence:INSDC:YPL039W"
                     /note="similar to Saccharomyces cerevisiae YPL039W;
                     ancestral locus Anc_8.487"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670371.1"
                     /db_xref="GeneID:11498706"
                     /db_xref="UniProtKB/TrEMBL:G0WBK8"
                     /translation="MIDNLSDPRSSSTSPIRTISDDLIHNPKRLRNIKLQVGTLNNFL
                     ISNFSKTIISKYGILLIDPLNMDMSHIHLTAAHHTKITTFFVTMLKRTRSSRLQFKKI
                     CCIVLKFLDCCTKEANYMKFLKYNLQKLIVASFVLSVPNVEGDEATRIQRREACYDLF
                     ARMTGLSKMDIINCCSIVRSIIIRRSRQQMKATNSSFHMNQHILNSFSRDSPTRDMFH
                     NEVSPFPHHHEPQMSDPPAHINPRQLSSSSSSSSVSYINSACGSEEGNDDETYGSNGY
                     ILSAELEQFNLTGKTLVYENFRII"
     gene            <662597..>663316
                     /gene="NDAI0E03120"
                     /locus_tag="NDAI_0E03120"
                     /db_xref="GeneID:11498707"
     mRNA            <662597..>663316
                     /gene="NDAI0E03120"
                     /locus_tag="NDAI_0E03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670324.1"
                     /db_xref="GeneID:11498707"
     CDS             662597..663316
                     /gene="NDAI0E03120"
                     /locus_tag="NDAI_0E03120"
                     /inference="similar to DNA sequence:INSDC:YDR253C,YPL038W"
                     /note="similar to Saccharomyces cerevisiae MET32 (YDR253C)
                     and MET31 (YPL038W); ancestral locus Anc_8.486"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670372.1"
                     /db_xref="GeneID:11498707"
                     /db_xref="GOA:G0WBK9"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0WBK9"
                     /translation="MAEEAAFFRLAAEAIVATSLNINNVDPTIKELLSRINYQKMTSA
                     LGSSSSSAQSPKRSISSESSSSPTIENINFLTDSNINEFNNIRHNSTSSSYNHATSPV
                     TRTNSLNNGNDVFKTDINNSPTTTSNKKVTKPSSKGKTKKNHATSPTAAANHNRRYPC
                     SKCELEFLRTSDLRRHEKAHLLVLPNICSQCGKGFARKDALKRHFNTMTCQRNRNKLM
                     EITGGNITELLERAKKSGISL"
     gene            complement(<663545..>664015)
                     /gene="NDAI0E03130"
                     /locus_tag="NDAI_0E03130"
                     /db_xref="GeneID:11498708"
     mRNA            complement(<663545..>664015)
                     /gene="NDAI0E03130"
                     /locus_tag="NDAI_0E03130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670325.1"
                     /db_xref="GeneID:11498708"
     CDS             complement(663545..664015)
                     /gene="NDAI0E03130"
                     /locus_tag="NDAI_0E03130"
                     /inference="similar to DNA sequence:INSDC:YDR252W,YPL037C"
                     /note="similar to Saccharomyces cerevisiae BTT1 (YDR252W)
                     and EGD1 (YPL037C); ancestral locus Anc_8.485"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670373.1"
                     /db_xref="GeneID:11498708"
                     /db_xref="InterPro:IPR002715"
                     /db_xref="UniProtKB/TrEMBL:G0WBL0"
                     /translation="MPIDQEKLAKLQKLSANNKVGGTRRKFSKKSTSSVSGANKDDTK
                     LHAQLAKMNAVTVDNVAEANFFREDGSVMHFNRVGVQVAPQHNTSVFYGLPQEKKLQE
                     LFPAVLPQLGAEAIQALNQLTSQLKEHEEKQAKNDGETASEAVPDLTAEQPDVE"
     gene            <664910..>665692
                     /gene="NDAI0E03140"
                     /locus_tag="NDAI_0E03140"
                     /db_xref="GeneID:11498709"
     mRNA            <664910..>665692
                     /gene="NDAI0E03140"
                     /locus_tag="NDAI_0E03140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670326.1"
                     /db_xref="GeneID:11498709"
     CDS             664910..665692
                     /gene="NDAI0E03140"
                     /locus_tag="NDAI_0E03140"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670374.1"
                     /db_xref="GeneID:11498709"
                     /db_xref="GOA:G0WBL1"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:G0WBL1"
                     /translation="MNQTSDSTSQGTERQSNIVSFLKIVKTFKGEPDEYFTWKAAMQG
                     NKELFEVSDRQFMAGLYNYFEGNPANWLKNTTFNSYEEFWITLDTKYQFDKNNEIATN
                     FRLLMSPPKNIRTYREYVNHFENRLALLPADFKDSSWKLACFLFLLQLGLQDAIRSQD
                     PQNVQEAIVIGENRSVMFKDSILDPRFCGLVSDVHGDNTKGNHQFNQSAIVCFNCGRS
                     EHKSNECRNSHGRHPGRHRYNQKSFRKSGSNTIPISDLSSKN"
     gene            <669008..>669472
                     /gene="NDAI0E03150"
                     /locus_tag="NDAI_0E03150"
                     /db_xref="GeneID:11498710"
     mRNA            <669008..>669472
                     /gene="NDAI0E03150"
                     /locus_tag="NDAI_0E03150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670327.1"
                     /db_xref="GeneID:11498710"
     CDS             669008..669472
                     /gene="NDAI0E03150"
                     /locus_tag="NDAI_0E03150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670375.1"
                     /db_xref="GeneID:11498710"
                     /db_xref="UniProtKB/TrEMBL:G0WBL2"
                     /translation="MCLEDCIQKLSSDLFSGESSGWCSYLDIDDSKLFSAASSDASSD
                     PSSAASSAASSGLYSNGTNMSSDLSSAASPDGTNMSPDGTNMSSDVSDVCSDAADPST
                     VFVGSSCFLEFPSPDFLGMSLIVRYMITCLGVFCSKRPAKKMKTIPKQKSNG"
     gap             669889..669908
                     /estimated_length=20
     gene            672625..672698
                     /gene="NDAI0Etrna10I"
                     /locus_tag="NDAI_0Etrna10I"
                     /db_xref="GeneID:11498711"
     tRNA            672625..672698
                     /gene="NDAI0Etrna10I"
                     /locus_tag="NDAI_0Etrna10I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:11498711"
     gap             673016..673035
                     /estimated_length=20
     gene            complement(<673686..>676526)
                     /gene="NDAI0E03160"
                     /locus_tag="NDAI_0E03160"
                     /db_xref="GeneID:11499079"
     mRNA            complement(<673686..>676526)
                     /gene="NDAI0E03160"
                     /locus_tag="NDAI_0E03160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670328.1"
                     /db_xref="GeneID:11499079"
     CDS             complement(673686..676526)
                     /gene="NDAI0E03160"
                     /locus_tag="NDAI_0E03160"
                     /inference="similar to DNA sequence:INSDC:YDR251W,YPL032C"
                     /note="similar to Saccharomyces cerevisiae PAM1 (YDR251W)
                     and SVL3 (YPL032C); ancestral locus Anc_8.484"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670376.1"
                     /db_xref="GeneID:11499079"
                     /db_xref="GOA:G0WBL3"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="UniProtKB/TrEMBL:G0WBL3"
                     /translation="MSSLKVLTLGNNPNIVLYTARFQLANSVELYHVSDSISNTFQIE
                     TIHYGIDNFKLQNHFNSLEQLMNHFQTNEDSSVLDLIIMSASSLQELSTSSAQLKPLI
                     NSNTKIFLESSGFIQLEPFMKLSMNSPQSKIFSLISNYDIREISPNHYKQFQTNNNKS
                     SSSSSYTIYLGDSTTTSDQNNNTKYTKNISGLLQTFQRLFQKLFPRDQIDLCNLNSMD
                     FLKQQWIMAIPKICFDPLLIMLEETNPTDLNNQILAKPLISGLVTETLTVMKNMNINL
                     KSENLENEDDLLKYWNSLYSPTQTKKDDKNEMMMPSLLYHFIHKTAPLDIDLILLQII
                     LLADDHQVKTPYLEFLYSILIQLQNLNNGKSKWFIRKDEQQQQQQQQQQQQQQQQQQQ
                     QNVKLNEEENNNKSIIEKLNEKISTLKNSNDDLLHSLENFKLENNNLKNQLNSSNKEL
                     SSKEKQYQNQINDLQDKLQGLGKANIQQEHSNRTTPSINNNKIQDIQKQQELEDNYNS
                     TGTPNLKDLQDFAMMNVNYGESPIKQNQNQPQQSVGVNASNNSSSSSGNYQPNDMNNT
                     NNNNSNNELDTDTSLKERELELRRKELELQERELEIQKRALQQQQQQRYSSKQYNVNN
                     VMPPQQMMINGHNRRPSYPQQQQQQLQQPMNMRPNRGMHGAAPTAPPSASNFIDPISS
                     GRSYSNGNNISTYSGGVGPSRNGNPMMMQQNGFPIKPTSRKNRNSNMPNLGHASTMGF
                     NNKNNNFNRPPNQQSLPSSAANSQSRLNSMSSHSIPAFQNSNNNMNPRFPQQQDQQMM
                     MANSASRMSMPLSSKPSNLTMNGQQPQQQQRQFSSSTAIEHSQSNPNMSTNSVLHNNF
                     PYQPPANNLNTNNGNNEDNNNTAGPSTPVMPQHVPQINIHQASPAPTSSTQDTNTTQM
                     TEESAPGDNNDDNGGKKKKKSRFGLFKKKNKK"
     gene            complement(<677441..>678543)
                     /gene="NDAI0E03170"
                     /locus_tag="NDAI_0E03170"
                     /db_xref="GeneID:11498712"
     mRNA            complement(join(<677441..678392,678524..>678543))
                     /gene="NDAI0E03170"
                     /locus_tag="NDAI_0E03170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670329.1"
                     /db_xref="GeneID:11498712"
     CDS             complement(join(677441..678392,678524..678543))
                     /gene="NDAI0E03170"
                     /locus_tag="NDAI_0E03170"
                     /inference="similar to DNA sequence:INSDC:YPL031C"
                     /note="similar to Saccharomyces cerevisiae PHO85
                     (YPL031C); ancestral locus Anc_8.482"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670377.1"
                     /db_xref="GeneID:11498712"
                     /db_xref="GOA:G0WBL4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0WBL4"
                     /translation="MSSSSSQFKQLEKLGNGTYATVYKGLNKSTGAFVALKEVKLDSE
                     EGTPSTAIREISLMKELKHENIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSQSTGNT
                     PRGLELNLVKYFQWQLFEGLAFCHENKILHRDLKPQNLLINKKGQLKLGDFGLARAFG
                     IPVNTFSSEVVTLWYRAPDVLMGSRTYTTSIDIWSCGCILAEMITGKALFPGTNDDEQ
                     LKLIFETMGTPSEATWPGVSTLPKYNPNFAQRLPKDLRMVLQPYCKENLDDNVLGLLN
                     GLLQLNPDLRLSAKQALHHPWFAEYYQHFSPEQQQQQQQQQQQQQQQ"
     gene            <679056..>680882
                     /gene="NDAI0E03180"
                     /locus_tag="NDAI_0E03180"
                     /db_xref="GeneID:11498713"
     mRNA            <679056..>680882
                     /gene="NDAI0E03180"
                     /locus_tag="NDAI_0E03180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670330.1"
                     /db_xref="GeneID:11498713"
     CDS             679056..680882
                     /gene="NDAI0E03180"
                     /locus_tag="NDAI_0E03180"
                     /inference="similar to DNA sequence:INSDC:YPL030W"
                     /note="similar to Saccharomyces cerevisiae YPL030W;
                     ancestral locus Anc_8.481"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670378.1"
                     /db_xref="GeneID:11498713"
                     /db_xref="GOA:G0WBL5"
                     /db_xref="InterPro:IPR011671"
                     /db_xref="UniProtKB/TrEMBL:G0WBL5"
                     /translation="MTSRKETNNNKMGKNSSSSSSSSSSSATGHNDGFKFIINEKSIL
                     GGQWLNMYTTTKPVEFGKEHFERAMTNLIREPNINSTAILRADILREITYDQETTPGT
                     DTNDDESELKILESKIQNFEITEDLGARTIGIDDITPRHSNFKENDLNLILYKEFVRR
                     IIPRNPSKDALINQTCLIMNSSSEKFKNSTSLIIYTPHVEAEDDYPFYIPRVKSVGIL
                     LHEKILTVHYLPFQDDIQLLQDESQRVVRTAYRLLQTSYKHSKGVMQGYEKRVNHDQV
                     VDKVKFQDRYILLKKKYSKFLVDNWAESTDPKKHVFEDIAIAAFLIELWIQLYPASSK
                     NKTESSDADDDEYSFKNKMQFRDLGCGNGVLCYILISEGIKGIGIDARRRKSWSIFPQ
                     EVRNCLKEQVIIPSVLLRPHPEVKKRAPHLEHNGRMFPVKVSHELIAPATLVYSSADL
                     LASPQVNVAEFPSNTFIIGNHSDELTCWIPLLGYPFMVIPCCSHNLSGQRVRFYPRKK
                     VTDSKNNNNNNNKKVNTNNSSTYAGLVDHVEYIASRVGWDISKEMLRIPSTRNAAVIG
                     SVNPNLGNFPTQAVYESIIEDSGHDSWVENTMALLKRSPRNH"
     gene            <681228..>683513
                     /gene="NDAI0E03190"
                     /locus_tag="NDAI_0E03190"
                     /db_xref="GeneID:11498714"
     mRNA            <681228..>683513
                     /gene="NDAI0E03190"
                     /locus_tag="NDAI_0E03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670331.1"
                     /db_xref="GeneID:11498714"
     CDS             681228..683513
                     /gene="NDAI0E03190"
                     /locus_tag="NDAI_0E03190"
                     /inference="similar to DNA sequence:INSDC:YPL029W"
                     /note="similar to Saccharomyces cerevisiae SUV3 (YPL029W);
                     ancestral locus Anc_8.480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670379.1"
                     /db_xref="GeneID:11498714"
                     /db_xref="GOA:G0WBL6"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR022192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WBL6"
                     /translation="MLKWCYPSKVEWNHCHKKVRIKSIQFRRTFIHSRTRNNNNYASN
                     TRAQSVNNNGIFTNKNWLIRKPQFKNIPKIERNDFIERFQFEINPKKYNNVYTKDLEF
                     KKNLDMAMNQVFHNKMKSFDKNESQLKRLVWNKLRDYIYAQLQQKDLDKSISQYKPIL
                     SQMIQPCNPEHLICQLAKCNSFASNTWAKILGKTDEQRTITTCDKYYYLLSKTFDYIY
                     GQEIIPTCYEDDTIDPNPYLNAEVNISDPAEWFVEARKMKRHIIMHLGPTNSGKTYKA
                     LQKLKTSESGYYAGPLRLLAREVYDTFKSQGIRCNLLTGEEIIKDLDSMGNSAKLTSG
                     TVEMIPLNKKFDVIVLDEIQMMNDEDRGWAWTNALLGVQAREVHLCGEKSALPLISKI
                     IKLTGDRLTINEYERLGELKVESEVLKRGLYSLRKGDCIVAFSKKKILDLKLQIEAKT
                     NLKVAVIYGSLPPETRVQQAQLFNEGECHVLVASDAIGMGLNLSIDRIIFTTDLKYNG
                     KELMKLTNSNIKQIGGRAGRFKFEGNGPAIGSISSLHTEVLDSVKEGIEAPIEYLKKA
                     VIWPTDKICEQLMIRFPPGTKVGVLLQTLSDQLEAGSNKLFKVSGLDNKFNVIKLFED
                     MEDIPFLDKLKLSNAPVKNLPMVQEAFSQFCLTISKKETRTLLSYPFPFYILQYKNIT
                     NDDYGLERYEALYNIIMLFFWLSNRYPNYFVDLESATDLKHFCEMMIFEKLNRLSKNP
                     YIRKFPSIRNSKNPKMVKNRR"
     gene            <684058..>685254
                     /gene="NDAI0E03200"
                     /locus_tag="NDAI_0E03200"
                     /db_xref="GeneID:11498715"
     mRNA            <684058..>685254
                     /gene="NDAI0E03200"
                     /locus_tag="NDAI_0E03200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670332.1"
                     /db_xref="GeneID:11498715"
     CDS             684058..685254
                     /gene="NDAI0E03200"
                     /locus_tag="NDAI_0E03200"
                     /inference="similar to DNA sequence:INSDC:YPL028W"
                     /note="similar to Saccharomyces cerevisiae ERG10
                     (YPL028W); ancestral locus Anc_8.479"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670380.1"
                     /db_xref="GeneID:11498715"
                     /db_xref="GOA:G0WBL7"
                     /db_xref="InterPro:IPR002155"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR020610"
                     /db_xref="InterPro:IPR020613"
                     /db_xref="InterPro:IPR020615"
                     /db_xref="InterPro:IPR020616"
                     /db_xref="InterPro:IPR020617"
                     /db_xref="UniProtKB/TrEMBL:G0WBL7"
                     /translation="MSNNVYIVSAKRTPIGSFQGTLSSKTAIDLGATAVKAVMDEVPQ
                     LNPESDYDEIIFGNVLSANLGQAPARQVALAAGLKNTIIATTVNKVCASAMKAIILGA
                     QSIKCGTADVVVAGGCESMTNTPYYMPAARSGARFGETVLVDGVQRDGLNDAYDGLAM
                     GVHAEKCASDWNISREEQDNFAIDSYQKAQAAENDGKFKNEIAPVIIKGFRGKPDMEV
                     VKDEEPGKLNINKLKSARTVFQKENGTVTAPNASPINDGGAAVILVSERKLNELGLKP
                     LAVIRGWGEAAHEPANFTWAPSLAVPKALKHAGIEDINSIDFFEFNEAFSVVGLANTK
                     ILKLDPSKVNVYGGAVAIGHPLGCSGARIVVTLLSILNQEKGRLGVAAICNGGGGASS
                     IVIERL"
     gene            complement(<686073..>687317)
                     /gene="NDAI0E03210"
                     /locus_tag="NDAI_0E03210"
                     /db_xref="GeneID:11498716"
     mRNA            complement(<686073..>687317)
                     /gene="NDAI0E03210"
                     /locus_tag="NDAI_0E03210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670333.1"
                     /db_xref="GeneID:11498716"
     CDS             complement(686073..687317)
                     /gene="NDAI0E03210"
                     /locus_tag="NDAI_0E03210"
                     /inference="similar to DNA sequence:INSDC:YDR247W,YPL026C"
                     /note="similar to Saccharomyces cerevisiae VHS1 (YDR247W)
                     and SKS1 (YPL026C); ancestral locus Anc_8.477"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670381.1"
                     /db_xref="GeneID:11498716"
                     /db_xref="GOA:G0WBL8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0WBL8"
                     /translation="MLTNCQINNLVLRSQVGSGAFGLVFHAIDIVSQQEYAIKAVLKT
                     SPNDSNNSTNDEKKQIKKSTILQDKLYHYFKEHQNRIYLPSVDLESIKNLTEQQLYCI
                     PHYKEINFHLKVHDHANIVTIHQILESQIATFIVMDYYPIDLFSSIVEHKHFSNDGLL
                     VKKVFLQLCSALNYCHQQNIYHCDIKPENILLDRFDNIHLCDFGLATYSSYLAPNTCV
                     GSSYYMAPERVFCNGNGNGNNNDNNGICNDQNVCSSFPTISGDIWSLGIILINLTCIR
                     NPWLKAHQLEDNTYHHFAKDNTILQKILPISNEFFQLLSNILKINPFERLTINSLIQN
                     VENLASFTVDGPLSSVPQLIPIYDNNNYYNINAVTQPNNNNSLSLNELINDYADDPNE
                     ENNRKWKHIQLIFRRYTISIRS"
     gene            <689572..>690339
                     /gene="NDAI0E03220"
                     /locus_tag="NDAI_0E03220"
                     /db_xref="GeneID:11498717"
     mRNA            <689572..>690339
                     /gene="NDAI0E03220"
                     /locus_tag="NDAI_0E03220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670334.1"
                     /db_xref="GeneID:11498717"
     CDS             689572..690339
                     /gene="NDAI0E03220"
                     /locus_tag="NDAI_0E03220"
                     /inference="similar to DNA sequence:INSDC:YPL024W"
                     /note="similar to Saccharomyces cerevisiae RMI1 (YPL024W);
                     ancestral locus Anc_8.475"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670382.1"
                     /db_xref="GeneID:11498717"
                     /db_xref="UniProtKB/TrEMBL:G0WBL9"
                     /translation="MSLPTSIISQDITGTFDLPTNISSLGSREQLIIRAYQNEPWFPN
                     ESTTAILEKKLCKVNRELLFQILMVENISKSKLAQVDDIKVKLDPKNQKVDRLRSGQL
                     KAPPTYKVVTQVDVDADDNIDRTGIDNIASTNNYNNNNNNNNNSNNSTTKAVFKLTLQ
                     SKNGDIFFAINSTPLPWISCMLGSKIVIKPGTIFNKGVFIISDTKVVFLGGINRVWNE
                     NRDHKMSAYLEAKLDREKETSKGNKQQNKRKRKAPGS"
     gene            complement(<690552..>692567)
                     /gene="NDAI0E03230"
                     /locus_tag="NDAI_0E03230"
                     /db_xref="GeneID:11498718"
     mRNA            complement(<690552..>692567)
                     /gene="NDAI0E03230"
                     /locus_tag="NDAI_0E03230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670335.1"
                     /db_xref="GeneID:11498718"
     CDS             complement(690552..692567)
                     /gene="NDAI0E03230"
                     /locus_tag="NDAI_0E03230"
                     /inference="similar to DNA sequence:INSDC:YPL023C"
                     /note="similar to Saccharomyces cerevisiae MET12
                     (YPL023C); ancestral locus Anc_8.474"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670383.1"
                     /db_xref="GeneID:11498718"
                     /db_xref="GOA:G0WBM0"
                     /db_xref="InterPro:IPR003171"
                     /db_xref="InterPro:IPR004621"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="UniProtKB/TrEMBL:G0WBM0"
                     /translation="MSRLSIKELYECKATPSISLEFFPPKTDSGTRNLMERMGRMSAM
                     DPLFITVTWGAGGTTSDKTLNLAQLISKEFNVPVCMHLTCTNMERSVIDEALKKCQEI
                     GIKNILALRGDPPIGEDWIDSDGNPEYEFKHAIDLVRYIKETYGSEFCIGVAAYPEGH
                     YQEDSENAIQDPVKDLVYLKEKIDAGADFVITQMFYDVERFLAFEQLFRDNISMNIPL
                     FPGLMPINSYLLFQRASKLSHASIPEKILERFPPEIQFDDDSVKSIGVEILIDIIEEI
                     YKRTSGRVRCFHFYTLNLEKAIAQIVSQSPTLSHILEENESSSDDEVTPQENGIATID
                     ADGDIVIEDIPESNNDDSDEIMIDGGNDHGTKRRRRSSTVSTEFMMNRALVTQGRTNT
                     TRTNQGMVGAPSKKFVISISKGSGALGRDATWDEFPNGRFGDSRSPAYGEIDGYGSTI
                     KVSTKRAYELWGQPKSLKDLKSIFIKYLEGSIDALPWCDLGLSAETGLIQEELIQLNH
                     RGYLTLASQPATNGSSSTDKIFGWGPKKGIVYQKAFVEMFIHKQQWENVLKPKIEHYG
                     TRKFSYYAGDSSGSFESNLDANSSNVVTWGVFPNSQVIQTTIIEENSFKAWRDEAFTI
                     WSEWAKIFPRNSVTNIFLREMFSEYCLISIVHHDYIETDELWDILLD"
     gene            <692864..>696139
                     /gene="NDAI0E03240"
                     /locus_tag="NDAI_0E03240"
                     /db_xref="GeneID:11498719"
     mRNA            <692864..>696139
                     /gene="NDAI0E03240"
                     /locus_tag="NDAI_0E03240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670336.1"
                     /db_xref="GeneID:11498719"
     CDS             692864..696139
                     /gene="NDAI0E03240"
                     /locus_tag="NDAI_0E03240"
                     /inference="similar to DNA sequence:INSDC:YPL022W"
                     /note="similar to Saccharomyces cerevisiae RAD1 (YPL022W);
                     ancestral locus Anc_8.473"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670384.1"
                     /db_xref="GeneID:11498719"
                     /db_xref="GOA:G0WBM1"
                     /db_xref="InterPro:IPR006166"
                     /db_xref="InterPro:IPR006167"
                     /db_xref="InterPro:IPR010994"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR020819"
                     /db_xref="UniProtKB/TrEMBL:G0WBM1"
                     /translation="MSQLFVQDESDEEELQLELSKQVNAEQAGRLREHDLDLPKQPPN
                     HDIEESQADAKSAEPVLYPLIPNQEEGDQNYKPNIEDIRAVDVQLTLPLVFQQQVVEN
                     VLVTENPLVIMGKGLGMINIIANLLHVLSVPTKIEGRLKRSLVIVLNASSRDNERIQE
                     ELQELSWVSVEDSGIEANDLDDDGMSPFERTFSIVTAESSSVEKRRKLYLTGGIVSVT
                     SRILIVDLLSGILHPNRVTGMVVLNAENLKTHSNVSFILEIYRSKYQWGFIQAFSESP
                     ESFVMEFSPLFTKMKELGLKNVLLWPRFRVEISSCLNALSKSGSNNTNSVIEVKVSLT
                     NSMSQIQFGLIECLKKCIEELNRKNPELSLEWWNIDNALDIKFLRSIDFIMIPNWHRI
                     SFESKQLVKDIKFLKNLLRTFFNADAVDFYENIQLSLEANKPSVSRKYTESPWLMANE
                     SQLVISYAKKRVVDNNEYSLEEMPKWEQLINILDDIAHERTTRDVQGTTLIVCSDTST
                     CIQLSRILFNSDRKNGIRKFMLGKLNRYKSLREERKAIMLEAQSKDNKTNAELNVSAA
                     FAKEDIITKRRRTRGASVVAAVERLRTAGTGEDIETKIEDYDLEQELTKIHGTEYDVD
                     LDEENLDEIKIDDIDSEFAVLPSKKEEEILPAAHDGVTEELWKERMENFEYINRNKQI
                     IIEKFSNLNDDASLEEIMPSYIILFEPDLSFVRRVEIHRAIHMNLPPKVYFMYYGDSI
                     EEKIHLTAIKKEKDAFTRLIRENANLAQHFETLEDLSHYKNLAARKSKLNRLKRSSTR
                     NAGGQSALHESTHDVVIVDTREFNASLPGLLFRYGVRVIPCMLTVGDYIITPDICIER
                     KSIEDLIGSLQNHRLELQCKKMLKYYKYPTLLIEFDEGQSFSLEPFSEKRRYKLKESS
                     TIHPISSKLTQEEIQSKLAKLVMKFPTLKIIWSSSPLQTVNIILELKLGREQPDPTLS
                     VGMGGTTRKTKVNTNVATNKKPVSDANLFTKILGIPGISKVDYFNIRRHFKNYDVLSN
                     LALEDIYNALDDEELATKLYSFFQYEQLENEGTDKDDDVEDGNENMEDFDDDDDDHLE
                     QLM"
     gene            complement(<696278..>700273)
                     /gene="NDAI0E03250"
                     /locus_tag="NDAI_0E03250"
                     /db_xref="GeneID:11498720"
     mRNA            complement(<696278..>700273)
                     /gene="NDAI0E03250"
                     /locus_tag="NDAI_0E03250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670337.1"
                     /db_xref="GeneID:11498720"
     CDS             complement(696278..700273)
                     /gene="NDAI0E03250"
                     /locus_tag="NDAI_0E03250"
                     /inference="similar to DNA sequence:INSDC:YPL016W"
                     /note="similar to Saccharomyces cerevisiae SWI1 (YPL016W);
                     ancestral locus Anc_8.472"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670385.1"
                     /db_xref="GeneID:11498720"
                     /db_xref="GOA:G0WBM2"
                     /db_xref="InterPro:IPR001606"
                     /db_xref="UniProtKB/TrEMBL:G0WBM2"
                     /translation="MDFFTSTNENNNNGSDDFENFLDTQSFDPNSNENNLNIDFNGNN
                     NNKFSGGNGLMPNMSPSMGAGSPFDPPTSTNMNLNPSGSLSPQAILARNSIIDPNQLP
                     ISSQQQIYSPMSNNMISTNGLVSTSAAATPQQLLSLNDNVSANANANMSQSPLNTGFN
                     DPMTKSNDNGNITTNDINFNNTAENGNMNLGMMQNNNDNNSNIQTNNISNNQYNDRTA
                     MMAAIQAQRQQQQQQQQQQQQQQQQQQPNSGSPFSGQYDQMQILQMKKRQQERFFALQ
                     QKMLQQQRQNQESRLQQPPASLESPSLNGSPSLTSQQLIQQQQQQQQVPRSTNEPQNF
                     PSKIQNIRQQLQQAHRLQQQQQQTQAQTNQQFASGQFNPQLQQQQQQQQQLQQQQQQR
                     LQLQQQQQRALLQNLDPVLQQRISTELSNKQYELFMKSLLENCKRRNMPIQAIPEING
                     KRVNLFFLYLLVQRFGGGEQITRNQQWPAITSKLQLGDAQQLELIYYKYLLPYEQYLI
                     SKGGMKETQAKRIFIQQFLQELLRKVGQQQQQQQQQLLRQQPQPQPQPQPQFPPATSP
                     IQPNTMTNNMAPQEPQQQPYDVNNIQGIATPIPQASRPTSKKVTKKPRKPAQKKKTKK
                     ELELERKEKADQEKQQKKQLEEKQRLQYSLLEKKFKEEYKAKLAKLPKKYKRTLIRNY
                     EPASKIIEHFNGYDINYISQIGEKIESNKPIFLFAPELGTIRVEALNLSLQSNNLSEV
                     NTALNTLLVVSADSLLQISLDQYPELLNSICLLGINLMYDLGSIRDGKDAKEIRKKTT
                     FTDNYLDEYDVKSFISSKTSSYSRNNQRVDEIFEQYLKQLQDNDKEEDKNQSEIEKVF
                     KIKVDSLTGQDLEQIPVMPTPAHTPVQDGTQPKKPWENVSITENHDGNDIEIVDETKQ
                     SKKSTLVKLVPTSPKYRGNKPHNLNVPSYLTSLRNVRDELDTIFTKATTRGAENIRVL
                     INDQLSMISMILRNLSFSESNSKLLAKNQFLKRYISDMLWIVFSEPELFLFHRKCLNF
                     KKDILIIFTNIAHLFELDSPIDSFLFLMLMFSFGEPKKLRKNDISSDQLSYSEYSLNW
                     GRYNSFGVDILAKFLSLNKPNRLFFKAILLDEFDTNEFGKYHRDTQIVKSLINNYNSG
                     DEFKLRNDLFSFLFSVIPFQQLNSNPTIFEAELPTISQTLLSLLEVLRFDDESSNSMK
                     KNLPLIWLKSNENIGLHLRRLSDFINTVSLNAQEFNLLHLQEFLPMLSARCIELLRTL
                     IERSIQLSQSNTSLNENINNELLTINNLLPKESDFFMIVSNPLIDERLVKQTRILYHL
                     TKRILSKCTTV"
     gene            complement(<701736..>702689)
                     /gene="NDAI0E03260"
                     /locus_tag="NDAI_0E03260"
                     /db_xref="GeneID:11498721"
     mRNA            complement(<701736..>702689)
                     /gene="NDAI0E03260"
                     /locus_tag="NDAI_0E03260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670338.1"
                     /db_xref="GeneID:11498721"
     CDS             complement(701736..702689)
                     /gene="NDAI0E03260"
                     /locus_tag="NDAI_0E03260"
                     /inference="similar to DNA sequence:INSDC:YDL209C"
                     /note="similar to Saccharomyces cerevisiae CWC2 (YDL209C);
                     ancestral locus Anc_8.466"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670386.1"
                     /db_xref="GeneID:11498721"
                     /db_xref="GOA:G0WBM3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G0WBM3"
                     /translation="MSWKNRSAKIQVKESDLPSSIPLQNGLTFNVWYNKWSQGTSNGH
                     DRFVNPYRLEPNVHSGRTLGDKEDNCFFCLYFAKGMCCLGKKCTYLHHIPDEEDYRKL
                     SLKSDILDCFGREKFGEYRDDMGGVGSFRKRNRTLYIGGLSGAFNNKELKPSQIESRI
                     RFVFGRLGDIESIRYIEAKNCGFVKYKYQCNAEFAKEVMSNQTLLLPNDKEWDSRKEG
                     AGLLVKWANDDPDPEARRREAENQKRETLKMMTELVENHEMKQNIQAKGERMHSNTSL
                     AITNEDEGLIFTKDILRQVQAKMQRKRRDPVVRPSSGKITR"
     gene            <703001..>704662
                     /gene="NDAI0E03270"
                     /locus_tag="NDAI_0E03270"
                     /db_xref="GeneID:11498722"
     mRNA            <703001..>704662
                     /gene="NDAI0E03270"
                     /locus_tag="NDAI_0E03270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670339.1"
                     /db_xref="GeneID:11498722"
     CDS             703001..704662
                     /gene="NDAI0E03270"
                     /locus_tag="NDAI_0E03270"
                     /inference="similar to DNA sequence:INSDC:YDL207W"
                     /note="similar to Saccharomyces cerevisiae GLE1 (YDL207W);
                     ancestral locus Anc_8.460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670387.1"
                     /db_xref="GeneID:11498722"
                     /db_xref="GOA:G0WBM4"
                     /db_xref="InterPro:IPR012476"
                     /db_xref="UniProtKB/TrEMBL:G0WBM4"
                     /translation="MKFSFDDLVDQFDLNSDIESQDHQLATSPNSSIISEDNSLFPSF
                     SLLKTKNQNVDQVQAEKQLKLDDKILDMLSSLDFKDKLVDPLAYEPFSVSFKNKRSQQ
                     PYIFENEPLDEADDYNEKHVTKALQDSIDSRWKKLEIANLKQINTIKEEKRRIEEERL
                     RLERERRAREEEEARRKAAEEEERKRRLQLEEEERIRKQKEEEEAKRKAAQEEEARLK
                     RIEEEAKRKEEENKQKKEAEAKAEAQLLEEQERKKIQQNKTDFKSIEKTFWKYKERIA
                     IIKKDIVEPMKNANKELRNIISRHKRKINPKFGQLTNSNQQLISIQTELIELINETKS
                     DQLAYQWILNFIAKAIVHQAETEVRVKPESAIPLGKLTLTLLVRFPELKTLLVARFVK
                     KCPYVIGFTCEIDTEKGRENMGWKRNSEQKWEDDTSYDERMAGMTTLFFVITRLPLSQ
                     DLITSFSHPLPIIYSWQFLARMANTPIDLLTNTHFVVIGAWWDAAAAQFLQAYSNQST
                     KLLQLIARDLTDAVASKKFVGAARLRILLEEWEMGQMKSFPEMTA"
     gene            <705245..>707539
                     /gene="NDAI0E03280"
                     /locus_tag="NDAI_0E03280"
                     /db_xref="GeneID:11498723"
     mRNA            <705245..>707539
                     /gene="NDAI0E03280"
                     /locus_tag="NDAI_0E03280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670340.1"
                     /db_xref="GeneID:11498723"
     CDS             705245..707539
                     /gene="NDAI0E03280"
                     /locus_tag="NDAI_0E03280"
                     /inference="similar to DNA sequence:INSDC:YDL206W"
                     /note="similar to Saccharomyces cerevisiae YDL206W;
                     ancestral locus Anc_8.458"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670388.1"
                     /db_xref="GeneID:11498723"
                     /db_xref="GOA:G0WBM5"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="UniProtKB/TrEMBL:G0WBM5"
                     /translation="MINLKRWLVLLVFYTANVLIFILSWNDQSNSNIWKYYIDPIILI
                     SYFITLALITTDCLTPSLSYVSKEILYISDRVSGMTLLALGNAIPDITSTYQSMNSGV
                     PSLAFGELIGGIFFLVTVVIGLMGITGDIHLMPKNIGNQENDIEVGQEVDSCWENDST
                     LVYERDMYIQDTLTFSIMIFLSGIFLSNGELKLWECVLMVMLYCGYICKLIFFNYKYC
                     SNVELWSSSSLSSSLSSSLSVGSPSYFPQPLETSSSLHLDTMNNNNLETFRCDTEDLA
                     QSIHDHEIDNIAKFNEGIASRREQIKKRIRKYLRSNYHGWVKMSLDDCLNIWENQRLF
                     ENEVSLLEKKFENEDGELSSLLQKRRTVSFQEMSLNTKVSPVLTTRYQTQNNENNRSI
                     HGIEQENAMDNVASNPNPDLLKLPVAKTQCKFLSCDHIPITMSNDYNTMTNDEHSLFF
                     HPSDSKISFTHETIGLIPNVSRSVKLLNYLNDAPFSCSISRSEFSTLLITTPISLILA
                     LLIPSLYNKDKNVDGGTKINQIAGFQLIRLSLSPIIGKFLLTETLEWQDLKILIPMSV
                     ILFGLLLLIFCKYNGDDEERRRKVDGKIISILGFILSILMISFIVRRVVELLIKWMET
                     FQISETILGLTIFAWGNSVGDLVSNITFIKIGVVDIALGACFGSPLLYFLFGVGIDGI
                     LIMIKKQDKVGDEIMRNFWMNSILFEVDFNLILSCVGILISFFVFIVIVPLNHWKIDK
                     SVGCVLLLIYFMVMGANIYFEGRS"
     gap             707582..707601
                     /estimated_length=20
     gene            complement(<707903..>708919)
                     /gene="NDAI0E03290"
                     /locus_tag="NDAI_0E03290"
                     /db_xref="GeneID:11498724"
     mRNA            complement(<707903..>708919)
                     /gene="NDAI0E03290"
                     /locus_tag="NDAI_0E03290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670341.1"
                     /db_xref="GeneID:11498724"
     CDS             complement(707903..708919)
                     /gene="NDAI0E03290"
                     /locus_tag="NDAI_0E03290"
                     /inference="similar to DNA sequence:INSDC:YDL205C"
                     /note="similar to Saccharomyces cerevisiae HEM3 (YDL205C);
                     ancestral locus Anc_8.456"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670389.1"
                     /db_xref="GeneID:11498724"
                     /db_xref="GOA:G0WBM6"
                     /db_xref="InterPro:IPR000860"
                     /db_xref="InterPro:IPR022417"
                     /db_xref="InterPro:IPR022418"
                     /db_xref="InterPro:IPR022419"
                     /db_xref="UniProtKB/TrEMBL:G0WBM6"
                     /translation="MSSSSTTVPKPKQLSIKIGGRRSKLAVAQSETIQKLILSKFPDA
                     ECPIFSTQTLGDQIQFKPLFSFGGKALWTKELEDKLYHDDPQERLDLIVHSLKDMPTL
                     LPDGFQLGCITERSDPQDCLVMPLGSPYNSLNDLPDGAIVGTSSVRRSAQLKRKFPTL
                     VYKSIRGNIHTRLDKLDDPQNEFQCIILAAAGLIRMGLSHRITQKFDSETMYHAVGQG
                     ALGIEIRKNDDRMMGILKEISHLETTVCCLAERSLMRTLEGGCSVPIGVESNYDKDSK
                     LLILKGIVIDVEGKTAVEDSHQMVINDVERDTIECGKILAEKMIHNGAKKILDEINLD
                     RVIQ"
     gap             709706..709807
                     /estimated_length=102
     gene            <710585..>711532
                     /gene="NDAI0E03300"
                     /locus_tag="NDAI_0E03300"
                     /db_xref="GeneID:11498725"
     mRNA            <710585..>711532
                     /gene="NDAI0E03300"
                     /locus_tag="NDAI_0E03300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670342.1"
                     /db_xref="GeneID:11498725"
     CDS             710585..711532
                     /gene="NDAI0E03300"
                     /locus_tag="NDAI_0E03300"
                     /inference="similar to DNA sequence:INSDC:YDL204W,YDR233C"
                     /note="similar to Saccharomyces cerevisiae RTN2 (YDL204W)
                     and RTN1 (YDR233C); ancestral locus Anc_8.454"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670390.1"
                     /db_xref="GeneID:11498725"
                     /db_xref="GOA:G0WBM7"
                     /db_xref="InterPro:IPR003388"
                     /db_xref="UniProtKB/TrEMBL:G0WBM7"
                     /translation="MDQSHSLLNRGPQDTRPPNFRTNNRENSNIVDSPHIIQNLVYWK
                     NPKNTLKVFSSILFSLIIFKLFNFFTLSLRVIYSILFISSLAEFITKLTLGRGLVTSI
                     SPLREIKSKNEAVSTLHSENSKLEKYFKFIWDSNILPECQLYMTSIIFAKSPRKTFAF
                     ALSFYILHKIAKLVSIWWCIFISVWSIFTVPFIFSKFQREIDQTIEKGLNYTKSKGKA
                     IVGETQEIPRTYMEKVDNKLNELVQENGNGNGKGNGKGNGKGNGKGTEQHKENPTHGL
                     MNSELASELETRPFAKEPVFEKEVVFEKEPAFERYGVRD"
     gene            complement(<711747..>713471)
                     /gene="NDAI0E03310"
                     /locus_tag="NDAI_0E03310"
                     /db_xref="GeneID:11498726"
     mRNA            complement(<711747..>713471)
                     /gene="NDAI0E03310"
                     /locus_tag="NDAI_0E03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670343.1"
                     /db_xref="GeneID:11498726"
     CDS             complement(711747..713471)
                     /gene="NDAI0E03310"
                     /locus_tag="NDAI_0E03310"
                     /inference="similar to DNA sequence:INSDC:YDL203C"
                     /note="similar to Saccharomyces cerevisiae YDL203C;
                     ancestral locus Anc_8.452"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670391.1"
                     /db_xref="GeneID:11498726"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G0WBM8"
                     /translation="MYQTSYNLPKSRQGQDGEQLGQDPYQKHINLYPRQQQQMQQEQT
                     PQRIQLQISSTDNSEQLQPKRAPYPTLEPQRQPQQQPRMVRLDSNPINDPIMNEIMKP
                     NPPVTLQSNFSASASSLSLQLNNLTLDNNNNNNNNGNATSTSNSQRMNLPFVDTNANS
                     RPSQTLDTKNANINNATNIKRKEECPSSPPDEYSEDAKYFFNLHKQIIQDSLNFIPNL
                     QMKWCETLLIYAFKDDFVSNYNINAQKFTRVLKPEEILTNKKIILEHAFKLLTKLIQL
                     KHAQAIYLMATLYSHQPYLIEIKSNLKSIITKNDAKALDYYIKASNLNHAEATYRTAI
                     CYEFQKGTPNDMLIEESLDLSFKYYLHGAQDLNLSSCKYKLGLAYLYGLNNNVLVVPL
                     DINKAIYWFEKASTSQSCYELGKIYEFDSLPIQIRQELMSDQHEDDTKRKIRQDYKKA
                     LYYYSKCAQDESMNGFNYPLAQWKLGHCYEFGELNCSIDSKKSIAWYYKAATNKVKPN
                     SMAMIALAGWYLTGAEGVLLPNFNESFNWIYKSYQLNDGKKLLGMNSYWVIIYLMVLV
                     VMKINNQV"
     gene            <714003..>714830
                     /gene="NDAI0E03320"
                     /locus_tag="NDAI_0E03320"
                     /db_xref="GeneID:11498727"
     mRNA            <714003..>714830
                     /gene="NDAI0E03320"
                     /locus_tag="NDAI_0E03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670344.1"
                     /db_xref="GeneID:11498727"
     CDS             714003..714830
                     /gene="NDAI0E03320"
                     /locus_tag="NDAI_0E03320"
                     /inference="similar to DNA sequence:INSDC:YDL202W"
                     /note="similar to Saccharomyces cerevisiae MRPL11
                     (YDL202W); ancestral locus Anc_8.449"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670392.1"
                     /db_xref="GeneID:11498727"
                     /db_xref="GOA:G0WBM9"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="UniProtKB/TrEMBL:G0WBM9"
                     /translation="MSILSIPGLSVIHKNSMTMAPLALSPISSLLLFKSGSGPTGSKS
                     YATTTTQDVTKNIKGKKKFKKESKQQRVTVKPLNSRKTFLIDYYKHLMESNSVILFLH
                     YNNLLKQEDHFFRAQVKQTGGTLTKIRNRLFQVYLKNSKREDPCAPLNGDKCQLLTNH
                     PLLPIFKGPTAAITFKESIPVNILKLSKVLEKAKSQDKLFIIGAQIDGQTFTLKDIKD
                     YQMLPSKEQLNVQLVQILQSLSGVSLVQLLQSAPVGLVSNLESHVNNKPSSSSEGKP"
     gene            <715072..>715953
                     /gene="NDAI0E03330"
                     /locus_tag="NDAI_0E03330"
                     /db_xref="GeneID:11498728"
     mRNA            <715072..>715953
                     /gene="NDAI0E03330"
                     /locus_tag="NDAI_0E03330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670345.1"
                     /db_xref="GeneID:11498728"
     CDS             715072..715953
                     /gene="NDAI0E03330"
                     /locus_tag="NDAI_0E03330"
                     /inference="similar to DNA sequence:INSDC:YDL201W"
                     /note="similar to Saccharomyces cerevisiae TRM8 (YDL201W);
                     ancestral locus Anc_8.448"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670393.1"
                     /db_xref="GeneID:11498728"
                     /db_xref="GOA:G0WBN0"
                     /db_xref="InterPro:IPR003358"
                     /db_xref="InterPro:IPR025763"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0WBN0"
                     /translation="MKTKPLSQDPGSKRYAYRVNKEENRKELKHVKIDETTLPKKSNG
                     KKSSLMELPKKRFYRQRAHSNPFSDHQLEYPKSPSDMDWSRLYPYYKDESTGKMTNKV
                     TIADIGCGFGGLLIDLSPKFPQDLILGMEIRVQVTNYVEDRIIALRNNNVTKQGYQNI
                     NVLRGNAMKFLPNFFEKGQLNKMFFCFPDPHFKQRKHKARIVTTTLLSEYAYVLKEGE
                     GVVYTITDVEDLHLWMVKHLEAHPLFERLDEEWEKNDECVQIMRNATEEGKKVERKKG
                     AKYIACFRRISNPEIII"
     gene            complement(<716052..>716618)
                     /gene="NDAI0E03340"
                     /locus_tag="NDAI_0E03340"
                     /db_xref="GeneID:11498729"
     mRNA            complement(<716052..>716618)
                     /gene="NDAI0E03340"
                     /locus_tag="NDAI_0E03340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670346.1"
                     /db_xref="GeneID:11498729"
     CDS             complement(716052..716618)
                     /gene="NDAI0E03340"
                     /locus_tag="NDAI_0E03340"
                     /inference="similar to DNA sequence:INSDC:YDL200C"
                     /note="similar to Saccharomyces cerevisiae MGT1 (YDL200C);
                     ancestral locus Anc_8.447"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670394.1"
                     /db_xref="GeneID:11498729"
                     /db_xref="GOA:G0WBN1"
                     /db_xref="InterPro:IPR001497"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014048"
                     /db_xref="UniProtKB/TrEMBL:G0WBN1"
                     /translation="MSKLLYTFVETALTNALIIFREQSQKLVYASLGSQKDVLLKIAE
                     QDFETLSKITKVKYLLDECTEGEKEWIWLEPLREEYTDFMENLGSYEFDKLEIEYLFG
                     TTLQRQIWDEMRKIKPGMTISYGEIAKKINKPKASRAVGRGCGFNKIALIVPCHRVIG
                     SSGKLTGYRWSIVLKKRLLAKEANYRSL"
     gene            complement(<716916..>717425)
                     /gene="NDAI0E03350"
                     /locus_tag="NDAI_0E03350"
                     /db_xref="GeneID:11498730"
     mRNA            complement(<716916..>717425)
                     /gene="NDAI0E03350"
                     /locus_tag="NDAI_0E03350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670347.1"
                     /db_xref="GeneID:11498730"
     CDS             complement(716916..717425)
                     /gene="NDAI0E03350"
                     /locus_tag="NDAI_0E03350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670395.1"
                     /db_xref="GeneID:11498730"
                     /db_xref="UniProtKB/TrEMBL:G0WBN2"
                     /translation="MKVSTILLSSSILMGSISAADSTSGGWVGHTHDSAHAASASSYW
                     AAHSTDPSVAAKHSKYESWLSYSSASAASVKKAVSSSTSGGWVGHTHDSAHAASASSY
                     WAAHSTDPSVASKHSQYESWLTSSSISAKSASSASKASSESANEGVRGDCFKGAFAAT
                     IVGFLSMLL"
     gene            <718583..>718849
                     /gene="NDAI0E03360"
                     /locus_tag="NDAI_0E03360"
                     /db_xref="GeneID:11498731"
     mRNA            <718583..>718849
                     /gene="NDAI0E03360"
                     /locus_tag="NDAI_0E03360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670348.1"
                     /db_xref="GeneID:11498731"
     CDS             718583..718849
                     /gene="NDAI0E03360"
                     /locus_tag="NDAI_0E03360"
                     /inference="similar to DNA sequence:INSDC:YER146W"
                     /note="similar to Saccharomyces cerevisiae LSM5 (YER146W);
                     ancestral locus Anc_8.192"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670396.1"
                     /db_xref="GeneID:11498731"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:G0WBN3"
                     /translation="MSLLPDVLPLEVIDKTINQPVWIILQSQREFTGTLIGFDDFVNV
                     IIEDAVEWVLNEEGEDEMIMTHHGRMLLSGNTIAMLVPGGKKNA"
     gene            complement(<719111..>721042)
                     /gene="NDAI0E03370"
                     /locus_tag="NDAI_0E03370"
                     /db_xref="GeneID:11498732"
     mRNA            complement(<719111..>721042)
                     /gene="NDAI0E03370"
                     /locus_tag="NDAI_0E03370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670349.1"
                     /db_xref="GeneID:11498732"
     CDS             complement(719111..721042)
                     /gene="NDAI0E03370"
                     /locus_tag="NDAI_0E03370"
                     /inference="similar to DNA sequence:INSDC:YER147C"
                     /note="similar to Saccharomyces cerevisiae SCC4 (YER147C);
                     ancestral locus Anc_8.196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670397.1"
                     /db_xref="GeneID:11498732"
                     /db_xref="InterPro:IPR019440"
                     /db_xref="UniProtKB/TrEMBL:G0WBN4"
                     /translation="MSSLTSLPPNEVYTLSQEYFGNATQLLQSGAIQSETALNEYYTL
                     VQMGIYCLQLLKKNPTITIEQDIHATFKLIDVLYNDTNNLDLVETYAQSMLKKLQNYN
                     GGTETLEWKLRCQFVLIYLVPFKKDVKLHYKIALKNCRELCLYLKQLQAATYSTSAWQ
                     CLFEFIQWTLLCKVKSKKVNNSLDLNIAIMEGVTKDWEAFVRLSYANYLLVKRADLPD
                     GILQDENDSTWWSGVDYRLYAWNLVLGLIVLIYRDENITNKLNEIGDFFKKNKTQLTF
                     SDTLEMTVNPDLRLLIDLPSVFDYKNIKNVLLLLQSVSYLINCYDEKANFSKIFLPKV
                     AKTTERIIKSLMKGSTSLSINDLNESYKWQNDILKMCSFFQNWETLILNPTDLMNSIL
                     TKQEQNDEMGIENSLLLNSICNHLDTKDNNMTSTLAQYQEIINKKTTKNEIKMFALLN
                     SYAILTSLVSKNISVQENIERSNLITEKMENLFAQTDLKFNPIWHCTLTILWIMCHLE
                     PFTGTPLPSTEEQRNAYLTILKQYYNSNKIIPNNSDNNDETLENPNRTQFKLKKSLLL
                     QILLNYIGGRLFETDLQTICSISSTLFHISKKQPMASIRYVMGLWHLMNSTIAMNAKE
                     ATLTKAKLENIVAKLQKNS"
     gene            <721443..>722237
                     /gene="NDAI0E03380"
                     /locus_tag="NDAI_0E03380"
                     /db_xref="GeneID:11498733"
     mRNA            <721443..>722237
                     /gene="NDAI0E03380"
                     /locus_tag="NDAI_0E03380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670350.1"
                     /db_xref="GeneID:11498733"
     CDS             721443..722237
                     /gene="NDAI0E03380"
                     /locus_tag="NDAI_0E03380"
                     /inference="similar to DNA sequence:INSDC:YER148W"
                     /note="similar to Saccharomyces cerevisiae SPT15
                     (YER148W); ancestral locus Anc_8.197"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670398.1"
                     /db_xref="GeneID:11498733"
                     /db_xref="GOA:G0WBN5"
                     /db_xref="InterPro:IPR000814"
                     /db_xref="InterPro:IPR012295"
                     /db_xref="UniProtKB/TrEMBL:G0WBN5"
                     /translation="MSEQGDRLKEFQDANKIVFDPNTRQVWENQNNNTGTINDTNGGI
                     ASNTTAKIEGPEPGSMEEAQQQQLAKQEQEQEEEDDNSATSGIVPTLQNIVATVNLGC
                     RLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLAS
                     RKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLI
                     YRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM"
     gene            complement(<722785..>723687)
                     /gene="NDAI0E03390"
                     /locus_tag="NDAI_0E03390"
                     /db_xref="GeneID:11498734"
     mRNA            complement(<722785..>723687)
                     /gene="NDAI0E03390"
                     /locus_tag="NDAI_0E03390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670351.1"
                     /db_xref="GeneID:11498734"
     CDS             complement(722785..723687)
                     /gene="NDAI0E03390"
                     /locus_tag="NDAI_0E03390"
                     /inference="similar to DNA sequence:INSDC:YDL198C"
                     /note="similar to Saccharomyces cerevisiae GGC1 (YDL198C);
                     ancestral locus Anc_8.445"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670399.1"
                     /db_xref="GeneID:11498734"
                     /db_xref="GOA:G0WBN6"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G0WBN6"
                     /translation="MSSNDKKQSGVARLLGSASAGILEIGVFHPVDTISKRLMSNHTK
                     IVSGKELNKVIFRDHFSEPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNK
                     HYKKDFDNAFGEKTGKALRSATAGSIIGIGEIILLPLDVLKIKRQTNPEAFKGRGFVK
                     ILKDEGLFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSEATWTQNFISSI
                     VGASSSLIVSAPLDVIKTRIQNRSFDNPESGLKIVKNTFKNEGFTAFFKGLTPKLLTT
                     GPKLVFSFALAQSLIPKFDQLLSK"
     gene            complement(<724039..>727341)
                     /gene="NDAI0E03400"
                     /locus_tag="NDAI_0E03400"
                     /db_xref="GeneID:11498735"
     mRNA            complement(<724039..>727341)
                     /gene="NDAI0E03400"
                     /locus_tag="NDAI_0E03400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670352.1"
                     /db_xref="GeneID:11498735"
     CDS             complement(724039..727341)
                     /gene="NDAI0E03400"
                     /locus_tag="NDAI_0E03400"
                     /inference="similar to DNA sequence:INSDC:YDL197C"
                     /note="similar to Saccharomyces cerevisiae ASF2 (YDL197C);
                     ancestral locus Anc_8.443"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670400.1"
                     /db_xref="GeneID:11498735"
                     /db_xref="UniProtKB/TrEMBL:G0WBN7"
                     /translation="MDSKKATKRKRNEDLYYDSSDDDSKSGGGAAGVGAEENGITISK
                     KRSKSSKKKLKKYMHHWETLETNYKKLISQMELKLIHFEKNEIFLKNHVNDLSDQLIN
                     DQIRLASLFGKVKQLKDQNFDLVTLQDFLFNDISNENRKVRNLQLLHEASITSDDDEN
                     DDENDNQMHQTMVKEVGNAESIDLTNEVFSPEAESQNATDVTDVTESEEESVDETSAK
                     EHRRITAAEDKKLILSLRTRIAELESKPEETDINIKNKLLELKQELLDKLRDSEFQQE
                     SLQSTLDEVNKYDVVKNLTIMEENPLMKRVRNKLTLLNEELREIRLARQTDLDNFKLL
                     INKEKKTSHDLTKQLDDSEKYLKKCQDYVAKCNVILGQYKTTIKEQQQKLDAMKQQQS
                     QQQQQQQQQQQQQQQQQLLEQNQLVQLQEPEKIQTPAKQGIEILQGNNQFLPQPGNNQ
                     QLPQTQVPHVDIQSIQSNKGLSLQKVNELQEQQRPQTNQVQTLPTSISSNQTQSGQHV
                     IPTFQQTQQTQLTNRQLPQHTDWIHNNTPPVQQPQQLHGDQTLESQGIKQSNLPYSGQ
                     ILLSNDPITINTAHYSKEELGETLYQVINGYRTAIQTNQAQVYQIDALKKELEMTRYG
                     WTISQDTINKQREEIMDLKQRTLEPNNDEIKKQVELLKKKITHDNKKFKENYKHLLVK
                     QSLETMRKIESFIKSKLISNIEKKFQVFEATSNNRNQQKYRKALTFLKYNIEHIHVVQ
                     LPNIPSHSIPVITNANIASSRSLSEPHSAQAHPQNLTNSTLPPDVSKNTDLNGSELIG
                     QPQDNDAVITIPTEVLAKWTQKVSPNKNNVDPATPYNKDTIDGHSSQDSRLKGISGSG
                     NKSNLTNGASFSLHTQQNNNKLSTTFKDRDTFNLYNNNLSNHQNPFQQVIKKSSQSSG
                     RLQRLHEFKPPKQNKNTTKARFIPLTGEKFRNISLDNTSKKDTSKDSTLPGNKPTRTT
                     SLSLSEILNEDENKSRNNGQQRPNEDMEEIVRHNPSIIMTPEPIKEDQGVEPTAKSTE
                     SKSTENTGSSSKDTPSTVKGQALEENNQQTKTDKNTSTERMIKLNPSIIMTPVPHQKE
                     STPGSNDKEHSL"
     gene            complement(<727872..>729833)
                     /gene="NDAI0E03410"
                     /locus_tag="NDAI_0E03410"
                     /db_xref="GeneID:11498736"
     mRNA            complement(<727872..>729833)
                     /gene="NDAI0E03410"
                     /locus_tag="NDAI_0E03410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670353.1"
                     /db_xref="GeneID:11498736"
     CDS             complement(727872..729833)
                     /gene="NDAI0E03410"
                     /locus_tag="NDAI_0E03410"
                     /inference="similar to DNA sequence:INSDC:YDR227W"
                     /note="similar to Saccharomyces cerevisiae SIR4 (YDR227W);
                     ancestral locus Anc_8.442"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670401.1"
                     /db_xref="GeneID:11498736"
                     /db_xref="UniProtKB/TrEMBL:G0WBN8"
                     /translation="MSQTDATTKLDANTLDQLRSIRPINPMSDEDQEIENPVTLFFKR
                     EDLYILTKVFPNWQNYAISLTELLTMFQDATNDTEQEQEPEQEHEQEIQQEVQQEIQK
                     EKPVQQQVLETNAAPEPKTTTKINADNTPQKEPSIQEPTITKDITKESELQKQQPNEQ
                     IPEQPQPIPRQQEAIQQHEPIVSTNTTRVNTSAVMETTTTAAAKTTTTTTTSTPTQTT
                     TKKQETNKHQQTIETPSTNISTASTHNTDTNTKNNNITNNNNDSNKINGTAPSVHTST
                     AVTTTATTSTNTDTDTDTDTKAKPNASKAVIGNDKQIIYQEKLWLIDNNKWPAPSADC
                     NANIYWSKLTTLTITNMENLDYISTFDMEKYLLDMTNFWIDQTQIWIDQLKDISPNRA
                     TSFIMFAADFENSFEELKLNQLLTLKSFNNSMKKTMKNIPLYEAENIFLTIILKSLFP
                     DIVDMSLPAYVNWELVKKTFVKINVPIVLQTILHDFKLNSWTRETHIRTWINKINAFN
                     QFERKPPIPNEIIKRELLNSFEEYYQGKYREWSRQYRNVGTPLDKVIQRIDLISYTNQ
                     IQNKIRDPNHNSITRSIGDSPTKRSNSLINTNAYSHSIPSTPVHNSDMNLKNVNRQTT
                     SYEGNNNNNNNNVNTSPKSETSPSTEYYI"
     gene            <730738..>734016
                     /gene="NDAI0E03420"
                     /locus_tag="NDAI_0E03420"
                     /db_xref="GeneID:11498737"
     mRNA            <730738..>734016
                     /gene="NDAI0E03420"
                     /locus_tag="NDAI_0E03420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670354.1"
                     /db_xref="GeneID:11498737"
     CDS             730738..734016
                     /gene="NDAI0E03420"
                     /locus_tag="NDAI_0E03420"
                     /inference="similar to DNA sequence:INSDC:YLR219W"
                     /note="similar to Saccharomyces cerevisiae MSC3 (YLR219W);
                     ancestral locus Anc_8.440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670402.1"
                     /db_xref="GeneID:11498737"
                     /db_xref="UniProtKB/TrEMBL:G0WBN9"
                     /translation="MVFGLTRKENRVPDLSRYDYYYQNKQDYNKSSQLSADAAYAASS
                     AQSSPPPPIAYTNSNQLRSSTPSTVNRRSRRNTVINNNNNNNRNSNITSRNNVRKANS
                     MVNYSSNPLRKQQQLQQQPQLPHSNSTRSVRNSAIPNTKRITNVNPVSKTPQKRQSVR
                     KNSTTRKISSNNNTTTNAVTNRNSNKTYSLKSQISFDSPRTKKNINTNTDTDTDTDTN
                     TNNIPTKKIINNNTRRINSLTTATTSQKQLQNNHQRRTNSLTLSKKQQENNSSSRTNS
                     ITIKTTKVLDPSGRTKSITKKTIKKIDGNEYIIETTTTTTTTTKKKKKPNNNYHFDHF
                     SDNFVDDYNEDLIEELNNNNSNQLDDEDDIDQSFLDPRIENIILANDSTSPQIQEIPE
                     EDEDEDIIELSENNNDQEYYDDYVENEDHDDESEVDYIEEEENPEEQVEQIDNKIDEF
                     VSNNFTYDYDNPYLDDINESPTLTPSESTNPAQFEWKIQTPYSELQTPKRIKTSGSLV
                     KLDETSSMSKFDDALDYIPTKSITTTKDQHPTSPMEKLTSPNRFKATKIISTPTKISN
                     TTTVEGYNNNNKNNNVDYPLNKRKSKGINKEKTTVINTPTATAPPPPPPPPSQASLTA
                     HMKNKTPRSASFSIPKAPSSQNSNQKTKQPLTEEEMYAHALKAAEKIVYKDRIASPIS
                     QQSGKGKTSNMGQRMTLRSPSDNNNNTNTNNQALMDIMNSPPHPSQPPPKNKLAALFH
                     KTKSHSRNSSIDQPTIVTTQPPVVVQSHTSPRTSNNSMQRNIPSVNTTSEETNNKTMK
                     KKKKPLSDEEMYAQALKITRKRYLDSHGIVEPDQDNGSSHEDNISHSNKTIARGNVPE
                     QSSTITHGIITASRPNEPEFEETTSSTIMEQPQPITPPTTSSNSATPPTTAAVLPQST
                     TSKPSTKNKSKFHDLMDKVVQFSVENSGYQPPREEKLKMKQSERQNEEQLIHDQVISS
                     IQNPTIPTQKVNSINNTIGPADGHEQPQQGGINEEELGNTIMPLNVPLTNPAATDSVS
                     SFQKTKSESKSMFTMNSKKSNKKSNNNDIAIDDTTKIIKVNTDGSNGTIKKKSVFKKL
                     FNRH"
     gene            complement(<734438..>735079)
                     /gene="NDAI0E03430"
                     /locus_tag="NDAI_0E03430"
                     /db_xref="GeneID:11498738"
     mRNA            complement(<734438..>735079)
                     /gene="NDAI0E03430"
                     /locus_tag="NDAI_0E03430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670355.1"
                     /db_xref="GeneID:11498738"
     CDS             complement(734438..735079)
                     /gene="NDAI0E03430"
                     /locus_tag="NDAI_0E03430"
                     /inference="similar to DNA sequence:INSDC:YLR221C"
                     /note="similar to Saccharomyces cerevisiae RSA3 (YLR221C);
                     ancestral locus Anc_8.436"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670403.1"
                     /db_xref="GeneID:11498738"
                     /db_xref="InterPro:IPR028217"
                     /db_xref="UniProtKB/TrEMBL:G0WBP0"
                     /translation="MSAGDINVIKKNNNKKSRRRKKRRTADVSSDSDSSSSSSSSDNE
                     EIITNDDNVENKDVIVSDVELSDNESSVPMKSEKAAEFLDDETKDRLNNIPFTTTDLT
                     QRSNGQRNQEGTQVDLQKVEEAINDAKLKFSDAINERKSTINGNNTNAEKIENDLKNQ
                     YLGLLFENYGDDINELRTAPDFTTKSLTLLANVLKEGSGMFDVNTLQTILESK"
     gene            complement(<735469..>738042)
                     /gene="NDAI0E03440"
                     /locus_tag="NDAI_0E03440"
                     /db_xref="GeneID:11498739"
     mRNA            complement(<735469..>738042)
                     /gene="NDAI0E03440"
                     /locus_tag="NDAI_0E03440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670356.1"
                     /db_xref="GeneID:11498739"
     CDS             complement(735469..738042)
                     /gene="NDAI0E03440"
                     /locus_tag="NDAI_0E03440"
                     /inference="similar to DNA sequence:INSDC:YLR222C"
                     /note="similar to Saccharomyces cerevisiae UTP13
                     (YLR222C); ancestral locus Anc_8.435"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670404.1"
                     /db_xref="GeneID:11498739"
                     /db_xref="GOA:G0WBP1"
                     /db_xref="InterPro:IPR000772"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR013934"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G0WBP1"
                     /translation="MENKDLKTSYSNQTLRPIYAGTSAIATISQDGSILATPVLDDIE
                     IIKLSPLQERLTTITNNDEQEITCLKLTPDGKFLISIALQSQALKIYNLTAIEGETTM
                     NTKQQSLQPIKTLKLSSPSYIMDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHG
                     GTISSVKFYGNNDTNCWLLCSGDTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVS
                     KENDNVVLQLLSGSRDNIVNLWEFNLRKLCKLLKTLPVNQQVESCGFIHDHDNELQDI
                     IYTAGGEAIFQLISLSKGSVIKRTVKPTEELFIIGTLPFTATNNDLNSYIVMSDQTLQ
                     MINLTKALSPTELSNPIIEIESCIAGNHGTIADMKFVGQDLNKLALATNSPTLRIIPV
                     PSTMKEAADPNTQDNSADLPINMETYEGHTDLLNSLAATEDGQWLATASKDHTSILWK
                     YSSETSRFFAYAKFIGHSSSVTAVGLPNVLLRGYPEFLITASNDLTIKKWKIPTPSKE
                     RSDDESKDKTHIIKVSEYTRHAHDKDINSISISPNDSLIATGSYDKSCKLWNLDSGEL
                     VATLNNHKRGIWDVSFCQFDKLIATCSGDKTIKLWSLDTFAVLKTFAGHTNAVQRCTF
                     INKQKQLVSSGADGLIKIWDCTTGDCLKTLDGHDNRIWALTTWNDGELIVSADADGVL
                     QFWNDCTELEILQNLENEKEKVENEQSLKNFLLNEDWTNAFLLALTLDHPMRLFNVLK
                     QSLLSLQEQEEGADGKIIIFNKELDKIIGKLSNDQLILLLKRCRDWNTNARTHTIAQR
                     TIRCILLQYNIVQLSEIPGLVQIIESIIPYTQRHFDRVDNLVEQSYVLDYALVEMDKL
                     F"
     gene            <738973..>741057
                     /gene="NDAI0E03450"
                     /locus_tag="NDAI_0E03450"
                     /db_xref="GeneID:11498740"
     mRNA            <738973..>741057
                     /gene="NDAI0E03450"
                     /locus_tag="NDAI_0E03450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670357.1"
                     /db_xref="GeneID:11498740"
     CDS             738973..741057
                     /gene="NDAI0E03450"
                     /locus_tag="NDAI_0E03450"
                     /inference="similar to DNA sequence:INSDC:YDR208W"
                     /note="similar to Saccharomyces cerevisiae MSS4 (YDR208W);
                     ancestral locus Anc_8.418"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670405.1"
                     /db_xref="GeneID:11498740"
                     /db_xref="GOA:G0WBP2"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="InterPro:IPR023610"
                     /db_xref="InterPro:IPR027483"
                     /db_xref="InterPro:IPR027484"
                     /db_xref="UniProtKB/TrEMBL:G0WBP2"
                     /translation="MHIIPSNKSNDLTLNLKLTNKGNLPQSTIDDIKDNNNNTKTNIA
                     IYSNVKAHLDDECRNRLHIPSYMTQTNTRTSCSTTLDFDPNNLDSLSITISKHQKDEP
                     KNLKIFQKGVIKNAMPKKKINDPSLSSFISSSPSSSSSSSSSSSNSEKSTKNLLSHVK
                     NLSKIKTTEPFRSKTKQLPAMRRSSLQQVQTHNPQEQKKVVHRRSLPPRRNTQESIAT
                     TIPFFALRHSQIFPLTDDEINHSLQHHQNHDTDELLSAVTSNVSSSMVSTTTTNTTNS
                     EERYPLSTDPEDRYQQNPSHSHDSPSGGKIDNRNSKMRMLGKKVSQGHVNFQIVYDML
                     LGIRVALNSLSPNSSSVLSSRKYKKFIFDSNYEIIEPIQDNYTYSFKFKDYYPTIFQK
                     LRNENFQLNDADYLDSLTSKYILNEFNSPGKSGSFFYFSRDYKYIIKTIHHDEHIHLR
                     NTLLRYYNHLKSNPNTLICQFYGLYRIKFPKRFFRKRKIYFLVMNNVFPPDLAMNVTF
                     DLKGSTWGRFSQTPLQSMPQNDIESSNNDNDDDDNNKMISIVLKDLNWLKNQNRLDFG
                     SHEKNEAILKQLKTDVELLIDMNTMDYSLLIGIHFLESDRTDDKEEDTNDGGNRATFK
                     YNVGDHEKRKCVICYIGIIDCLTNYSMVKKLETIWRSLNHDYKTVSAVPPRFYGNRFY
                     KYVEESIGHIDV"
     gene            741299..741440
                     /gene="NDAI0Etrna11I"
                     /locus_tag="NDAI_0Etrna11I"
                     /db_xref="GeneID:11498607"
     tRNA            join(741299..741336,741404..741440)
                     /gene="NDAI0Etrna11I"
                     /locus_tag="NDAI_0Etrna11I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUA"
                     /db_xref="GeneID:11498607"
     gene            <742144..>744993
                     /gene="NDAI0E03460"
                     /locus_tag="NDAI_0E03460"
                     /db_xref="GeneID:11499082"
     mRNA            <742144..>744993
                     /gene="NDAI0E03460"
                     /locus_tag="NDAI_0E03460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670358.1"
                     /db_xref="GeneID:11499082"
     CDS             742144..744993
                     /gene="NDAI0E03460"
                     /locus_tag="NDAI_0E03460"
                     /inference="similar to DNA sequence:INSDC:YDR213W,YLR228C"
                     /note="similar to Saccharomyces cerevisiae UPC2 (YDR213W)
                     and ECM22 (YLR228C); ancestral locus Anc_8.423"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670406.1"
                     /db_xref="GeneID:11499082"
                     /db_xref="GOA:G0WBP3"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G0WBP3"
                     /translation="MIKSESTTMSLNESTLTATSGNSITKPKPKRREKNIELIEVGGK
                     KVSKTSTGKRKFHNKSKNGCDNCKRRRVKCDESKPHCQKCVNMQLHCVYTPPQPRRSK
                     GRNDTTRKTKSMSGMSDSIMTSTDDNEDESATSPRSVTRTSSFSMNSNDNNNDNNNND
                     NNNNNNNNNNNLNNNQSSDQFVDENDAILTVAEIQRQTIAKLQKQQEEQQKQLQQQLQ
                     QLQQLQHLQQLGVQTTHSTSRASNSISSSSFPLPGSPERQQAELLSNNNNVHTALNGP
                     PLSNTNKTSNSLDGLLLPPLMAGLSNSTVQSQQNSLATRQASSNNNIPFDFANSPGFS
                     GMNLSTSINNILSPNKFNQQQQQQQQQQQQTSSSNPLSALFSNGNLPTDALSQLSKMG
                     LNLKSFNMNSTSALASLASIANPAMISSLANLTNLTSNTSNTNSAGFFDFNDLLSNKY
                     NNSPIAQNNTSGNNRAMKASTAEEVLASMQEHQERLTKNTEEKSNSNDGVNKNDANDA
                     SNSNIPMTTDSNNNANSINNNNNGNTSANSVTPILSSNPLMMPLNSMSPMTKTNSLDL
                     PPIKQLDSNLNNDPAIITSMDSQRNTGLHTSNDSVSSNSSSSSSSVSSTAEKSSSISK
                     ADSTETALIPKLLQLSPKVNLNLIDLKLFHHYCTKVWPTIISAGISGPDVWSTYIPEL
                     AFDYPFLMHSLLAFSATHLSRTETGLDNYVSSHRLDALKLLREAVLNISDDNIDALVA
                     SALILIMDSLANASSSSPTNVNTMSPSAWIFHVKGAVTILTAVWPLPENSRFFNLINV
                     DLSDLGDVINQENGTISELICFDETIADLYPVEIDSPYLITLAYLDKLHREKNQLDFI
                     LRVFAFPALLDKTFLALLMTGDLGAMRIMRSYYKLLRSFTTEIKDKVWFLEGVSQVLP
                     MDVDDYSNGGGMHMMLDFLGGGLPSMTTTNFSEFM"
     gene            <745331..>746827
                     /gene="NDAI0E03470"
                     /locus_tag="NDAI_0E03470"
                     /db_xref="GeneID:11498742"
     mRNA            <745331..>746827
                     /gene="NDAI0E03470"
                     /locus_tag="NDAI_0E03470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670359.1"
                     /db_xref="GeneID:11498742"
     CDS             745331..746827
                     /gene="NDAI0E03470"
                     /locus_tag="NDAI_0E03470"
                     /inference="similar to DNA sequence:INSDC:YLR227C"
                     /note="similar to Saccharomyces cerevisiae ADY4 (YLR227C);
                     ancestral locus Anc_8.427"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670407.1"
                     /db_xref="GeneID:11498742"
                     /db_xref="UniProtKB/TrEMBL:G0WBP4"
                     /translation="MPVPIQPHISKKDPIQYRILVCSFTEEIRTLISRLKKNDRYDQT
                     LYMELLTPVLLMYPMEVIQCIFNNKSYRNKIVKCLGNEINKYPELDLRMGPRRISKTI
                     GKDINSNVKSNHKFLITKINLILIMKGIESFILFFHQEYLESLSSFRWCLQFISYIKR
                     LPFNETEHQYFLKNCNISFAMYCSQCQISDSKRNGTQWPISNYLNTPLNESGILQSLL
                     YIILENTDPSMMMFDKRCSSFEKFFLGKIFQHIGDIYEALAVFNGQRSEYESLDGKTF
                     GLHAANEYVEGMIKNYILAISMKLEGDSTVLYCLDKIIEGLILYGDIHVEIITFFMRL
                     KKYYELYENDDLLIEHLEYDSLTFECLDIARKTFQKWENSKESFKGSVIQMPDTLLRS
                     QRGALVMVKNDITELPGSNIEDGTKKDGKYKREITENLIIRKSRFVKKWNNERHWQKE
                     EKYIKKHWDLGIHWINFWKNCYLENNQLFNRELMTLWADFEGEIAGME"
     gene            complement(<746985..>748274)
                     /gene="NDAI0E03480"
                     /locus_tag="NDAI_0E03480"
                     /db_xref="GeneID:11498743"
     mRNA            complement(<746985..>748274)
                     /gene="NDAI0E03480"
                     /locus_tag="NDAI_0E03480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670360.1"
                     /db_xref="GeneID:11498743"
     CDS             complement(746985..748274)
                     /gene="NDAI0E03480"
                     /locus_tag="NDAI_0E03480"
                     /inference="similar to DNA sequence:INSDC:YLR226W"
                     /note="similar to Saccharomyces cerevisiae BUR2 (YLR226W);
                     ancestral locus Anc_8.429"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670408.1"
                     /db_xref="GeneID:11498743"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:G0WBP5"
                     /translation="MMDSKAATSPSIENYPSTTDEAKKGPIATTTNASANKNLHNSLA
                     RPEPTEPPAKATPTPSFNARLLWPDMIRTPTNRWTFTCKEIIDKLGTDPYKSNEIKKS
                     MEICLMYFYTLKKKLNLFDHTYTASCILFFRYWFIYDLSPNLMDSIHISHAILVTACK
                     IMENNRPIDAYVKATAEFLIQSPKIMGRQQGKNMDKLKWEVRDKLVTNEKVIMCSFGF
                     DLDIENPKEMIEEMFSGYYRFNRDYDLPEEFTKVFPKVLQEARNFIVQAVTQPVSLLC
                     DGYSFIALSLIYCGIQYKNKIDKKFMFPKDFFKNRFPVTVTAQRFNELFTDYRILEDN
                     FFDLKSNKGEKLQISVEAIESIIDEESKHSGDDVLQQSDISSFYEYNLIKSGDVKQKL
                     LDHIGTRVEDLIKKTIAESKKRNSPDSVEPPAKRVNI"
     gene            <749078..>752335
                     /gene="NDAI0E03490"
                     /locus_tag="NDAI_0E03490"
                     /db_xref="GeneID:11498744"
     mRNA            <749078..>752335
                     /gene="NDAI0E03490"
                     /locus_tag="NDAI_0E03490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670361.1"
                     /db_xref="GeneID:11498744"
     CDS             749078..752335
                     /gene="NDAI0E03490"
                     /locus_tag="NDAI_0E03490"
                     /inference="similar to DNA sequence:INSDC:YDR223W,YLR223C"
                     /note="similar to Saccharomyces cerevisiae CRF1 (YDR223W)
                     and IFH1 (YLR223C); ancestral locus Anc_8.434"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670409.1"
                     /db_xref="GeneID:11498744"
                     /db_xref="InterPro:IPR018837"
                     /db_xref="UniProtKB/TrEMBL:G0WBP6"
                     /translation="MVGMKSPRKQVGGKLLANVAKLKQQKSNGNMKKIVRPRRFSLIY
                     SSSSSSNDDDKGDDDDEDSSLSDVSDDGSNDDAFQRRNISSKGKKMSNNSSGKRSKLI
                     QQNKISNKDNNASAIASSSDDNTESSDYEMVQGADDSDEEDDDDDDDDDDDESDTTSS
                     DDENIDFVKLTAQRKKRAMKALSAIKRGEEINDKPVSRNKATETTVSSSSDEEHNGTN
                     YTNNNNNNNNNNNKQEPSSYYSKMNATLQPEPFPTVIVPNEEDIGEEIKSSSKSATPI
                     ETSNKLVLPNMINDNVNQLNAPHFDESDESDESEYDIDQDAYFSILKDDNEQDLINDS
                     SSGDIDTGENDLPMLQEEEENIVSELRNDDELSFDGSIHEEGDDPVDLEMENNLNGAY
                     TNHTDEDDEDEEDDDDEIMTDFDMPFYEDPKFANLNYYEDGSEPRLTLSTSLPLILND
                     EKKSRLQKKQAKRREHEERIKRRKLLRKRLKQKSLEKRSNDLDGDEYIFGVFFQSDNE
                     NEDEKDARMDHIKKSRSADNINNLGKNFALESPLRRLSTAAYSDSDYGISDDDDDEDE
                     DILLNIANIPSENDDDETGDENNDSNSLTSESLYLALDDDDVDDDDDDDSSVTNVFID
                     IDDLDPDSFYFHYNDEGMLSDEEGTELSTENSNSENAADVVEPVEYVDDESTDEDDNL
                     PPPSSRNKNIGSKAKEIVSANVVGLRPPKLGTWETDNKPFSIIDGLSTKSLYALIQEH
                     QQLHEQNQREQSPDISKNNDSNSVSNGDELTLNELLNMSELDDDDDNDTTNHSHTSRG
                     NSDWYTNKPKVPLSAFRNKGVATYERDEYMLPSLSTRKAPIGYVGNERTRRKIDKIKE
                     LQKKKTEKKRLLKKKRKLLKIKREKQRLEKDRISLNNVVPQNDETHVVTLEGTPNHED
                     HDITTDSLPRNHDIELPNDLHALDNLGPITVDIPHSMISRKNSVKSVGLDEIHAILGK
                     DSHDLLDDKNNIHDDGIFNNSQTGITETHIYPDTIDEGDADILASLTAPVRLDDLETG
                     LSSWRRRQSMAEAAAENLRFTKNGLFSESALADIDGIIGTGANTVAIDFNEQDLL"
     gene            <752811..>753536
                     /gene="NDAI0E03500"
                     /locus_tag="NDAI_0E03500"
                     /db_xref="GeneID:11498745"
     mRNA            <752811..>753536
                     /gene="NDAI0E03500"
                     /locus_tag="NDAI_0E03500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670362.1"
                     /db_xref="GeneID:11498745"
     CDS             752811..753536
                     /gene="NDAI0E03500"
                     /locus_tag="NDAI_0E03500"
                     /inference="similar to DNA sequence:INSDC:YBR256C"
                     /note="similar to Saccharomyces cerevisiae RIB5 (YBR256C);
                     ancestral locus Anc_7.181"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670410.1"
                     /db_xref="GeneID:11498745"
                     /db_xref="GOA:G0WBP7"
                     /db_xref="InterPro:IPR001783"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023366"
                     /db_xref="InterPro:IPR026017"
                     /db_xref="UniProtKB/TrEMBL:G0WBP7"
                     /translation="MFTGIVELIGTVQEYNEFDESSSGGQGVSVVIKDAAPILKDCHI
                     GDSIAINGICLTVTEFDVEAGTFKVGISLETIKRTNVSSWKPNSKVNLERAVSQDVRF
                     GGHYVQGHVDTVASIVGIEPEGNAVNYSFQLNQTNDDKKYMNYIVEKGFICIDGTSLT
                     VVSVDDNNAIFSISMIKHTQENVIMPLKGLGDLVNIEVDLTGKIIEKQILMAVENQIE
                     KEDSLLSKMITKIVDKRIQKYLK"
     gene            <755198..>756451
                     /gene="NDAI0E03510"
                     /locus_tag="NDAI_0E03510"
                     /db_xref="GeneID:11498746"
     mRNA            <755198..>756451
                     /gene="NDAI0E03510"
                     /locus_tag="NDAI_0E03510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670363.1"
                     /db_xref="GeneID:11498746"
     CDS             755198..756451
                     /gene="NDAI0E03510"
                     /locus_tag="NDAI_0E03510"
                     /inference="similar to DNA sequence:INSDC:YIR011C"
                     /note="similar to Saccharomyces cerevisiae STS1 (YIR011C);
                     ancestral locus Anc_7.179"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670411.1"
                     /db_xref="GeneID:11498746"
                     /db_xref="GOA:G0WBP8"
                     /db_xref="InterPro:IPR013868"
                     /db_xref="UniProtKB/TrEMBL:G0WBP8"
                     /translation="MVQNNVGFSWGFTSTGGSQPSRKQENNDRVDIKNISLWEDDFRS
                     SLQPSTNATTGVNKSTIYQGNYTNGHPIQGSIRSKRRLVDSEDASNENVSTNTSFSNL
                     YARGTKQPLRYQYSKKPSYSAANNTVTATKKISNTFNAIRSQPLPIQRCLELMDHQQV
                     NDLLNDILNLNNPSLNQFIHTRINSNYNSNFSIEKCSILLKEKFENILKNVPYNKNYY
                     NNAQASENNNNNNNTLLLDDYAFIRLKSFILEFLNSLIDFILNNIPPNFNNVHESLNF
                     LNECTLMVITLPRFQLPSNNYYYDKCIEQLSFIWSTIINELAKDLVMANLNDKEFYLN
                     WLSKLENHNQRTGGMFNQPLKLFKHIDNNDETSAVAGNVTIDNNPFNSNNGNDYVTSR
                     SGNNSNPGSTSNFSSSSFSSPFLNR"
     gene            <756961..>757397
                     /gene="NDAI0E03520"
                     /locus_tag="NDAI_0E03520"
                     /db_xref="GeneID:11498747"
     mRNA            join(<756961..757030,757132..>757397)
                     /gene="NDAI0E03520"
                     /locus_tag="NDAI_0E03520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670364.1"
                     /db_xref="GeneID:11498747"
     CDS             join(756961..757030,757132..757397)
                     /gene="NDAI0E03520"
                     /locus_tag="NDAI_0E03520"
                     /inference="similar to DNA sequence:INSDC:YBR255C-A"
                     /note="similar to Saccharomyces cerevisiae YBR255C-A;
                     ancestral locus Anc_7.178"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670412.1"
                     /db_xref="GeneID:11498747"
                     /db_xref="UniProtKB/TrEMBL:G0WBP9"
                     /translation="MTIGNFQPLRNSDPTTIKRLYKESTAAGLGAIQGSIISGSSTLI
                     FNKYSKFFRNLTFQGKLFYNVALISMNIIFKAEHQVLKFQQKLLLEEDIKRGKLLDKA
                     AENGVFIED"
     gene            complement(<757488..>760043)
                     /gene="NDAI0E03530"
                     /locus_tag="NDAI_0E03530"
                     /db_xref="GeneID:11498748"
     mRNA            complement(<757488..>760043)
                     /gene="NDAI0E03530"
                     /locus_tag="NDAI_0E03530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670365.1"
                     /db_xref="GeneID:11498748"
     CDS             complement(757488..760043)
                     /gene="NDAI0E03530"
                     /locus_tag="NDAI_0E03530"
                     /inference="similar to DNA sequence:INSDC:YBR255W"
                     /note="similar to Saccharomyces cerevisiae YBR255W;
                     ancestral locus Anc_7.177"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670413.1"
                     /db_xref="GeneID:11498748"
                     /db_xref="UniProtKB/TrEMBL:G0WBQ0"
                     /translation="MPPAEHDHEQQRYHQDNEQQQHQIPNSGRIKLVTKVLMDTRTGL
                     MDDLNFINHIPAANLATSANTKKELDFLGNNTFPLPRGSSNTRVPPTTGKTNRTSLGD
                     DYGTGIENIIAASVPTTNIESLEPTVLNIPKSTRIKADRVRIYLDYYYSILERCISID
                     SAEHRHDGVEGVYNPLQVIRNRKVRKKYRGGAPMREISISKAPVIAIVDFSKNYQGKH
                     KAAYVRKRMPWFVDINEKYNDLMWRTSHWDELVDPQGNLWFGDKRGHHHHQGYIHKNH
                     LYPHSTQKKSASKERDERMKSASRSRSRSSSPFKNITKKNAEYEDDKYMKTQQLDMSN
                     KSSLSSSSNNIEKSIDSNSSLKSSISSSALAQKDNPSPSGSLNTEQEKSKLKKPLEKI
                     KKGSKRWLSSNTKIDKQTLSIAQKEQAVHDEDVGPTSIVPPSYVTPKDKDKDTTGLTI
                     LNDIPIKRVKKGTEEQMKKNGVLIPPLATKRSNTKMSSPLGHVGTTNNNNNNNNNNNN
                     NNMGNNMGNNFARRMSVIPSQLDIFEKFLKKKDAEDRYRLQKEKEKGDIINEGEENDE
                     RDRSAAENGEDKDEENDEDDEGLRLEVKNTTPGVSSRSSRSNLEASELNPALQMTNTK
                     DITSNKNRTSESKDNNIKRNNRSNNNKAVNNNLIDDIIINEGSNTFEPIQIDEKLTKY
                     WHDTRYMLCTISIMNHRRVTHEIVKDREIRKRNRIKVEDDAELKISQTNEIIDTYNME
                     LSKVLKIGNDWTSKLLNDYSVRVETLISSSDRILSDINTTLTLKLKLFQENTEKYGNV
                     KIIKSQKMTRLVYRVLELAIVVILWTIWLVVSFFKGIRNIFYFILRVIKLVLW"
     gene            <760333..>761010
                     /gene="NDAI0E03540"
                     /locus_tag="NDAI_0E03540"
                     /db_xref="GeneID:11498749"
     mRNA            <760333..>761010
                     /gene="NDAI0E03540"
                     /locus_tag="NDAI_0E03540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670366.1"
                     /db_xref="GeneID:11498749"
     CDS             760333..761010
                     /gene="NDAI0E03540"
                     /locus_tag="NDAI_0E03540"
                     /inference="similar to DNA sequence:INSDC:YBR254C"
                     /note="similar to Saccharomyces cerevisiae TRS20
                     (YBR254C); ancestral locus Anc_7.176"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670414.1"
                     /db_xref="GeneID:11498749"
                     /db_xref="GOA:G0WBQ1"
                     /db_xref="InterPro:IPR006722"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:G0WBQ1"
                     /translation="MPQYFAIIGTQDNPIYEAEFTNPTSKNASSNEGGFPNDLKELNP
                     FILHAALDVIEDLQWQPNPTVNNANGGGGIGIGYFNSNTSSNSSLNSTGFLKSRTSLG
                     GNNSASDNCYLGKVDHFYGLSITAYLTYNGMKFVMIHGDASKSNTNEKDITFNYNEEI
                     NSKTSNGNRNKAMVPLDDNAIRSFYQEVHELYIKALMNPFYNLNDPINDSSFDMRVRR
                     LAKKYIT"
     gene            complement(<761091..>761492)
                     /gene="NDAI0E03550"
                     /locus_tag="NDAI_0E03550"
                     /db_xref="GeneID:11498750"
     mRNA            complement(<761091..>761492)
                     /gene="NDAI0E03550"
                     /locus_tag="NDAI_0E03550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670367.1"
                     /db_xref="GeneID:11498750"
     CDS             complement(761091..761492)
                     /gene="NDAI0E03550"
                     /locus_tag="NDAI_0E03550"
                     /inference="similar to DNA sequence:INSDC:YBR253W"
                     /note="similar to Saccharomyces cerevisiae SRB6 (YBR253W);
                     ancestral locus Anc_7.174"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670415.1"
                     /db_xref="GeneID:11498750"
                     /db_xref="GOA:G0WBQ2"
                     /db_xref="InterPro:IPR009332"
                     /db_xref="InterPro:IPR016530"
                     /db_xref="UniProtKB/TrEMBL:G0WBQ2"
                     /translation="MNNQALFEKLDQTVELLSLKLAELIRLSSIDNPESANDNIDSGS
                     MNSGMLEAQDSNIAIATTSMTMVYGQTMQLIRGVQDLLVMTRGMREMWLLNQIPDQDK
                     QNDNARSINHEELASLLNTCMQEIIGEPPSL"
     gene            complement(<761808..>762728)
                     /gene="NDAI0E03560"
                     /locus_tag="NDAI_0E03560"
                     /db_xref="GeneID:11498751"
     mRNA            complement(<761808..>762728)
                     /gene="NDAI0E03560"
                     /locus_tag="NDAI_0E03560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670368.1"
                     /db_xref="GeneID:11498751"
     CDS             complement(761808..762728)
                     /gene="NDAI0E03560"
                     /locus_tag="NDAI_0E03560"
                     /inference="similar to DNA sequence:INSDC:YBR251W"
                     /note="similar to Saccharomyces cerevisiae MRPS5
                     (YBR251W); ancestral locus Anc_7.170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670416.1"
                     /db_xref="GeneID:11498751"
                     /db_xref="GOA:G0WBQ3"
                     /db_xref="InterPro:IPR000851"
                     /db_xref="InterPro:IPR005324"
                     /db_xref="InterPro:IPR013810"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:G0WBQ3"
                     /translation="MNNIIWKRTFNTRPMGFLKHYNEDILSKYYSKPLLESIQLAQQV
                     IPEGTTFKRQDNVQIAPVTNPDYSKIDPFWDYKPGTPHAHSFYNNTYKWDAVQQRLPP
                     GGVPVPKGESILLKDSSKLMILARGLKFQNGIDADYISKKLVMKPLVMKRVSNQTRKG
                     KIPSYYSLVVVGDKNGMVGLGEGKSRESMSKSIFKAHWDAVRNLKYVVRYENRTILAD
                     IDHRYHGVKLFLRNARPGFGLRVNHVIFEICECAGIKDLSGKIYKSRNPMNIAKGFLE
                     ALTENQKTVDEIALGRGKKIVDVRKVYYSA"
     gene            complement(<763324..>764082)
                     /gene="NDAI0E03570"
                     /locus_tag="NDAI_0E03570"
                     /db_xref="GeneID:11498752"
     mRNA            complement(<763324..>764082)
                     /gene="NDAI0E03570"
                     /locus_tag="NDAI_0E03570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670369.1"
                     /db_xref="GeneID:11498752"
     CDS             complement(763324..764082)
                     /gene="NDAI0E03570"
                     /locus_tag="NDAI_0E03570"
                     /note="ancestral locus Anc_7.169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670417.1"
                     /db_xref="GeneID:11498752"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:G0WBQ4"
                     /translation="MICSNIPTSSIPRYNGANISFPTYLSKTTSAYSVLPTNTDTRTS
                     FNPYTTTTRSSLSMGSILGPETPPSSRHSSVISSPLTKSPFQPVTNFNVQQQDQQPII
                     NDACSCKKNSHNKHNGSIYSETHIPRPRNAFILFRQHLHHTLFPKEKEMLIKEGSFKA
                     NSQVSRDIGQRWRQLTDEEKKYWQDLAQKEKEWHKKKYPNYKYTPRSKEPSVVGTDGT
                     ISEPKKLRKGKSSPCDFCKSKKKLVVTKKITSRI"
     gene            <769293..>771641
                     /gene="NDAI0E03580"
                     /locus_tag="NDAI_0E03580"
                     /db_xref="GeneID:11498753"
     mRNA            <769293..>771641
                     /gene="NDAI0E03580"
                     /locus_tag="NDAI_0E03580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670370.1"
                     /db_xref="GeneID:11498753"
     CDS             769293..771641
                     /gene="NDAI0E03580"
                     /locus_tag="NDAI_0E03580"
                     /inference="similar to DNA sequence:INSDC:YER017C"
                     /note="similar to Saccharomyces cerevisiae AFG3 (YER017C);
                     ancestral locus Anc_7.168"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670418.1"
                     /db_xref="GeneID:11498753"
                     /db_xref="GOA:G0WBQ5"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR011546"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WBQ5"
                     /translation="MHPFRSALLPRSVPCKPIFPSSVCRVRSSLLIQRSYLSNAIYRD
                     LNSTLNNKIYSRSFHSSPLIQFRISNILLNENTNEDKNNDNEQQKKYSEKEKKDDSKK
                     TSEEYKSMADYFKSKEFMNTIFLTIGFTILFNLMSTSRDSNENKSLTFQDFKSNYLER
                     GLVKKIYVINKYLVEAELHDQSIITGSQPNSMNPFNKHSNVVAFTIGSVDIFEEQMDQ
                     IQDELQIDPKDRIPIVYADRASFLQYLFPFLPTIILLGGLYFITKKMGNPTNGAAGSN
                     GSGGGLGGMFGVGKSRAKLFNKETDVKVSFKNVAGCDEAKVEIMEFVHFLKNPNKYTV
                     LGAKIPRGAILSGPPGTGKTLLAKATAGEAGVPFLSVSGSEFVEMFVGVGASRVRDLF
                     EQARKLAPSIIFIDEIDAIGKERGKGGALGGANDEREATLNQLLVEMDGFSTSDQVVV
                     IAGTNRPDVLDPALLRPGRFDRHIQIDAPDINGRKQIYLVHLKRLNLEEKLVETKEDV
                     ENLAGKLATLTPGFTGADIANACNEAALIAARHKDPFVTIQHFEQAIERVIAGLEKKS
                     RVLSKEEKKTVAYHEAGHAVCGWFLKYADPLLKVSIIPRGQGALGYAQYLPPDQYLIS
                     EEQFQHRMIMALGGRVSEELHFPSVTSGAHDDFKKVTQMANAMVTSLGMSKKVGYVSY
                     DQRDSQFQVNKPFSEKTARNIDTEVKRIVDFAHNKCTQLLSENIEKVDKVAKELLRKE
                     AITREDMIRLLGPRPFPERNEAFEKYLDTAGDDKASPAPEAK"
     gene            complement(<771921..>772862)
                     /gene="NDAI0E03590"
                     /locus_tag="NDAI_0E03590"
                     /db_xref="GeneID:11498754"
     mRNA            complement(<771921..>772862)
                     /gene="NDAI0E03590"
                     /locus_tag="NDAI_0E03590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670371.1"
                     /db_xref="GeneID:11498754"
     CDS             complement(771921..772862)
                     /gene="NDAI0E03590"
                     /locus_tag="NDAI_0E03590"
                     /inference="similar to DNA sequence:INSDC:YER016W"
                     /note="similar to Saccharomyces cerevisiae BIM1 (YER016W);
                     ancestral locus Anc_7.167"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670419.1"
                     /db_xref="GeneID:11498754"
                     /db_xref="GOA:G0WBQ6"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR004953"
                     /db_xref="InterPro:IPR027328"
                     /db_xref="UniProtKB/TrEMBL:G0WBQ6"
                     /translation="MNNIGESRSELLNWLNNILKLNYKKIEECGTGAAYCQIMDSIYN
                     DVPMHRVKFNATAEYDYQINYKILQSCFSRHRIEKTIYVEKLMKCRFQDNLEFLQWSK
                     KFWQQNKDSTEYDPNSRRKYRPNPSAGNSNGPTSNITKRKTSGFGLNNNSSTSLHGGP
                     IVASRSASLGMNRRVSNEQLIVLQTELSQAQGSVQKLKKEIDTYKETVTILERERSFY
                     FGKLRDIEVLVQSTQDLIKEGVYKTETSDLDKFLSKVQQILYATEEGFEVVDEDEKGI
                     AAEEQHNSGQSENDIVNGSNERVEVSNTNLIIDEETF"
     gene            complement(<774520..>776772)
                     /gene="NDAI0E03600"
                     /locus_tag="NDAI_0E03600"
                     /db_xref="GeneID:11498755"
     mRNA            complement(<774520..>776772)
                     /gene="NDAI0E03600"
                     /locus_tag="NDAI_0E03600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670372.1"
                     /db_xref="GeneID:11498755"
     CDS             complement(774520..776772)
                     /gene="NDAI0E03600"
                     /locus_tag="NDAI_0E03600"
                     /inference="similar to DNA sequence:INSDC:YER015W"
                     /note="similar to Saccharomyces cerevisiae FAA2 (YER015W);
                     ancestral locus Anc_7.166"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670420.1"
                     /db_xref="GeneID:11498755"
                     /db_xref="GOA:G0WBQ7"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="UniProtKB/TrEMBL:G0WBQ7"
                     /translation="MSHNKSVNTKDYSITELIDTDPRYEGLKERLSAFRTGSDEYIRE
                     MFNELPLTSWPRYKTFLKEQAVPMLDSNENHSYSPVYRSSLSPNHLITTMDPHLKTFY
                     DHFQFAVRNWPTNDCLGVRTFDPVKNEYSNQYYWESYQTVNDRSQAFGSGLLSLVNTK
                     RGKPLRSNDFIVSILSHNTPEWIIADFACQAYSLTNTALYETLGPQTSEYIMNLTESP
                     VLIFAKSNIYNILRILPKFKHLNTLICTEDLTKEELSLFNTSLLSISENSKNEKISMF
                     SLKQVETIGKLNQIPLIPPNPDSVYTISFTSGTTGLPKGVEMTQRNITSGIAFSMSTF
                     YKVVAKRGQQLHDICFLPLAHIFERMLIAWDLSQGVGLGFLHQPDPTVLVEDLKILKP
                     DAIALVPRILTRFEAGIKNSLDKSTFQKNVANNILDSKVSRFTSRGGPDKSLMNFLVF
                     HRVLIDKIRTSLGLNNASYIVTGSAPISKDTLLFLRSALDIGVRQGYGLTESFAGICL
                     SEPHERDVGSCGAIGISAECRLRSVPEMGYDAAKDLKGELLLRGPQIFSKYFKNPEET
                     SKAIDSNGWFATGDIGFIDGKGRLHIIDRVKNFFKLAHGEYIAPEKIENLYLSSCPYI
                     TQIFVYGNPLKNHLVGVLGLDIPGVQAALEKKNRIVKSWTDEQLIDNLNLDPQLRLQL
                     LKLVNKYTKGLQGFEKLHNIYVGLEPLTVEDDVITPTLKIKRMNASKRFKKELDALYE
                     EGSLIKNGNL"
     gene            complement(<777607..>779238)
                     /gene="NDAI0E03610"
                     /locus_tag="NDAI_0E03610"
                     /db_xref="GeneID:11498756"
     mRNA            complement(<777607..>779238)
                     /gene="NDAI0E03610"
                     /locus_tag="NDAI_0E03610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670373.1"
                     /db_xref="GeneID:11498756"
     CDS             complement(777607..779238)
                     /gene="NDAI0E03610"
                     /locus_tag="NDAI_0E03610"
                     /inference="similar to DNA sequence:INSDC:YER014W"
                     /note="similar to Saccharomyces cerevisiae HEM14
                     (YER014W); ancestral locus Anc_7.164"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670421.1"
                     /db_xref="GeneID:11498756"
                     /db_xref="GOA:G0WBQ8"
                     /db_xref="InterPro:IPR004572"
                     /db_xref="InterPro:IPR027418"
                     /db_xref="UniProtKB/TrEMBL:G0WBQ8"
                     /translation="MLSPLSKLPPNAKVGVVGGGVSGLMFTYFLSKLRSDIKITLFEG
                     EKRTGGWINSWNTADQNGASVMLERGPRTLRGVSDGTVVIMDTMNDLGKSDSIRCVEK
                     YATANRKFLLGPNDKLVQVPNSFGSFLKFATSPLSKGLFTGIAGEMFRKSSSTPGKDE
                     SVRTMLNRRYGNDFIASNLMSAIYHGIYADDISTLSAQKTSGKVFYTELKHGSVLRGS
                     IKEYIRNRFGKKQPETLSGCLKLYQRAFNKDTGALLKLSNHLKKYPMLGFVGGLETFP
                     KTIRKELDNIRNVEIVTGSAVTKMYKDSKNSTMSVKLSTNERIDGFDHLRITVTPQIL
                     STLITSTYGDLIKDLKKVKSNTVILINYYLPNKEIIRPEIQSFGYLIPQSNTNPANIL
                     GVIFDSVIEKNFKSFNIDDANPSRLEVSSSGQSSELQYTKLTIMVGGHLLNENGKTKI
                     PAEATCLADVKSALETHLNVSREDLDNGLWVYTVAKECFPHYFIGYKDWQNKLEKTLL
                     TTYDNKISLGGMGFAKGPGVPDVIVDGLQDALKLK"
     gene            complement(<779748..>782924)
                     /gene="NDAI0E03620"
                     /locus_tag="NDAI_0E03620"
                     /db_xref="GeneID:11498757"
     mRNA            complement(<779748..>782924)
                     /gene="NDAI0E03620"
                     /locus_tag="NDAI_0E03620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670374.1"
                     /db_xref="GeneID:11498757"
     CDS             complement(779748..782924)
                     /gene="NDAI0E03620"
                     /locus_tag="NDAI_0E03620"
                     /inference="similar to DNA sequence:INSDC:YER013W"
                     /note="similar to Saccharomyces cerevisiae PRP22
                     (YER013W); ancestral locus Anc_7.163"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670422.1"
                     /db_xref="GeneID:11498757"
                     /db_xref="GOA:G0WBQ9"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WBQ9"
                     /translation="MNIILQTKSLEEFRDKLEELESGIGEETIFKIYNLVHPMTGDSK
                     MTTNNNNNPFLIVEKKEVIHNPFTLPDQKVEWNDLTDNKDILPPKSQQLDSSPRLHKI
                     YRGKVRKITTFGCFVEILGVQMKDCDGLVHISELSDHRVKDPYEVVGEGQYVYVKVIK
                     IQRNGRISLSMKHIDQKNGKEMGGGANAIPLGKERGRGHEKSNQNIGLDKSIKRRALT
                     SPERWEIRQLISSGAASIEDYPELQEEDKNKAFDPNATADAEDVREDEQEADEVQVEA
                     NTDDTPDFLKGQLEKGNKRYEMPKIVKVPRGSMNRAATYGSNTIKTHREEKLAKKKEI
                     EQEIRKMKVFDDPTSSSERGKEEIDMLRKQLVVTEWERSRMKEQISYGKRTSMPISSQ
                     RKSLPVYKMRSELVEAVQKNQFLVIVGETGSGKTTQITQYLNEEGFSNHGIIGCTQPR
                     RVAAVSVAKRVAEEVGCKLGEEVGYTIRFEDRTSRNTQIKYMTDGMLQRECLLDSKMS
                     KYSVIMLDEAHERTVATDVLFALLKKAAIERPDLRVIVTSATLNSARFSEYFNNCPVV
                     NIPGKTFPVEVLYSQTPQMDYIEAALESVMNIHINDGPGDILVFLTGQEEIDACCEML
                     YERVKTLGDAIDDLLILPVYSALPSEIQSKIFEPTPKGSRKVVFATNIAETSITIDGI
                     FYVIDPGFAKINTYNPRAAMEQLIVSPISQAQANQRKGRAGRTGPGKCYRLYTETAFY
                     NEMLPNSIPEIQRQNLSHTILMLKAMGINDLLNFDFMDPPPKNLMTYALDELYNLEAL
                     NNEGLLTKLGMRMSQFPMDPTLSRALLSSVTNNCSDETITIIAMLSVQNVFSRPKGKQ
                     QDADNKKARFHHPYGDHLTLLNVYNRWEQNGYSDEFCNQNFLQARHLKRARDVKNQIS
                     MIFRKLGLPLVSCHGDPDLIRRTLVNGFFMNAAKRDSQVGYKTITGGTVVGIHPSSSL
                     YGKEYEYVIYHSLVLTTKEYMSQVTSIEPSWLVELAPHYYKPVDSESVSRKKAKITPL
                     YNKFSKDQNSWRLSSIRQSRERALGVKR"
     gene            complement(<783559..>784146)
                     /gene="NDAI0E03630"
                     /locus_tag="NDAI_0E03630"
                     /db_xref="GeneID:11498758"
     mRNA            complement(<783559..>784146)
                     /gene="NDAI0E03630"
                     /locus_tag="NDAI_0E03630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670375.1"
                     /db_xref="GeneID:11498758"
     CDS             complement(783559..784146)
                     /gene="NDAI0E03630"
                     /locus_tag="NDAI_0E03630"
                     /inference="similar to DNA sequence:INSDC:YER012W"
                     /note="similar to Saccharomyces cerevisiae PRE1 (YER012W);
                     ancestral locus Anc_7.162"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670423.1"
                     /db_xref="GeneID:11498758"
                     /db_xref="GOA:G0WBR0"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G0WBR0"
                     /translation="MDIILGIKVQDSVILATSKAVTRGISILKDSDDKTRQLSPHILM
                     SFSGEAGDTVQFAEYIQANIQLYAMREDYELSPHAVSSFVRQELAKSIRSRRPYQANV
                     LIGGFDTKKDTPGLYQIDYLGTKVELPYAAHGYSGFYTFSLLDRHYRPDMTTEEGLKL
                     LKLCITELEKRMPVDFKGVFVKVVDKDGIRQVDDF"
     gene            complement(<784609..>785286)
                     /gene="NDAI0E03640"
                     /locus_tag="NDAI_0E03640"
                     /db_xref="GeneID:11498759"
     mRNA            complement(<784609..>785286)
                     /gene="NDAI0E03640"
                     /locus_tag="NDAI_0E03640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670376.1"
                     /db_xref="GeneID:11498759"
     CDS             complement(784609..785286)
                     /gene="NDAI0E03640"
                     /locus_tag="NDAI_0E03640"
                     /inference="similar to DNA sequence:INSDC:YER004W"
                     /note="similar to Saccharomyces cerevisiae YER004W;
                     ancestral locus Anc_7.148"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670424.1"
                     /db_xref="GeneID:11498759"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G0WBR1"
                     /translation="MNALIFGATGLCGRYFVEYAEKSSKISKIFTVTRRSLPQKVGPR
                     ITQLVETDNSKWASMIPDKEINVLFTSLSTTRGAAGGFDEQYKIDHDLNIELAKAAKE
                     KGCSTIVLVSSRGAHADSRMAYTRMKGEIERDIIALGFDHTIILRPGILLGQRDSNGD
                     SGFGGGIASMIGGFLYNHKRNLFKGHSVEAEDVGKVGVHLALDEQEKVRIVESKEIIE
                     IAEKISK"
     gene            <788320..>789501
                     /gene="NDAI0E03650"
                     /locus_tag="NDAI_0E03650"
                     /db_xref="GeneID:11498760"
     mRNA            <788320..>789501
                     /gene="NDAI0E03650"
                     /locus_tag="NDAI_0E03650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670377.1"
                     /db_xref="GeneID:11498760"
     CDS             788320..789501
                     /gene="NDAI0E03650"
                     /locus_tag="NDAI_0E03650"
                     /inference="similar to DNA sequence:INSDC:YER011W"
                     /note="similar to Saccharomyces cerevisiae TIR1 (YER011W);
                     ancestral locus Anc_7.161"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670425.1"
                     /db_xref="GeneID:11498760"
                     /db_xref="GOA:G0WBR2"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:G0WBR2"
                     /translation="MKFSTSAILLATAGAAMAISEDDVVELEIVMDDVKSNLVRYMNL
                     LTVPGFSLPDNIMDVYMAMNSDPEGYTTAFTELDMTQISNMMTWLPWYSTEIEPKIES
                     ALSSLHPKASSTTTITSTTTSTSSTQAASAAPSSASSAVASTTTVKSSVAATTSTEAS
                     AVASSAETSTTATSDAPVVSSAETSSTATSDAPVVSSAETSTTATSDSPVVSGTTSAP
                     TVSNTTTTTTTSAPIAEQSTVLATATNLFTNTTTMTSCPPTSVATSTKHFTNTTVITE
                     CTECTKKGQSTILETATNLYTNTTTLTSCPPTSSTEKTATSTAVTTKKTTVTICDEEC
                     KKSKASTSTAAKPSTVSQITKAQTSTQSTVTVHQQTENGAVKAVVGMGAGVLAVAALL
                     L"
     gene            <790519..>791796
                     /gene="NDAI0E03660"
                     /locus_tag="NDAI_0E03660"
                     /db_xref="GeneID:11498761"
     mRNA            <790519..>791796
                     /gene="NDAI0E03660"
                     /locus_tag="NDAI_0E03660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670378.1"
                     /db_xref="GeneID:11498761"
     CDS             790519..791796
                     /gene="NDAI0E03660"
                     /locus_tag="NDAI_0E03660"
                     /inference="similar to DNA sequence:INSDC:YOR008C"
                     /note="similar to Saccharomyces cerevisiae SLG1 (YOR008C);
                     ancestral locus Anc_7.124"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670426.1"
                     /db_xref="GeneID:11498761"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="UniProtKB/TrEMBL:G0WBR3"
                     /translation="MISRKLTISLLTLFYGIKDINTQDTTTGYTYLNCYGSIPSGFTL
                     YDSYAYQSSSHCYTNCLANGSQYFALTNHADCYCGNQAPSSSDVSSSCNTNCNGYGQE
                     MCGGEDAFSVYTIDSDDDNTGTSNDAVSSPTTTTSTSSTRSITSSSTTTTSHFSSSTF
                     PTSISTTSTLLPNPQTSSTTSTTSSISSANSIINSGTTTQEQATTSVSETVAVVYQTA
                     YNTEGGSTVFVTNTITQSYAATGLMNNNSSSSNMSKDSKNKKKTNVGAIVGGVVGGVV
                     GAIVVAIGILLLIRHINVKREEARMEKEYQEAIKPVEFNDYDTTATTSGGGFDDLGFE
                     NKDVAGGVTITNDNNGNKNVGDVIYSNSISRSQHPLTTTDSGSFLDDLRVPPNMVSNP
                     FDDSRRISNGSILHGPASHGGKTLTVVNPDETD"
     gene            <792667..>794235
                     /gene="NDAI0E03670"
                     /locus_tag="NDAI_0E03670"
                     /db_xref="GeneID:11498762"
     mRNA            <792667..>794235
                     /gene="NDAI0E03670"
                     /locus_tag="NDAI_0E03670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670379.1"
                     /db_xref="GeneID:11498762"
     CDS             792667..794235
                     /gene="NDAI0E03670"
                     /locus_tag="NDAI_0E03670"
                     /inference="similar to DNA sequence:INSDC:YPL260W"
                     /note="similar to Saccharomyces cerevisiae YPL260W;
                     ancestral locus Anc_7.125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670427.1"
                     /db_xref="GeneID:11498762"
                     /db_xref="InterPro:IPR018810"
                     /db_xref="UniProtKB/TrEMBL:G0WBR4"
                     /translation="MSVQLSNYPSNSTHPQLVPKEEEGILKYLLDVRNYLQNLKRNRT
                     QYLNSQAVQKTYQEVLTKVRELDEIRKNNHATPSNSATTLIHSMELHNRVDSVLDDVF
                     QLLSLCFLTVGLKNSAPATYASLSTVQSLLEHLNESNIFTHHDLGPIKERLDQISKIV
                     EESCSQEIKLDNEGDDQFNQYLDETELEQNQNKIEQDLLLRAKLQHCLDEYHEIESKL
                     EEIDPSLNSILEKLFQIRRGLLSLVASAKKNSLLSQKELDEKHLISPEYLNKKLLELE
                     KEFKDLESNRDEFGKFKSLETGEIPENGQNVLKGLEDDCNDLINDLSHQTNGRLTLDP
                     DLQPVYEQLIEIKTTLEKLMITRRWTLRETDLFTYQKKLGEIDNLRVKGKFPSKSSDS
                     KGQFIILYLLRRCYAIIYKLLECSEPVSESLQPIHNQLSTVRRCLLDIKRLGGVSNER
                     ELYPYQMKLASLDNLRKDGIFYDSDGNIPEGQGTLNALLAACFDIVHEMKVEAEANNK
                     SNDTSDNDDTNSQF"
     gene            complement(<794613..>795947)
                     /gene="NDAI0E03680"
                     /locus_tag="NDAI_0E03680"
                     /db_xref="GeneID:11498763"
     mRNA            complement(<794613..>795947)
                     /gene="NDAI0E03680"
                     /locus_tag="NDAI_0E03680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670380.1"
                     /db_xref="GeneID:11498763"
     CDS             complement(794613..795947)
                     /gene="NDAI0E03680"
                     /locus_tag="NDAI_0E03680"
                     /inference="similar to DNA sequence:INSDC:YPL259C"
                     /note="similar to Saccharomyces cerevisiae APM1 (YPL259C);
                     ancestral locus Anc_7.127"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670428.1"
                     /db_xref="GeneID:11498763"
                     /db_xref="GOA:G0WBR5"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR018240"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:G0WBR5"
                     /translation="MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESS
                     VIPPCLTYNNTQYLFIQHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEE
                     SIRDNYVIIYELLDELMDYGIPQITETKMLKQYITQKSFKLVKAAKKKQNAARPPSAL
                     TDSVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLK
                     LGINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPD
                     GDFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVP
                     EDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNK
                     KPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLI"
     gene            complement(<796355..>796946)
                     /gene="NDAI0E03690"
                     /locus_tag="NDAI_0E03690"
                     /db_xref="GeneID:11498764"
     mRNA            complement(join(<796355..796663,796665..>796946))
                     /gene="NDAI0E03690"
                     /locus_tag="NDAI_0E03690"
                     /product="hypothetical protein"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_003670381.1"
                     /db_xref="GeneID:11498764"
     CDS             complement(join(796355..796663,796665..796946))
                     /gene="NDAI0E03690"
                     /locus_tag="NDAI_0E03690"
                     /inference="similar to DNA sequence:INSDC:YIL009C-A"
                     /artificial_location="low-quality sequence region"
                     /note="similar to Saccharomyces cerevisiae EST3
                     (YIL009C-A); ancestral locus Anc_7.128"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670429.1"
                     /db_xref="GeneID:11498764"
                     /db_xref="UniProtKB/TrEMBL:G0WBR6"
                     /translation="MPRVILSSKQTVSDSVFLQPWIANIIRKEIQAKTYLPGNQRLSI
                     ARLSRRDMDAPEISETILNNYSHFAKVTKFFSVNNYKIFASIRDSTYQILVEFTPQCV
                     LEFERVYRSRITSETVNCLFVIGDCTVIYKTRSQIRSSFPKFDLQSLAGEKNSNKNGF
                     GLFPVLQINQASLFDSDQVQLLFEFPFIYNKLHFTV"
     gene            complement(797243..797315)
                     /gene="NDAI0Etrna12A"
                     /locus_tag="NDAI_0Etrna12A"
                     /db_xref="GeneID:11498765"
     tRNA            complement(797243..797315)
                     /gene="NDAI0Etrna12A"
                     /locus_tag="NDAI_0Etrna12A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:11498765"
     gene            complement(<797791..>799581)
                     /gene="NDAI0E03700"
                     /locus_tag="NDAI_0E03700"
                     /db_xref="GeneID:11499084"
     mRNA            complement(<797791..>799581)
                     /gene="NDAI0E03700"
                     /locus_tag="NDAI_0E03700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670382.1"
                     /db_xref="GeneID:11499084"
     CDS             complement(797791..799581)
                     /gene="NDAI0E03700"
                     /locus_tag="NDAI_0E03700"
                     /inference="similar to DNA sequence:INSDC:YOR356W"
                     /note="similar to Saccharomyces cerevisiae YOR356W;
                     ancestral locus Anc_7.33"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670430.1"
                     /db_xref="GeneID:11499084"
                     /db_xref="GOA:G0WBR7"
                     /db_xref="InterPro:IPR007859"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="UniProtKB/TrEMBL:G0WBR7"
                     /translation="MFLSRKITPTISRKSIRLYRPLSTISTIPRDIEKVDVCIVGGGP
                     SGLTTAIKLKQLDKKDKLKVVVLEKGSYIGAHSLSGMILEPRSFLELFPNMKTPPTDI
                     LTLVQEEEMKYFWNEKLGIPMPHVPGLDNKGKNYVGSQSQLVTWLGEKAEEYGVEVYP
                     GVSVSEVVYNNRDDAIIGVATKDSGISKAGEAKDSFERGMEFHARQTVFAEGCHGSLT
                     KKVIKKFDLRADRSPQTYGLGIKEVWQVKPEVFRKGFISHTMGYPLPNDVYGGGFQYH
                     FGDGLVTVGLVIGLDYKNPYVSPYQEFQKMKKMPYYSKILEGGKCISYGARAINEGGL
                     QSVPKLNFPGGVLVGCSAGFVNVPKIKGTHTAMKTGILAAEKIYEEIRELPEIEEEES
                     LGVDTSKTNEQIINLESYEQAFKKSWVYDELYQVRNIRPSFNFSLGAYGGMVYSGLDS
                     MLLKGRAPWTFENKETDSLKTGAASNFKPIKYYKADNKVTFDIMTSVSRTGTYHDEDE
                     QCHLKLVNGETLQSHAEKTYPKYREVEQRFCPAGVYEYVKDDKSSVGLKFKINSQNCI
                     HCKACDVKTPIQDIDWQVPEGGDGPKYTNT"
     gene            complement(<800263..>802059)
                     /gene="NDAI0E03710"
                     /locus_tag="NDAI_0E03710"
                     /db_xref="GeneID:11498766"
     mRNA            complement(<800263..>802059)
                     /gene="NDAI0E03710"
                     /locus_tag="NDAI_0E03710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670383.1"
                     /db_xref="GeneID:11498766"
     CDS             complement(800263..802059)
                     /gene="NDAI0E03710"
                     /locus_tag="NDAI_0E03710"
                     /inference="similar to DNA sequence:INSDC:YOR355W"
                     /note="similar to Saccharomyces cerevisiae GDS1 (YOR355W);
                     ancestral locus Anc_7.34"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670431.1"
                     /db_xref="GeneID:11498766"
                     /db_xref="UniProtKB/TrEMBL:G0WBR8"
                     /translation="MTFPGSEIVDMADIVPSLNHSSNGSNEEFSNNANNSGLSLPIPT
                     ELSTASLPQDGFTQLNTPLSSSSVSMNSVKSNATPGGTYNNFNNPSNNNTNGNGLKNG
                     KKDIVTPKKENPFLDISKLIPVTGERPKPEEDKTPIDDDVLYAVFVILWEMDPNQQGM
                     TVKQLCDHLLTKHPNMSTLSTKLSNLISAKLNAYVKKIEKGEKTLTYALSREWSSSSP
                     RRMLYIYRGILAPDYKEQAQAVTLQLKQKLAQESSNSFNEDFGSHVTNAKSINNSSKK
                     KSPQTNGNDNNNVTNKNGNNKLAFPVGPSPNGSFNSATKNLVMASPLVNSNTSLHDST
                     TPLQDPLNGANGLGVSNVAFSVGPEFNIPYSASPVSLNFSPVHQNQVENTITNMPAPS
                     LTTTTMAAQLNNTNNNNASNTLAKKRLLDSNNNNNTKSNKKTKTSKSKQSSASISASP
                     SSSSLSSIASNTPMNTMDNSNNNFYITAVAATPRISKLLRGNTFKSNSATSTKALSAI
                     HDIIFTQMPVEGSTDEQSVLNKNTNVITTTREGAHNIAADGACTPSSSNASSTTSSPQ
                     SSWMKIIKDGFLTQDIESPENLTIDDLDNIFD"
     gene            complement(<803907..>805655)
                     /gene="NDAI0E03720"
                     /locus_tag="NDAI_0E03720"
                     /db_xref="GeneID:11498767"
     mRNA            complement(<803907..>805655)
                     /gene="NDAI0E03720"
                     /locus_tag="NDAI_0E03720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670384.1"
                     /db_xref="GeneID:11498767"
     CDS             complement(803907..805655)
                     /gene="NDAI0E03720"
                     /locus_tag="NDAI_0E03720"
                     /inference="similar to DNA sequence:INSDC:YAL040C"
                     /note="similar to Saccharomyces cerevisiae CLN3 (YAL040C);
                     ancestral locus Anc_7.36"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670432.1"
                     /db_xref="GeneID:11498767"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:G0WBR9"
                     /translation="MFNINESQNRTISTTAAAAAAAAVTNGINLGITNLGINTRSTSA
                     PIANNAATTINLDTIKPVDLNVLSQIRKHVANVKAHNPNLMKKEMTNHQSSINEYSKD
                     ILNKLITFEYSTDFKINKPDLSKFKLQPEINESMRNLIFDFLMCCHTRLKLSTSTLFL
                     AYSIIDRFSSKFLIKNFSYQLISLTALWISSKYWDSKYRIPTLKNLQNLCCNQYSKSE
                     FKEMELQILKAFNWSVCQIPTHDSVIDILLFLNQKNIFQNQLMTINEIKMGSIMLCEL
                     ASFNLDISFEYNPSMISITSINLMKLALTFHKSNKWDEIESISQDNKIITICHALLEQ
                     LSSAYQTSSTVEADEGADATSVYSGTTHPYSQQKELKRSTLPTSFNSKYNLINNKNNE
                     SNETTSTYYKNLFTALYNYSIQWQLNNFYASQSVQDYLSTITPSSGDKDIATTPSSLQ
                     SRNMSVMETPHINNTSSLSSNSSYLSATHLPTPSIESYGSNINMHSQNHHSNKFIQLP
                     QLLTPLTPTNGVNMVTNLKKRSVASVMSSIDNPNSTRTKKRIISTVGPRYMSNPATST
                     TSAFSSLNLSTKNDIT"
     gene            <809216..>811363
                     /gene="NDAI0E03730"
                     /locus_tag="NDAI_0E03730"
                     /db_xref="GeneID:11498768"
     mRNA            <809216..>811363
                     /gene="NDAI0E03730"
                     /locus_tag="NDAI_0E03730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670385.1"
                     /db_xref="GeneID:11498768"
     CDS             809216..811363
                     /gene="NDAI0E03730"
                     /locus_tag="NDAI_0E03730"
                     /inference="similar to DNA sequence:INSDC:YOR354C"
                     /note="similar to Saccharomyces cerevisiae MSC6 (YOR354C);
                     ancestral locus Anc_7.37"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670433.1"
                     /db_xref="GeneID:11498768"
                     /db_xref="UniProtKB/TrEMBL:G0WBS0"
                     /translation="MPIVRQALGSRFIVTSTIRRLQSTVNSSRLNLTKLNNTDGVSPI
                     ENQHNEQANEYTNQSHGFTRQNRAAAHPATLLKNKLTSELRKNNSSLLEIFNTFKMGV
                     NEVCEENDNPEYFQKTFGLNKPLADLLTKSSNTNDADIDPYQILDTMCQLQVARSEHF
                     EIVMDYFLKNGKFQDILALWVRYLQTITENPYSLNNKVEFKTAKGNNAYMNPHAKNLA
                     ITAVSYILLLENKPSLETLYDLLRLDKSLGQKIPFTSMKEVIDRELPEQYKVTASEGF
                     NVLLKIFSKSDKEWFLRHIDNSLQVKKIDDLYHSYTYVKEDLDADILTRFMDKYTAFN
                     QFDKTISIFNELKDQFKDNKSFQNRLLIAVGRLDSNINNVTSTNKLNRVLAVWNSIVK
                     PSNPDASSYAALITALNDSGNFEHFKTVWSRDIPENIKENSEVKEAYLLSLLKSKNVS
                     YKEIKDKIPENINSLELINAVLISIVLDAEVTRDQFKEFYSKRIRHEQDATTKKISNI
                     QTTAIKMYADYKYYEHPENFQFELPLRDFNKSLAIIEEFLRVAPTLQSIELLYEQTKE
                     PFDKRRFKAFAKATFLKNDIDIDFSEKIFRDFVKGAKSRELRSEGFQNMVETMIDGFC
                     FIIRRNRDSSILLKIDTYCQLAENLNIQLGNRTLTRLLRTLANLSKNRATKFTEEESK
                     FIENFLNSLEKNDSYVPSRSDIHAIKKFGLEPR"
     gene            <811831..>814764
                     /gene="NDAI0E03740"
                     /locus_tag="NDAI_0E03740"
                     /db_xref="GeneID:11498769"
     mRNA            <811831..>814764
                     /gene="NDAI0E03740"
                     /locus_tag="NDAI_0E03740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670386.1"
                     /db_xref="GeneID:11498769"
     CDS             811831..814764
                     /gene="NDAI0E03740"
                     /locus_tag="NDAI_0E03740"
                     /inference="similar to DNA sequence:INSDC:YOR353C"
                     /note="similar to Saccharomyces cerevisiae SOG2 (YOR353C);
                     ancestral locus Anc_7.39"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670434.1"
                     /db_xref="GeneID:11498769"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR019487"
                     /db_xref="UniProtKB/TrEMBL:G0WBS1"
                     /translation="MTTSSSEVGLQSHPKPTKMKLSQLILKELSHNDGNKSTIKLVGL
                     EITKITDEDVSFLRSVERLSLRKNHITSLPSTFHELKNLRYLDLHSNSLSEIPSVILQ
                     CPQLEIVDFSSNKIKNLPEEISTLWKQNLKVLSLKNNDISTIYSLKSIIYLENLSVLE
                     IDQNSIPQEELEAVQSYTPLTNNITREEYWAIAIRRYLKDHVQEAKMSKASKRMGFIN
                     SLNSSNSMVNTSGSSISLSNGVVANNSYGTTPTSTNNNSNGNNNTTNIIEASEAVNNS
                     NNESNTSLFNSELYNHSKYNDYFKRLSILPEENSTNEEHKIPHAELVLSCRKLLFSFT
                     ECQQSIRRIASFCKENAIAVDIVSLLYSVRSHIDNLVEVLQQAENDENPQDEALIKLC
                     MIIISIFKKIIALLRKNFETFFENDDLCFVRMFYMTLLCSYTEMYNAWTFISSEKPKA
                     TKKKSITQKDSSIISFHAGHRSSNSANSTTSNGSSNTGTVNYKSRTRSNTLQNRIVSN
                     PSTSIESTPSSILTQSLNTMAGNIATTPANVMKQTSTAVGSVAIKSSSSPNGSKNNSN
                     IFWAHSTSAPLHRNHSILGDESPSPSPSVITSQSLEESPKKMGQRSPRPSLILKGKNE
                     LSNNSIAIGGVQQQQQQQQQQLSTSPPTARSKSNPIINSAISGTFFNTANTNPNANSP
                     PRMNASTASTTSMVSAGPGTTATTTVHVPAIANTQIPTASVTTNTTTTTTTTTTTVTP
                     ISSSEEDVDLNLYQTLLLVVKTVNVVYNQLTAEISKVALASSTGQQILTDLLATKIKD
                     LTDTCWQAMELSKVLHGRLNLLLSKDPNVAEKYLTNVEKLKTWENINSFLKSIISILA
                     NAKILMTELPHLNDIRPNLASLAKITKDVTVILDLSSYKVVSMNAQTQAQAQAQSQSQ
                     APAQAQGQGHNQTQMYSNTQAQAQLQQQQIPITKDSHVPLLTPQVKMSNQNVNPFEQQ
                     MNVSK"
     gene            complement(<814885..>815886)
                     /gene="NDAI0E03750"
                     /locus_tag="NDAI_0E03750"
                     /db_xref="GeneID:11498770"
     mRNA            complement(<814885..>815886)
                     /gene="NDAI0E03750"
                     /locus_tag="NDAI_0E03750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670387.1"
                     /db_xref="GeneID:11498770"
     CDS             complement(814885..815886)
                     /gene="NDAI0E03750"
                     /locus_tag="NDAI_0E03750"
                     /inference="similar to DNA sequence:INSDC:YOR352W"
                     /note="similar to Saccharomyces cerevisiae YOR352W;
                     ancestral locus Anc_7.40"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670435.1"
                     /db_xref="GeneID:11498770"
                     /db_xref="UniProtKB/TrEMBL:G0WBS2"
                     /translation="MSTPLTPLHPDANEQLDINSINELNDDDINDLDLNPDLDNLTDT
                     TSNNNTESINPSPSPLQTTPIKTTTTTSKRPLTFTEDDEIFDDVDDFKPRINIGSPFS
                     SNVSLPIHQQQQNATPSHNNGIVPKSKPKPRRLSMSQQSRFIMYCDNELMQIQRKFVQ
                     SQGLNSENGYESLVPLLKDLKTLVDFIWYSIDNSNPHTDYLLKTPRSNEYIPSSPEDN
                     NNNSAKISTYFGQTSYLIKIADDLLDYIEKFKISNDDQVVKIFKFLFILDKIFIRLLN
                     GQIPGGHKMNLTDAVRLCGIAERTRMKLPIFFESQNIHGYHYEVSKIYEETLDKCGN"
     gene            <817014..>818765
                     /gene="NDAI0E03760"
                     /locus_tag="NDAI_0E03760"
                     /db_xref="GeneID:11498771"
     mRNA            <817014..>818765
                     /gene="NDAI0E03760"
                     /locus_tag="NDAI_0E03760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670388.1"
                     /db_xref="GeneID:11498771"
     CDS             817014..818765
                     /gene="NDAI0E03760"
                     /locus_tag="NDAI_0E03760"
                     /inference="similar to DNA sequence:INSDC:YOR351C"
                     /note="similar to Saccharomyces cerevisiae MEK1 (YOR351C);
                     ancestral locus Anc_7.41"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670436.1"
                     /db_xref="GeneID:11498771"
                     /db_xref="GOA:G0WBS3"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:G0WBS3"
                     /translation="MSEPSLGFLEVWQRNENNQGNKTPEYNIEHSTTLHGITTEELGS
                     GDSINESILSNDDSSFPQQQEQQQGGEKISILKICKHKTLKIGRNTKEVDFLLNDPSV
                     SSIHCIIWAILFDEKSIPMCYIKDLSLNGTFVNSKRLERNVAYLLNDNDIIELSSTFN
                     TLSTSMINLFQEEGNPHSYFKFKSLNLEDKCFLKNVERTIFDALNIKKIINKNWEISP
                     KIIGNGTFGNVLVAFKKNLNDNINSKPTGKIIYSPRNYAVKIVKLKKNNVDKEAKILL
                     KLNHPNIIKIHYTFSDIINDNLYLFQDLIPGGDLFSYLAKGDCLTSITETESLILVYQ
                     ILKALSYLHNQGIVHRDLKLDNILLCSPEPCTRIVLADFGIAKDISKLKRNSRMNTIV
                     GTPEYCAPEVGFKTRHPHPNSKSHHELLSSSRSFLNQTCSRANTIEQYKNGYTYKCDL
                     WSLGVVTHIMLTGISPFYGDGTENSIIQNVRNGKLDFSIKHWDHIHENAKDFVRNLLK
                     IDANERFDSFQSLNHSWISNHSGYLEKIYQKKILSVLPLQTLKNMSLNEPLPSSNDWK
                     RKLPKSVNIEARDPEMQ"
     gene            <819174..>820583
                     /gene="NDAI0E03770"
                     /locus_tag="NDAI_0E03770"
                     /db_xref="GeneID:11498772"
     mRNA            <819174..>820583
                     /gene="NDAI0E03770"
                     /locus_tag="NDAI_0E03770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670389.1"
                     /db_xref="GeneID:11498772"
     CDS             819174..820583
                     /gene="NDAI0E03770"
                     /locus_tag="NDAI_0E03770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670437.1"
                     /db_xref="GeneID:11498772"
                     /db_xref="UniProtKB/TrEMBL:G0WBS4"
                     /translation="MPGKNINTNTLHDQHHHHMLDNSNGNNNNNTGVVVPDAAGLAQH
                     TSLSSSSSSPSQLLSSPSSPTSSMTTTNVYPKVYHLIPVENTPPDIPWKALDSSRRGA
                     DGQAILSFFLHNKSLNYWKCLQCKKVYYFRLSDYRYKLNPLKNHLTGKGNKHGIICEK
                     KPDLNTAIRNMEMKNSIDNAVKKRRLETMGAVEMNLLTNSNANNTTTTTANHINNIVN
                     EHHQASYSAITNNFNGDTHNSSHRNVNNTSHNATSNRSLAQINPTNSSDINEEFIKVS
                     VLKDIFRFVLDVVGRDRDRDRDRMHRNLENAISLASNEIDERKKRRKISSNNVDGDIQ
                     EQDQNIQDDGLMIPRHNPNSNSNSNLNQGEHERHVRSQLQAQQQQNQRHLQHRQIQQQ
                     QQQQHQHQQLGETQGQQHHHHLQEGDHRSQLGQQHHQLQLQHLQERMSRNNYQQSSQR
                     RQNNHQQQPQQQHGAGGLL"
     gene            <820891..>822876
                     /gene="NDAI0E03780"
                     /locus_tag="NDAI_0E03780"
                     /db_xref="GeneID:11498773"
     mRNA            <820891..>822876
                     /gene="NDAI0E03780"
                     /locus_tag="NDAI_0E03780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670390.1"
                     /db_xref="GeneID:11498773"
     CDS             820891..822876
                     /gene="NDAI0E03780"
                     /locus_tag="NDAI_0E03780"
                     /inference="similar to DNA sequence:INSDC:YOR350C"
                     /note="similar to Saccharomyces cerevisiae MNE1 (YOR350C);
                     ancestral locus Anc_7.42"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670438.1"
                     /db_xref="GeneID:11498773"
                     /db_xref="InterPro:IPR025694"
                     /db_xref="UniProtKB/TrEMBL:G0WBS5"
                     /translation="MTIFPVRAATNAWKRSISSNITSIVNDVLNNASKNRATSPIITG
                     ENITTENNISPRDKSASILSPTDKWIHESFTKYRGYLKKTGSKNTITLNLPQILRTLQ
                     ILRSSDQTRSYFILLNRLNSTERINWISQNGKAVRLTNNRAPLELYNELSKMLYRQSL
                     RLEDDSSNNDILAKLAMKLLREYYEIIMESQQAVTTRPIITIATTDTVPNSLLENTKF
                     FKNCLSIIIKSKSFARLHYVLKKYIRNGTDNLSYYFAILSFYEKTYQIFKLKNYISML
                     SSFENTEVNLQAESDIKSFSSIIVHVTNRLLSNNMEETCIQFFDKLTRDWNYKMLDHD
                     YNVILEMIEKYGSYKFLYRLKILFPDYSDSEISLVDAIKLNCSEKSLLQLIPILNDYH
                     HKLESNESELRFLQCKLPPLYTNLKGWEDFFHSLLPTLRSSAITQNTKNFIMNLIISH
                     VASDRSLGFMLLFLEHITYQLNLPTLLLSFQENRTVILNQLYHSLLRSMAVNPSANRL
                     SLFHLFNWIKQNELDSFYFSEQDLKSIWKTFPQDVTIYTKSDSLLLNYYHNELSRICE
                     NTCIPNHLETLVSNNTKINNNQTENLTAVQIETVLLQVSGPVTDTLDLHELLDIEKKH
                     EGGSYFFSIDKGNSQRLKDILQTLKSKAAERQAKTCE"
     gene            complement(<822922..>826302)
                     /gene="NDAI0E03790"
                     /locus_tag="NDAI_0E03790"
                     /db_xref="GeneID:11498774"
     mRNA            complement(<822922..>826302)
                     /gene="NDAI0E03790"
                     /locus_tag="NDAI_0E03790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670391.1"
                     /db_xref="GeneID:11498774"
     CDS             complement(822922..826302)
                     /gene="NDAI0E03790"
                     /locus_tag="NDAI_0E03790"
                     /inference="similar to DNA sequence:INSDC:YOR349W"
                     /note="similar to Saccharomyces cerevisiae CIN1 (YOR349W);
                     ancestral locus Anc_7.43"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670439.1"
                     /db_xref="GeneID:11498774"
                     /db_xref="UniProtKB/TrEMBL:G0WBS6"
                     /translation="MNKHPNELAVITLTDKITVLNETSSSYSKNHDYKLLESNVEEIT
                     VIINSFQNDPSILEKKLHIIVPVLLDEFFEETKDITIKIFKSKIFYNLSKVTSLKATS
                     KFLTTNVFLLPLIMNDLKSLGKSTENRIVDIWYLHYLLLASLNTVVQSPFDFKDNYAE
                     IIEAINSFKNNQLFITILCQIRAQLYFKNKEKSKHDIEKVTSNPEQNEDLLTLNYYLK
                     LLIVNAKSIDIEELEQFFLTVLSMEKLTCFILNSASASASSSSSNRMNILNKLLPKLF
                     ILNGYFENWDALEQIISWYLSHFSNQSTDTRFIIAHSFKKILNTLCNELKEVEMAQDI
                     LINDIILTTASLLKEKSWDMIDIDFLHTNLLIIAESIKYIANSLTSTYLLTISNEIIP
                     KSLTFQQLQLKSIKGNQIKDATNFICWSLARSRSTIPIPVLDSVFLNLLTCSLFDHAY
                     IIRKSSTAALQELLGRYGTKILDHPTIMKIIELPINDIDHSYSENIITLYSIFNVKFP
                     EYWDFIISWLFDTNIFGTNFNLGSVKLTAKSFTSLSNHVDTAHLVASSNFNAKLFQRI
                     QQFIKAGKSSKDRYQLQLDSAKIVYLLIELILRTKIAQDKDVLQKYRNFLDELITNFK
                     AFDIFKRHRNINSNRLFQYTVILKIFIYHFASNYEQTLKFTKDDCYRFFSIVKSIPTR
                     DPLVFKEFDNLTKQVISVLSDSIRSKFENNEVAELFWKEYEKQIKSNNLIVCSSLPKL
                     EPRHFSEIFYKQLQTLSCQSKSKIIDSLTADTTKFQLLITSGLLHENSLLDFLNDYTI
                     TEQGDVGRLVRTSACELISKNKNILLSGSTTDLRIISKLIPSLIRISTEPATELKKLA
                     FTLLSDIFKSSNDDSKSIHCQLLTFYDEEYIKDNTIYMRNFWKGYMMTLGAVHATDED
                     LTESLNEFIRFYNNRTSNDEKLELCNELIKIIPRATELTQENLKFTIISLNFWERLFQ
                     SGIRWPFEFNIKGVYAKLYNLHLVEIHSDDGMLMLKLGVLRLFPHLCVVYQDINNDNP
                     DLVVPFVNTIIKRLLVLIQRKSTTDSTNSIKKKRISEMIKRSSIESLLQILLEFEMYH
                     ELKVVKSACKSDDVSKSIWTDDTLPEQILLKDNCVKNI"
     gene            <829594..>831459
                     /gene="NDAI0E03800"
                     /locus_tag="NDAI_0E03800"
                     /db_xref="GeneID:11498775"
     mRNA            <829594..>831459
                     /gene="NDAI0E03800"
                     /locus_tag="NDAI_0E03800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670392.1"
                     /db_xref="GeneID:11498775"
     CDS             829594..831459
                     /gene="NDAI0E03800"
                     /locus_tag="NDAI_0E03800"
                     /inference="similar to DNA sequence:INSDC:YOR348C"
                     /note="similar to Saccharomyces cerevisiae PUT4 (YOR348C);
                     ancestral locus Anc_7.44"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670440.1"
                     /db_xref="GeneID:11498775"
                     /db_xref="GOA:G0WBS7"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:G0WBS7"
                     /translation="MAPFSFIKKFSNRKNENHQSENYEVNNNGIDLVDVDIDIEATAS
                     NDNNKKNPQIIYNEKSYSQDELQTTSPTIIDSIDDEAEKEQGKERSSSNGELKQGLKS
                     RHIQLIALGGTIGTSLLVGTSSALANCGPAGLFISYLIISTFVYPIMNALGEMVCFLP
                     GNGSDSAGSAAHLVHKYVDPSLGFAASWNYYYCFVILVAAEVSAASGVIEYWAWAEHV
                     PKGAWITIFLSLIVILNFLPVNVYGESEFWFASIKILCITGLIILSFILFWGGGPKSD
                     GILGFRYWKNPGSFAHHITGGGGGNFLDIYTGIIKGGFSVILGPELVCLTSSECADQR
                     RNIAKASKRFVWRLMFFYILGSLSIGVIVAYNDPVLQNALAQSKAGAGSSPFVIGIQN
                     AGIRAVPHIVNFCILTSAWSAGNAYMFASSRSLLTMARNGNAPKIFCRINQLGVPYTA
                     VGASLLLSCLAYLNVSSSTADVFNWFSNISTISGFIGWICACVAYIRFRKAITYNKLT
                     HRIPFRAKGQQYTIWYSLFWVSLITLTNGYAIFIPRNWNVKDFIAAYITLPIFIVLWI
                     GHKVFTRTLLKAWLRPIDKIDVYTGLEEIEELTEELNANRQAPKNKWEKFMAILL"
     gene            complement(<832022..>835540)
                     /gene="NDAI0E03810"
                     /locus_tag="NDAI_0E03810"
                     /db_xref="GeneID:11498776"
     mRNA            complement(<832022..>835540)
                     /gene="NDAI0E03810"
                     /locus_tag="NDAI_0E03810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670393.1"
                     /db_xref="GeneID:11498776"
     CDS             complement(832022..835540)
                     /gene="NDAI0E03810"
                     /locus_tag="NDAI_0E03810"
                     /inference="similar to DNA sequence:INSDC:YOR330C"
                     /note="similar to Saccharomyces cerevisiae MIP1 (YOR330C);
                     ancestral locus Anc_7.64"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670441.1"
                     /db_xref="GeneID:11498776"
                     /db_xref="GOA:G0WBS8"
                     /db_xref="InterPro:IPR001098"
                     /db_xref="InterPro:IPR002297"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR016265"
                     /db_xref="InterPro:IPR019760"
                     /db_xref="UniProtKB/TrEMBL:G0WBS8"
                     /translation="MHSFTVKRIPSRRFSRSQLIVYHRLRFQLSRRYQSTEPITFKET
                     PRINPVGIQHLSKSLHAQLFGNKKHSLKEESMTTEERANLINLSKQLLKNHGLLGKKT
                     SISEPISFELPKLQGNSLDEHFQKLGHFASEPYKTMALNKFTTIIPKPLQWVRTPGWT
                     RYEPNKKPEQVPYPKETTIVFDVETMYKLSPYPTLATAVSDKAWYSWCSPYICDADTT
                     NDSDEIKHLVPLGDNTTTPRLIIGHNVGYDRARVLEEYNFKPSKTFFLDTQSLHVATS
                     GLCSRQRPMFVQMKKKRKLLEEEEAKVEESMRTTTETEDTDGITGISTSSLNNLEEEE
                     DPWLNVSTMNSLSDVALFHCGIKMDKEPRDYFASLDKTIVVENFQKLMTYCSDDVDAT
                     SRVFDKVLRMFLKKCPHPVSFGALRALSSFILPTTETAWNNYIQNAEELYQNSKLMIE
                     NKIIESIEELVKLKDDSEKLSRVVPKDPWLRQLDWTMKPIRMTKKGVPVKGQKLPGYP
                     EWYRSLFANKDSKTPQITIKSRSIPIFFKLSWEDHPVVWTKESGWCFPVHRDEFETFK
                     SKNYIIADEDSIAQYRRDTNSINEDGTSDQILLKVPHPNGPAFNCTTLLSKPYIHFFE
                     KGVLKSDSELAHQALNMNSSGSYWMAARERIKSQFVVSRKDFPDQFQELSSSSSVDAF
                     NEQDNLAIILPTVIPMGTVTRRAVENTWLTASNAKGNRIGSELKTLIKAPKGYCFVGA
                     DVDSEELWIASLVGDSVFNIHGGTAIGWMCLEGTKNEGTDLHTKTAQILGCSRNEAKI
                     FNYGRIYGAGVKFAGQLLKRFNPSLGDEEAKETAIKLYENTKGKTKRSKIFKKFWFGG
                     SESILFNKLESIAEQDEAKTPVLGCGITTSLMKRNLKSNSFLPSRINWAIQSSGVDYL
                     HLLCCSMTYLIAKYNLNARLTISIHDEIRYLASEKDKYKVAMALQISNIWTRAIFCEQ
                     MGIDDLPQNCAFFSAVDIDHVMRKEVDMDCTTPSNKVPIPHGENLDIIKLLAKPESLL
                     IDPDSSVDVSQFSYKYREPVFSEYNRAYSKDFWKYFLKMQVQDTKWKVDSLENSYLKE
                     ATAESFHKNGYKTEYGLLDYLRDVKGKKIRKKNIMENSFLTDYSVDVQPIKIEPTCSG
                     EDYNILHSVALSNDTGNMKLKNIQVK"
     gene            <835913..>837301
                     /gene="NDAI0E03820"
                     /locus_tag="NDAI_0E03820"
                     /db_xref="GeneID:11498777"
     mRNA            <835913..>837301
                     /gene="NDAI0E03820"
                     /locus_tag="NDAI_0E03820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670394.1"
                     /db_xref="GeneID:11498777"
     CDS             835913..837301
                     /gene="NDAI0E03820"
                     /locus_tag="NDAI_0E03820"
                     /inference="similar to DNA sequence:INSDC:YOR334W"
                     /note="similar to Saccharomyces cerevisiae MRS2 (YOR334W);
                     ancestral locus Anc_7.62"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670442.1"
                     /db_xref="GeneID:11498777"
                     /db_xref="GOA:G0WBS9"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="InterPro:IPR026573"
                     /db_xref="UniProtKB/TrEMBL:G0WBS9"
                     /translation="MFLKAGLTLLRHPPTYSTQFRPLLRVTNSTFTYSKRFQSNTTLQ
                     VPLIYKQLLSLKPITPNDSYISCTVFNEKGDVVAVSQKFQKWAFLRDHKLYPRDLRKI
                     DTTQVDIIPSILVKPNCFLINMLHIKALIEKDKIFIFDTSNPSAAVKLGVLMYDLESK
                     LSSTSVSPTLKSMGGTQLYEHKALESILINVMSTLETEFHFHHDLCSHILNELENEVN
                     REKLRDLLIKSKKLSLFYQKSLLVRQVLDELLESDEDLASMYLSVHRTEDDDFADLEM
                     LLETYYTQCDEYVQQAASLIQDIKSTEEIVNIILDANRNSLMLLELKVTIYTLGFTVA
                     TLLPAFYGMNLKNFIEESYLGFGAVVFLSIVSAFMVTGSNFKALRSVTKLTMLDNNTS
                     NVTKLPSVEVLQETKSQMTKEGTSQLWARSIQRLRQIWLGTNGMNSVSHRKWTKEDRD
                     LVWKWLTDDPKD"
     gene            complement(<837784..>840654)
                     /gene="NDAI0E03830"
                     /locus_tag="NDAI_0E03830"
                     /db_xref="GeneID:11498778"
     mRNA            complement(<837784..>840654)
                     /gene="NDAI0E03830"
                     /locus_tag="NDAI_0E03830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670395.1"
                     /db_xref="GeneID:11498778"
     CDS             complement(837784..840654)
                     /gene="NDAI0E03830"
                     /locus_tag="NDAI_0E03830"
                     /inference="similar to DNA sequence:INSDC:YOR335C"
                     /note="similar to Saccharomyces cerevisiae ALA1 (YOR335C);
                     ancestral locus Anc_7.58"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670443.1"
                     /db_xref="GeneID:11498778"
                     /db_xref="GOA:G0WBT0"
                     /db_xref="InterPro:IPR002318"
                     /db_xref="InterPro:IPR003156"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018162"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="InterPro:IPR018164"
                     /db_xref="InterPro:IPR018165"
                     /db_xref="InterPro:IPR023033"
                     /db_xref="UniProtKB/TrEMBL:G0WBT0"
                     /translation="MTIGDKQKWTAVQVRNTFLDYFKSKNHKFIPSSPVVPFDDPTLL
                     FANAGMNQYKPIFLGTVDPSSDFYTLKRAYNSQKCVRAGGKHNDLEDVGKDSYHHTFF
                     EMLGNWSFGDYFKTEAINYAWDLLTNVYGIPKDRLYVTYFEGDAKQGLEPDTEAQELW
                     KKVGVPEDHILPGNAKDNFWEMGDQGPCGPCSEIHYDRIGGRNAAQLVNQDDPDVLEV
                     WNLVFIQFNRESNGELKSLPAKHIDTGMGFERLVSVLQDVRSNYDTDVFQPLFKRIQE
                     ITGARDYTGKFGDEDKDNIDTAYRVLADHVRTLMFALADGGVPNNEGRGYVLRRILRR
                     GARYARKYMNYPIGNFFSTLAPTLIDQVKHIFPEIAKDPSFLFEILDEEEASFAKTLD
                     RGERLFEKYAAAASQTESKTLDGKQVWRLYDTYGFPVDLTELMAEEQNLKIDGPGFEK
                     AKQESYEASKRGGKKDNGDLIKLDVHQLSELNDNNVPKTDDNAKYGTENIESTILRIH
                     DGTNFVDSITEVGKKYGIILDKTCFYAEQGGQEYDTGKIVIDDAAEFNVENVQLYNGF
                     VFHTGSLEEGKLSVGDKIIASYDELRRFPIKNNHTGTHILNLALKETLGADVDQKGSL
                     VNPEKLRFDFSHKKALTTDELRKVEDISNEQIKENLIVYYKDVPLEQAKSINNVRAVF
                     GETYPDPVRVVCVGKPIDELLADPTNEEWNKYSIEFCGGTHVAKTGDIKYFVVLEESG
                     IAKGIRRIVAVTGSEAFEAQRIANEFASELETAEKLPFSPLKEKKLKELGVKLGQLSI
                     SVINKHELKEKFTAIEKVVKDEVKSRAKKEAKQTLDEVKTYFTENADAPYFVKFIDIP
                     VNAKAITEAINYIKSSAKDKSIYLLTGNDSNGKIAHGCYISDAALAKGVDGAVLAKQV
                     SNVIGGKAGGKGNVFQGMGDKPDAATEAVSEIEKLLREKLTI"
     gene            <841914..>846083
                     /gene="NDAI0E03840"
                     /locus_tag="NDAI_0E03840"
                     /db_xref="GeneID:11498779"
     mRNA            <841914..>846083
                     /gene="NDAI0E03840"
                     /locus_tag="NDAI_0E03840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670396.1"
                     /db_xref="GeneID:11498779"
     CDS             841914..846083
                     /gene="NDAI0E03840"
                     /locus_tag="NDAI_0E03840"
                     /inference="similar to DNA sequence:INSDC:YOR336W"
                     /note="similar to Saccharomyces cerevisiae KRE5 (YOR336W);
                     ancestral locus Anc_7.57"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670444.1"
                     /db_xref="GeneID:11498779"
                     /db_xref="GOA:G0WBT1"
                     /db_xref="InterPro:IPR009448"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G0WBT1"
                     /translation="MILINILLVLLTLAFRTFSIGLDVSSFGVHEAVVAWSILTHLSS
                     SSLFSNEPTFHELEGLYSIITGLDESVDYEEIDLIPYIEQLLTEKYNNPDIASLFSLY
                     TELYPMGIINNDLQKQLRHYAIEENENCFILNGKKYTKPDDIFYLKSNDLKQQALLPD
                     SQIVLSNEYIISDAAAPATTTAENGNSPILTFYGCPNNNDLFNEFNRNLFSEITSKSG
                     KFRFIWRSTCSIGSNNEEYKEIQFPLALTIKENSDFNSLSNKKTNEFKIPLDIPKRFQ
                     NDQYEHYNPSETELEELDMKVTYLISKYYKQTSNLTSTSKFAKGIINNFPLLMSQLIQ
                     VELPPTALKKIKKSNSDLEKFGVDYKMLGLYVNGQYIKLSSLNEFSLLNMIVKEHSHV
                     SKLLFLFENMFPNTMKPTLSSVKKIINYFSSISLDNLNTLQPIKYNLHMIPGFSESVI
                     YFNDIEIDSQYDELSNDISAFFQESKFGELPEYRQNWNELIFVIDFNNLQDESTIHAL
                     KGLITAINVITQGYPQRIGLLPLDTSQGTNLLVQRMIRKVYELKNFDLIELQSFLQEL
                     SEINEDVDLDMEDENYPSPNVNKLLKNLQIFETSIIIDGEIYPFKKNTWHYLIAKVIK
                     KDVSYLKNELRQIANKIQNNAANPVKDVRSLLHMKSGNARHSKYTPDYFSDAVYTTMN
                     NTVLFEIQERIVEYVASEEYNLLHTITLFDDFNTLSSLKRLQNLLENTYSGIRVRIIH
                     NGSMKGKTWTKLKKVLEKKKNVKSQLSALIQQTKNNEYEGTSSINPNMLARWLPDISV
                     PFVPGLSSFMIINGRFIHFEPTEIPTTTNFEAIIKREAQRTLQTTFSLIKEFPTLEDA
                     KFNPDLIEMTSALLTKEFYHSTNVFDNGIEYSTENYFPRLNLDELLKFNSYTTLQSNS
                     HNSIKPVDILLLIDPLEERSQKILSLISKLKNLSFINLQIILLPTEKLKIVPIERIYI
                     DNPIEETYPLPNILMENFEVDIDIPSQFSSNNFQELKKISIEVHTFPTNSYPSQSQVD
                     GIGGVCLELINSQGDVVDTTTTMATFGYGTLHANDINTKYQVRSCGDDFIIGSFSVNT
                     YSDYIPVDSFSIADFTPIKLYVQVMKNPNFHEKVKKVDDNNYHVFTLLKDDPDEETIY
                     QDMVFSLLKNPERKQDSILHFWIIDQPFFSQEFREFIRLINEETENLRGIIHLFSYDW
                     PSWLRPQRFRSRTLDVSKILFLDTLFPQNISKVLYMNPVAQNIVDPAKVIDQYNVDNA
                     FSMLKMNGKGYWNEGYWSKMLDENNLEFYSVNPFFLINLENVRKNEVCEKLRVHYQRL
                     TTNINSLQVIDQDLLNDIQLLVPISALPDKLRTISVHSTETNFLQWKQNKEQKYSQIK
                     TTQEQISHDEL"
     gene            <846504..>848810
                     /gene="NDAI0E03850"
                     /locus_tag="NDAI_0E03850"
                     /db_xref="GeneID:11498780"
     mRNA            <846504..>848810
                     /gene="NDAI0E03850"
                     /locus_tag="NDAI_0E03850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670397.1"
                     /db_xref="GeneID:11498780"
     CDS             846504..848810
                     /gene="NDAI0E03850"
                     /locus_tag="NDAI_0E03850"
                     /inference="similar to DNA sequence:INSDC:YOR337W"
                     /note="similar to Saccharomyces cerevisiae TEA1 (YOR337W);
                     ancestral locus Anc_7.56"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670445.1"
                     /db_xref="GeneID:11498780"
                     /db_xref="GOA:G0WBT2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G0WBT2"
                     /translation="MNVNMTQQQQGSSNAQEAGNNGSIDTVTSTDNEGPNDNVESNAQ
                     LFGQLGLPKRKRLACTNCRKRRKKCDLSYPCASCVRLRIDCNVNEEDLRKKRYSSSYV
                     KSLEGHVAYLESNLKTLIDKVYPNNIDMLNSMNIGDVISGLVNNKPEYNKDTLNGFSK
                     LNNKDSITTDGSISKPPHSALSPNGAKSVPNPIVPYRIRSPPLEPEKKRKPLIKGSLY
                     PEGPVIYKPKATNSVLSVSSLVSNNSSPSDDITPSFHQTPKDGNNCDNVDIESDKQRI
                     SDLHTTVIKRTAPVGDTNSLNNDSKILESLSNFYKFLYPGHFIFVHRESFLYGFFNHF
                     KNNYADSHYCSLELIYAMSAIGSRLSPTLQDMSEIYYEMSKTTLLNIVFDENSAPKIT
                     TVQALLCLAFYELGKGSNQLAWYFSGLAIRVGYDMGFQLDPQVWYTDDIKSKLTESEL
                     KIRSRIYWGCYIADHFICLMLGRTSTLSVSNSTIPESDELPEVNGTEEFRFVSKHVLQ
                     ISLPLKNLIVLSRVVQIFTSKIFIETDDIEQKVEYLNNFNLQVFNWRQSLPDFLKWNK
                     NLLEDEDVSTDPTISYFWYYYYIVRLTFNKPFIEDCTESQIVVIEILDDLQTLFNNFK
                     KKYGGFNKATLYQLYVCLLAINCLKKLEEQTNVTANSTVSGEIMNPINETSTIDKATR
                     LKLDEQLKFFNNIFYRCLTPAYQLPRKLQEDTDYEFEQEKQDLIQMSSNTNYIHDFSL
                     SNEIDDLIRDLFGAVPNPNLPNNGNPIS"
     gene            <849328..>850530
                     /gene="NDAI0E03860"
                     /locus_tag="NDAI_0E03860"
                     /db_xref="GeneID:11498781"
     mRNA            <849328..>850530
                     /gene="NDAI0E03860"
                     /locus_tag="NDAI_0E03860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670398.1"
                     /db_xref="GeneID:11498781"
     CDS             849328..850530
                     /gene="NDAI0E03860"
                     /locus_tag="NDAI_0E03860"
                     /inference="similar to DNA sequence:INSDC:YAL034C,YOR338W"
                     /note="similar to Saccharomyces cerevisiae FUN19 (YAL034C)
                     and YOR338W; ancestral locus Anc_7.55"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670446.1"
                     /db_xref="GeneID:11498781"
                     /db_xref="GOA:G0WBT3"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:G0WBT3"
                     /translation="MQLFSPQAENQALTNHPKTNNDATGNNSPNDSDPGLLSLLHQRV
                     LIATNSAKLRKTNSNPSTFNFNNNNASTIINTSNSRNQNSETSSITSDEHLIPSPPLS
                     PTISTVDTTQLANFSDIYESKNGITLLPSWERGLTTKDYHYRLTQFLSRYKTVFGNEA
                     KDIITVPRSIKRLRSYNRNTNNQFNKDRSGKAQIITRRYNTRSEGERTPRASSKSSYY
                     TKDSQYETYDRHLLTPPSPRRNISYGRSITPIRRVKKTLPMVSSPLASASAIHSAPQY
                     IPNMSWEKLPDYSPSTSTLPANNPKCLKVEWKGSPMDLSHDPLKNNLHPAELILAQVL
                     RLPCDLYLDSKRRLFLEKVHRLKKGLPFRRTDAQKACRIDVNKASRLYAAFEKVGWLK
                     DSNFLSKL"
     gene            complement(<850773..>851267)
                     /gene="NDAI0E03870"
                     /locus_tag="NDAI_0E03870"
                     /db_xref="GeneID:11498782"
     mRNA            complement(<850773..>851267)
                     /gene="NDAI0E03870"
                     /locus_tag="NDAI_0E03870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670399.1"
                     /db_xref="GeneID:11498782"
     CDS             complement(850773..851267)
                     /gene="NDAI0E03870"
                     /locus_tag="NDAI_0E03870"
                     /inference="similar to DNA sequence:INSDC:YOR339C"
                     /note="similar to Saccharomyces cerevisiae UBC11
                     (YOR339C); ancestral locus Anc_7.54"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670447.1"
                     /db_xref="GeneID:11498782"
                     /db_xref="GOA:G0WBT4"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:G0WBT4"
                     /translation="MSSTKIKHVPLPEGHSVVKRLQSELMQLMMSPTPGLSAFPNDEE
                     DLTHWSAIITGPKDTPYDGLRFKLSFQFSDSYPYAPPLVKFISPMWHPNVDMSGNICL
                     DILKDQWSAVYNVETILLSLQALLEEPNNSSPLNAVAAELWDDDMNEYKKRLLARYED
                     IGDQ"
     gene            complement(<851720..>852679)
                     /gene="NDAI0E03880"
                     /locus_tag="NDAI_0E03880"
                     /db_xref="GeneID:11498783"
     mRNA            complement(<851720..>852679)
                     /gene="NDAI0E03880"
                     /locus_tag="NDAI_0E03880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670400.1"
                     /db_xref="GeneID:11498783"
     CDS             complement(851720..852679)
                     /gene="NDAI0E03880"
                     /locus_tag="NDAI_0E03880"
                     /inference="similar to DNA sequence:INSDC:YOR340C"
                     /note="similar to Saccharomyces cerevisiae RPA43
                     (YOR340C); ancestral locus Anc_7.52"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670448.1"
                     /db_xref="GeneID:11498783"
                     /db_xref="GOA:G0WBT5"
                     /db_xref="InterPro:IPR005576"
                     /db_xref="UniProtKB/TrEMBL:G0WBT5"
                     /translation="MKRSHETLQEKIFIKKQKKQVSNPIDEEDGISNCMVRIPVSLYV
                     SLAPMYMNNPLQGIMKQHLNPMVMKYNSTVGGVVLGYENLKICDMDPTNDETSDEKLI
                     KLTPDTPFGFTWCEVDLYAWQPHVGDIMEGYIFIQSASHIGLLLHDAFNASIKKNNIP
                     EDWTFISNDEEYIAETSRTDDGDKNENNNGNEGNNNNGIQGNSYVNRSLGYWVDANGS
                     RIDGKLKFTVRNVHTTGRVVSVEGTLYTYDGGATNQNTRSQVENLPVVSNKKIVFDEE
                     VEEENKVSHKELDLSAVREDDGSKIVYDQNSSDSSDDDSDDSD"
     gene            complement(<853042..>855999)
                     /gene="NDAI0E03890"
                     /locus_tag="NDAI_0E03890"
                     /db_xref="GeneID:11498784"
     mRNA            complement(<853042..>855999)
                     /gene="NDAI0E03890"
                     /locus_tag="NDAI_0E03890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670401.1"
                     /db_xref="GeneID:11498784"
     CDS             complement(853042..855999)
                     /gene="NDAI0E03890"
                     /locus_tag="NDAI_0E03890"
                     /inference="similar to DNA sequence:INSDC:YAL035W"
                     /note="similar to Saccharomyces cerevisiae FUN12
                     (YAL035W); ancestral locus Anc_7.50"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670449.1"
                     /db_xref="GeneID:11498784"
                     /db_xref="GOA:G0WBT6"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR023115"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WBT6"
                     /translation="MAKKGKKNQPQDWEDELGEDIVSQSEPVTTTEENTPVPDEGNGP
                     QEAEEAGPGDFMSTLKKSKKKLDKKVTDEDEGGKNGGGKPVLKSKKEKEKEKKEKEKQ
                     LKKEQAAKKKAQQQAQKEKNKELNKQNLEKVKEEKNKKSSSPESDEGEKKASSTKKAA
                     KKVPAGLAALRRQLELKKQLEEQERLEREEEERLEREEEERVANEEKEKEASKQAKKE
                     KEKAKREKLKAEGKLLTRKQKEEKKLLERRRAALLAAGNVKVAGLDKKNGTENGEAPK
                     SKKVVYNKKKKRTTTDETSKESSHGTKGAEKKSTETNEAEEVLIDDWENLALDEDEEE
                     TPTAEGSENVTENEIIENGEKEEEGEEEIEEIVRTEAPVVKASASSGNKKDLRSPICC
                     ILGHVDTGKTKLLDKIRQTNVQGGEAGGITQQIGATYFPIEAIKQKTQKMAQYEKQTF
                     DVPGLLVIDTPGHESFSNLRSRGSSLCNIAILVIDIMHGLEQQTIESIKLLRDRKAPF
                     IVALNKIDRLYDWKTTPNNSFRDSFDQQSRAVKDEFETRLSNIQVALAEQGLNSELYF
                     KNKNLAKYVSIVPTSAVTGEGVPDLLWLLLELTQKRMSKQLMYLSHVEATILEVKVVE
                     GFGTTIDVILSNGYLREGDRIVLCGMNGPIVTNIRALLTPQPLRELRLKSEYVHHKEV
                     KAALGVKIAANDLEKAVSGSRLLVVGPEDDEEDMMDEVMDDLTGLLDSVDNSGKGVTV
                     QASTLGSLEALLDFLKDMKIPVMSIGLGPVYKRDVMKAGTMLERAPEFAVMLCFDVKI
                     DKEAEQYAEQEGIKIFNADIIYHLFDAFTAYQEKLLEERRKDFLDYAIFPCVLQTLQI
                     INKRGPMIIGVDVIEGELRIGTPICAVKTDPTTKEKNILLLGKVSSLEINHQAVTEVK
                     KGQTAAGVAVRLEDPSSQQPIWGRHVDESDTLYSMISRRSIDTLKDKAFRDQVSRGDW
                     LLIKKLKPVFGIE"
     gene            complement(856283..856338)
                     /gene="NDAI0Etrna10P"
                     /locus_tag="NDAI_0Etrna10P"
                     /db_xref="GeneID:11498741"
     tRNA            complement(join(856283..856319,856283..856338))
                     /gene="NDAI0Etrna10P"
                     /locus_tag="NDAI_0Etrna10P"
                     /product="tRNA-Pro"
                     /note="codon recognized: CCA"
                     /db_xref="GeneID:11498741"
     gene            <859911..>860864
                     /gene="NDAI0E03900"
                     /locus_tag="NDAI_0E03900"
                     /db_xref="GeneID:11499080"
     mRNA            <859911..>860864
                     /gene="NDAI0E03900"
                     /locus_tag="NDAI_0E03900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670402.1"
                     /db_xref="GeneID:11499080"
     CDS             859911..860864
                     /gene="NDAI0E03900"
                     /locus_tag="NDAI_0E03900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670450.1"
                     /db_xref="GeneID:11499080"
                     /db_xref="GOA:G0WBT7"
                     /db_xref="InterPro:IPR008162"
                     /db_xref="UniProtKB/TrEMBL:G0WBT7"
                     /translation="MSSITRTKSYITANTGEGDSINYEVSNEITNEVVSPFHDIPLKT
                     PVDDIFNMVVEIPRWTNAKFEISKAAAWNPIVQDTTSDKKLRYVKNCFPYHGYIHNYG
                     AFPQTWEDPKKKIDGGDIISNDKIDRKADPEKEAGGDNDPLDVLEIGSTVASTGQVKQ
                     VKVLGALALLDEGEIDWKIIAIDVKDPLHKELNDIGDVEKYCPGLLKATKEWFRIYKI
                     PDGKPENKFALFGKPQNKRHALKIIEDAHGYWETLFEQRPPPEAISLVSQKSKNEQPP
                     ESDTQTEAKAPSSEDFNPKWYFTGSAEEEKKFNFNRYNIYV"
     gene            complement(<861976..>863001)
                     /gene="NDAI0E03910"
                     /locus_tag="NDAI_0E03910"
                     /db_xref="GeneID:11498786"
     mRNA            complement(<861976..>863001)
                     /gene="NDAI0E03910"
                     /locus_tag="NDAI_0E03910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670403.1"
                     /db_xref="GeneID:11498786"
     CDS             complement(861976..863001)
                     /gene="NDAI0E03910"
                     /locus_tag="NDAI_0E03910"
                     /inference="similar to DNA sequence:INSDC:YAL037W,YOR342C"
                     /note="similar to Saccharomyces cerevisiae YAL037W and
                     YOR342C; ancestral locus Anc_7.48"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670451.1"
                     /db_xref="GeneID:11498786"
                     /db_xref="UniProtKB/TrEMBL:G0WBT8"
                     /translation="MSFDNQAYLADQNTAHRLDNDLYFGSLETLSTQLQSIKQNNIRF
                     FIAIDIPSEQCAQLYNQVISNLYESKDDVIMINFESINSNINESSFQSDELLTSYRWN
                     NTRLLQNLVNSLITPSPIPSPTHSEKNLNIMNYNNNIHENYNSNSPDILNELTYLLKG
                     ANKLDSNILTIQNIEKFQLFNDFLTIFKKFGNSFVFANNENNENLITLLISTVLKKNP
                     TLNLIESLQFIKSLKSNDPSNTQELQDAKIFWCSPLINYHEFVRKNNMFWGISSNMNN
                     NNNNNMINQQQFNYQTINSHYGNGNSLYQTPNSNRTRKLDSISQQQQQLQHGSSSSSP
                     NKRSRGD"
     gene            865363..865435
                     /gene="NDAI0Etrna9M"
                     /locus_tag="NDAI_0Etrna9M"
                     /db_xref="GeneID:11498787"
     tRNA            865363..865435
                     /gene="NDAI0Etrna9M"
                     /locus_tag="NDAI_0Etrna9M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:11498787"
     gene            complement(<865971..>866879)
                     /gene="NDAI0E03920"
                     /locus_tag="NDAI_0E03920"
                     /db_xref="GeneID:11499095"
     mRNA            complement(<865971..>866879)
                     /gene="NDAI0E03920"
                     /locus_tag="NDAI_0E03920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670404.1"
                     /db_xref="GeneID:11499095"
     CDS             complement(865971..866879)
                     /gene="NDAI0E03920"
                     /locus_tag="NDAI_0E03920"
                     /inference="similar to DNA sequence:INSDC:YOR344C"
                     /note="similar to Saccharomyces cerevisiae TYE7 (YOR344C);
                     ancestral locus Anc_7.47"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670452.1"
                     /db_xref="GeneID:11499095"
                     /db_xref="GOA:G0WBT9"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:G0WBT9"
                     /translation="MNTAFNTATTTAPMTEQISNTTNFNSWMFQPKFDTEEQEQEQDD
                     LTTPHFIKKEQSSTSLSSSSSSSWFEPLENILSSTSASTSSMGSPLDENQFNLLPNLI
                     TVKKEKILPSTSTSNSNNTSPFDYDACDEETDFFFNSLANTNNNNTAAAGAAATALTA
                     STEEEEDETTIKKQLQQSIINNSNKKRCSRKRLTPDQKQAHNKIEKKYRININTKIAK
                     LQHIIPWVASEKTAFEVGDSMKLPDSTSNDLQQTLNSTGANTKLNKSMILEKAVDYIL
                     YLQNNERLYELEVQRLKKEIESLKQK"
     gene            <868403..>871489
                     /gene="NDAI0E03930"
                     /locus_tag="NDAI_0E03930"
                     /db_xref="GeneID:11498788"
     mRNA            <868403..>871489
                     /gene="NDAI0E03930"
                     /locus_tag="NDAI_0E03930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670405.1"
                     /db_xref="GeneID:11498788"
     CDS             868403..871489
                     /gene="NDAI0E03930"
                     /locus_tag="NDAI_0E03930"
                     /inference="similar to DNA sequence:INSDC:YOR346W"
                     /note="similar to Saccharomyces cerevisiae REV1 (YOR346W);
                     ancestral locus Anc_7.46"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670453.1"
                     /db_xref="GeneID:11498788"
                     /db_xref="GOA:G0WBU0"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR012112"
                     /db_xref="InterPro:IPR017961"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="UniProtKB/TrEMBL:G0WBU0"
                     /translation="MTNHDELIDALLTDSDLDSNTASASASNSGSQPSINFNLETPFL
                     PPPTLRQQQQEDVDPSLISPLKAKNENQNDINSSFLSNLSDDSLIDYINRFSQDEKKK
                     ADQNSSKKRLLNDTKSVTSSIGNTSTTNTNVNDYSREDYFHDKKLRQDQQDEHLRNQY
                     RNLYLNGTDHINEGLPPQIFKDCIIYINGYTIPGRLQLHESIVLHGGKFIHHLSAKKK
                     ITHIIASNLTLKKKLEFEKYKVVKPDWIVKSIESKKLLPWQDFALLTHLDEQQKRLDF
                     LPTEKQTIASSLSPSPGPLRSASPSAFSTTRQIIDCNHPDFIKNYFENSRLHHLSTWK
                     SNLKSKFLNNFLNPSSLTRFKIPTKKDNVLIFHVDFDCFFATVAYMYKDPKIICDIDK
                     DPIVVCHGNKNSDIASCNYIARKYGIRNGMWVSQAAKLCPPGVNLISLPYNFEQFQKK
                     SEIFYHVLENFITQPLSNNNNNNNNNNNNNNNTGQMFDLILPISIDEAICVIILPPPS
                     SSSLTEDDTMLTLTDQIGRNIRSQIFDATNGCTVSIGCANSLVLARLSLKMAKPNGYH
                     AVLNNNNMVDFDEFLSSFKLDDLPGVGHSLVAKLLNKFKPSNFPSNESFNLNHLKQYS
                     NLSSLQKLLGNKSGLKIYLQLQGKDDDESSKLLYDPQSTLERKSFSIDINWGIRFSTI
                     KEVDTFIDRCCAYLINELTTKIKKSTSQITLKVLRRAPNAPIEPAKYLGCGECDAFNK
                     SSKLGIPTDEFGVITTEIKSLYRIIGCPPTELRGLSIQFNKLVDPTKQIDTLGKNQAR
                     LNFEKKNLNYLPADIKDDVTKELQRRKIIINPPSRTSLSPSPRHISPPKRKFEMLSTF
                     EEKFIDNLPTQIGMELRKDLKIQKKIEHTKMKDVQEQRMKREDAIKNYKSHFFDDDSI
                     FIPIKFQNRARFKDISKLVMMWLKNTIKTNGPHEKDLKLFEKYLQKLCDSNRIHLVLN
                     LANMISTQLNMLPKQFHEETGFQEWEKILLTLIVPMLNKNKHTFQTVRKYDMDFDL"
     gene            complement(<871674..>873296)
                     /gene="NDAI0E03940"
                     /locus_tag="NDAI_0E03940"
                     /db_xref="GeneID:11498789"
     mRNA            complement(<871674..>873296)
                     /gene="NDAI0E03940"
                     /locus_tag="NDAI_0E03940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670406.1"
                     /db_xref="GeneID:11498789"
     CDS             complement(871674..873296)
                     /gene="NDAI0E03940"
                     /locus_tag="NDAI_0E03940"
                     /inference="similar to DNA sequence:INSDC:YAL038W,YOR347C"
                     /note="similar to Saccharomyces cerevisiae CDC19 (YAL038W)
                     and PYK2 (YOR347C); ancestral locus Anc_7.45"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670454.1"
                     /db_xref="GeneID:11498789"
                     /db_xref="GOA:G0WBU1"
                     /db_xref="InterPro:IPR001697"
                     /db_xref="InterPro:IPR011037"
                     /db_xref="InterPro:IPR015793"
                     /db_xref="InterPro:IPR015794"
                     /db_xref="InterPro:IPR015795"
                     /db_xref="InterPro:IPR015806"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018209"
                     /db_xref="UniProtKB/TrEMBL:G0WBU1"
                     /translation="MNRTICSRIRAFTTNSLNLLTQTGSQQPTIDLLTPAMLQSRLAR
                     LTNLNVHADHDTALRKTSIIGTIGPKSNSIEMITSLRDAGLNIIRMNFSHGTHEFHSS
                     VIDNAVQSEFLDDGRPLGIALDTKGPEIRTGITRDNKDYAVKQGHEMLFTTDPKYKEI
                     CDDQVMYLDYVNITKVISVGKIIYVDDGVLSFKVLKIIDKENLKVQVLNDGVISSHKG
                     VNLPGTDVDLPTLSEKDMLDLEFGIEKGVHMIFASFIRSAKDVLTIREFLGEEGKDIK
                     IISKIENQQGVNNFDEILKVTDGIMVARGDLGIEIPTPQVLAVQKRLIAKCNLVGKPV
                     ICATQMLESMTYNPRPTRAEVSDVGNAILDGADCIMLSGETAKGDYPIEAVKMMTQTA
                     LVAENAIPYLANYDDIRNCTPKPTPTTETVAASSVAAVFEQNAKAIIVLSTSGETARL
                     CSKYRPNCPIILVTRNRGTARFSHLYRGVYPFVYELPPLEDWVKDVEKRLNFGIEMGK
                     ELNILQKGDAVVTIQGFKCGVGHSNTLHVLTI"
     gap             873381..873400
                     /estimated_length=20
     gene            874990..875084
                     /gene="NDAI0Etrna7F"
                     /locus_tag="NDAI_0Etrna7F"
                     /db_xref="GeneID:11498785"
     tRNA            join(874990..875027,875048..875084)
                     /gene="NDAI0Etrna7F"
                     /locus_tag="NDAI_0Etrna7F"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /db_xref="GeneID:11498785"
     gene            <875702..>877339
                     /gene="NDAI0E03950"
                     /locus_tag="NDAI_0E03950"
                     /db_xref="GeneID:11499092"
     mRNA            <875702..>877339
                     /gene="NDAI0E03950"
                     /locus_tag="NDAI_0E03950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670407.1"
                     /db_xref="GeneID:11499092"
     CDS             875702..877339
                     /gene="NDAI0E03950"
                     /locus_tag="NDAI_0E03950"
                     /inference="similar to DNA sequence:INSDC:YBL099W"
                     /note="similar to Saccharomyces cerevisiae ATP1 (YBL099W);
                     ancestral locus Anc_7.432"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670455.1"
                     /db_xref="GeneID:11499092"
                     /db_xref="GOA:G0WBU2"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005294"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR023366"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WBU2"
                     /translation="MLRQTALKPLIPLTRNILARAVLSPTLASSRRLASTSTKPQPTE
                     ASSILEERIRGISNEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALN
                     LEPGQVGIVLFGSDRLVKEGELVKRTGKIVDVPVGPAMLGRVVDALGNPIDGKGPIKA
                     EKHSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALD
                     TILNQKRWNEGKDESKKLYCVYVAIGQKRSTVAQLVQTLEQHNALQYSIIVAATASEA
                     APLQYLAPFTAASIGEWFRDNGKHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGD
                     VFYLHSRLLERAAKMSEKEGGGSLTALPIIETQGGDVSAYIPTNVISITDGQIFLEAE
                     LFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDAS
                     TKQTLVRGERLTQLLKQSQYSPLSAEEQVPLIYAGVNGYLDEVDISRVGEFESSFLAF
                     LKSSHEEILSDIRDKGELTKELMAALKSATESFVATF"
     gene            complement(<877738..>880071)
                     /gene="NDAI0E03960"
                     /locus_tag="NDAI_0E03960"
                     /db_xref="GeneID:11498790"
     mRNA            complement(<877738..>880071)
                     /gene="NDAI0E03960"
                     /locus_tag="NDAI_0E03960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670408.1"
                     /db_xref="GeneID:11498790"
     CDS             complement(877738..880071)
                     /gene="NDAI0E03960"
                     /locus_tag="NDAI_0E03960"
                     /inference="similar to DNA sequence:INSDC:YPR024W"
                     /note="similar to Saccharomyces cerevisiae YME1 (YPR024W);
                     ancestral locus Anc_7.430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670456.1"
                     /db_xref="GeneID:11498790"
                     /db_xref="GOA:G0WBU3"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WBU3"
                     /translation="MRRGRTRKGLEKGNKGRRRLNLKNMELARPLFPAIKTCSLQRSL
                     PLLTKTLITRGLLIGNANRLLVVTKNNICTSSLLYRRFHTNSKTSSIHMDSWRNDRER
                     VETTKKITASMLAHEEQIANKKIHDSQTQHDFYKLLLKSNYPQYVVARFETPGIATSP
                     ECTELYMEALQRIGRHPEADYVRLKLLNSSSVGLVNPTLTENTSPNNTTSTNNSMAVS
                     NMAASSLLYGNNHGTKQTPLHVIISESKFTIISRWIKWIAILGIVSYGLTGVLNYVVD
                     NSSLINNTDASKIIDSTDVENNVTFNDVKGCDEARFELEEIVDFLKNPDKYKHLGGVM
                     TKGVLLTGPPGTGKTLLAKATASESNVKFFTMSGSEFDEVYVGVGAKRIRELFNQARQ
                     NSPAIIFIDEIDAIGGKRSGKDDQGFARQTLNQLLVELDGFKKDEGIIIIGATNFPES
                     LDKALLRPGRFDKIVNIDLPDVRGRTEILKHHMGKITLGDDVDCTLIARGTPGLSGAE
                     LFNLVNQAAVYACQQNASEVNMLHLEWAKDKILMGAERKSMVMTEATKKATAFHEAGH
                     AIMAKYTAAASPLYKATILPRGNALGITFQLPEMDKVDITRKECLARLDVCMGGKIAE
                     ELIFGEDNVTSGCGSDLRTATNMARAMITEYGMNDEVGPINLAENWNTWSNDIQERAD
                     NEVIKVLKEAETRCRQLLKRKNVELHRLAQGLVEYETLDAKEMDRICLGKQIDRDGSK
                     NATDEPAENDIHNPDLDSHNNSTISPVLSMFNTLFGT"
     gene            <880302..>882974
                     /gene="NDAI0E03970"
                     /locus_tag="NDAI_0E03970"
                     /db_xref="GeneID:11498963"
     mRNA            <880302..>882974
                     /gene="NDAI0E03970"
                     /locus_tag="NDAI_0E03970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670409.1"
                     /db_xref="GeneID:11498963"
     CDS             880302..882974
                     /gene="NDAI0E03970"
                     /locus_tag="NDAI_0E03970"
                     /inference="similar to DNA sequence:INSDC:YBL097W"
                     /note="similar to Saccharomyces cerevisiae BRN1 (YBL097W);
                     ancestral locus Anc_7.428"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670457.1"
                     /db_xref="GeneID:11498963"
                     /db_xref="GOA:G0WBU4"
                     /db_xref="InterPro:IPR022816"
                     /db_xref="UniProtKB/TrEMBL:G0WBU4"
                     /translation="MATIRSLERSQSGMDPQNADLEDDETGLFTNRSTVMANFEEWIK
                     MATDNKINSRNSWNFALIDYFYDLNVLRDAENNINFQKASATLDGCVKIYSSRVDSVT
                     SETGKLLSGLAQKKANNKDRNKNAGNNSDPNGNTNNSSGSNDNSNQADDDASNSDNDS
                     IQIDPLTGLPIGRDDNLDENGHNTRRRVYNRVLETTLVDFDSLKMKELDQELNIDPLF
                     KKALVDFDEGGAKSLLLNTLNIDNSIRVIFDASMKDINNADNEVDGESADREEAEEEL
                     KDMENIEEDNISENNNSAYSANNTSIHSGFAPIEDEILSLGMDFINFKQLSVCEISSS
                     IHQLRNVVQDINKAKTFIDSVNSNKFDNFLTEEELQETIPDNVTNNDDNNDFDTGIEK
                     ELEYSIQKEEENRDEAVGPVALDLGADDNEDDIVGGGQPHSRINDGRQTIYDDNGDGD
                     GDEGNDSNIMMSSIFEQDLMSYFDENLKKNWRGREHWKVRNFKKNNKLPKLLGSIEEE
                     REGGTPQLGEDGNPIEPSKSSSLNTSSTSTKNLQQSAQQQHFEIDFFAQDDTLEEKVF
                     DNAKGNGKNKRKVNIDMPIKNRINDAHFLLPDDYHFSTDKITRLFIKPTERMCLSNLR
                     KRKSKHTANGNFTTRSHTELRTNNNDGNNVAINIENHGPEIANEEFWAENYKRKEAEA
                     NQGIDDDADDADGEEGVVDVVGASMDNPFNNFGNGDGDGDDDMGNGIDFNQAFDDDDD
                     MDKRSHDSELSTRDKERNAHFKDEDMKEDYLSKNNKINFSRVAKRVDVRRLKKNIWSS
                     ILVKIDEQKQAKKEDSSQDAAIESYMFKFSDIIERVRIKYSKEVLKDISTSFCFICLL
                     HLANEHGLDIEDYENLEDLTVTFTPAVISSSSSL"
     gene            <883361..>884146
                     /gene="NDAI0E03980"
                     /locus_tag="NDAI_0E03980"
                     /db_xref="GeneID:11498964"
     mRNA            <883361..>884146
                     /gene="NDAI0E03980"
                     /locus_tag="NDAI_0E03980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670410.1"
                     /db_xref="GeneID:11498964"
     CDS             883361..884146
                     /gene="NDAI0E03980"
                     /locus_tag="NDAI_0E03980"
                     /inference="similar to DNA sequence:INSDC:YBL095W"
                     /note="similar to Saccharomyces cerevisiae YBL095W;
                     ancestral locus Anc_7.427"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670458.1"
                     /db_xref="GeneID:11498964"
                     /db_xref="InterPro:IPR006683"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:G0WBU5"
                     /translation="MGILLKSINRLVILPTAGFSLGVLTFMKAWPELNTDANEAGRLS
                     LKDPGINDNAIMLPDSLRIENEKILNAMRELPLYKRLVNDPMIKHTRQSEGIPEGHKP
                     NHVGQGILFGSGKLEIDPIIFHDEKNGEIVIFYHFGKGLSNEHGAVHKGILALILDEG
                     LCLCGFPLLPSQRGVTAKLNLKFHADIPVDSSAILRAKVTEIKGRKCVIDGTLESVPQ
                     SYENPLWKLLNKVNERKPTTYVSANCILVEPKWFKYIKNLNIM"
     gene            complement(<884287..>884958)
                     /gene="NDAI0E03990"
                     /locus_tag="NDAI_0E03990"
                     /db_xref="GeneID:11498965"
     mRNA            complement(<884287..>884958)
                     /gene="NDAI0E03990"
                     /locus_tag="NDAI_0E03990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670411.1"
                     /db_xref="GeneID:11498965"
     CDS             complement(884287..884958)
                     /gene="NDAI0E03990"
                     /locus_tag="NDAI_0E03990"
                     /inference="similar to DNA sequence:INSDC:YBL093C"
                     /note="similar to Saccharomyces cerevisiae ROX3 (YBL093C);
                     ancestral locus Anc_7.425"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670459.1"
                     /db_xref="GeneID:11498965"
                     /db_xref="GOA:G0WBU6"
                     /db_xref="InterPro:IPR013942"
                     /db_xref="UniProtKB/TrEMBL:G0WBU6"
                     /translation="MSTFTETANASSNVEQILPSYYYYVDPEVSYQPQIPNPLDDLIS
                     IYGLDDLSRQVARSNTETGIKAVKLRKSYKNQISDLSGKFTTIPTRENGKGGEISHIL
                     FQNNPDMMNQIHRNTSKNDNEWIEHARNRDMDLFQSTKNMDWNVCNNVISQFEKSYPS
                     EFQQQQFNVDDLAFDLDGTGKNNGNIPGSVGNNKKRKNKSNGSSMATPNSDVQQEDLK
                     RRRLE"
     gene            <887943..>888338
                     /gene="NDAI0E04000"
                     /locus_tag="NDAI_0E04000"
                     /db_xref="GeneID:11498966"
     mRNA            <887943..>888338
                     /gene="NDAI0E04000"
                     /locus_tag="NDAI_0E04000"
                     /product="ribosomal protein L32"
                     /transcript_id="XM_003670412.1"
                     /db_xref="GeneID:11498966"
     CDS             887943..888338
                     /gene="NDAI0E04000"
                     /locus_tag="NDAI_0E04000"
                     /inference="similar to DNA sequence:INSDC:YBL092W"
                     /note="similar to Saccharomyces cerevisiae RPL32
                     (YBL092W); ancestral locus Anc_7.424"
                     /codon_start=1
                     /product="ribosomal protein L32"
                     /protein_id="XP_003670460.1"
                     /db_xref="GeneID:11498966"
                     /db_xref="GOA:G0WBU7"
                     /db_xref="InterPro:IPR001515"
                     /db_xref="InterPro:IPR018263"
                     /db_xref="UniProtKB/TrEMBL:G0WBU7"
                     /translation="MASALPHPKIVKKHSKKFKRHHSDRYHRVSENWRKQKGIDSVVR
                     RRFRGNIAEPTIGYGSNKKTKFLAPSGHKTFLVANIKDLETLMMHTKTYAAEIAHNVS
                     AKNRVGILARAKALGVKVTNPKGRLALEA"
     gene            <888700..>890115
                     /gene="NDAI0E04010"
                     /locus_tag="NDAI_0E04010"
                     /db_xref="GeneID:11498967"
     mRNA            <888700..>890115
                     /gene="NDAI0E04010"
                     /locus_tag="NDAI_0E04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670413.1"
                     /db_xref="GeneID:11498967"
     CDS             888700..890115
                     /gene="NDAI0E04010"
                     /locus_tag="NDAI_0E04010"
                     /inference="similar to DNA sequence:INSDC:YBL089W,YER119C"
                     /note="similar to Saccharomyces cerevisiae AVT5 (YBL089W)
                     and AVT6 (YER119C); ancestral locus Anc_7.420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670461.1"
                     /db_xref="GeneID:11498967"
                     /db_xref="GOA:G0WBU8"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:G0WBU8"
                     /translation="MASTIRYGVLTLLHTACGAGILAMPYAFKPFGLIPGFIMIAICG
                     LCSLWGLILQARVTKYSKTDDNDDTANDRSVSFFSLTQIINPNLSVIFDLAIAIKCFG
                     VGVSYMIVVGDLMPQILSHLIPESHSTSSLLLSRNFHITIMMLCIVSPLCFMKNLSSL
                     RYASMVAISSVVYLCVLVVFHFLSPSQEIKDLKGELSYWLPNNEPSPLVTLPIFVFAY
                     TCHHNMFSVINEQIDNSFHNIKKLAIIAMSLAFSLYIIIGGSGYYTFGDNIVGNIITL
                     YPQSVSSTIGRMAIVFLVTLAFPLQCHPARASIHHIILYITMKINDAKEIKPSNPQQE
                     PLALSANNQERAMLIRSERSDTLIEEESPLQPVTVPLEGKQFILITTSILICSYLLAI
                     SVSSLAHVLAIVGATGSTSISFILPGVFGYKLIGSEMLTTEQLPIKTRLFKYSGLLLS
                     IWGVFIMITSLAASILLGASH"
     gene            complement(<890287..>898647)
                     /gene="NDAI0E04020"
                     /locus_tag="NDAI_0E04020"
                     /db_xref="GeneID:11498968"
     mRNA            complement(<890287..>898647)
                     /gene="NDAI0E04020"
                     /locus_tag="NDAI_0E04020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670414.1"
                     /db_xref="GeneID:11498968"
     CDS             complement(890287..898647)
                     /gene="NDAI0E04020"
                     /locus_tag="NDAI_0E04020"
                     /inference="similar to DNA sequence:INSDC:YBL088C"
                     /note="similar to Saccharomyces cerevisiae TEL1 (YBL088C);
                     ancestral locus Anc_7.418"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670462.1"
                     /db_xref="GeneID:11498968"
                     /db_xref="GOA:G0WBU9"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR021668"
                     /db_xref="UniProtKB/TrEMBL:G0WBU9"
                     /translation="MNRTSSDINNILNSLSSTKVKERTAAIDELVSILKQRPQDIPTP
                     LLASTSHTLIELLDLEHRKYCRYVSDVNESNASKISLSETKITNISYVVRLFIEKTCQ
                     RFKVKTMNQLLTILPELMINDEGSFEIIKPIAFQLSMATYALIQSDLFQLKFTSHRWS
                     SLIEKTCSYIEKYISVSLTDRTILSLFSILDILLSLDCMALQTDCMDIYRALLSYLEA
                     CTKENGNTRLIFLCINKLIVKTHCIKIHEVLDLINATWRYIISIGNISNDAINTEMSF
                     FDIISSELACNKLPTMLGQKPLDIESSLLRFEDYLNHRISNFASKSFTLDSLMFDESF
                     IEQDKERISWFETHDFQLKDSAQHLPWLRLHGITKLLASYFELKKPYQSVNLFKRRKC
                     EDNTVYILKNSDDIFSFIERCLDNTQPINLQIFGLQICAMYGASFSITANQIERLLTV
                     ILSKFAVTELIGFSALSLIPLVSQKDFTLSEADLNTILKVGLPLLKNPESSIVICVLL
                     ARLIHYNDLKISDTKTINLIYDIYELSTINGPKYMCNESFFFGRCLQKYGKHYHSRSG
                     KSSASKVLKWVYANWDQIKDIDIITQNEFSIFMAWFCCRDTKGVKGDNKWRKYGWMSC
                     SWQENYYFWNLFQEQRQFLLQDSENFKCVRLSKTQAQEGCTYENIEVSEILYRILDLI
                     ENNDNLTSLQRFNWLHVTLGIVSYLSGDSNFTEFIMAFKSTVALSVSSIKFIETKSYT
                     RFFEAILSVNNPNVAHLLYEELDIIAIVTEFKKSKLASAYNLLPESISSEFDGFEKSQ
                     KLKDEDIRLYAYTIPYNQADIKLAADALISTQKLTNQTKCLDIIYNFMADLPPYMLIQ
                     CLPSINGLLTRLSPGLSIGTECFESLTHLIGERLLGGRYNTYNGSMEMLCDYLDALRL
                     QWLGDNKSPLNADCNDILDWIISRFEENSFPGGFPTGRLSILLLNILKFNSSTHSSIK
                     GGKQKIFATFTACLQRLGPAINITQLPAITSYMELVGYKNLSIILSELTNVYETPQQS
                     IEMSAIYSLAMSKIGTVSYTTLIYTLEDLLSYSKFSHTRCYISGALQIITKAMGLKDV
                     QALFERCKFDLFLFWCNKSGAEMASEIDWDIELFGFHDLIPFIGRYSCELSAIYFSQG
                     LNIPVLLTKLVEITKSNESQLLTQSIHLSIPLSFAPNGVKAVIFDVIDNLLGRSVNKI
                     MKQYELIIFRWILKFIDLGSSADMESLLRKTFPKSSLLYTLFPKNATSYRYQYPLHIE
                     LTTGTKLLKHRFRDFSRQHLRVLLFWILADLESSKNYIGKLHYIRELKYIFVIYENCL
                     PTDSALLVIMKHISPYLIESGLHDETASIIETLLLFATKIDIHIYDVFPTLFSSLFMY
                     VNQSHGDIHASLLITLESLVKNSSTFGRIWKYCMDVLQGLTLSNEVYQHVEILDQSEV
                     DEQVLILLSLLFGFATPLNHFPEDYTVTESCIQNLLTKQIPEKYMSTNFKLWMSLCLE
                     LSYIRGYAPFKSIVLKKDIYSPAFFQEKNPLSLVYEQFFRLFSELTEKGSCKMLFLSE
                     YILSFLVSSHSELSTTGSAISVDLYEKYKDRGLPVSIDSFRSVYRLENRGSGFDDYLT
                     EHLISKTDNYETWLLKLSMALLNNITFTQPFLIIFQPLFKENIKFSENLLPYLVYLPM
                     RDGQKDIREWATEILSKSAQILDTEDGEKKVKVVFNILRLIRCASRLSIDYFTHLYNS
                     LDLHMLCDVALKADLTSFSYMLYEELYANSPKKDILILRNIYEKIDDLNLLSGLPVPD
                     CLSASIDYINSTEPRTWKNFLFNSARIDSNYKKISAADRNAIMNSSGSNGIYFVANGL
                     TEKNSDETSNEEYKWSLQLGAWDLPFPEQVNTKEKGLYYCLKKLVHEPTASNKSLEHS
                     LLTVIEWRNHFRTQMEWYETVAEVSLFKKFVKLVTLPSELLYFFKTLHSIDDRKLTST
                     DFEDYKTNLNARYLLPTLISTCKENNIIPPGQMEVISAIHLSNFVEQALTYNASQDAL
                     RNSFLLNNIAEEMKNQGEKADLNAKIAIETLNSYISAKAMWSSNEVNAPIKIMQNLLQ
                     PGETTNDAEAGAVGLLSLITISKDQIISHLVTWSSQMRLETPSTIYKRYIDRWAVSLK
                     ENSARADIFMALANFLNEQVKRSQDSGEIPEKTRIYNSGISHLQMLDKIYKNASLSDK
                     ERKDARRHYFKINVQVLRDKELMMNAVNERITFLWMALHFYINTLAFSDKHDDTAMDK
                     FCALWFGNDEENEINIRLQKEIGAIPSWKFLPWINQISSKLSTNQTPFQNVLQLTMKR
                     LLYKLPYDTLYSVISIKLYDKNSQEQSIVSRITAVETILNDLKAYESGKYYRKFVMPI
                     EEFCVKSVELANYKTTQNSRTLHLSNLKIGDYWCNILRDTMLPLPTGNFPITCSKDGR
                     KARPYITAIDETVHSTTTGLSLPKIIKFTVSDGTVHKVLMKGSNDDLRQDSIMEQVFQ
                     QVNKILRQNKGLRKMELGIRTYKVIPLGPRAGIIEFVPNSISLHEVLSNLHKDDPIRF
                     EQARKEMKAVQNKSNDERIKVYLKLTEKIKPQLRNFFFNSFLEPSAWFRSKQRYSKGA
                     AASSIVGHILGLGDRHLNNILLDRSTGEPIHIDLGISFDQGRLLPIPELVPFRLTRDM
                     VDGLGVTGVDGLFRRSCEKVYSVLRKDSEKVMCVLNILKWDPLYSWVMSPVRKHINLL
                     EQESAHYGADKPTTSGVVSLHDGENGESTRALKGVEDKLTRSGLSVEATVQELIQQAT
                     DPAHLAVIYMGWSPFY"
     gene            complement(<899147..>900102)
                     /gene="NDAI0E04030"
                     /locus_tag="NDAI_0E04030"
                     /db_xref="GeneID:11498969"
     mRNA            complement(join(<899147..899518,900061..>900102))
                     /gene="NDAI0E04030"
                     /locus_tag="NDAI_0E04030"
                     /product="ribosomal protein L23"
                     /transcript_id="XM_003670415.1"
                     /db_xref="GeneID:11498969"
     CDS             complement(join(899147..899518,900061..900102))
                     /gene="NDAI0E04030"
                     /locus_tag="NDAI_0E04030"
                     /inference="similar to DNA sequence:INSDC:YBL087C,YER117W"
                     /note="similar to Saccharomyces cerevisiae RPL23A
                     (YBL087C) and RPL23B (YER117W); ancestral locus Anc_7.417"
                     /codon_start=1
                     /product="ribosomal protein L23"
                     /protein_id="XP_003670463.1"
                     /db_xref="GeneID:11498969"
                     /db_xref="GOA:G0WBV0"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR019972"
                     /db_xref="InterPro:IPR023571"
                     /db_xref="UniProtKB/TrEMBL:G0WBV0"
                     /translation="MSGNGAQGTKFRISLGLPTGAIMNCADNTGARNLYIIAVKGSGS
                     RLSRLPAASLGDMVMATVKKGKPELRKKVMPAIVVRQSKSWRRKDGVYLYFEDNAGVI
                     ANPKGEMKGSAITGPVGKECADLWPRVASNSGVVV"
     gene            <900685..>903036
                     /gene="NDAI0E04040"
                     /locus_tag="NDAI_0E04040"
                     /db_xref="GeneID:11498970"
     mRNA            <900685..>903036
                     /gene="NDAI0E04040"
                     /locus_tag="NDAI_0E04040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670416.1"
                     /db_xref="GeneID:11498970"
     CDS             900685..903036
                     /gene="NDAI0E04040"
                     /locus_tag="NDAI_0E04040"
                     /inference="similar to DNA sequence:INSDC:YBL084C"
                     /note="similar to Saccharomyces cerevisiae CDC27
                     (YBL084C); ancestral locus Anc_7.412"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670464.1"
                     /db_xref="GeneID:11498970"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G0WBV1"
                     /translation="MLFQPELGAVPRPNISSTNDPTVNTDETGPSSTWKKPSVSFLNG
                     DTFIPSSAVLFLSETSMLKLEEVIEHAIEQLNYDTAEFYAELLFAQCSNLENSNIHKI
                     KSIYLYTLALFLNQNYHTSMHVSKDYKHSDIGIAYLYGKCALKLSRKIKEAIDSLVRL
                     KGVFNGNSNAENVQLFPLIHFPNVATIDCLIAKLYSKLDRKHESSLFHSGALNQDPYL
                     WESYTELCKMKVSIDIKALFMGTSQKSSNLRPKKSNRIVKSTVSSSSSTSSLSLSLLH
                     KGSNNIPTVEVTPFNISAPWYNEVPESSINNLNRNLNISRISPARHGKVNDPKNIADG
                     WPTISRNANNLNNNNNNINNESSPGTQRGSSIFSAKQPTSPSVKQPTISSLAKINSNR
                     NRLLTTPPSKLNSNHDQRARYKTLKNISYNTSSNNANMSSTIRKKLLLESDNPNGNMF
                     DAQNDEPLNNLLYSFALILKTSSQYNSYKAIRLINSLLPTHIRDEMPWCQSQLGMLHF
                     EIVNYEMSLKYFEKLRKLQPTRLKDLETYSTLLWHLHDKIKLTVLSNELLKEFKNEPQ
                     TWCCLGNLFSLQKDHKEAIKAFEKVTKLDPTFTYGYTLQAHEYLSDDSFDLAKNYFRK
                     AVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEKARSINPSNVILICCCGVAFEKLSY
                     PEKALSYYELACQVQPSSSLAKFKRAHLLYSMANYPLALECFEELTKLAPEEATVHFI
                     LGQLYNIMGRKKDAVKEYTIAMNLDPKGNQVILEALEKCHEQE"
     gene            complement(<903302..>906220)
                     /gene="NDAI0E04050"
                     /locus_tag="NDAI_0E04050"
                     /db_xref="GeneID:11498971"
     mRNA            complement(<903302..>906220)
                     /gene="NDAI0E04050"
                     /locus_tag="NDAI_0E04050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670417.1"
                     /db_xref="GeneID:11498971"
     CDS             complement(903302..906220)
                     /gene="NDAI0E04050"
                     /locus_tag="NDAI_0E04050"
                     /inference="similar to DNA sequence:INSDC:YBL085W,YER114C"
                     /note="similar to Saccharomyces cerevisiae BOI1 (YBL085W)
                     and BOI2 (YER114C); ancestral locus Anc_7.413"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670465.1"
                     /db_xref="GeneID:11498971"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011510"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="UniProtKB/TrEMBL:G0WBV2"
                     /translation="MSQILLVQNKYLKQMEDELDLKIGDKIKVITDDGKYNDGWYLGE
                     NLKTKEKGLFPVQFTKPYIANNQRNVHENANNTIDNTMNDIDKALRELQMDSFLDISN
                     NNDFTTTINTNANTPGLNIIFNNNGRYSMNDAQFSNHSAPSLNENTTLINRSTHNNVD
                     MDLMNVLNWSPHHVMEYFLKLGFDPKLIQNFGKHKISGKILLQLELNHLKELDINSFG
                     SRFEIFKEIQYIKNFYQNTYCKMKITKFTITSTTFDKKPINLSFTIIVIGNKKTTTYK
                     EKISSNDIITTSSSPYSRSPRRLQSDNNNFIKGIDRKKSGILDTYSYDSLPMISKNFV
                     AEGAFESPGKAPKPPSYPSPIQLKQSPKNNNSNKFRHSSIDLYSSSLPLANNNTDFIF
                     PQSIELNDNNNMISNKNLCTNSTLSSSNTVDMTATSILTEITPISDSAVINSKGTIPN
                     SNTNTNTSTNKHHRKTSSTVTSSSLKRNSVVYTGHKKNQSGGSFIELFNRISTLSPGP
                     MNIKTTTTFENNEIELPQRPASTIYTSSPIHYSHQPYYLRQSSSSNTRTRHHHSHHSR
                     STSTAAATNSYSFPKSPYSNVTNLQYTNNNNSSSNDNRRPHHTRSISNLEVSYSRNIS
                     SSSTTPKDRNNNERRQQPQHKRNSSLLSFFTSFDHDKTVNVDERKTSSSTTVTSARQN
                     SNNLNSLRTPTPLHQRNSSLITSPTKQRQQPSNKNVRSLSSNNILPSPSKDSSTTLTS
                     PNHLRSTSDATNRINKSNHNNSKLKGKQQTSAFQEGRRTIKVEDSIITSNCSGWMYKK
                     SSNKLAIWKKRFFTLHGTRLSYFYDYNDTMERGLIDITSHQVIPLNNESISLLKPSGK
                     YCFKLIPPQPGSKKGLTFTQPRIHYFAVNSKDDMRSWLAALIKATIDIDTDVPVITSV
                     SIPTVSLNEAKRMLKEAREITLECERNRELNEEDEDNMSWDSPPTPKELIATEQSRII
                     "
     gene            <907013..>908737
                     /gene="NDAI0E04060"
                     /locus_tag="NDAI_0E04060"
                     /db_xref="GeneID:11498972"
     mRNA            <907013..>908737
                     /gene="NDAI0E04060"
                     /locus_tag="NDAI_0E04060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670418.1"
                     /db_xref="GeneID:11498972"
     CDS             907013..908737
                     /gene="NDAI0E04060"
                     /locus_tag="NDAI_0E04060"
                     /inference="similar to DNA sequence:INSDC:YBL086C"
                     /note="similar to Saccharomyces cerevisiae YBL086C;
                     ancestral locus Anc_7.414"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670466.1"
                     /db_xref="GeneID:11498972"
                     /db_xref="InterPro:IPR019448"
                     /db_xref="UniProtKB/TrEMBL:G0WBV3"
                     /translation="MAAFSNKNKERRPKFLLFLKINELVNIPQSSGYCYVKWHLKDGT
                     GISPHPKISSTTNDSINISKRDSNATIPNGVSSSSSGSANKTTNDIDKIAMNQSHGTT
                     PKVLVKHHKVQWNFALSKPLQIKLQVDKSRNLQNKYMKFDVFFEFLDSNSSSYCTSPI
                     KCRTSTDTNKGTGDDEEDMKKIKRKTSISSMKSTGSNSYSQKISGKILLGSITIDITE
                     YVKPNEMAFTNRFLLQDSKINSIINVSLQLKIFRGSYNDFNCNKFFTNGQLSNNAQNY
                     TSQGDTLQSDRGGGGGSGGITDILETNSNQSSSNIGNTNTESSTSFNMSNGRFTNNTN
                     NSSRSTGAYTSSATTTSSSFDNNKYIKSTISNSMKPLIEKLYEKTFQLSWDPRPNEFT
                     PKECINDILNGGNGWAKNEKGINLIDLQTLQLNEMELEDPSSLNHGAGAGGHEEEGSN
                     YFSKMSKKEFLERKRRQLERQNSKNKSNAMINNHSNSNNGSNWTHLSPSQREKLRGND
                     NSNNNQADSNVTKHRSMLLNKNRNGSYEDVERDDDNEDSVSSNEIRFDENDIVRDVKN
                     WSVNQIRS"
     gene            <909548..>910837
                     /gene="NDAI0E04070"
                     /locus_tag="NDAI_0E04070"
                     /db_xref="GeneID:11498973"
     mRNA            <909548..>910837
                     /gene="NDAI0E04070"
                     /locus_tag="NDAI_0E04070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670419.1"
                     /db_xref="GeneID:11498973"
     CDS             909548..910837
                     /gene="NDAI0E04070"
                     /locus_tag="NDAI_0E04070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670467.1"
                     /db_xref="GeneID:11498973"
                     /db_xref="GOA:G0WBV4"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:G0WBV4"
                     /translation="MVNLISKWFLSERLPNCHLADLDTRWNPKIGIRNLKRWNPKRND
                     ILHYGFLSSVLLFVFVTNPASFLSKLLFYSFMSLLFLIPITSQFFFNALPVLTWASLY
                     FTSSHFPAANRPPITVKVLPTIETMLYGDNLSDILATSTNNFLDILAWLPYGVFHFGA
                     PVVVAIILFIFGPPTILQGFAFAFGYVNLFGVIIQNIFPAAPPWYKILYGLDPANYSM
                     HGSPGGLARIDEIFNISLYTTAFSNSSVIFGAFPSLHSGCATLLALFFSYTFPRLKPL
                     FIFYVVWLWWSTMYLTHHYFVDLMIGSVISLMVFQYVKYYQLPVISNDAFCRWSYSEI
                     KKYDPVKMNPLASSSSSSLGSSLTGLLNDVENGPLELELNDFEYEKNNENNNQTDTFR
                     SESDESSISYTPSIFDEAVPSSRSNATSTTSLGNFPK"
     gene            <912160..>913647
                     /gene="NDAI0E04080"
                     /locus_tag="NDAI_0E04080"
                     /db_xref="GeneID:11498974"
     mRNA            <912160..>913647
                     /gene="NDAI0E04080"
                     /locus_tag="NDAI_0E04080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670420.1"
                     /db_xref="GeneID:11498974"
     CDS             912160..913647
                     /gene="NDAI0E04080"
                     /locus_tag="NDAI_0E04080"
                     /inference="similar to DNA sequence:INSDC:YBL082C"
                     /note="similar to Saccharomyces cerevisiae ALG3 (YBL082C);
                     ancestral locus Anc_7.407"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670468.1"
                     /db_xref="GeneID:11498974"
                     /db_xref="GOA:G0WBV5"
                     /db_xref="InterPro:IPR007873"
                     /db_xref="UniProtKB/TrEMBL:G0WBV5"
                     /translation="MVHKETKKKNLDVVIEDITTTTTTKKNETKPFERPPIDLIQDMK
                     DGIRYILFNNQANLIIMPILLLIESIVLKYIIFKIPYTEIDYKAYMEQIEMITYDNEL
                     DYSKIRGGTGPLVYPAGHVFIYKLMYKWITDGMENIHDGQVVFRYLYLITLLGQFICY
                     YIMGLKPWCVVLACMSKRLHSIYVLRLFNDCFTTAVMVWVVVLLLCGGKLLEFKSSTK
                     KMQDNSSKTIKKWHLICLSIVISILYSFAISIKMNALLYFPSIMISLYLINEGQLLNI
                     IGYLFVICGIQTIIALPFLKTYPMEYFENAFNFGRKFMFEWSINWQFLHEDAFNNEFF
                     HLSLLICHVMLLLTVILIKYPDFLLNVLESLSYPLSETITNNKDNLNSITSIICYIVI
                     VTNFVGVIFSRSLHYQFLSWYHWTLPLLIHWSHMPIYLGPMWYLIHEYCWNSYPPNKG
                     ASILLTCVNDILLFLVIYYHGDSDVSTNETMNTKVTMVEDDKKEK"
     gene            <916105..>919155
                     /gene="NDAI0E04090"
                     /locus_tag="NDAI_0E04090"
                     /db_xref="GeneID:11498975"
     mRNA            <916105..>919155
                     /gene="NDAI0E04090"
                     /locus_tag="NDAI_0E04090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670421.1"
                     /db_xref="GeneID:11498975"
     CDS             916105..919155
                     /gene="NDAI0E04090"
                     /locus_tag="NDAI_0E04090"
                     /inference="similar to DNA sequence:INSDC:YER109C"
                     /note="similar to Saccharomyces cerevisiae FLO8 (YER109C);
                     ancestral locus Anc_7.406"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670469.1"
                     /db_xref="GeneID:11498975"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="UniProtKB/TrEMBL:G0WBV6"
                     /translation="MQNNINTNNINSDCQTIPNNNCYNNINYQAPSQIINKMNSNNNG
                     NLSSQGGQTFYNNSPIINPSYTNNNNYSNQYSQQIHQQPNIQQQQQQQQQHINNRNYS
                     NNIPNGNNNIHPSPYSSSSSSIRIQNPKPPPSNNMDSQQQQQQYMLQQLQLQQEQYNQ
                     NQRQLQQEKQTLLQKKKITLLNQYIHEFLLKGSLNKTAKLFAEETQINNNSKGESADN
                     KNNTTLSGNSSMLFEWWRIFWDIFNATTHNDGTKLTKDYLSILKIKESKIDQIRSQSI
                     NAARVQYNFEINNQYNSEIDIHNNTNNTFDPYFPSEFINQQRMQQYPPPSSSSPSSSS
                     PSMPPPPSTLQSSQLTNNNNNNNNDKKSYSNQSQNNYQRMVMMNPPPPQQQYNSLQQT
                     SQSPYTTNKPYYNNQPPYSRTPKNEPSQNNHHPVYLSSENNNNNNNTSSSSSSSNTVT
                     GWPVQNHMEEVKSNTNTNRQRFYQQLQHQQKNQTQPSNISFDNDGTITIKDQKQYRKI
                     VSNFSNNNNNKVTKTGKNTSRTKTSGKSSSIPNMVRTSSSSNNNNTNSNNARKSKTPK
                     STTSATTTSASRQSNKKTGSKSTNNIRSRDNRIVVPNDGGTDNTVTKKNLQALTPDLT
                     PIDKRRNSMINNLNGAANESPKAINRIGKNTLQQSTAITATTSSSSSNITRANSNKDV
                     TTSTTTNNNTNNMHFSSLSTIDEKAPIESPSSLSLKGKFSKNNNNNNAKVPINKKRRK
                     STTVIMNIEKKNNRIKEIKDKDMKLNMNTSSSKSEPVTPLNYNGLPSPSLNSNNNNNN
                     TTTSTKRQQEHISSSSSGSSALSPLMEPSVTTNNLSNPITSTTGNSIEIQARGQEHTQ
                     EKIEDEFDFNLNLDMNINLNDINKFNFDPIVGNMELQHTNGRGSVNSIELDNFINIDN
                     IDNIDNIDNNNLHTHTMTALDHAHHRHDDIAGEIISSLNEKRTDNGVVSTVDAAIVHA
                     DHHQHNKGNNSNGNNLDGMANAGDFDTGMLDSSIHDFNFLNWTK"
     gene            <920291..>921496
                     /gene="NDAI0E04100"
                     /locus_tag="NDAI_0E04100"
                     /db_xref="GeneID:11498976"
     mRNA            <920291..>921496
                     /gene="NDAI0E04100"
                     /locus_tag="NDAI_0E04100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670422.1"
                     /db_xref="GeneID:11498976"
     CDS             920291..921496
                     /gene="NDAI0E04100"
                     /locus_tag="NDAI_0E04100"
                     /inference="similar to DNA sequence:INSDC:YBL081W"
                     /note="similar to Saccharomyces cerevisiae YBL081W;
                     ancestral locus Anc_7.404"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670470.1"
                     /db_xref="GeneID:11498976"
                     /db_xref="UniProtKB/TrEMBL:G0WBV7"
                     /translation="MPGQIISTPFLSQLEEIDIRLTNYRNSKSSSSTSSSTSTSTSTY
                     YNHSQYQSKNRFNYNNNNNNNNNNNSYYRQHSAMHNDITILNNNYNNNCNNNINKYNK
                     YNGTNTTNTPISIEGIFDRIPQLKNSNNFRNNYNSNNSNNTNKNNNHHTTTNNYLDKR
                     KQYYNNKPYGYNNNVNFNNNMNASESNQNPMMSTHLRNTYPQMYSHMRNTSMNNTTST
                     ANATNNNLSSTNMDIQPSSIQLPVTPTPYLDMTSSIHHNQSMNNNSTTSNYLMKENQF
                     YSSTAMEQPKPTYPLNTFPTSFHNNTNDNNGIISPIPSSNSNLISNSMFLTPNNTQNR
                     SSSSTSNGFMMNEGATTNSGSSNNSNPIGMNSIWNNNNNNNNINFNNGISNGNNNTNF
                     NGLMMNVWS"
     gene            complement(<921549..>923240)
                     /gene="NDAI0E04110"
                     /locus_tag="NDAI_0E04110"
                     /db_xref="GeneID:11498977"
     mRNA            complement(<921549..>923240)
                     /gene="NDAI0E04110"
                     /locus_tag="NDAI_0E04110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670423.1"
                     /db_xref="GeneID:11498977"
     CDS             complement(921549..923240)
                     /gene="NDAI0E04110"
                     /locus_tag="NDAI_0E04110"
                     /inference="similar to DNA sequence:INSDC:YBL080C"
                     /note="similar to Saccharomyces cerevisiae PET112
                     (YBL080C); ancestral locus Anc_7.403"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670471.1"
                     /db_xref="GeneID:11498977"
                     /db_xref="GOA:G0WBV8"
                     /db_xref="InterPro:IPR003789"
                     /db_xref="InterPro:IPR004413"
                     /db_xref="InterPro:IPR006075"
                     /db_xref="InterPro:IPR017958"
                     /db_xref="InterPro:IPR017959"
                     /db_xref="InterPro:IPR018027"
                     /db_xref="UniProtKB/TrEMBL:G0WBV8"
                     /translation="MTTHTMLLSKRFLQRRFTTNNKFKFIPGYKLKCGLEIHTQLNTK
                     KKLFSSSINHHPSSSETPNSHTNFFDLSLPGTQPILNHESILFALKLSLALNSKINLN
                     SQFDRKHYFYADQPQGYQITQHYSPFAKHGSLTLYHDIDNIKEPTKKINIIQLQIEQD
                     TARSIYLQPPQNLTLLDFNRSNVPLIELVTEPEFNDIDQIKAFIRKYQNLIRHLHIST
                     GDLEDGAMRIDVNVNVNEHPRVELKNLPNTTSIIKAIKYEYTQQVQTLLNQKNGDVFE
                     GGTKSWDGQKTIKLRNKETMVDYRYMPDPELPTITLSTELIESIRKTMPMLPDDIINM
                     LVSHPYCLTMKDAKILTINSNSNSTSNKSAENEVSIYNHEDLRGYYLETCNEFLQLSN
                     TGQKVNEKSPLKLPTNWIIHELIGNLKKLSISFNEFNAKCMNPPTFAEFLTLIKQNVI
                     SNSSAKFLLFEILKQFKDSSSMMTKMEIDLPKLIKKYNLETIDESNEKGQEFINEICN
                     SVIEQTSNDLITEIKMGGKNKEKKLKYLIGQSMKLSKGKISPKEIESCLNKILFL"
     gene            <925680..>930419
                     /gene="NDAI0E04120"
                     /locus_tag="NDAI_0E04120"
                     /db_xref="GeneID:11498978"
     mRNA            <925680..>930419
                     /gene="NDAI0E04120"
                     /locus_tag="NDAI_0E04120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670424.1"
                     /db_xref="GeneID:11498978"
     CDS             925680..930419
                     /gene="NDAI0E04120"
                     /locus_tag="NDAI_0E04120"
                     /inference="similar to DNA sequence:INSDC:YBL079W,YER105C"
                     /note="similar to Saccharomyces cerevisiae NUP170
                     (YBL079W) and NUP157 (YER105C); ancestral locus Anc_7.401"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670472.1"
                     /db_xref="GeneID:11498978"
                     /db_xref="GOA:G0WBV9"
                     /db_xref="InterPro:IPR004870"
                     /db_xref="InterPro:IPR007187"
                     /db_xref="InterPro:IPR014908"
                     /db_xref="UniProtKB/TrEMBL:G0WBV9"
                     /translation="MFSTPLKVTPNDYNINNNQSFSSGYPIPNNIISSSTTTNADPQF
                     HDRNHHTSVQQSNAPIMALTNMSTDLSNNSNSLTSTNTSTTTTTGAATTTTAATSNNG
                     ISNYNLKIQGFGSKKPLELASLYINHLYNQDENTPILDQISYYNNGVSYNFNKEIGGL
                     GAFTPLERTKIINLPDELLQETSKASIKTDMGIFPQLDRTWIIIDNKLILWNHNDPTD
                     YQSIDEIKHTILKVALVKPKPNTFINEINHLLLIATPFDIYILAVSYNGKNSNELSVF
                     NTGMSVSVNGLAVNDIVSYEKTGQIFFSGRSNGLNIWELQYTGSDDWFNSKSNKICLT
                     QSSWANLLPSNVISKIQIPGSELISSFFQNNTTSTTTTNKNANATDSIDGSDNLDIND
                     NNNPHNKRKYTRETVIQLNVDQSRGVIYSLSSNSIIRAYLIKNNNTLSDPVTIHPSYI
                     SRIITTTMAKGAAVLGKNYLQIVKIVPVSQQQNNNLFFVAITVTGVRLYFNGSININS
                     IEAICLESIKFPPSSATPEKIRLELEKQQNNDQQKRRTAPFFSSFNYSSESIQLKLQK
                     KSAVLLTTTDASTIVSPGIFVASVIKKSKIPPSSSSPSHQDQTTTPPPTTTTTKAKPH
                     YHYDRKLFVTLPDYGVLKYHGKYIENATFLDTTAHVKQIIPLTPTFNATEKPIGYANQ
                     FATQYNSENLQIAVVTDTSIEIYKYRNPDEIFESLIDNPLPFIANYGIIEACSSALYV
                     TCKFNKPALLRSNALTFLTVGIPGIIDIKPKYNRYVSSSFPNTNTNTNTNINTTTTIT
                     TKESSMIMKPFTSQDLNLDDVILSPRFYGIALLITRLLRNIWNQKVFITSKPVATTPI
                     KSNTMDNKKSQIDIIGISISKNEIQYYLSSIMILNEFFISYSDSITIFAAPTLSTSSA
                     TNTTTTTTTNNNNPNTLSSVSKDKYEEVSNQAENIAINSIIKLTESIKESLSFLNVLY
                     EESELDGIDNRSNSFKDIINFLNVENQSNLIDLNFKHLFAPNDQTKSLIKDILSSIIN
                     RNISRGASIEYMATTLQDRCGSFCSAKDILGFRAIEHLRKAKEIGLNKDNDNLHYHLD
                     NAMKLFENIVDDISQEKLDEAVQIMVSLDYFPKTIEFLLNIASLIDRGNLAYQYLDNG
                     SMEYDERKIYYDKRINIYDLVFRVLTTIDERSSIVSTTTTITTPTTSSKKNPIEIETP
                     TNTVITRYSGNTNFNKLREESYNIALRCNDKLFHYHLYDWLVSTDNQDKLLQLDTSFI
                     LPYLIEKSTNSLKISNLLWVYQSKKHNFFEAAEILYSLSISKFELKLNERISFLSRAN
                     GFCNSVCPPNQKQRMVQLASTIQELFEVAAIQDDILTLVKTDPRLDMQIKSDLINQLD
                     GEILPLTSLFNDYADPLGYYEICLNIFKVSDFRNSEEILSKWNELFESLKLELKKTND
                     VDYLQDSKTFINLLSSVITKVGKQVHSSELVFPISKLFPIISDLFYKNLPNNQVKEGS
                     IISIFISIPIPYSKLYYILKDLIETTTTTNPNNLLFKKEMTYLIKDWYQSDRKLRDII
                     PYNEIESLKDYNIDPIENYTTRTGNGI"
     gene            complement(<930936..>931295)
                     /gene="NDAI0E04130"
                     /locus_tag="NDAI_0E04130"
                     /db_xref="GeneID:11498979"
     mRNA            complement(<930936..>931295)
                     /gene="NDAI0E04130"
                     /locus_tag="NDAI_0E04130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670425.1"
                     /db_xref="GeneID:11498979"
     CDS             complement(930936..931295)
                     /gene="NDAI0E04130"
                     /locus_tag="NDAI_0E04130"
                     /inference="similar to DNA sequence:INSDC:YBL078C"
                     /note="similar to Saccharomyces cerevisiae ATG8 (YBL078C);
                     ancestral locus Anc_7.400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670473.1"
                     /db_xref="GeneID:11498979"
                     /db_xref="GOA:G0WBW0"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G0WBW0"
                     /translation="MKSAFKSEYPFEKRKAESERITEKFQNRIPVICEKAEKSDIQEI
                     DKRKYLVPADLTVGQFVYVIRKRILLPPEKAIFIFVNDTLPPTAALMSAVYQEHKDRD
                     GFLYVTYSGENTFGHKE"
     gene            complement(<931733..>934948)
                     /gene="NDAI0E04140"
                     /locus_tag="NDAI_0E04140"
                     /db_xref="GeneID:11498980"
     mRNA            complement(<931733..>934948)
                     /gene="NDAI0E04140"
                     /locus_tag="NDAI_0E04140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670426.1"
                     /db_xref="GeneID:11498980"
     CDS             complement(931733..934948)
                     /gene="NDAI0E04140"
                     /locus_tag="NDAI_0E04140"
                     /inference="similar to DNA sequence:INSDC:YBL076C"
                     /note="similar to Saccharomyces cerevisiae ILS1 (YBL076C);
                     ancestral locus Anc_7.398"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670474.1"
                     /db_xref="GeneID:11498980"
                     /db_xref="GOA:G0WBW1"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002301"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR023586"
                     /db_xref="UniProtKB/TrEMBL:G0WBW1"
                     /translation="MSDNTTHFSFSKQEEEVKAFWDEIDAFHRSLELTEDKPEFSFFD
                     GPPFATGTPHYGHILASTIKDIVPRYATMTGHHVERRFGWDTHGVPIEHIIDKKLGIK
                     GKDDVYKYGIDNYNNECRKIVMTYAADWRKTIGRLGRWIDFDNDYKTMYPSFMESTWW
                     AFKELFEKDQVYRGYRVMPYSTGLTTPLSNFEAQQNYKDVNDPAVTIGFDVIGQEKTQ
                     LVAWTTTPWTLPSNMALCVNPEFEYVKIYDEKKDRYYILLEALIKSLYKKPKDEKYKI
                     VEKIKGSELVGLKYKPLFPYFAEEYKETAFRVISDGYVTADSGTGIVHNAPAFGEEDF
                     NVCLAAGIIQPGSTFPNPLDDLGKFTSEVTDFAGVYVKDADKLIIKHLTNTGNLLYAT
                     QIRHSYPFCWRSDTPLLYRTVPAWFVKVKDIVPQMLESVQKSHWVPNVIKEKRFANWI
                     ANARDWNVSRNRYWGTPIPLWVSDDFKEVVCVGSIAELEELTGVTGITDIHRDIIDKL
                     TIPSKQGKGELRRIEEVFDCWFESGSMPYASQHYPFENTEKFNERVPANFISEGLDQT
                     RGWFYTLSVLGTHLFGKVPYKNVIVSGIVLAADGRKMSKSLKNYPDPNIVLEKYGADA
                     LRLYLINSPVLKAESLKFKEDGVKEVVSKVLLPWWNSFKFLDGQIALLKKTSDIDFKY
                     DPNMKSDNVMDRWILASLQSLVQFIHQEMGLYKLYTVVPKLLNFIDELTNWYIRFNRR
                     RLKGENGVEDCLKALNSLFEALFTFVRAMAPFTPFLSDSIYMKLKAFIPADVLSQFSK
                     DDRSVHFLSYPEVREELFDEAIEKAVARMQSVIELGRNIREKKTISLKTPLKTLVILH
                     SDEEYLKDVESLKSYIAEELNVRDIIITTDEAKYNVEYKAVADWPVLGKKLKKDAKKV
                     KDALPSVKSADVQKYLETGELQVADILLVKGDLNVIRGLPESAVQSGQETRTDQEVLI
                     ILDTNIYPELKTEGLARELVNRIQKLRKKCGLNATDDVLVEYELVKDTIDFEDVVKQH
                     LDMVSKTCRSDITKSSGKEGAIADEEQSINDTIFKLKIFKL"
     gene            complement(<935363..>937324)
                     /gene="NDAI0E04150"
                     /locus_tag="NDAI_0E04150"
                     /db_xref="GeneID:11498981"
     mRNA            complement(<935363..>937324)
                     /gene="NDAI0E04150"
                     /locus_tag="NDAI_0E04150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670427.1"
                     /db_xref="GeneID:11498981"
     CDS             complement(935363..937324)
                     /gene="NDAI0E04150"
                     /locus_tag="NDAI_0E04150"
                     /inference="similar to DNA sequence:INSDC:YBL075C,YER103W"
                     /note="similar to Saccharomyces cerevisiae SSA3 (YBL075C)
                     and SSA4 (YER103W); ancestral locus Anc_7.397"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670475.1"
                     /db_xref="GeneID:11498981"
                     /db_xref="GOA:G0WBW2"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:G0WBW2"
                     /translation="MSKAIGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFTD
                     TERLIGDAAKNQAAINPSNTIFDAKRLIGRKLSEHEVVEDIKHFPFKVIEIAGKPVIQ
                     VEYKGETKTFTPEEISSMVLSKMKETAENYLGTKINDAVVTVPAYFNDSQRQATKDAG
                     VIAGMNVLRIINEPTAAAIAYGLDKKGRGEHDVLIFDLGGGTFDVSLLSIDEGVFEVK
                     ATAGDTHLGGEDFDNRLVTHLANEFKRKTRKDLTSNQRALRRLRTAAERAKRALSSSS
                     QTSVEIDSLFEGQDFYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKNQIHELVL
                     VGGSTRIPKIQKLITDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDTSSKTQDLLLL
                     DVAPLSMGIETAGGIMTKLIPRNSTIPTKKSETFSTYADNQPGVLIQVYEGERTKTRD
                     NNLLGKFELSGIPPAPRGIPQIEVTFDIDANGILNVSAIEKGTGKSNKITITNDKGRL
                     SKDDIERMVSEAEKYRAEDEKEAERVQAKNQLETYAFQLKNTASEAAFKEKVGEEDTN
                     ALTSAAQETINWLDASQAASTEEYQDKQKELEGTANPIMTKFYGAAGGAGAGASGMPG
                     AGGPMPGGGPTPGGGGPGGDSGPTVEEVD"
     gene            complement(<938381..>938986)
                     /gene="NDAI0E04160"
                     /locus_tag="NDAI_0E04160"
                     /db_xref="GeneID:11498982"
     mRNA            complement(<938381..>938986)
                     /gene="NDAI0E04160"
                     /locus_tag="NDAI_0E04160"
                     /product="ribosomal protein S8"
                     /transcript_id="XM_003670428.1"
                     /db_xref="GeneID:11498982"
     CDS             complement(938381..938986)
                     /gene="NDAI0E04160"
                     /locus_tag="NDAI_0E04160"
                     /inference="similar to DNA sequence:INSDC:YBL072C,YER102W"
                     /note="similar to Saccharomyces cerevisiae RPS8A (YBL072C)
                     and RPS8B (YER102W); ancestral locus Anc_7.395"
                     /codon_start=1
                     /product="ribosomal protein S8"
                     /protein_id="XP_003670476.1"
                     /db_xref="GeneID:11498982"
                     /db_xref="GOA:G0WBW3"
                     /db_xref="InterPro:IPR001047"
                     /db_xref="InterPro:IPR018283"
                     /db_xref="InterPro:IPR022309"
                     /db_xref="UniProtKB/TrEMBL:G0WBW3"
                     /translation="MGISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGGKRIH
                     TVRIRGGNKKYRALRIETGNFSWASEGVAKKTRIAGVVYHPSNNELVRTNTLTKAAIV
                     QIDATPFRQWYEGHYGQTLGKKKAGKGTEEEIVKTKNSEKKWASRAASAKIEASVEHQ
                     FSAGRLYACISSRPGQSGRCDGYILEGEELAFYLRRLTAKK"
     gene            complement(<940288..>941061)
                     /gene="NDAI0E04170"
                     /locus_tag="NDAI_0E04170"
                     /db_xref="GeneID:11498983"
     mRNA            complement(<940288..>941061)
                     /gene="NDAI0E04170"
                     /locus_tag="NDAI_0E04170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670429.1"
                     /db_xref="GeneID:11498983"
     CDS             complement(940288..941061)
                     /gene="NDAI0E04170"
                     /locus_tag="NDAI_0E04170"
                     /inference="similar to DNA sequence:INSDC:YER100W"
                     /note="similar to Saccharomyces cerevisiae UBC6 (YER100W);
                     ancestral locus Anc_7.392"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670477.1"
                     /db_xref="GeneID:11498983"
                     /db_xref="GOA:G0WBW4"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:G0WBW4"
                     /translation="MATKQAFKRLTKEYKTLTETPPPYILARPNEDNILEWHYIITGP
                     PDSPYSEGQYHGTLTFPTDYPYKPPAIRMITPNGRFKENTRLCLSMSDYHPDLWNPSW
                     SVSTILTGLLSFMTGDEATTGSIVTTDSQKRQFAMNSVAFNNRQNTRFLMVFPDVVQK
                     NWSEIKRREEEILKEKENGNNKNAKHSNDPILEASKEKVITLEEIMDPEDRIRAEQAL
                     AALQEEQKNKQLHKDTPHSSSIYYIVFAIFVFLLGLFMK"
     gap             941460..941479
                     /estimated_length=20
     gene            complement(<941527..>944010)
                     /gene="NDAI0E04180"
                     /locus_tag="NDAI_0E04180"
                     /db_xref="GeneID:11498984"
     mRNA            complement(<941527..>944010)
                     /gene="NDAI0E04180"
                     /locus_tag="NDAI_0E04180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670430.1"
                     /db_xref="GeneID:11498984"
     CDS             complement(941527..944010)
                     /gene="NDAI0E04180"
                     /locus_tag="NDAI_0E04180"
                     /inference="similar to DNA sequence:INSDC:YBL067C,YER098W"
                     /note="similar to Saccharomyces cerevisiae UBP13 (YBL067C)
                     and UBP9 (YER098W); ancestral locus Anc_7.390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670478.1"
                     /db_xref="GeneID:11498984"
                     /db_xref="GOA:G0WBW5"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G0WBW5"
                     /translation="MTMLRRWFSKGDRKKSKAALKDGAISENVTAVELLEPLEGSEYA
                     MEPQESAVDTTVEENQCLTQQLEERPDEQDDTDESVNQLSFQTSTTNKVKHLQQMQKQ
                     HLDANSNNETTFHYDVSNEESANEDMDKNKFSSILSTMTDDYIPFGDGSNKIFGYENF
                     GNTCYCNSVLQCLYHLDDFKLNLLKTSLRSSSLPECSFLEDSPRMRKLEMPGNIPKHF
                     TEASFVDNSKITCTCKNNNNSGKIRKNSDEKIGGKTKTMFRSFIKKTDNNPNNSNNND
                     TNTKKVPCTVHKNINAMKPIQNSAPNLTTHTNFTKLDTRIQHTISETPTGMTQQQRKP
                     SLVQGLSLNVRSNTNNVILGRPIDKKKLSNSFPSSSPTTTKNPSSNNAFSNNLEKKLE
                     MAETLPDIVEISMSGNFKTDIFQENQNLQTNGQQVNQCSPPRYLTIEEKKKNALINGP
                     ILNIDHLLDNNNNKTRDSNLYNGLKDIFECIIENKFLTGVVSPTEFVQLLKKENVLFD
                     TMMHQDAHEFFNFLINQLSDYIQTDCANPQDDNFINESFQGILTNRIKCLSCDNVTSR
                     DEPFLDFPIEVQEHKEFTDISTILKSYHQKEMLGGHNKFYCSQCCTLQEAQRTVGLKK
                     LPNTLALHLKRFKYSEEHFTNIKLFNKIVYPLELNVSSSFTSSISKKYKLQGIVVHMG
                     SSPQQGHYVAICKTDKYGWLLFDDETASWINEEEVLSFIGDEKSQNTAYVLFYEEVKD
                     ENDTISTSSSVTSGKRNKMYEDNIRQVIEYDDLMRLSSKKFSWQKLISGSSTNGMEDL
                     LNPGNILNTKTASPRRKSRLFSFRKNHND"
     gene            complement(<944753..>948466)
                     /gene="NDAI0E04190"
                     /locus_tag="NDAI_0E04190"
                     /db_xref="GeneID:11498985"
     mRNA            complement(<944753..>948466)
                     /gene="NDAI0E04190"
                     /locus_tag="NDAI_0E04190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670431.1"
                     /db_xref="GeneID:11498985"
     CDS             complement(944753..948466)
                     /gene="NDAI0E04190"
                     /locus_tag="NDAI_0E04190"
                     /inference="similar to DNA sequence:INSDC:YBL066C"
                     /note="similar to Saccharomyces cerevisiae SEF1 (YBL066C);
                     ancestral locus Anc_7.389"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670479.1"
                     /db_xref="GeneID:11498985"
                     /db_xref="GOA:G0WBW6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G0WBW6"
                     /translation="MSNDNNNKGSDHPNPHNITPGPSSGALPMKPVLDHKFDDNNKNS
                     NNANKHTLAQTLSSTLPKIKKQRRSDSIPLSGSESFNTTPNTNNNNINLNHRPVTSCS
                     HCRQQKIKCDASQKFPSPCSRCIKMNLFCEIDPDFKPKKGSQIQILRRDVDDLKYKFD
                     YLISNESLFGEFLHQQSMKAENGPNILENLNSMNASSSSQILKRSTATTVPTTSTNID
                     TKNISKDGNKNKIQTSPKNTKICVQTYLVGEPQLLRTETQSPITFKKDASSNATEFTR
                     KDSVSSSHASLKKNLPPLLNDSAPTNNGKEGLPIALKMALHRNTSPPNSTSPSMPYNE
                     NNNNRNEQHVSTNQLGEKNNDKATNQNNKSESTITRTTDAQHKEHVIATTNTIAPLSS
                     PHPITDLNIDEFVLGEVNISISKANELHSIFVKEYLPYFPILHTNSAIELYSQSQLLF
                     WTVMLTACLSDPEPTMYIKLASLIKQLAVETCWMRTPRSTQISQALLILCIWPLPNQK
                     VLDDCSYRFVALAKSLSYQLGLHRGKFIQEFTRTQTSMPNAEKWRTRTWLGIFFAELC
                     WTSILGLPPTSQTDYLLENARLAQDEENDADDADGTTDSDQNSNGIDKLPKRFRRLIC
                     LANFQSKLCNVMGSSVMSPDGLMEPKDRGGALSILERELERLNRKLDFQSDIVIHIYY
                     LYVKLTVCCFAFLPETPIEDQTQYVTDAYFCSTQIVTLLNKLLEKQQLIALPIYIRQS
                     ATFASLILFKLQLNPMMLDKYLDSARQSIVTIHRLFRNQLTAWTTGVENDISRTASML
                     EKLNMVLITHPEVFIEETGIISRMRSHLTGSLFYDLVWCVHEARRREMDPKYNKEAIE
                     KAQQKRKAKDGDSPDLKIWEMKLYPLPLYNHISKEDFQTVTQTTPSGTTVTTLVPTKT
                     ALKNAETLAKSKNKDSDGIISEINGIPLSMLDATGSVQLDINELFHDTGNTSSFTTDA
                     VMNSKTNSSHKLPPLVPANQPSLSKQPVKSNSNTEFASRSNGRVKNNTTITTSDENNI
                     TSNDDGNEPATVPSTRPLLSPVTSSIQRFNNPKSLFGNHNKSNVQLPEKLSQTNLNSM
                     KSINSNNNNKNTITNSNNYNNNNNLIQQQSPSSSSLLPFSISHSNSFSNLNLFPPQVP
                     TNDNNTTVSNMLNKYRTNTSAAADSRTNLNAPNTATNNNSNGTEPLQHTASRVQLNQL
                     SDFFQQQTAGWIEDNLSNDDIFGWFGMDMEPKF"
     gene            complement(<949094..>949858)
                     /gene="NDAI0E04200"
                     /locus_tag="NDAI_0E04200"
                     /db_xref="GeneID:11498986"
     mRNA            complement(<949094..>949858)
                     /gene="NDAI0E04200"
                     /locus_tag="NDAI_0E04200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670432.1"
                     /db_xref="GeneID:11498986"
     CDS             complement(949094..949858)
                     /gene="NDAI0E04200"
                     /locus_tag="NDAI_0E04200"
                     /inference="similar to DNA sequence:INSDC:YBL064C"
                     /note="similar to Saccharomyces cerevisiae PRX1 (YBL064C);
                     ancestral locus Anc_7.388"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670480.1"
                     /db_xref="GeneID:11498986"
                     /db_xref="GOA:G0WBW7"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR019479"
                     /db_xref="InterPro:IPR024706"
                     /db_xref="UniProtKB/TrEMBL:G0WBW7"
                     /translation="MLFSRQLTTNTFRLMTPIGKRFLSGHTLRINSQAPNFDVDSTIG
                     KLNFYEYLGDSWGVLFSHPADFTPVCTTEMSAFAKLKPEFDKRNVKLIGLSVEDVESH
                     NKWIKDIEDISGEFGFNLNSNDKFGFPIIGDVDKKVSMLYDMVDEEAFKKLQDGAKDK
                     KGIDVATIRSVFIIDPKKKIRLSFNYPGSVGRNTSEVLRCIDALQLSDSKGVVTPANW
                     SVNDDFIIPPKVSDQEAKEKFGDFKKIKPYLRLTKG"
     gene            <950949..>952151
                     /gene="NDAI0E04210"
                     /locus_tag="NDAI_0E04210"
                     /db_xref="GeneID:11498987"
     mRNA            <950949..>952151
                     /gene="NDAI0E04210"
                     /locus_tag="NDAI_0E04210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670433.1"
                     /db_xref="GeneID:11498987"
     CDS             950949..952151
                     /gene="NDAI0E04210"
                     /locus_tag="NDAI_0E04210"
                     /inference="similar to DNA sequence:INSDC:YBL055C"
                     /note="similar to Saccharomyces cerevisiae YBL055C;
                     ancestral locus Anc_7.373"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670481.1"
                     /db_xref="GeneID:11498987"
                     /db_xref="GOA:G0WBW8"
                     /db_xref="InterPro:IPR001130"
                     /db_xref="UniProtKB/TrEMBL:G0WBW8"
                     /translation="MRIVPPILLKQTKKLVTPKNMTRATKYYDIGLNLTDPMYQGIYN
                     GKKYHESDIKQVLNRAVDRHVKCGLLTGSSWKESNQAIALSHKYGEGTGVKLYYTIGV
                     HPCCVNEFAMEDSMTIDNPTHDEKFNESLIHDILREGSEKNKVAIKKLRQLYELIERQ
                     LQDDKERFRAVGEIGLDYDRFHYSSKQLQLVFFEEQLKLSCLIRDPKLSLFLHMRNCS
                     NDFVTILKKFIDGFEDLEDPFNWKGMFNTRQAISYKFDKDRKFVVHSFTGSEEDMNNI
                     LNLSSNCYIGMNGCSLKIEENIECAKKIPLTRLLLETDAPWCEIRRTHESFKYLKEFI
                     IPYKSVKRDKLAKLSMEDDWPTTMIKSRNEPCTMEQVATVVANVKELNIDEVMEQVWE
                     NSCKIYGE"
     gene            complement(<952289..>953710)
                     /gene="NDAI0E04220"
                     /locus_tag="NDAI_0E04220"
                     /db_xref="GeneID:11498988"
     mRNA            complement(<952289..>953710)
                     /gene="NDAI0E04220"
                     /locus_tag="NDAI_0E04220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670434.1"
                     /db_xref="GeneID:11498988"
     CDS             complement(952289..953710)
                     /gene="NDAI0E04220"
                     /locus_tag="NDAI_0E04220"
                     /inference="similar to DNA sequence:INSDC:YBL056W,YER089C"
                     /note="similar to Saccharomyces cerevisiae PTC3 (YBL056W)
                     and PTC2 (YER089C); ancestral locus Anc_7.374"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670482.1"
                     /db_xref="GeneID:11498988"
                     /db_xref="GOA:G0WBW9"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:G0WBW9"
                     /translation="MGQILSNPIIDKTVFSGTDEFTSFGISSMQGWRINMEDSDIQEL
                     KVQIVNTATDLEEEDHLALFAVFDGHGGPNVARFCREKFTSIFKRQFASIEQKQKQKH
                     LESMYMDALENTFFDLDKELLSRSFNVNEKSGSTAIVILISKKLNLVICANAGDSRSI
                     ISIDGQAKNLSFDHKPNLINEKLRIEKAGGFIEMNRVNGNLALSRAIGDFNYKMNDKL
                     SKYEQMVTCAPDFITHTLDYADDEFVILACDGIWDCLSSQDCIDLVHYGIHLGNMSLT
                     DICSKIIDCVLSPDAEGSGIGCDNMTIIIVALLKNEESLHDWFQRIRNKNSNNKKNLI
                     SFEQKRRQIFSYYKFPDDDKLIFNATSGPPIENKAASTNNDKKGTTSNNDKEESHDEK
                     DSKTGNPLNLFSLDKLLKADAKMNENVNTETMYEDNSISQMIASLSDAAAGETGPDTT
                     DDGDDDDDECESANEKKRTNSTE"
     gene            <954503..>955399
                     /gene="NDAI0E04230"
                     /locus_tag="NDAI_0E04230"
                     /db_xref="GeneID:11498989"
     mRNA            <954503..>955399
                     /gene="NDAI0E04230"
                     /locus_tag="NDAI_0E04230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670435.1"
                     /db_xref="GeneID:11498989"
     CDS             954503..955399
                     /gene="NDAI0E04230"
                     /locus_tag="NDAI_0E04230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670483.1"
                     /db_xref="GeneID:11498989"
                     /db_xref="UniProtKB/TrEMBL:G0WBX0"
                     /translation="MSKRFKSDVPSNNEEEENENENEPYEFQSKSTERYKDYNTDNKR
                     KVHFEKLNSTVFDLYFNHEDKYKDYDYSRPDLIRLATGNLNKDNNHITKKRKRIKSNS
                     SNNDLASKLRMKICENDGSFSKTPDFSASPVTMYQPKDTIRTSKNSSSKQTKSHLNTN
                     ADITTNLYWTKDGFHKFNEQPSESQSQSRSHHEDIHISKQEQDHENDNVTRIQGSQQT
                     RNNALAPMEAMDHSVYKYHIATRYPNCIWEPKQRNSKEHENTMTQHSNDRHRHQYRHQ
                     DRTNRKKSKHITHFITFLYQFL"
     gene            <955637..>956317
                     /gene="NDAI0E04240"
                     /locus_tag="NDAI_0E04240"
                     /db_xref="GeneID:11498990"
     mRNA            <955637..>956317
                     /gene="NDAI0E04240"
                     /locus_tag="NDAI_0E04240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670436.1"
                     /db_xref="GeneID:11498990"
     CDS             955637..956317
                     /gene="NDAI0E04240"
                     /locus_tag="NDAI_0E04240"
                     /inference="similar to DNA sequence:INSDC:YBL057C"
                     /note="similar to Saccharomyces cerevisiae PTH2 (YBL057C);
                     ancestral locus Anc_7.376"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670484.1"
                     /db_xref="GeneID:11498990"
                     /db_xref="GOA:G0WBX1"
                     /db_xref="InterPro:IPR002833"
                     /db_xref="InterPro:IPR023476"
                     /db_xref="UniProtKB/TrEMBL:G0WBX1"
                     /translation="MMIPQYNSNIPLIFGIAAASLATGYYLGQLTPSHLSLNKNEKKA
                     QKSLNAEDNTAINNDTKKNIKKNTLTKQSEQYDSEVSSDEDEEESEEEEIESTSLNDI
                     PGEVRLSLVIRQDLNMTKGKIAAQCCHAALSCFRLIAMDPSKNLIIPTMTERWLRHGQ
                     AKITLKCPNEEIMDELYAKAMSLGVNASVIHDAGRTQIAAGSATVLGIGPAPRAVLDQ
                     ITGDLKLY"
     gene            complement(<956574..>957755)
                     /gene="NDAI0E04250"
                     /locus_tag="NDAI_0E04250"
                     /db_xref="GeneID:11498991"
     mRNA            complement(<956574..>957755)
                     /gene="NDAI0E04250"
                     /locus_tag="NDAI_0E04250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670437.1"
                     /db_xref="GeneID:11498991"
     CDS             complement(956574..957755)
                     /gene="NDAI0E04250"
                     /locus_tag="NDAI_0E04250"
                     /inference="similar to DNA sequence:INSDC:YBL058W"
                     /note="similar to Saccharomyces cerevisiae SHP1 (YBL058W);
                     ancestral locus Anc_7.377"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670485.1"
                     /db_xref="GeneID:11498991"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR012989"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G0WBX2"
                     /translation="MSHEVTDDDIEQFIALTNSSPAIATQFLKEFGSVNEAINSYFAT
                     QTTNDPNYRSPPVSAIQRVQDLLSDADDSHNSGKENTPSSTKSADSKGSKFMSFSDMV
                     RTQADEEDEDPDKPRNTFAGGETSGLEVTDPNDSNALIKDLLEKAKRGGEQMERDGSS
                     DSPAEEQHHFLGRGYRLGSSVDAPSRVIEGDRDAVGPMPKRVAREITFWKEGFQVGDG
                     ELYRYDDPANSFYLKELNQGRAPLNLLNVEFGQEVDVNVHKKIDESFKPPKRKLGGFH
                     GQGQRLGSPIPGESESSVEPSILKAKAEETTAAKTEVEEPKGDTSVQIRYASGKREVF
                     RCYSTDKVQKLYDHVMENTQDHSRTFTLNHAFPVKPVENLDSTIKDADLVNSVVVQRW
                     A"
     gene            complement(<958086..>958412)
                     /gene="NDAI0E04260"
                     /locus_tag="NDAI_0E04260"
                     /db_xref="GeneID:11498992"
     mRNA            complement(<958086..>958412)
                     /gene="NDAI0E04260"
                     /locus_tag="NDAI_0E04260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670438.1"
                     /db_xref="GeneID:11498992"
     CDS             complement(958086..958412)
                     /gene="NDAI0E04260"
                     /locus_tag="NDAI_0E04260"
                     /inference="similar to DNA
                     sequence:INSDC:YBL059W,YER093C-A"
                     /note="similar to Saccharomyces cerevisiae YBL059W and
                     YER093C-A; ancestral locus Anc_7.381"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670486.1"
                     /db_xref="GeneID:11498992"
                     /db_xref="UniProtKB/TrEMBL:G0WBX3"
                     /translation="MEEFKIRRKQQMIRFFSSTVITLVCTKLILRRLQLPKYVPSMFE
                     LNYIRPPITTVKKDLINAGMLTTGMTLGVFSMIFFGTCWNWNVSTLAELKDALNSGTT
                     DDKQNI"
     gene            <958794..>959239
                     /gene="NDAI0E04270"
                     /locus_tag="NDAI_0E04270"
                     /db_xref="GeneID:11498993"
     mRNA            join(<958794..958827,958920..>959239)
                     /gene="NDAI0E04270"
                     /locus_tag="NDAI_0E04270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670439.1"
                     /db_xref="GeneID:11498993"
     CDS             join(958794..958827,958920..959239)
                     /gene="NDAI0E04270"
                     /locus_tag="NDAI_0E04270"
                     /inference="similar to DNA sequence:INSDC:YBL059C-A"
                     /note="similar to Saccharomyces cerevisiae YBL059C-A;
                     ancestral locus Anc_7.382"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670487.1"
                     /db_xref="GeneID:11498993"
                     /db_xref="InterPro:IPR013892"
                     /db_xref="UniProtKB/TrEMBL:G0WBX4"
                     /translation="MHPQLEAERFHSCLDFIEALDKCHKKEYYKRIFGLCNNEKDALS
                     QCLKEASLETKKKAIKQNREKRAQLDAKWKKIDEEEYGQDTILKKIIERQYNKKLAEE
                     SMNSEIPNQTQQKKE"
     gene            complement(<959418..>961778)
                     /gene="NDAI0E04280"
                     /locus_tag="NDAI_0E04280"
                     /db_xref="GeneID:11498994"
     mRNA            complement(<959418..>961778)
                     /gene="NDAI0E04280"
                     /locus_tag="NDAI_0E04280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670440.1"
                     /db_xref="GeneID:11498994"
     CDS             complement(959418..961778)
                     /gene="NDAI0E04280"
                     /locus_tag="NDAI_0E04280"
                     /inference="similar to DNA sequence:INSDC:YBL060W"
                     /note="similar to Saccharomyces cerevisiae YBL060W;
                     ancestral locus Anc_7.384"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670488.1"
                     /db_xref="GeneID:11498994"
                     /db_xref="GOA:G0WBX5"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR023394"
                     /db_xref="UniProtKB/TrEMBL:G0WBX5"
                     /translation="MPSSDADVNVILDLLDNIQPSKSTKNAIISSPSIHSKSRTLLES
                     PKLTNINDFVELNRLDPNNYNNAERNNNTSPRINISQGEQSSNTIIPMNTPLSSIDSS
                     QGNTEQNDINNKNLNYRKIDNKDSDTDTDVDETYAVTCDILKGTLQGYSFKDYADFLG
                     SKENHEILQTFIHLLRPLPLSLLSVLQKISSNLYFIAEAQNIDRILEETSKQWVQCHP
                     DTIWKSNYKLCHIVLFSLLILNSDLHNNITATSNNNKSKTNISGSKHQQKFTSSAFIS
                     NTIYALEREPESHNIDMNQIRPHLQHELLSYYEALKYTPLPLFSKHSSKHARPSSIRT
                     SSKLSFNFDNNNNNNDRQYQMDRSNSRTQSIYSTNDSILTSSTTTTTTTTTTTTTKAR
                     REFENTTSNWKFHHNIPLPQLYTKEPIDDLLLRNKSTKKLWNIDSILSIIDKNKMMDV
                     ATYDDNITSSGNPVDPSSSSSNNKRGSINSNNNNNNKSIFKWLKITNKRNSLFDEKKS
                     QLSMLEANSKWVKARIRIFEGRIFIFKLKKNIVLHSENNLTNNFDHFKKICSDYFVYN
                     LYECISEVFQDNVIIGSHTTGNHTSTRKKTNPVGNFTISFPNGINGGANVLEFKTNSI
                     KDAHDYVSCINFWAARLTPIPMTQFEIVSNQEYGWSDRLLNAYKDNLTNDEANKIRLC
                     VWKPLLSLELLYDDMDSLLNGQTNFELQLLQLKQFTQQLDEWIDKHNEIKSKIIELWS
                     GTQFFEKVMDNWNAKYLYMFTQYKKRSSYLRALEKVRDTINTALAE"
     gene            <963171..>965090
                     /gene="NDAI0E04290"
                     /locus_tag="NDAI_0E04290"
                     /db_xref="GeneID:11498995"
     mRNA            <963171..>965090
                     /gene="NDAI0E04290"
                     /locus_tag="NDAI_0E04290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670441.1"
                     /db_xref="GeneID:11498995"
     CDS             963171..965090
                     /gene="NDAI0E04290"
                     /locus_tag="NDAI_0E04290"
                     /inference="similar to DNA sequence:INSDC:YBL061C,YER096W"
                     /note="similar to Saccharomyces cerevisiae SKT5 (YBL061C)
                     and SHC1 (YER096W); ancestral locus Anc_7.386"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670489.1"
                     /db_xref="GeneID:11498995"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G0WBX6"
                     /translation="MAMTPSSIHPYKKHLLQSRNLPFETANNVSPELRQASPAVSEGN
                     TYQNDRFTSTTSINRPPSNVSNSFSNLGPQSRAQSQSQLQLQAPSLRETVSDISGNNI
                     NNTNNNLSQEYFDLPPPSLPHSGQRSIVSLNSPSPAASSSSSSSVAINKINRNNNNSN
                     NIFANGSTSSLNTNTTGNNKNTKKTRTRSVDLSHLYLLNSSQETQLTATNESVADISH
                     QMISHYLGDENNSSLVPRLETIEMYRQNVKKSKDPNVLFQYAQYILQTALTTSESSSP
                     VSIRTPSKKNVSTKTITQKELKKQFLKEAQHYLKKLSDKGYSDAQYLLADAYSSGAFG
                     KIENKEAFNLFQTAAKHGHIESAYRTSHCLEEGLGTARDSRKALNFLKFAASRNHSSA
                     MYKLGLYSFYGRMGLPNDVNTKQNGVKWLSRAAARANELTCAAPYELAKIYEQGFLDI
                     VIPDEKYAMELYIQAATLGHTKSATLLGQIYEAGNDVVQQDTSLSIHYYTQASLQGGD
                     PVAMLGLCAWYLVGAEPAFKKDENEAFQWALRAANAGLPKAQFTLGHFYEHGKGCEIN
                     ESLAWKWYERAAENNDERALNKVGSKFGQDKLKNLSTGDAKVKGKQLLKGKTHKKSKS
                     ISSLNLFSVFESNKK"
     gene            complement(<965403..>968963)
                     /gene="NDAI0E04300"
                     /locus_tag="NDAI_0E04300"
                     /db_xref="GeneID:11498996"
     mRNA            complement(<965403..>968963)
                     /gene="NDAI0E04300"
                     /locus_tag="NDAI_0E04300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670442.1"
                     /db_xref="GeneID:11498996"
     CDS             complement(965403..968963)
                     /gene="NDAI0E04300"
                     /locus_tag="NDAI_0E04300"
                     /inference="similar to DNA sequence:INSDC:YBL063W"
                     /note="similar to Saccharomyces cerevisiae KIP1 (YBL063W);
                     ancestral locus Anc_7.387"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670490.1"
                     /db_xref="GeneID:11498996"
                     /db_xref="GOA:G0WBX7"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:G0WBX7"
                     /translation="MSQNHQSRSAMNSTSGSRRTTSIGPVPNLNRRTTISGINNNTNT
                     NNNSKQPFSSNFDKHITPSQRSLTQRRQQKKQRLSPINSSPSNSTTSSSETNILSSSS
                     SPSSTNIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYPKKSYSFD
                     RVFGAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLES
                     KDMILLGEHAGIIPRVLVNLFKMLALENDYSVKISFLELYNERLKDLFAQNESEEETI
                     RIFDNNNNASSSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVF
                     TIATNITKIDPISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLG
                     RVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAI
                     RAKSIKNTPQINQSMSKDTCINEYVSEIERLRLELKTSRQKDGICITQDQLDLYESNG
                     ILVDEQKTKIHNMEEQIQKFKEKYVRQTELNKNLESNLKENEQVTKQLRSEKYQLMDL
                     LENYQINSNSFVQRVLQIHESNIALIQNLDKERNRIHHNSTQYMNNMEETFNQLSIQR
                     DELLRLKNSLQSYNINFNDVMQSVFNELETNVVANQKETSNKLGSISLMKTFELLQNL
                     ELTLAKDLNLLNEPYLRDTNHFLISHKTILEECYNNVHSCTKSMEGLISTQLTDLNGY
                     LSSSFKDLEDQTIEETEDLKQVIISQQKKIQTLEHQFMKEKESTNSLNENLQSLKSYF
                     QDHVSKERSNIFKDIKNIINQAEKKQTDLDVDILQRSENVLTQFNKGLQERQDKQMSS
                     LLMETIASLLSINEHTEKLPFTLKESFDRNKTSLETRVKEIPIQKSFNEIITTVKDRT
                     NIEVSNNLEKLITKFNTELTSGLTSKQISIQNAFKTLHDTITEENQFNENNLESIKSK
                     LSELYHYILNDYKDNTLQISKSQSDIIIDHCSSVESVMASINEPIQQYSQPNYPILKL
                     EVNNEIIDELPKLSKPKNFHIYTEMKNSSSSSSSEFFVPNAVSPMGHNMVDPTNYIPS
                     TPVPVPDQPLPKVLVPKSINSNNKRAVTMPIVTAKNTNAIKNGDDTTSKPGIENQHPV
                     NNLKRRFTTVPNLRMDNKNNNDDTSNNNNRDVSKKARLDK"
     gene            <970604..>972424
                     /gene="NDAI0E04310"
                     /locus_tag="NDAI_0E04310"
                     /db_xref="GeneID:11498997"
     mRNA            <970604..>972424
                     /gene="NDAI0E04310"
                     /locus_tag="NDAI_0E04310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670443.1"
                     /db_xref="GeneID:11498997"
     CDS             970604..972424
                     /gene="NDAI0E04310"
                     /locus_tag="NDAI_0E04310"
                     /inference="similar to DNA sequence:INSDC:YBL054W,YER088C"
                     /note="similar to Saccharomyces cerevisiae YBL054W and
                     DOT6 (YER088C); ancestral locus Anc_7.372"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670491.1"
                     /db_xref="GeneID:11498997"
                     /db_xref="GOA:G0WBX8"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:G0WBX8"
                     /translation="MPVPKSIRGVNHVSSSITPTRITPIGMNPKIERKQQKHNTFEQL
                     SSSSSWSSASISSPYQQSDNLLTKNSTAKDAIDNTGPHPKKNSTKITMAQGPTATENE
                     NKNKNPSSWEPEDDILLRQLKELKKLGWKEIAQHFHNRTPNACQFRWRRLKSGNLKSN
                     KTALLDLSQLTMGSDIKRSSTPLEPIVSSNGSTSDKYKDLIPKSNKPKAVVSIIEPKR
                     KETIDDNTISTSFNGFVSPKNIRSNISIDKTLLSPPPGLPKLPASHTNATKASKSFVK
                     PRSFSHSVTRPNFSTSQSSVATSMKLQPDAENIGFIPKIIIKSRRSSFATNFNNTTNN
                     INNNINNNINNAPTNSNLLSTMKTTLVTSKSRRNSFLPSSHQHHHQHTYINNNNNHLH
                     TMNHPHHQYHHNTPRRLSFNYNNSNNNSNTNSVTNSRRSSMVMAPNSANIVFNNYQPS
                     LPNTRKNSITVLRKEQLPSAVHTNSIEPQQQEQRHSFSSKFTFINSENPHANHRDRKE
                     LFSMWTNDEDDVLKIGNSKKLSAIELSILLPNKSDNQIETRMKKLFTTKEEERDHDDA
                     LDGDHLSVLHSYSKMKTDIIDDSVNENKYLPTPKFSPSDE"
     gene            <974435..>976015
                     /gene="NDAI0E04320"
                     /locus_tag="NDAI_0E04320"
                     /db_xref="GeneID:11498998"
     mRNA            <974435..>976015
                     /gene="NDAI0E04320"
                     /locus_tag="NDAI_0E04320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670444.1"
                     /db_xref="GeneID:11498998"
     CDS             974435..976015
                     /gene="NDAI0E04320"
                     /locus_tag="NDAI_0E04320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670492.1"
                     /db_xref="GeneID:11498998"
                     /db_xref="GOA:G0WBX9"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="InterPro:IPR026030"
                     /db_xref="UniProtKB/TrEMBL:G0WBX9"
                     /translation="MSEFEAKETYDIVDLEKNFPSTQTSEKVFTENGSLSVEEQFSVD
                     NTKAAKLVIFSNLINRLNAETNGIDPISDEDKTEGSVLNATTMWFSANLVLSAYAVGA
                     LGPLAFGLNFGTSVLTVVFFNILGVLPVAFFSLFGPELGLRQMILSRFLTGNITGRIF
                     SLFNCVACVGWCVLNTIVAAQLLNMVNEGGHQLPLWAGCLVIISGTVLVTFFGFKIIH
                     AYEKWSWVPNFAVFLIIIARLKMSGKFSGGEWTSGSTTAGNVLSFGCAAFGYAAAWAT
                     YAADYTVYMPRDSNKFKIFFSLVAGLIFPLCFTMILGAACAMGAVNDPVWKQYYDTNA
                     MGGLTYAILVPNSLHGFGDFCCVLLALSTIANNIPNMYTIALSVQAFWEPLAKIPRAL
                     WSVAGNATALGIAIPACYYFESFLEKFMNTIAYYAAIYICLSCAEHFVFRRSIKAYNV
                     EDWNDPSKLPVGIAGCAGLIVGAFGVALGMCQSYWVGEIARLIGKSGGDIGFELGGGW
                     AFITYVVVRFLELKYIGR"
     gene            <978236..>979858
                     /gene="NDAI0E04330"
                     /locus_tag="NDAI_0E04330"
                     /db_xref="GeneID:11498999"
     mRNA            <978236..>979858
                     /gene="NDAI0E04330"
                     /locus_tag="NDAI_0E04330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670445.1"
                     /db_xref="GeneID:11498999"
     CDS             978236..979858
                     /gene="NDAI0E04330"
                     /locus_tag="NDAI_0E04330"
                     /inference="similar to DNA sequence:INSDC:YER056C"
                     /note="similar to Saccharomyces cerevisiae FCY2 (YER056C);
                     ancestral locus Anc_7.236"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670493.1"
                     /db_xref="GeneID:11498999"
                     /db_xref="GOA:G0WBY0"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="InterPro:IPR026030"
                     /db_xref="UniProtKB/TrEMBL:G0WBY0"
                     /translation="MSSLSDKKNVYELTTDLERNSGSFINSNTHSSSPNDDNDVKIAI
                     TYSGDEETPYIIESSEPAKLSIFNRIASQLNAETNGVEPITDEEKTDDSLLNASSMWF
                     SANLVIAAYALGGLGPLVYGLNFGTSVLVIVFFNILGLLSVAFFSVFGAEFGLRQMIL
                     SRFLLGNITARVFAVINSVACVGWGVVNTLASAQLLNMVNHTSGHSCPIWAGCLIIVG
                     CTVLVTFFGYNIIHAYERWSWVPNLAVFLVIIARLSKSGNFSGGEWTSGPNTAASVLS
                     FGSAVYGFATGYTTFAADYTVYMPRSTNKYKIFFSIVAGLSFPLFFTMILGAACAMGA
                     VNNPAWKAYYDTNGMGGVTYAVLVPNSLHGFGEFCCVLLAMSTVSNNIPNMYTVALSV
                     QAIWSPLSKVPRVAWTMMANAATFGIAVPAGYYFDGFMENFMNTIGYYLAIYTAISLS
                     EHFIYRHGFKGYNIEDWNDTSKLPIGIAGCCALVVGAFGVALGMSQTYWTGEIAVLIG
                     DFGGDIGFELGASWAFIVYNILRPLEIKYFGR"
     gene            <981301..>982194
                     /gene="NDAI0E04340"
                     /locus_tag="NDAI_0E04340"
                     /db_xref="GeneID:11499000"
     mRNA            <981301..>982194
                     /gene="NDAI0E04340"
                     /locus_tag="NDAI_0E04340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670446.1"
                     /db_xref="GeneID:11499000"
     CDS             981301..982194
                     /gene="NDAI0E04340"
                     /locus_tag="NDAI_0E04340"
                     /inference="similar to DNA sequence:INSDC:YER055C"
                     /note="similar to Saccharomyces cerevisiae HIS1 (YER055C);
                     ancestral locus Anc_7.232"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670494.1"
                     /db_xref="GeneID:11499000"
                     /db_xref="GOA:G0WBY1"
                     /db_xref="InterPro:IPR001348"
                     /db_xref="InterPro:IPR011322"
                     /db_xref="InterPro:IPR013115"
                     /db_xref="InterPro:IPR013820"
                     /db_xref="InterPro:IPR015867"
                     /db_xref="InterPro:IPR018198"
                     /db_xref="InterPro:IPR020621"
                     /db_xref="UniProtKB/TrEMBL:G0WBY1"
                     /translation="MDLVNHLNDRLLFAIPKKGRLYEKSVTILNGSDIKFHRSQRLDI
                     ALCTTLPIALIFLPAADIPMFVGEGRCDLGITGVDQVREAKMDVELPIDLKFGSCKLQ
                     VQVPVNGEYKNPKQLIGKTIVSSFTNLTKEYFAKLEGVPIEKMATKVKYVGGSVEASC
                     ALGVADAIVDLVESGETMRAAGLIDIATVLETSAHVIESKRPNKDIELIETIKSRIEG
                     VITAQRYVCCNYNAPEGQLKELLPITPGRRAPTISKIDSEGWVAVNSMIERSKKGIIM
                     DELKRKGAADIMVFEISNCRV"
     gene            <983232..>985091
                     /gene="NDAI0E04350"
                     /locus_tag="NDAI_0E04350"
                     /db_xref="GeneID:11499001"
     mRNA            <983232..>985091
                     /gene="NDAI0E04350"
                     /locus_tag="NDAI_0E04350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670447.1"
                     /db_xref="GeneID:11499001"
     CDS             983232..985091
                     /gene="NDAI0E04350"
                     /locus_tag="NDAI_0E04350"
                     /inference="similar to DNA sequence:INSDC:YER054C,YIL045W"
                     /note="similar to Saccharomyces cerevisiae GIP2 (YER054C)
                     and PIG2 (YIL045W); ancestral locus Anc_7.230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670495.1"
                     /db_xref="GeneID:11499001"
                     /db_xref="InterPro:IPR005036"
                     /db_xref="UniProtKB/TrEMBL:G0WBY2"
                     /translation="MYVKAENKRPSFSSLQGDMNKNKNEGSLSAIQTSISRGPPTYGK
                     ENENDSHHKNIIQDVSENMVDNSNAHAHPPSLIQQHFQKYNASQGNPTHMSDLKPPKR
                     SPVNSLAFLHKPQRVTRMNIDKFPEEELERNTNLNKNIKSGFNENNFAEINIDDENKG
                     NNGNDITEYSPIDFPSLSPRSTIPTNSFIRPSPPLNSDNDNPINSDEHQIPFFPVYKK
                     SGELLKSSLKRRSKSLPSTSEILTKQKNRGNENNDDPRMMLMRSKSVHFGHKAPVKYF
                     SKDESPISVQDRDEFEALLNFKQNANSPLAFDEEEMMSANLQKLRIGEQSMPIKSSAS
                     ETKLRKSKRFQNVIKDKKNKNESSDSDNNITSSSSDLRLNDKENITRKNLAKFNEISD
                     NLKIPKESHNVSKNIITSLPSRGGKVNLTYNKVVGLYNINFPILSNKNPKSLKLNIFI
                     KLSKDQKCFPQEISLHIDRESRLNPYHMPFTSSSDSLNSINSVTGRSTTGKQTIQRST
                     RIITGKILVKNIFYDKRVVVRYTWNGWRTVHDVECIWVSDADGIVPGTNMEVFRFLID
                     DVSKVDSRAKLEFCIQYTTRNDHVRQEYWDNNDGKNYKVGLVLNGFNNPFAVK"
     gene            <986659..>986772
                     /gene="NDAI0E04360"
                     /locus_tag="NDAI_0E04360"
                     /db_xref="GeneID:11499002"
     mRNA            <986659..>986772
                     /gene="NDAI0E04360"
                     /locus_tag="NDAI_0E04360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670448.1"
                     /db_xref="GeneID:11499002"
     CDS             986659..986772
                     /gene="NDAI0E04360"
                     /locus_tag="NDAI_0E04360"
                     /inference="similar to DNA sequence:INSDC:YER053C-A"
                     /note="similar to Saccharomyces cerevisiae YER053C-A;
                     ancestral locus Anc_7.229"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670496.1"
                     /db_xref="GeneID:11499002"
                     /db_xref="UniProtKB/TrEMBL:G0WBY3"
                     /translation="MQDIGVFLSIFVFFFVFYFSAHKNVMNRYKNDIPYLV"
     gene            <987903..>988823
                     /gene="NDAI0E04370"
                     /locus_tag="NDAI_0E04370"
                     /db_xref="GeneID:11499003"
     mRNA            <987903..>988823
                     /gene="NDAI0E04370"
                     /locus_tag="NDAI_0E04370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670449.1"
                     /db_xref="GeneID:11499003"
     CDS             987903..988823
                     /gene="NDAI0E04370"
                     /locus_tag="NDAI_0E04370"
                     /inference="similar to DNA sequence:INSDC:YER053C"
                     /note="similar to Saccharomyces cerevisiae PIC2 (YER053C);
                     ancestral locus Anc_7.228"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670497.1"
                     /db_xref="GeneID:11499003"
                     /db_xref="GOA:G0WBY4"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G0WBY4"
                     /translation="MSKSDRKIQMFTKEYYAACTLGGIIACGPTHSSVTPLDLVKCRL
                     QVNSKLYKSNIDGALKIIKNEGISKLFTGVGATLIGYSLQGAGKYGGYELFKRFYSTT
                     LVKNEEMAYKYRTSIYLMASASAEFFADIMLCPFEAIKVKQQTTMPPFCNNVVEGMKK
                     MYAAEGIKGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKNDMSALQQISV
                     SFVGGYLAGILCAVVSHPADVMVSKINNERKFGETMAIASKRIYKNIGFIGLWNGLTV
                     RIFMIGTLTSFQWLIYDSFKAYIGLPTTGH"
     gene            <990651..>992933
                     /gene="NDAI0E04380"
                     /locus_tag="NDAI_0E04380"
                     /db_xref="GeneID:11499004"
     mRNA            <990651..>992933
                     /gene="NDAI0E04380"
                     /locus_tag="NDAI_0E04380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670450.1"
                     /db_xref="GeneID:11499004"
     CDS             990651..992933
                     /gene="NDAI0E04380"
                     /locus_tag="NDAI_0E04380"
                     /inference="similar to DNA sequence:INSDC:YLR190W"
                     /note="similar to Saccharomyces cerevisiae MMR1 (YLR190W);
                     ancestral locus Anc_7.366"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670498.1"
                     /db_xref="GeneID:11499004"
                     /db_xref="InterPro:IPR013712"
                     /db_xref="UniProtKB/TrEMBL:G0WBY5"
                     /translation="MNTPPLKPFQLSPSLSPISLCLDDPNNNAINNNGPAGFKHLLAS
                     PTKLKLDSSLFYRTSLSKLNEINFSGTSTTTSQLQERRKSDTFLPNSPVMLPLFSNNN
                     NPTHGASATANNNANKPTMFKREYFSPATKHSNTTNISKASLPLLSALMKGSIVTNSS
                     PTVEPSTRAIENDSIGTKSNNTNGLKSKSKSKLTIKESLEQFQQKLESSFKDRQPLST
                     PIHMEQHSEITNERESNTSERTNNDDIRDVKQQQIVTEINEPSSTISSSSLLPLQMEP
                     TYERDTLNPLYSDYLKEAIPEKPNVNVYRGNSMRMSSTATTLYTPLEEQHENQIQQDL
                     VDMNGFAKPYNTLSTHGNQLRNAGMNENIRSGYNNSKNRYSFISSTSTDYDIDWYDQV
                     ASQNGVNNGMMGNRMMRSSPVGMAMRGNSGSSNTNGRNSFINMNMNIDEISNGSEEKE
                     VIDLKIKKLELEINELKLQNEKLINSISKKNLIEDKILLGFFSQQQQQRHNATNKKMK
                     KSKKNTKKEKYSNESRSGSRGIDNTVETSKKETNDESMEMKLKEMEMQFRNYQKMLTD
                     LTIEQKERKKKSTRAKCGDKNKNKSKSERPVSNQRKERLARISSRELKKIEEQNDSIS
                     DLNTSFTKITTSEGETNEAEEEEDLEYEDEYEYSDDEEEQEEVDQSLQSREYVDDSYF
                     SEEEKKLNVTQEQLEDFRYNSQEIEPSSAEEDGDDHDDGYESEDEQLETQSRRIPTSS
                     LSSGKTGFQLNFHVQPVHID"
     gene            <993398..>994735
                     /gene="NDAI0E04390"
                     /locus_tag="NDAI_0E04390"
                     /db_xref="GeneID:11499005"
     mRNA            <993398..>994735
                     /gene="NDAI0E04390"
                     /locus_tag="NDAI_0E04390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670451.1"
                     /db_xref="GeneID:11499005"
     CDS             993398..994735
                     /gene="NDAI0E04390"
                     /locus_tag="NDAI_0E04390"
                     /inference="similar to DNA sequence:INSDC:YLR191W"
                     /note="similar to Saccharomyces cerevisiae PEX13
                     (YLR191W); ancestral locus Anc_7.365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670499.1"
                     /db_xref="GeneID:11499005"
                     /db_xref="GOA:G0WBY6"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007223"
                     /db_xref="UniProtKB/TrEMBL:G0WBY6"
                     /translation="MTSIPRPKPWETKAYDIDSGSEFPTVIPREGTGNSNNNNNTANI
                     NINDGTHRGDDNDNDNDNENTPLSLPERPSSLMTNVNGNNNPNHNSGYNNNMYDGGMT
                     NNNNMNLMNSTSYLPYGYGNSSFNNSYGYGAGTSGIGGGYGYGYNNNMGGILGGNSGY
                     GYGYDGGMGGRISNDIGESTRATFQLIESIIGTVTGFAQMLESSYLATHNSFFTMVSV
                     AEQFSYLKDSLGSFFGIFTIMKVLKKLLYFITKGKLGNSITKNKRQRSLLDEFNKFAD
                     GNDDHQVRGANGQFEQTKKRGRKISMKPLIIFLMGVFGFPFLLNKFIENVNKNNSRRL
                     SGGRGRYGNLRGQGGREDDEEGYEDGSGMSIDPNNLEFARAKYKFVPENPEMELQLSK
                     GDLMAIISKQDPLGRDSEWWKVRTKNGDMGYVPYNYLEIIKRVAKDRRPIEDV"
     gene            complement(<996334..>997137)
                     /gene="NDAI0E04400"
                     /locus_tag="NDAI_0E04400"
                     /db_xref="GeneID:11499006"
     mRNA            complement(<996334..>997137)
                     /gene="NDAI0E04400"
                     /locus_tag="NDAI_0E04400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670452.1"
                     /db_xref="GeneID:11499006"
     CDS             complement(996334..997137)
                     /gene="NDAI0E04400"
                     /locus_tag="NDAI_0E04400"
                     /inference="similar to DNA sequence:INSDC:YLR192C"
                     /note="similar to Saccharomyces cerevisiae HCR1 (YLR192C);
                     ancestral locus Anc_7.363"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670500.1"
                     /db_xref="GeneID:11499006"
                     /db_xref="GOA:G0WBY7"
                     /db_xref="InterPro:IPR013906"
                     /db_xref="InterPro:IPR023194"
                     /db_xref="UniProtKB/TrEMBL:G0WBY7"
                     /translation="MSWDDEAVTGSMGMDDEEVLLESWDAEEEPIMESWDAEVVPKEE
                     TKPKSKASTSGTKNKNGKKSKETTPGIALDALDPKMRRELLKKAELESDLSNAADLLG
                     SLDLAEEHPRARQLKEQQEAALLMMSQPVLTKETEFDVHPLFQAETKKDYQDLRKALS
                     KSIVKMHDKSPLNYSSSLAIDLIRDVAKPMSIESIRQTVATLNVLIKEKEKEERQARL
                     ARVRGGTATGGAGKKKAKVKTNLGGAFKKDQDFDLDDMNYDNFGDDDFM"
     gene            complement(<997790..>998341)
                     /gene="NDAI0E04410"
                     /locus_tag="NDAI_0E04410"
                     /db_xref="GeneID:11499007"
     mRNA            complement(<997790..>998341)
                     /gene="NDAI0E04410"
                     /locus_tag="NDAI_0E04410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670453.1"
                     /db_xref="GeneID:11499007"
     CDS             complement(997790..998341)
                     /gene="NDAI0E04410"
                     /locus_tag="NDAI_0E04410"
                     /inference="similar to DNA sequence:INSDC:YLR193C"
                     /note="similar to Saccharomyces cerevisiae UPS1 (YLR193C);
                     ancestral locus Anc_7.359"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670501.1"
                     /db_xref="GeneID:11499007"
                     /db_xref="InterPro:IPR006797"
                     /db_xref="UniProtKB/TrEMBL:G0WBY8"
                     /translation="MVLVHKNTHIFQHDFRSVSCAFFNRYPNPYSSHVLSIDTLSRRV
                     DTQDGKLYTTRLLKKQGKLPSWTSSLIGRVSDSWIIEYSVIDPKLQKMETYTKNLDHI
                     KILKVEEYTTYYYDSKNRNTVVTSEVKFSSGFHLGIKNKIENWSRSKFDESVKKSRMG
                     MSFVMQKWEEQKSIKLDEETSTI"
     gene            complement(<998715..>999557)
                     /gene="NDAI0E04420"
                     /locus_tag="NDAI_0E04420"
                     /db_xref="GeneID:11499008"
     mRNA            complement(<998715..>999557)
                     /gene="NDAI0E04420"
                     /locus_tag="NDAI_0E04420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670454.1"
                     /db_xref="GeneID:11499008"
     CDS             complement(998715..999557)
                     /gene="NDAI0E04420"
                     /locus_tag="NDAI_0E04420"
                     /inference="similar to DNA sequence:INSDC:YLR194C"
                     /note="similar to Saccharomyces cerevisiae YLR194C;
                     ancestral locus Anc_7.358"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670502.1"
                     /db_xref="GeneID:11499008"
                     /db_xref="UniProtKB/TrEMBL:G0WBY9"
                     /translation="MKFNPSNILLTTLFASAFARQDTGSLDSDDTTTNNEDSNFEVNS
                     LEAGQSSLPITTDESTAATIRTQVANSQLVQTTNVINTNGKVNAGSYAVGPSTTIITT
                     DEQGQTTTKLLWWIPETTAPVSSVATIGVSNTKHSSQITSKASRTTNILASSTSTRNP
                     DDALTTVTGVNSLGETYTSKIWWLPSTATATSIGSETETEETNKIITSYSKSLYLTTS
                     GSKVETLTTSFATTFLKKELTSSSSGSRRSTNATIASENGGYKNIDEYRYQGLALAFV
                     ALFL"
     gene            complement(<1000369..>1001742)
                     /gene="NDAI0E04430"
                     /locus_tag="NDAI_0E04430"
                     /db_xref="GeneID:11499009"
     mRNA            complement(<1000369..>1001742)
                     /gene="NDAI0E04430"
                     /locus_tag="NDAI_0E04430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670455.1"
                     /db_xref="GeneID:11499009"
     CDS             complement(1000369..1001742)
                     /gene="NDAI0E04430"
                     /locus_tag="NDAI_0E04430"
                     /inference="similar to DNA sequence:INSDC:YLR195C"
                     /note="similar to Saccharomyces cerevisiae NMT1 (YLR195C);
                     ancestral locus Anc_7.357"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670503.1"
                     /db_xref="GeneID:11499009"
                     /db_xref="GOA:G0WBZ0"
                     /db_xref="InterPro:IPR000903"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR022676"
                     /db_xref="InterPro:IPR022677"
                     /db_xref="InterPro:IPR022678"
                     /db_xref="UniProtKB/TrEMBL:G0WBZ0"
                     /translation="MDEKKLQDLLKLLQINNGDLTKLNAQQRKDMKDYKFWKTQPVAS
                     FDEKIDTEGPIDATKKPEDIPDDPYPLLNEFEWCNINIDDSQQLQDVFVLLNENYVED
                     KDAEFRFNYTPEFFNWALKSPGWKNEWHVGVRVKQTQKLIAFISAIPISLQIRGKTIT
                     SVEINFLCVHKQLRSKRLTPVLIKEITRRVNKHDIWQALYTAGIVLPSPVSTCRYTHR
                     PLNWSKLYDVGFTDLPPNASKAQMVAEYTVPNKTKLNGLRPMTMDDIDEVYNLFEKYQ
                     SRFDLIQTFTKDEFKHWFLGHVEKSNQEQDVKKKIVFSYVVENKETNNITDFFSFYSL
                     PFSILKNPTYKELGIGYLYYYATDADFEFNDRFSPEATKKLRKRLDELISDALILAKQ
                     ANMDVFNALTSQDNTLFLDDLKFGAGDGFLNFYVFNYKAFPVTGGLKEDKSYDVEKRS
                     NVGVVML"
     gene            <1002113..>1003858
                     /gene="NDAI0E04440"
                     /locus_tag="NDAI_0E04440"
                     /db_xref="GeneID:11499010"
     mRNA            <1002113..>1003858
                     /gene="NDAI0E04440"
                     /locus_tag="NDAI_0E04440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670456.1"
                     /db_xref="GeneID:11499010"
     CDS             1002113..1003858
                     /gene="NDAI0E04440"
                     /locus_tag="NDAI_0E04440"
                     /inference="similar to DNA sequence:INSDC:YLR196W"
                     /note="similar to Saccharomyces cerevisiae PWP1 (YLR196W);
                     ancestral locus Anc_7.356"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670504.1"
                     /db_xref="GeneID:11499010"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G0WBZ1"
                     /translation="MISSTNWVPRGFTSEFPEKYELDDAELARIENLANLNLDDVKAE
                     LEGEAAAASAEEDDLAIESKHDANVLKNQLEVDDDMKEYDLENHDNDEQAQNGEGEDV
                     TMFPGLSNDSDVKFHEGEDGQDPYISLPTQEDTVEEKQELQVYPTDNLILATRTEDDI
                     SYLDVYVYDDGAGFHSNEIPVEQGDELDADVAKGMVRDSALYVHHDLMLPAFPLCVEW
                     INYRPNSGSNENDIANFAAIGTFDPQIEIWNLDCIDKAFPDMILGEPLENSLAGLKKN
                     KKKPKKQEHITTHHTDAILSLSHNKQFRAVLASTSADHTVKLWDLNNGQTARSLASVH
                     SGKNVSASEWHPTNGSILLTGGYDSRVALSDVRISNEKEMSKYWSVMSGEEIECTTFA
                     NENIILCGTDSGNIYSFDIRNNENSKPVWTLKAHDAGISTLSTNSFIPGLMSTGAMGE
                     KAVKLWKFPLGDGVNNNAGKGPGMVLSRDFDVGNVLTTSFSPDIEVAGTMVVGGVNKG
                     LKLWDVFSNRTVRKSFAKELKDVQARARDEAKNVGRSSRIARKYTQNDNPETVMTVDD
                     LGEDEEEGGEGELSE"
     gene            complement(<1004080..>1004745)
                     /gene="NDAI0E04450"
                     /locus_tag="NDAI_0E04450"
                     /db_xref="GeneID:11499011"
     mRNA            complement(<1004080..>1004745)
                     /gene="NDAI0E04450"
                     /locus_tag="NDAI_0E04450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670457.1"
                     /db_xref="GeneID:11499011"
     CDS             complement(1004080..1004745)
                     /gene="NDAI0E04450"
                     /locus_tag="NDAI_0E04450"
                     /inference="similar to DNA sequence:INSDC:YLR199C"
                     /note="similar to Saccharomyces cerevisiae PBA1 (YLR199C);
                     ancestral locus Anc_7.353"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670505.1"
                     /db_xref="GeneID:11499011"
                     /db_xref="InterPro:IPR018855"
                     /db_xref="UniProtKB/TrEMBL:G0WBZ2"
                     /translation="MNPLFPEDLLPLVSVSNISTTLTLNPDQLMGNEGKHSWNYNENF
                     PNEFDPSDKDMKSSEKSYDFNFPIFAIDRTLVISIQENFLKISPIFSNVISQTLVQAL
                     PLNKEILILGTSDRVAVMRKISNEIDTLEPPEFVTGFIGSLITELNLHNAKYNFDAII
                     VPSEGPTGFEKLNLTIMQDLIDIFKNEWNYLNIDSKVYTEQCYRHWKLAGAAIGAQSG
                     LYI"
     gene            complement(1005213..1005283)
                     /gene="NDAI0Etrna15G"
                     /locus_tag="NDAI_0Etrna15G"
                     /db_xref="GeneID:11499012"
     tRNA            complement(1005213..1005283)
                     /gene="NDAI0Etrna15G"
                     /locus_tag="NDAI_0Etrna15G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11499012"
     gene            <1005674..>1005994
                     /gene="NDAI0E04460"
                     /locus_tag="NDAI_0E04460"
                     /db_xref="GeneID:11499086"
     mRNA            <1005674..>1005994
                     /gene="NDAI0E04460"
                     /locus_tag="NDAI_0E04460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670458.1"
                     /db_xref="GeneID:11499086"
     CDS             1005674..1005994
                     /gene="NDAI0E04460"
                     /locus_tag="NDAI_0E04460"
                     /inference="similar to DNA sequence:INSDC:YLR200W"
                     /note="similar to Saccharomyces cerevisiae YKE2 (YLR200W);
                     ancestral locus Anc_7.352"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670506.1"
                     /db_xref="GeneID:11499086"
                     /db_xref="GOA:G0WBZ3"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="UniProtKB/TrEMBL:G0WBZ3"
                     /translation="MASNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLP
                     SESQVYKLTGNVLLPVDQEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEIL
                     KMRQ"
     gene            complement(<1006109..>1006903)
                     /gene="NDAI0E04470"
                     /locus_tag="NDAI_0E04470"
                     /db_xref="GeneID:11499013"
     mRNA            complement(<1006109..>1006903)
                     /gene="NDAI0E04470"
                     /locus_tag="NDAI_0E04470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670459.1"
                     /db_xref="GeneID:11499013"
     CDS             complement(1006109..1006903)
                     /gene="NDAI0E04470"
                     /locus_tag="NDAI_0E04470"
                     /inference="similar to DNA sequence:INSDC:YLR201C"
                     /note="similar to Saccharomyces cerevisiae COQ9 (YLR201C);
                     ancestral locus Anc_7.351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670507.1"
                     /db_xref="GeneID:11499013"
                     /db_xref="InterPro:IPR013718"
                     /db_xref="UniProtKB/TrEMBL:G0WBZ4"
                     /translation="MLLNRILSKNVKLSINRAFHSNTLEYAKAATLSPLTYNKDSVQY
                     KILSNALNKWVPKKGFTDEAITSSLNELDLSSSLFSVLGSSNSPSIFRSISPAVMELL
                     KFQLVSKRYQLTENITPYIETAKDKLPSLETLLIERLKMDQPLNNQLSSLFNQLIIPS
                     PLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENF
                     DKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSMNLVKARLARG"
     gene            complement(<1007346..>1008677)
                     /gene="NDAI0E04480"
                     /locus_tag="NDAI_0E04480"
                     /db_xref="GeneID:11499014"
     mRNA            complement(<1007346..>1008677)
                     /gene="NDAI0E04480"
                     /locus_tag="NDAI_0E04480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670460.1"
                     /db_xref="GeneID:11499014"
     CDS             complement(1007346..1008677)
                     /gene="NDAI0E04480"
                     /locus_tag="NDAI_0E04480"
                     /inference="similar to DNA sequence:INSDC:YLR203C"
                     /note="similar to Saccharomyces cerevisiae MSS51
                     (YLR203C); ancestral locus Anc_7.346"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670508.1"
                     /db_xref="GeneID:11499014"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="UniProtKB/TrEMBL:G0WBZ5"
                     /translation="MLCRCVSRLPTAYRSRLPTTLCFTPNPRNFRNNAHVSHHSSRSL
                     MGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEINY
                     TCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDF
                     DRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPI
                     TLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFP
                     EQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDLFPY
                     DPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDEK
                     YKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL"
     gene            <1009082..>1009537
                     /gene="NDAI0E04490"
                     /locus_tag="NDAI_0E04490"
                     /db_xref="GeneID:11499015"
     mRNA            <1009082..>1009537
                     /gene="NDAI0E04490"
                     /locus_tag="NDAI_0E04490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670461.1"
                     /db_xref="GeneID:11499015"
     CDS             1009082..1009537
                     /gene="NDAI0E04490"
                     /locus_tag="NDAI_0E04490"
                     /inference="similar to DNA sequence:INSDC:YLR204W"
                     /note="similar to Saccharomyces cerevisiae QRI5 (YLR204W);
                     ancestral locus Anc_7.345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670509.1"
                     /db_xref="GeneID:11499015"
                     /db_xref="InterPro:IPR013177"
                     /db_xref="UniProtKB/TrEMBL:G0WBZ6"
                     /translation="MLPLFFSRMPASRPLSILKGNARFLSTQLKNTNQSYHHHGDDTM
                     ISTMMNLSKSRLINSNDIFELSSKSALGLDRKFQCNINDISNMIPMFGRTLIENAEQV
                     VINDVTNLSNVEMHLDSVLRKRRKKMKKHKLRKRRKRQRAEKRKLSQGR"
     gene            complement(<1009814..>1010797)
                     /gene="NDAI0E04500"
                     /locus_tag="NDAI_0E04500"
                     /db_xref="GeneID:11499016"
     mRNA            complement(<1009814..>1010797)
                     /gene="NDAI0E04500"
                     /locus_tag="NDAI_0E04500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670462.1"
                     /db_xref="GeneID:11499016"
     CDS             complement(1009814..1010797)
                     /gene="NDAI0E04500"
                     /locus_tag="NDAI_0E04500"
                     /inference="similar to DNA sequence:INSDC:YLR205C"
                     /note="similar to Saccharomyces cerevisiae HMX1 (YLR205C);
                     ancestral locus Anc_7.344"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670510.1"
                     /db_xref="GeneID:11499016"
                     /db_xref="GOA:G0WBZ7"
                     /db_xref="InterPro:IPR002051"
                     /db_xref="InterPro:IPR016053"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="UniProtKB/TrEMBL:G0WBZ7"
                     /translation="MSSSTVTIIPSPTDTEALANRINFHTRDAHNKIDKKMTLKLAVA
                     LRHGDIYRQGILTYYYIFQAVESEINYLLSFNTDATKEQKRTGSLLSKIWLTEFNRTD
                     KLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQNKNSKLYQFVNFIHISIQTNPCCIL
                     AYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLSSKELFNNATNFFQFTENSDSLEG
                     INSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEIAKQIFQWNLESMEELGQRNQK
                     ELMNLFSFKLINYLFEEWKFNDSIKKNFKAILMFVILLLLIQFFVSRSLFT"
     gene            <1011671..>1012216
                     /gene="NDAI0E04510"
                     /locus_tag="NDAI_0E04510"
                     /db_xref="GeneID:11499017"
     mRNA            <1011671..>1012216
                     /gene="NDAI0E04510"
                     /locus_tag="NDAI_0E04510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670463.1"
                     /db_xref="GeneID:11499017"
     CDS             1011671..1012216
                     /gene="NDAI0E04510"
                     /locus_tag="NDAI_0E04510"
                     /inference="similar to DNA sequence:INSDC:YER050C"
                     /note="similar to Saccharomyces cerevisiae RSM18
                     (YER050C); ancestral locus Anc_7.223"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670511.1"
                     /db_xref="GeneID:11499017"
                     /db_xref="GOA:G0WBZ8"
                     /db_xref="InterPro:IPR001648"
                     /db_xref="UniProtKB/TrEMBL:G0WBZ8"
                     /translation="MSHFTARLKTLASGILSRRFISSSKTLTNNNRNGFSIKPQQKNS
                     LDIGSNSTKKAINNMKQIDDKFVKKFQPGSIYDPFDFSMARLYYTRKNNMNGINNNRR
                     IINPNILDKKFNPLDLYSSPNKLYPFLTSTGKILHRDVTGLSAKNQRRVSKAIRRAQS
                     IGLISKTCGNLNTLPTRNIQQ"
     gene            complement(<1012409..>1014325)
                     /gene="NDAI0E04520"
                     /locus_tag="NDAI_0E04520"
                     /db_xref="GeneID:11499018"
     mRNA            complement(<1012409..>1014325)
                     /gene="NDAI0E04520"
                     /locus_tag="NDAI_0E04520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670464.1"
                     /db_xref="GeneID:11499018"
     CDS             complement(1012409..1014325)
                     /gene="NDAI0E04520"
                     /locus_tag="NDAI_0E04520"
                     /inference="similar to DNA sequence:INSDC:YER049W"
                     /note="similar to Saccharomyces cerevisiae TPA1 (YER049W);
                     ancestral locus Anc_7.220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670512.1"
                     /db_xref="GeneID:11499018"
                     /db_xref="GOA:G0WBZ9"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR006620"
                     /db_xref="InterPro:IPR019601"
                     /db_xref="UniProtKB/TrEMBL:G0WBZ9"
                     /translation="MKRKAAETSSSSASKSQTLEDDKVESLFNPKIWDPKYQQELRDE
                     IASSKPFNWGSIPNLVDENLLRAVRKEIETEIQFSKKETDIYKVNQSGDLANLSKLDW
                     NDLSRLPNLFKLREILYSEKYRKFFSFITQSGDLSSEKTDMSINTYTKGCHLVPHDDV
                     IGSRRISFILYLPDPDRTWKSHYGGGLRLYDTIMPNIPQNDPCAKLVPQFNQIAFFKV
                     NPGFSFHDVEEVKVDKHRLSIQGWYHIPQPGEKAYIVNEEKSWIQKNITDLVPLDQHI
                     LQDFEFPKEEREFLSTYQIKHFETILNEEKSITESLSIPKELKTIPLEDKFLSKEEVK
                     YLRKYISEEHLTEEGITKLQTQFSENSFLTIETFLNNEKSELLKELIKITELEKDCPY
                     VSKDVSYPWKTAMPSHKRKYLYIDGKKFQKFETGEDLIATINNDELSNFEMVKEIISS
                     KKTSNDDYGVEIELIELSCFFKSLIFKKYLLLLTSLCLVSEQILIRRFRPGLDFTLAN
                     KCQLNVKHFNEILDNVLEGTLCLTPSKGWESGEVGGYEMYMMDDTKEKLEDEVDIEAE
                     WYKNDDGGDSVLLNCKPSWNSFNLVLRDESVLEFVKYVSWSAKSSRWDIKLKYDVKSL
                     EEDEGDDENEEGDE"
     gene            complement(<1015055..>1015357)
                     /gene="NDAI0E04530"
                     /locus_tag="NDAI_0E04530"
                     /db_xref="GeneID:11499019"
     mRNA            complement(<1015055..>1015357)
                     /gene="NDAI0E04530"
                     /locus_tag="NDAI_0E04530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670465.1"
                     /db_xref="GeneID:11499019"
     CDS             complement(1015055..1015357)
                     /gene="NDAI0E04530"
                     /locus_tag="NDAI_0E04530"
                     /inference="similar to DNA sequence:INSDC:YER048W-A"
                     /note="similar to Saccharomyces cerevisiae ISD11
                     (YER048W-A); ancestral locus Anc_7.219"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670513.1"
                     /db_xref="GeneID:11499019"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:G0WC00"
                     /translation="MTAAIAPTRRQVLSLYKQFIKNANQFNNFNFREYFLRKSRASFK
                     QNSTIQDAEKLSKLYQDAKNDLSALKRQSVISQMYTFDKLVVEPVDKEERKDINKH"
     gene            complement(1015714..1015785)
                     /gene="NDAI0Etrna11Q"
                     /locus_tag="NDAI_0Etrna11Q"
                     /db_xref="GeneID:11499020"
     tRNA            complement(1015714..1015785)
                     /gene="NDAI0Etrna11Q"
                     /locus_tag="NDAI_0Etrna11Q"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAA"
                     /db_xref="GeneID:11499020"
     gene            complement(<1017208..>1017675)
                     /gene="NDAI0E04540"
                     /locus_tag="NDAI_0E04540"
                     /db_xref="GeneID:11499083"
     mRNA            complement(<1017208..>1017675)
                     /gene="NDAI0E04540"
                     /locus_tag="NDAI_0E04540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670466.1"
                     /db_xref="GeneID:11499083"
     CDS             complement(1017208..1017675)
                     /gene="NDAI0E04540"
                     /locus_tag="NDAI_0E04540"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670514.1"
                     /db_xref="GeneID:11499083"
                     /db_xref="UniProtKB/TrEMBL:G0WC01"
                     /translation="MKSMRGKNHNKIPTLIPDSRADDNFTYISLWKPYPYVDISGIKF
                     TPLQTKACSPTSVSPAVGISRIITTKTELQIIYHKHSFTTWCYLIPRDRFNIIIRKPL
                     LRRLQYRSTETAEMITIHNIDINLNQIEYITTKQSIYTIAKLKNIQWFQGLVE"
     gene            complement(<1018309..>1018812)
                     /gene="NDAI0E04550"
                     /locus_tag="NDAI_0E04550"
                     /db_xref="GeneID:11499021"
     mRNA            complement(<1018309..>1018812)
                     /gene="NDAI0E04550"
                     /locus_tag="NDAI_0E04550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670467.1"
                     /db_xref="GeneID:11499021"
     CDS             complement(1018309..1018812)
                     /gene="NDAI0E04550"
                     /locus_tag="NDAI_0E04550"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670515.1"
                     /db_xref="GeneID:11499021"
                     /db_xref="UniProtKB/TrEMBL:G0WC02"
                     /translation="MQLRCLLTFQISSKNLGLHKFSFGEQVKNEIVQIKQQSNNNKMG
                     SSPDINSKIEEVEKFVPDSIIKRGDSRLLACIKNFSDVNLGNINPDMLISTGSGIDVT
                     QQLLKIQSLLLSKQIAFKDWVFFLNNRCFGIAARAPKDERDRLMDWANCVISLCKHVE
                     FYKNPWK"
     gene            <1020784..>1021968
                     /gene="NDAI0E04560"
                     /locus_tag="NDAI_0E04560"
                     /db_xref="GeneID:11499022"
     mRNA            <1020784..>1021968
                     /gene="NDAI0E04560"
                     /locus_tag="NDAI_0E04560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670468.1"
                     /db_xref="GeneID:11499022"
     CDS             1020784..1021968
                     /gene="NDAI0E04560"
                     /locus_tag="NDAI_0E04560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670516.1"
                     /db_xref="GeneID:11499022"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR026894"
                     /db_xref="UniProtKB/TrEMBL:G0WC03"
                     /translation="MVKDTEYYDILGVEPDATPTEIKKAYRRKAMQTHPDKHPDDPDA
                     QAKFQAVGEAYQVLSDPGLRSRYDEFGKDDAVPKQGFEDAGEYFTAIFGGDGFKDWIG
                     EFSLIKEFTDASEMFDENGNPKESNEKDSAGNPADSGMVKHDGKAASNRKADKLTKEQ
                     RSRMMELEKKRREEMAKQVDELASKLTTKLDEYLIAVKENHLDQFNRKLDQEIEDLKL
                     ESFGLELLYLIAKVYKTKANNFIISKKTYGFSKIFTGTRENARTVKSAYNLLSTGIET
                     QKAMEEMNKVNPEELDQYERAKFENMIAGKALGMMWEMSKFELQQKLKEICNKVLQDK
                     NVSSKVRIAKAKAMLYIAEKFASAKRSPEEAEEARVFEELILGEKEKEKQKKAKHKIG
                     VI"
     gene            <1031014..>1034325
                     /gene="NDAI0E04570"
                     /locus_tag="NDAI_0E04570"
                     /db_xref="GeneID:11499023"
     mRNA            <1031014..>1034325
                     /gene="NDAI0E04570"
                     /locus_tag="NDAI_0E04570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670469.1"
                     /db_xref="GeneID:11499023"
     CDS             1031014..1034325
                     /gene="NDAI0E04570"
                     /locus_tag="NDAI_0E04570"
                     /inference="similar to DNA sequence:INSDC:YBL101C,YPR030W"
                     /note="similar to Saccharomyces cerevisiae ECM21 (YBL101C)
                     and CSR2 (YPR030W); ancestral locus Anc_7.436"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670517.1"
                     /db_xref="GeneID:11499023"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="UniProtKB/TrEMBL:G0WC04"
                     /translation="MPFISQRITYDYDQHKNNHNAPKVSSTSASSDYIRNNSRQKTPS
                     PTKRTMPHHAKTDRRRSSTVKGSLFNFLNHSHAYDDNKTSDTTSNSATTATSLSNVGH
                     ISRKSTTDAIPTNNTVCIHNDIQQRNKNHAVPPCSSDNRADGDTWNNTTNSTIPRNIL
                     TNGHLTDITSSPPSTNETCSSVTDNSSADNLSSNKRSTASIKFNNKQFLKEYLNNWGF
                     LNPKELATKRDEFFKMYIATSGDNVFLPTISSNDDEYLARLNGLQDEEDDILLIEGID
                     LSTGDSHGRNTNSNGTGPSRHESLHNADDVTAEQLSEIHTGTALGGDSEVNGSRVPLD
                     ADEPRSSSPSSLEMDNSMVALRIAVIISLNKETALSDIEVELCSRVKIFWNNGVPPTK
                     TFNEEFYTLGATRWSLNQANFNLYIPPHVSSTEQIIENNSILRENEVFKNMPVDKRVY
                     LDKTKSRKSFMNSIKATSRNRFKPGDYIFVLPVLFSNDVPESIYLPSARVSYKIRVGT
                     KFKNRVNQNNRGRHNNSDKLQVSSSASSLNVTEMESTQSHKYVSKGLFKKVKNHLHIQ
                     NQSSKNEDKDVTNELLSEYPIHIIRTPPPISISTANKPIFINRVWTDSLAYEISFSQK
                     YVPLNNEIPIKIKLAPMVKNICVKRIRVSITEKITFVSKNYEFEYDQVDPVAKDPYNP
                     YYLDFASKRRKERNLNLLEIRTKEKGARAMREEIVENCYDDNLLSYSTIDTGSVHSKN
                     EEEKKVGITEPIIIETKLEFPKYADLARKSAKVTPPYGIDIYTNVPTFDRTAADDHHR
                     SSVISFLSGHKSSFSSTKKNSQEDGEHNQHENINPRFRETRFRTNSGTNVKHHTKLNR
                     PKRGLYLDSLHFSNIHCKHKLEIMLRISKPDLAIPGKLRHYEVLIDTPIFLVSELCNS
                     GNMELPTYDMATSEFEPLNEAMLLAPPPAFEEAISVPASPIGSPDLLASYEPDLSSIQ
                     QLSLSRSTSISSQGGQLDGSNPVLAGPSTSPIRDGDDLRFNNLDKLLASPVPSGGRSN
                     AFFREHRPSEDDALFKEDYSMAKPTRKVPRQIGGDRAIDDDAVADDGMRAGSHSPITE
                     GHFHSPPNYDDIVSR"
     gene            complement(<1034621..>1035268)
                     /gene="NDAI0E04580"
                     /locus_tag="NDAI_0E04580"
                     /db_xref="GeneID:11499024"
     mRNA            complement(<1034621..>1035268)
                     /gene="NDAI0E04580"
                     /locus_tag="NDAI_0E04580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670470.1"
                     /db_xref="GeneID:11499024"
     CDS             complement(1034621..1035268)
                     /gene="NDAI0E04580"
                     /locus_tag="NDAI_0E04580"
                     /inference="similar to DNA sequence:INSDC:YBL102W"
                     /note="similar to Saccharomyces cerevisiae SFT2 (YBL102W);
                     ancestral locus Anc_7.437"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670518.1"
                     /db_xref="GeneID:11499024"
                     /db_xref="GOA:G0WC05"
                     /db_xref="InterPro:IPR007305"
                     /db_xref="InterPro:IPR011691"
                     /db_xref="UniProtKB/TrEMBL:G0WC05"
                     /translation="MTEPASTNQFRDALSRWNQSRSQAATQPTSTDSGSSFFGRIGES
                     LNATANDVYQRLPISRQDLIQETQEPEWFTLSRTERLILFICFLLGAAVCFTLCVFLF
                     PVLAIKPRKFGLLWSFGSLLFVTAFGIFMGPIAYMKHLTSRERLPFTIFFFTTCFMTI
                     YFAAFMKSSILTIPCAILQLIAVLYYAISYFPFGGTTLRMLSSMGLSTARGVLRI"
     gene            <1036925..>1038556
                     /gene="NDAI0E04590"
                     /locus_tag="NDAI_0E04590"
                     /db_xref="GeneID:11499025"
     mRNA            <1036925..>1038556
                     /gene="NDAI0E04590"
                     /locus_tag="NDAI_0E04590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670471.1"
                     /db_xref="GeneID:11499025"
     CDS             1036925..1038556
                     /gene="NDAI0E04590"
                     /locus_tag="NDAI_0E04590"
                     /inference="similar to DNA sequence:INSDC:YBL103C"
                     /note="similar to Saccharomyces cerevisiae RTG3 (YBL103C);
                     ancestral locus Anc_7.438"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670519.1"
                     /db_xref="GeneID:11499025"
                     /db_xref="GOA:G0WC06"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="InterPro:IPR024099"
                     /db_xref="UniProtKB/TrEMBL:G0WC06"
                     /translation="MNTEDNDNDAENQRLLDELMRQGSFQFDAHPASTSLQNEYDFMQ
                     FHPLRSQGYPGDTPAHHHEKLSYMSSSNNRKHSHNQSPNTSARINHDQNSNIGRQPFI
                     SHHASIAQPEPQASFLDDMFATSSSSHPLSTSITATSANAYSTANSTHPQRFSSHQEN
                     ASMNSFSRNAHLDSNSEINNKGTPTNILDDTSTYTATTSDHDNIDPNNILNDFLFRPN
                     DDAMFNYADDISTSVGSSINSELLASSYSSSFSFNPTPYLENMTGTSVTSNNNNLNIN
                     TIRSPTASSIRPGSFISTSLRNASININNNTPKTRNTSISSYNNTNNNIMDGFTPNGT
                     SAGFGSLSKSALSHLTAEEKLKRKREFHNAVERRRRELIKQKIKELGNLVPPYLLHYD
                     FSTGKQIKTNKGIILNKSVEYVAFLQNVISEQANKKNLLQNKVNELEIELSKLGLNAN
                     ELIPQTGEGNHNMNSVNETDSHQSIKSEYLKTNESSSGNNTKDNNITLRTPTGANDDL
                     QEFLSGAAIEAQDNERLMFGDDEGNPADYLLEFDS"
     gene            <1039124..>1042228
                     /gene="NDAI0E04600"
                     /locus_tag="NDAI_0E04600"
                     /db_xref="GeneID:11499026"
     mRNA            <1039124..>1042228
                     /gene="NDAI0E04600"
                     /locus_tag="NDAI_0E04600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670472.1"
                     /db_xref="GeneID:11499026"
     CDS             1039124..1042228
                     /gene="NDAI0E04600"
                     /locus_tag="NDAI_0E04600"
                     /inference="similar to DNA sequence:INSDC:YBL104C"
                     /note="similar to Saccharomyces cerevisiae YBL104C;
                     ancestral locus Anc_7.440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670520.1"
                     /db_xref="GeneID:11499026"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0WC07"
                     /translation="MGLIKKVTSWSHDNFIDYLSVNPTRDEVTHYKVDPNDESDKSIH
                     RLHTVKDFGSITCLDYSYLDAGLVGVGEKNGYVRLFNIMADLDTGDKDYNENDVDNNK
                     NKKTPIGINIRAKQQRCINALGINSNGLIAMGLDRNRNDSSLQIWDINYQNVESDVAN
                     IAFAYCVNESIISLKFLNDTNILAASSKFIKEIDVRVPQPIYQHPTRLTYDIKLNPFN
                     DWQFSTYGDDGTLAIWDRRKITDQTNDINQISPLITFEKLVGTGAASRKYMNTCFRWS
                     TIRKREFATLHRGDTIKLWRLGATGGTTEDSNNVENLFVSTVHDIDTTFDRVATFDYI
                     PKENFRSSLLCMRQSGTVYRMPLKQCYSKVSFNTSNSLLLSNGEISELDEIRINQDAQ
                     KANSENITTVLKNLSFEDLDVADEYQKSVGTTSSEEEDYLSDNEDRGRRKDSKVDLQH
                     NYDNEQHYHLEAHSSHDGNDPYQIYWKAEKLLQKDISVIMKSRAELGYGLDPMTTVEM
                     IDTSKALQNNAYIRNTWRWIAIAKSSVDDGTMVSGDLDLGYQGVLGIWNGLDGISNQN
                     RYSEDTILTEKQLNREMEKIIKLRKKEKENQGYKTLLSRFADSPKHMQRKLCLIISGW
                     DLSPADYEDKYHIIIKNGNYEKAAAWAVFFGDIPKAVDILADSKNERLRLIATAIAGY
                     MAYKDQPGNNSWRQQCRKMSSELEDPYLRVIFAFIADNDWWDILYEPAISLRERLGVA
                     LRFLNDTDLSKFLQRTSSIVIANGELEGLILTGITPNGIDLLQSYVNKTSDIQSAALI
                     SIFGSPKYFRDERVDEWIERYRTMLNSWNLFSMRAKFDVLRTKLSRTSSGIITAVTKP
                     RQLYIQCIHCKKNVNNPKGIEHTSARNILHNNIASLPKMKGFRASDNSDEIRYRYACP
                     HCGTPFPRCAICLMPLGTSNLPFVINGTENDPNESTKNTYDVTSSAVSKANSENGNDN
                     TKSVEPDNIDQLRRKKLRLNEWFSFCLSCNHGMHAGHSDEWFEKHSTCPTPGCNCQCN
                     KQYT"
     gene            <1042690..>1046154
                     /gene="NDAI0E04610"
                     /locus_tag="NDAI_0E04610"
                     /db_xref="GeneID:11499027"
     mRNA            <1042690..>1046154
                     /gene="NDAI0E04610"
                     /locus_tag="NDAI_0E04610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670473.1"
                     /db_xref="GeneID:11499027"
     CDS             1042690..1046154
                     /gene="NDAI0E04610"
                     /locus_tag="NDAI_0E04610"
                     /inference="similar to DNA sequence:INSDC:YBL105C"
                     /note="similar to Saccharomyces cerevisiae PKC1 (YBL105C);
                     ancestral locus Anc_7.441"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670521.1"
                     /db_xref="GeneID:11499027"
                     /db_xref="GOA:G0WC08"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002219"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011072"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:G0WC08"
                     /translation="MLSNIKEDIQRKIAVEQNIIQGATNLKKRTDNVMVIQKCNTNIR
                     EARQNIEYLEDTLRKLKLNDNQPNASKGFSDSTSHLEEKGQEYGVLSTISPEEQTFSR
                     LDLIKYDCPSLSQRIQFMLQQLEFKLQVEKQYQEANTKLTKLYRIDGDEHTSSAAEGG
                     AFESKYMIQLLTKSLKKYQAINVDLDQYKPHDNDSLNNNQSKFRRKQLTGVLTIGITA
                     LRDVDHIQSPMFARKPESYISIKIDDTVKARTKASRNDRWNEKFNISVDKGNEVEITI
                     YDKVNDMMMPVAVTWLLLSDIAEEIRKKKVEQTSGMHGWANASNHGLSSSSLEEAPKN
                     SSNVQSESLSSASTARPETVVSTNQAAQITTNQWFILEPSGQMLLTLGFQKTSQPERK
                     NVVGGLHRQGAIINRKEEVFEQHGHHFVQKSFYNIMCCAYCGDFLRYTGFQCQDCKFL
                     CHKKCYTNVVTKCIAKISTDTDPDEAKLKHHIPHRFEPVSNRGTKWCCHCGYILPWGK
                     HKVRKCSECGIMCHTQCAHLVPDFCGMSMEMANQILRTIKDTQRSQEKRRKRIPISGQ
                     QDSGGPTAVATRSPKKASEQKTNEIYMDKNKIQNESKRQSYENRPEQYSRDQSTLETR
                     FDNEQTVKQENIRKKLNTFIDNNEAYLDFTNNTSETMAVDVSSKTLDPTNRLSYRDAQ
                     LETKDVAVTEDRDIEAEQTQMSSYNNARLSIHDKNTLQSASEITEPTYEHSIDLGLET
                     TQLTSAAAEEDIDDNMDTQADFSTSNPFRDMNSAKFEQVQNELSNKIVQDQATILLPT
                     DSNSSYKHQTAVKHKRKTSKRRKVSLDNFVLLKVLGKGNFGKVILSRSKNTGRLCAIK
                     VLKKDNIIQNHDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGD
                     LMWHVQNQRLSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLTPEGHIKIGDYG
                     LCKDEMWYESKTSTFCGTPEFMAPEILKEQGYTRAVDWWAFGVLLYQMLLCQSPFSGD
                     DEDEVFNAILTDEPLYPIDMAGDIVQIFQGLLTKDPENRLGAGPRDALEVMEEPFFRN
                     INFEDMLNLKVKPPYIPEIKSPEDTSYFEQEFTSAPPTLTPLPSILTTKEQEEFRGFS
                     FMPDDLEL"
     gene            <1046665..>1049760
                     /gene="NDAI0E04620"
                     /locus_tag="NDAI_0E04620"
                     /db_xref="GeneID:11499028"
     mRNA            <1046665..>1049760
                     /gene="NDAI0E04620"
                     /locus_tag="NDAI_0E04620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670474.1"
                     /db_xref="GeneID:11499028"
     CDS             1046665..1049760
                     /gene="NDAI0E04620"
                     /locus_tag="NDAI_0E04620"
                     /inference="similar to DNA sequence:INSDC:YBL106C,YPR032W"
                     /note="similar to Saccharomyces cerevisiae SRO77 (YBL106C)
                     and SRO7 (YPR032W); ancestral locus Anc_7.442"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670522.1"
                     /db_xref="GeneID:11499028"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013905"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G0WC09"
                     /translation="MFKRTKLKKVSNPFKSSKKAEPASSSTTNSPTKTSTSKTNVLRS
                     ANISDLTASSSSKMFNPRELYSFGFTGKVITMAFDFTQSLLALATETGELRIYGEKQV
                     EVVIPLENKIPIVKMKFVKGIYLIAVDAKDTILVISLYSKKVLTTVFSPNRITCMEVD
                     PSLDWIFFGLQSGTVMIYDIDRNQFSNMKIENLQKAKFFPKDRLSPVVSIQWNPRDIG
                     TVLISYEWVTVTYSLIDGDIKQSFIYDLPPFSPGGNPSMNVDKLRRPKVIQSLYHPNS
                     LHILTAHEDNSLVFWDANTGELIQARSLLETDVNIPQAGLINNTNGDSGPQILSVDWI
                     CQSDPEYTSLVIATGTTTGTENIQDLTMLDLGGTPLYSLTSYEGMSKYYSVPVQERHF
                     PLVNKSKIRSLLPIPKASPYFHGCHDPSFILILLDDGEIETLLYPSGLFTSKASLFPQ
                     NISWIRPVVTMSMAVAVPSKLWLGMMSSNSAKDSLLKGGSLTKRPMRKQELRSVIVTG
                     HTNGSLRIYDASHGELDDSSVFDVNVSQILNKSTSVSITHASFATETLELAVCVESGD
                     VVLFKFEVNKFYDPENKNKENNLALEFGRFSLNDHKEILIDVKSRASRYVKQGFMPIT
                     AVHAKRGRISAVTNSNVGFVGIAYEDGSILVIDRRGPAVIFMDNIRNISGIRGQNITA
                     IEFSIMEYGQDGYSSILMFCGTNNAEILVYRVFPESNGRFAVEFIEFTKTNDAGSISK
                     IDTFAKANKISCSATISRMQDLSKGIPIPGYVCISGQSDIRIIKPGKSKESHRSFKFP
                     LAASGLSHVYMMNSKGQRELMIILSCLLINGDIKILSVPDLKELKSSPSLVPVHSAFM
                     NGSSVLKNGEIAVRSGKFKMSLISLVNDPKSEITKKSVDTDTLYNPNLRIKYRPQVNT
                     LQWARGTVTCTPEQLDILLGGERRPASKYQESLIAKGTLTVKPTDKPGASSPQLYKKP
                     VRHGRSSHYGVLKSVSRAVETHWDVLEDNFNDYATAVGEGMNDAVEQTGKDLVKGSLG
                     F"
     gene            <1050133..>1050798
                     /gene="NDAI0E04630"
                     /locus_tag="NDAI_0E04630"
                     /db_xref="GeneID:11499029"
     mRNA            <1050133..>1050798
                     /gene="NDAI0E04630"
                     /locus_tag="NDAI_0E04630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670475.1"
                     /db_xref="GeneID:11499029"
     CDS             1050133..1050798
                     /gene="NDAI0E04630"
                     /locus_tag="NDAI_0E04630"
                     /inference="similar to DNA sequence:INSDC:YBL107C"
                     /note="similar to Saccharomyces cerevisiae YBL107C;
                     ancestral locus Anc_7.443"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670523.1"
                     /db_xref="GeneID:11499029"
                     /db_xref="InterPro:IPR016805"
                     /db_xref="InterPro:IPR019171"
                     /db_xref="UniProtKB/TrEMBL:G0WC10"
                     /translation="MRTNTYERSHENPEGNSNKITVKFPQQLILDSNLNFSIDSRGTN
                     NRRDNINELVINRKRCIHSTLVDSFLRMLRHSSDDTLRQKINDYSKRDNNGNDISNYD
                     KCRVVKNELYENWKVRTDIINFCDKESQNLKRELDAKYSNNNSNDKPVDPRLDPYAAR
                     DYQDEQESQYGEYNKMRTWVANNLHIESILQNTSDRILKQNCDQNKDYLKEFQDLLKY
                     SQR"
     gene            complement(<1050989..>1052452)
                     /gene="NDAI0E04640"
                     /locus_tag="NDAI_0E04640"
                     /db_xref="GeneID:11499030"
     mRNA            complement(<1050989..>1052452)
                     /gene="NDAI0E04640"
                     /locus_tag="NDAI_0E04640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670476.1"
                     /db_xref="GeneID:11499030"
     CDS             complement(1050989..1052452)
                     /gene="NDAI0E04640"
                     /locus_tag="NDAI_0E04640"
                     /inference="similar to DNA sequence:INSDC:YJR080C"
                     /note="similar to Saccharomyces cerevisiae YJR080C;
                     ancestral locus Anc_7.446"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670524.1"
                     /db_xref="GeneID:11499030"
                     /db_xref="UniProtKB/TrEMBL:G0WC11"
                     /translation="MMMLKHNIKRNTVAIVQNATAFKKYYHENSNPQLIISTNTISPS
                     SPNNDVDMDPFASTEIELLNQPPTIAKITIPNSSEFFIKKGSLISLYGTNPQNNLYKP
                     SKLKAINEQEQGEGDNINDTNNTEKNIETTVEYNYDHHPFPLHSISVTNNNKNIIEKD
                     PNFLNYIPLMKSSNHFQKISFNDSYSNMNSKINILVSSPNTNVNPFPSPLYHLKLDGT
                     KDWNIFNQNAILAFENNSNLQITQVYDKNRKSSSFSSSPSLFNKYHRIKGRGNVLLSS
                     SSLSQGIGGSILTVHLKNGVDEILINSKNLLAINGVSQLDMNNSMALFNSSESSHPPP
                     NRKHLPLPSIITNDTFLINMKSILNFIKICTKNSIVSLIHYYKIWKIGKPLTLIKING
                     PRTILIQSNNHIPDSKYNNSNNNILSSSFPDLSFSSNPLKEKAKQGFQNKKKINMNMN
                     ADICIENDEIANHDDLKYFIATVTNENNVKFRPVDKV"
     gene            complement(<1052607..>1053194)
                     /gene="NDAI0E04650"
                     /locus_tag="NDAI_0E04650"
                     /db_xref="GeneID:11499031"
     mRNA            complement(<1052607..>1053194)
                     /gene="NDAI0E04650"
                     /locus_tag="NDAI_0E04650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670477.1"
                     /db_xref="GeneID:11499031"
     CDS             complement(1052607..1053194)
                     /gene="NDAI0E04650"
                     /locus_tag="NDAI_0E04650"
                     /inference="similar to DNA sequence:INSDC:YJR082C"
                     /note="similar to Saccharomyces cerevisiae EAF6 (YJR082C);
                     ancestral locus Anc_7.447"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670525.1"
                     /db_xref="GeneID:11499031"
                     /db_xref="InterPro:IPR015418"
                     /db_xref="UniProtKB/TrEMBL:G0WC12"
                     /translation="MPHGDEETQQTTIDIELPDEKMDTKLKEYEDLKEKLKDSLLAKR
                     NLEDEFDRIQQQIYDKETEYLAGSVGAPTSNSKGTPSSSAAAAASHSIGNIIKGFDGF
                     SKSSHHHHHHHHESNFNSGNNNVSFSNQDRIFSLSSALFVKQQQERPKYNNSNTASNN
                     NAKEPLSNINTNGNASSSSLNENGPQQVNSTSQSN"
     gap             1053570..1053589
                     /estimated_length=20
     gene            complement(<1055590..>1056693)
                     /gene="NDAI0E04660"
                     /locus_tag="NDAI_0E04660"
                     /db_xref="GeneID:11499032"
     mRNA            complement(<1055590..>1056693)
                     /gene="NDAI0E04660"
                     /locus_tag="NDAI_0E04660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670478.1"
                     /db_xref="GeneID:11499032"
     CDS             complement(1055590..1056693)
                     /gene="NDAI0E04660"
                     /locus_tag="NDAI_0E04660"
                     /inference="similar to DNA sequence:INSDC:YJR083C"
                     /note="similar to Saccharomyces cerevisiae ACF4 (YJR083C);
                     ancestral locus Anc_7.451"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670526.1"
                     /db_xref="GeneID:11499032"
                     /db_xref="UniProtKB/TrEMBL:G0WC13"
                     /translation="MLKNKFNANSSKSGERIVSQPIELQKLSIVNKQQKTKNASTPTT
                     TPSSSPRKANPIQFPISVESSPKKFNNNQKIPDKNNKETDEEQQAPNDQDLIYQMASK
                     QRQIIELETLLNKAKNEFKQLENEFKLSLNTDDNYNGDDILNENESEINNGNNGRNLG
                     IIGLNNHSSTSINVNNATKWLSSVQKRINDVNNSPNVIKSKKNISNFFTNVSSNNNNN
                     NNNNNNNNNKSNTDETIYEGENDDISTIRNRTRMNQNKNLEIDPVEDEEEDNDYNNNE
                     ASIGLKSTSNNRTFLGNLINKFNEINVDEMEEQEFDESQNKQRNNYYIKESYDYDIDQ
                     DQDASRLEAEEDDDDDNPALQNLDGIPISYFKR"
     gene            <1057448..>1059097
                     /gene="NDAI0E04670"
                     /locus_tag="NDAI_0E04670"
                     /db_xref="GeneID:11499033"
     mRNA            <1057448..>1059097
                     /gene="NDAI0E04670"
                     /locus_tag="NDAI_0E04670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670479.1"
                     /db_xref="GeneID:11499033"
     CDS             1057448..1059097
                     /gene="NDAI0E04670"
                     /locus_tag="NDAI_0E04670"
                     /inference="similar to DNA sequence:INSDC:YJR084W"
                     /note="similar to Saccharomyces cerevisiae CSN12
                     (YJR084W); ancestral locus Anc_7.452"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670527.1"
                     /db_xref="GeneID:11499033"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="UniProtKB/TrEMBL:G0WC14"
                     /translation="MEKELIDIADYFQMKKYDDDFINFITFRKPTIQSSSMEPSSKKI
                     FILNDDSTDDEKLTMFYETTMKAKKFIDDAMNNYMKNKKKIKNKNKNKLKNKKNLYPI
                     TLLSSKEFLDTIMLQLKSLNRLVERDSSSNWLILPLFIVANQIFKIFSQLKDQVTHPN
                     LKFNINSIPDCNKLPIKTKIVKEFLEDCARNIHRSFSLCLNDKNPNLRKNKKIGIILF
                     SNLEFKIYHKLQNKDMIKNLIKVLNSNNVLTQQQQQQNAVNNADLTTFYKSHVVMFNY
                     FMGQYYGCYESDFNLACNYLNNALMECPDPKKIIITSPSTINSIWRRLLILLIPFTIL
                     TRKTYPNLDYILNNIFINIEDNHAKEIKDIFHPIIQCFKTGNLQKFDETFKQNEYFYL
                     ENGIYVAMTLIRELVFLKLIKNCYKIWLTINDGKNNKFVIPLPFLLIGYLKSLGAQQE
                     LIQQIVVADDNDSASGSHQEQQQSSAHPRGQRETQTRYKNKKQLPMTSKETRELILDE
                     IECHLANLISKNYIKGYLSHGNRCLVISKTVPFPKLATKNG"
     gene            <1060089..>1060250
                     /gene="NDAI0E04680"
                     /locus_tag="NDAI_0E04680"
                     /db_xref="GeneID:11499034"
     mRNA            <1060089..>1060250
                     /gene="NDAI0E04680"
                     /locus_tag="NDAI_0E04680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670480.1"
                     /db_xref="GeneID:11499034"
     CDS             1060089..1060250
                     /gene="NDAI0E04680"
                     /locus_tag="NDAI_0E04680"
                     /inference="similar to DNA sequence:INSDC:YPR036W-A"
                     /note="similar to Saccharomyces cerevisiae YPR036W-A;
                     ancestral locus Anc_7.453"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670528.1"
                     /db_xref="GeneID:11499034"
                     /db_xref="UniProtKB/TrEMBL:G0WC15"
                     /translation="MAFLQLASEVSQPFVIPSLSPVTPQPSRKNSTNIASATTTPIVR
                     SRNNSMSLL"
     gene            complement(<1060594..>1060911)
                     /gene="NDAI0E04690"
                     /locus_tag="NDAI_0E04690"
                     /db_xref="GeneID:11499035"
     mRNA            complement(<1060594..>1060911)
                     /gene="NDAI0E04690"
                     /locus_tag="NDAI_0E04690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670481.1"
                     /db_xref="GeneID:11499035"
     CDS             complement(1060594..1060911)
                     /gene="NDAI0E04690"
                     /locus_tag="NDAI_0E04690"
                     /inference="similar to DNA sequence:INSDC:YJR085C"
                     /note="similar to Saccharomyces cerevisiae YJR085C;
                     ancestral locus Anc_7.454"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670529.1"
                     /db_xref="GeneID:11499035"
                     /db_xref="GOA:G0WC16"
                     /db_xref="InterPro:IPR005349"
                     /db_xref="UniProtKB/TrEMBL:G0WC16"
                     /translation="MDHPAIFLTLVNLSGGMMGYQRKGSLISLLGGTTLSATFARAAY
                     LIRYKIDVAQGISIALYSSLVLFMVGMIRGVSSNFEKQVPIILICFGLLSSLYYFYKS
                     TIY"
     gene            complement(<1061383..>1062975)
                     /gene="NDAI0E04700"
                     /locus_tag="NDAI_0E04700"
                     /db_xref="GeneID:11499036"
     mRNA            complement(<1061383..>1062975)
                     /gene="NDAI0E04700"
                     /locus_tag="NDAI_0E04700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670482.1"
                     /db_xref="GeneID:11499036"
     CDS             complement(1061383..1062975)
                     /gene="NDAI0E04700"
                     /locus_tag="NDAI_0E04700"
                     /inference="similar to DNA sequence:INSDC:YER052C"
                     /note="similar to Saccharomyces cerevisiae HOM3 (YER052C);
                     ancestral locus Anc_7.226"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670530.1"
                     /db_xref="GeneID:11499036"
                     /db_xref="GOA:G0WC17"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001341"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR018042"
                     /db_xref="UniProtKB/TrEMBL:G0WC17"
                     /translation="MLQSSSSSNWVVQKFGGTSVGKFPVKIVDDIIKFYSSPDNKEYN
                     NNVAVVCSARSSSVKAEGTTSRLLKCCDLASQEMDFKPIIEMIRQDHIDNAERYIQNA
                     VLQTKLIDDSNKELKLVDKYLEASKILGEVSTRTIDLVMSVGEKLSCLFITALCNDRG
                     CKAKYVDLTHIVPSDYNSTVLDNSFYTFLFQAFKEKLQPFMNSKERIVPVFTGFFGLV
                     PMGLLNGVGRGYTDLCAALIAVAANADELQVWKEVDGIFTADPRKVPQARLLASVTPE
                     EASELTYYGSEVIHPFTMEQVIQAKIPIRIKNVQNPRGEGTIIYPDNVAKKGECTPPH
                     PPETLSSSFFEKKKRGATAITTKNDIVVLNIHSNKKTLSHGFLAQIFTILDKYKLVVD
                     LISTSEVHVSMALPIPDSDSMKSLRQAVEKLKVLGRVDVTKKMAIVSLVGKQMKQFIG
                     IAGTMFTTLAEQGINIEMISQGANEINISCVIDEVDSIKALQSIHRNLLDAKIQETEE
                     QKQENFEHAINERLEQIKRLDL"
     gene            complement(<1064631..>1065443)
                     /gene="NDAI0E04710"
                     /locus_tag="NDAI_0E04710"
                     /db_xref="GeneID:11499037"
     mRNA            complement(<1064631..>1065443)
                     /gene="NDAI0E04710"
                     /locus_tag="NDAI_0E04710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670483.1"
                     /db_xref="GeneID:11499037"
     CDS             complement(1064631..1065443)
                     /gene="NDAI0E04710"
                     /locus_tag="NDAI_0E04710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670531.1"
                     /db_xref="GeneID:11499037"
                     /db_xref="UniProtKB/TrEMBL:G0WAL5"
                     /translation="MSSPDQDTPTNKDGRAPITKTRRSERQRTMPLSSSPNSSLSSTS
                     DSSTSSFISHSRSEFLSPITTPLRQSQQQRQDSSNITQSTTATSDSTTTPIKVSSLIH
                     NHFEKRKRQRIESGDDPDPDVLLKNMITTVDEITQLAATICRQNNVLIDDFPRSTSTP
                     QRTRKRNLEDKNTSKSIRYAEKEEEEEEEDSDYITVKEINELLVFSKKIKKEEIFKRI
                     DQLVAKSEKLRLVREQKRQIENKDQSKNINKRNYSNNKVDQLIQCLKQHEDD"
     gene            complement(<1065833..>1066081)
                     /gene="NDAI0E04720"
                     /locus_tag="NDAI_0E04720"
                     /db_xref="GeneID:11499038"
     mRNA            complement(<1065833..>1066081)
                     /gene="NDAI0E04720"
                     /locus_tag="NDAI_0E04720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670484.1"
                     /db_xref="GeneID:11499038"
     CDS             complement(1065833..1066081)
                     /gene="NDAI0E04720"
                     /locus_tag="NDAI_0E04720"
                     /inference="similar to DNA
                     sequence:INSDC:YER019C-A,YER087C-B"
                     /note="similar to Saccharomyces cerevisiae SBH2
                     (YER019C-A) and SBH1 (YER087C-B); ancestral locus
                     Anc_7.369"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670532.1"
                     /db_xref="GeneID:11499038"
                     /db_xref="InterPro:IPR016482"
                     /db_xref="UniProtKB/TrEMBL:G0WAL6"
                     /translation="MATTSTPPGGQRTLQKRKQAPVAAKSKAESASSPSSNPMLKIYS
                     DEATGLKIDPLVVLFLAVGFIFSVVALHIISKITSKLF"
     gene            <1066657..>1069299
                     /gene="NDAI0E04730"
                     /locus_tag="NDAI_0E04730"
                     /db_xref="GeneID:11499039"
     mRNA            <1066657..>1069299
                     /gene="NDAI0E04730"
                     /locus_tag="NDAI_0E04730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670485.1"
                     /db_xref="GeneID:11499039"
     CDS             1066657..1069299
                     /gene="NDAI0E04730"
                     /locus_tag="NDAI_0E04730"
                     /inference="similar to DNA sequence:INSDC:YBL052C"
                     /note="similar to Saccharomyces cerevisiae SAS3 (YBL052C);
                     ancestral locus Anc_7.371"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670533.1"
                     /db_xref="GeneID:11499039"
                     /db_xref="GOA:G0WAL7"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G0WAL7"
                     /translation="MVITNKPADTNEKFVKSGNIPTLSTDCKSNSNSDTDKSSPMSSS
                     KRRSPSILKNLVIDDNIHSKAQQLYLNSNGTDASTDEDVARRPRMRRNQDRAKISYVF
                     KRGNSRQNSSSRRVKAKHTQLANQVNEQQEYSPYNHTLPLGLNDANKLNENVQFNPIH
                     NDSIDTSSLNDTTNHDTTPLIYNYDYSTIKIKYDPLKYFNFQKNLEFSSSSLYTNSEE
                     QQQEEHEEQEDDVKKFQKISKQLQINSSNDNMININPQQKYSHHFPYNGAILKQKDYS
                     TSNTFPNSNDRDFFLKLLKHSKHASYFNSNTTLANHSNRNDKSIIGKNKIRSKLKITT
                     VVNSSIEYIHINNYEIKTWYKSPYPLSTNKNKILYICELCLKNSNSRQTHYNHQFKCT
                     NHRNNNNIKTPPGNQIYFAQINGLSIWEIDGRENIEYCRNLCLLSKLFLNSKTLYYDV
                     EPFIFYVLMKQTKDSYDYNFIGYFSKEKSNSLNYNLSCILTLPIYQRMGYGNFLMEFS
                     YLLSRREFKLGTPEKPLSDLGLLSYRNFWKIKIAKTLLLIKNAFEQSSSSSSSSSSSS
                     SQAQLTLKTITLNDLANLTGMTTTDVIFGLEQLKLLYYHTPSVPSPASSQFSPNKEEV
                     KIKIKIKSWSILQELVDNWDSKNYPNVEPELLIWKPMIFGPSFGINTLQPPPPISPPL
                     QHHQQSDSISLNTTSGDFFSDHINTLTNFMSDDINDPRDLETVTLESLLKKNEALQKI
                     SDLPKSSNDLGETLDHAGGDEEWKLCYKEPILPSTTIAITTMNSGTNVINYNNNNNNN
                     SSNKSKNKRPQKAIFSSEIQITEQEGEDDEPDDDIGDISNTLEDIDNNDDDDQEYSSN
                     DVDEDDEEDDDEEEEENLVSDEEV"
     gene            complement(<1069822..>1070658)
                     /gene="NDAI0E04740"
                     /locus_tag="NDAI_0E04740"
                     /db_xref="GeneID:11499040"
     mRNA            complement(join(<1069822..1070150,1070622..>1070658))
                     /gene="NDAI0E04740"
                     /locus_tag="NDAI_0E04740"
                     /product="ribosomal protein L34"
                     /transcript_id="XM_003670486.1"
                     /db_xref="GeneID:11499040"
     CDS             complement(join(1069822..1070150,1070622..1070658))
                     /gene="NDAI0E04740"
                     /locus_tag="NDAI_0E04740"
                     /inference="similar to DNA
                     sequence:INSDC:YER056C-A,YIL052C"
                     /note="similar to Saccharomyces cerevisiae RPL34A
                     (YER056C-A) and RPL34B (YIL052C); ancestral locus
                     Anc_7.237"
                     /codon_start=1
                     /product="ribosomal protein L34"
                     /protein_id="XP_003670534.1"
                     /db_xref="GeneID:11499040"
                     /db_xref="GOA:G0WAL8"
                     /db_xref="InterPro:IPR008195"
                     /db_xref="InterPro:IPR018065"
                     /db_xref="UniProtKB/TrEMBL:G0WAL8"
                     /translation="MAQRVTFRRRNPYNTKSNKIKVVKTPGGILRAQHVKKLASRPKC
                     GDCGIALPGVAALRPRQYASVSKTHKTVSRVYGGSRCANCVKERIVRAFLIEEQKIVK
                     KVVKEQTEAAKKAEKKSKK"
     gene            complement(<1071393..>1071779)
                     /gene="NDAI0E04750"
                     /locus_tag="NDAI_0E04750"
                     /db_xref="GeneID:11499041"
     mRNA            complement(<1071393..>1071779)
                     /gene="NDAI0E04750"
                     /locus_tag="NDAI_0E04750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670487.1"
                     /db_xref="GeneID:11499041"
     CDS             complement(1071393..1071779)
                     /gene="NDAI0E04750"
                     /locus_tag="NDAI_0E04750"
                     /inference="similar to DNA sequence:INSDC:YER057C,YIL051C"
                     /note="similar to Saccharomyces cerevisiae HMF1 (YER057C)
                     and MMF1 (YIL051C); ancestral locus Anc_7.238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670535.1"
                     /db_xref="GeneID:11499041"
                     /db_xref="GOA:G0WAL9"
                     /db_xref="InterPro:IPR006056"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR013813"
                     /db_xref="InterPro:IPR019897"
                     /db_xref="UniProtKB/TrEMBL:G0WAL9"
                     /translation="MTTLTPINCSEAPSAAASYSHAMKANNLIFLSGQIPLTSDNKPV
                     EGSIADKAEQVIQNVKKVLEASNSSLERIIKVNIFLADINSFAEFNTVYAKYFNVHKP
                     ARSCVAVAALPLNADLEMEVIAAENE"
     gene            <1072076..>1072423
                     /gene="NDAI0E04760"
                     /locus_tag="NDAI_0E04760"
                     /db_xref="GeneID:11499042"
     mRNA            <1072076..>1072423
                     /gene="NDAI0E04760"
                     /locus_tag="NDAI_0E04760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670488.1"
                     /db_xref="GeneID:11499042"
     CDS             1072076..1072423
                     /gene="NDAI0E04760"
                     /locus_tag="NDAI_0E04760"
                     /inference="similar to DNA sequence:INSDC:YER058W"
                     /note="similar to Saccharomyces cerevisiae PET117
                     (YER058W); ancestral locus Anc_7.239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670536.1"
                     /db_xref="GeneID:11499042"
                     /db_xref="UniProtKB/TrEMBL:G0WAM0"
                     /translation="MSRASKITFTLACIFTVTTTVGVHMVQALERETLHQGPIKDAKR
                     VAEKKRLKDSSGDEVPLGKQFGSSDPSKEKKRLFNKTEHEMQAELKKKYEQLQPLSGE
                     IVTEDGEVVQSNK"
     gene            <1073112..>1074023
                     /gene="NDAI0E04770"
                     /locus_tag="NDAI_0E04770"
                     /db_xref="GeneID:11499043"
     mRNA            <1073112..>1074023
                     /gene="NDAI0E04770"
                     /locus_tag="NDAI_0E04770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670489.1"
                     /db_xref="GeneID:11499043"
     CDS             1073112..1074023
                     /gene="NDAI0E04770"
                     /locus_tag="NDAI_0E04770"
                     /inference="similar to DNA sequence:INSDC:YER059W,YIL050W"
                     /note="similar to Saccharomyces cerevisiae PCL6 (YER059W)
                     and PCL7 (YIL050W); ancestral locus Anc_7.240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670537.1"
                     /db_xref="GeneID:11499043"
                     /db_xref="GOA:G0WAM1"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:G0WAM1"
                     /translation="MFFEGNSITNYSSEKSRIVTEEDYSSNERSNYYDNDDINSPTSR
                     WREVSSDDESLVSVHGKSVHDLIPNKQNQTVIPIKLTTRAIVKKIDRLDSSAEKRISL
                     LRLLRIPSSKATRMIIQVLKKIDRKFDENYENGLIHYQKINIPADDIKHVLQSFLGNH
                     RLKIELEEYLNTLQRHCPMNTIDLLALLIYLDRIIQNLYKYPLDKKPIYQFMASRFQH
                     KQTCLSRIVNSCTVHRLILAGITVSSKFLSDFTYSNKRYAQASGLTLEELNYLEFQFL
                     RLTNFNLSVSLNELEDYGTALCSCSQI"
     gene            <1074922..>1076529
                     /gene="NDAI0E04780"
                     /locus_tag="NDAI_0E04780"
                     /db_xref="GeneID:11499044"
     mRNA            <1074922..>1076529
                     /gene="NDAI0E04780"
                     /locus_tag="NDAI_0E04780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670490.1"
                     /db_xref="GeneID:11499044"
     CDS             1074922..1076529
                     /gene="NDAI0E04780"
                     /locus_tag="NDAI_0E04780"
                     /inference="similar to DNA sequence:INSDC:YER060W-A"
                     /note="similar to Saccharomyces cerevisiae FCY22
                     (YER060W-A); ancestral locus Anc_7.241"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670538.1"
                     /db_xref="GeneID:11499044"
                     /db_xref="GOA:G0WAM2"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="InterPro:IPR026030"
                     /db_xref="UniProtKB/TrEMBL:G0WAM2"
                     /translation="MTINRRMSSSIQYQDSEFELNAIDLEKNPKDIKTSQNTSQDYYY
                     LDVDSHASEEVVETKLSFFNRIASQLSAETKGIEPITDEEKTDGSLINAASMWFSANL
                     VLPALAIGGLGPLVFSLNFGTSVLVIVFFNILGLLPVAFFSLFGAELGLRQMVLSRYL
                     LGNITARIFALINSVACVGWGIVNTIASAQLLNMINQGPHKCPLWAGCIIIIGATVLV
                     TFFGYRVIHTYEKWSWVPNFAVFLVIIARLKMSGNFKGGEWTSGPTTAGEVLSFGSSV
                     FGFASGWTTYASDYTVYMPRGSNKFKIFFSLVAGLSFPLFFTMILGAACGSAAVNNSV
                     WNEYYQSNGMGGLTYAVLVPNSLHGFGQFCCVLLAISTVSNNVPNMYTIALSVQAIWE
                     PFSRVPRVFWTLFGNAAALGISIPGCYYFAEFMQYFMDSIAYYLAIYIAIGLSEHFIY
                     RRGYSAYNVEDWNDNSKLPIGIAGCCALVVGAFGVGLGMSQSYWTGEIAALIGEFGGD
                     IGFELGASWAFITYNIIRPLELKYFGR"
     gene            complement(<1076929..>1078275)
                     /gene="NDAI0E04790"
                     /locus_tag="NDAI_0E04790"
                     /db_xref="GeneID:11499045"
     mRNA            complement(<1076929..>1078275)
                     /gene="NDAI0E04790"
                     /locus_tag="NDAI_0E04790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670491.1"
                     /db_xref="GeneID:11499045"
     CDS             complement(1076929..1078275)
                     /gene="NDAI0E04790"
                     /locus_tag="NDAI_0E04790"
                     /inference="similar to DNA sequence:INSDC:YER061C"
                     /note="similar to Saccharomyces cerevisiae CEM1 (YER061C);
                     ancestral locus Anc_7.242"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670539.1"
                     /db_xref="GeneID:11499045"
                     /db_xref="GOA:G0WAM3"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR017568"
                     /db_xref="InterPro:IPR018201"
                     /db_xref="UniProtKB/TrEMBL:G0WAM3"
                     /translation="MSRRVVVTGLGCITPIGHTVRESWRNLLASKSGIIPITELENYN
                     NDYRPFTKYIPPKVAVGKVPPFSKEIKELSDALITSQEERKYSQFIKLSILTSYEALK
                     DADLLSTNSSLPNPAINTSLCNLDRFGCIIGSGIGSIGDIYSTSLQFHENDPKKKISP
                     FFIPKILTNMAAGNVSIKFNLRGPSHSVSTACATGNNAIGDAYNFIKLGMQDICIAGA
                     SESSILPLSLAGFLRAKSITPDGISRPFDIERNGFVLGEGSGMLVLESLEHAQNRGAK
                     IYCELKGYGLSCDAYHITSPSPSGDGAKRAMEMALSMSDIEIYDIDYVNAHATSTQLG
                     DSTEIEAIISALIPPSRVNPLYISSNKGSVGHQLGAAGAVESIFTILSLRNGIIPHTL
                     NLKNQLHLESIQGNPDTLSFVKGVPSRPKKLEYALSNSFGFGGVNTSLLFKKWEQC"
     gene            complement(<1078808..>1079560)
                     /gene="NDAI0E04800"
                     /locus_tag="NDAI_0E04800"
                     /db_xref="GeneID:11499046"
     mRNA            complement(<1078808..>1079560)
                     /gene="NDAI0E04800"
                     /locus_tag="NDAI_0E04800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670492.1"
                     /db_xref="GeneID:11499046"
     CDS             complement(1078808..1079560)
                     /gene="NDAI0E04800"
                     /locus_tag="NDAI_0E04800"
                     /inference="similar to DNA sequence:INSDC:YER062C,YIL053W"
                     /note="similar to Saccharomyces cerevisiae HOR2 (YER062C)
                     and RHR2 (YIL053W); ancestral locus Anc_7.243"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670540.1"
                     /db_xref="GeneID:11499046"
                     /db_xref="GOA:G0WAM4"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023198"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G0WAM4"
                     /translation="MGLTTKPLSLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYF
                     DAEHVIHISHGWRTYDAIAKFAPDFADEELVTKLEGEIPEKYGEHSIEVPGAVKLCND
                     LNKLPKEKWAVATSGTREMATKWFDLLKIKRPTYFITANDVKQGKPHPEPYLKGRNGL
                     GYPINEKDPSKSKVIVFEDAPAGILAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNH
                     ESIRVGSYDAETDEVEFIFDDYLYAKDDLLQW"
     gene            complement(<1080691..>1082343)
                     /gene="NDAI0E04810"
                     /locus_tag="NDAI_0E04810"
                     /db_xref="GeneID:11499047"
     mRNA            complement(<1080691..>1082343)
                     /gene="NDAI0E04810"
                     /locus_tag="NDAI_0E04810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670493.1"
                     /db_xref="GeneID:11499047"
     CDS             complement(1080691..1082343)
                     /gene="NDAI0E04810"
                     /locus_tag="NDAI_0E04810"
                     /inference="similar to DNA sequence:INSDC:YER064C,YIL056W"
                     /note="similar to Saccharomyces cerevisiae YER064C and
                     VHR1 (YIL056W); ancestral locus Anc_7.246"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670541.1"
                     /db_xref="GeneID:11499047"
                     /db_xref="InterPro:IPR007147"
                     /db_xref="UniProtKB/TrEMBL:G0WAM5"
                     /translation="MTETTNFVSMPSVTPTPQLNKNHKITKLSGKGTTHKIREQLNFT
                     DERKWKQFSSRRLELIDRFGLSQRKASEQDDNIKQIATLLRSEFGYSSLYANEFEKLV
                     TAAVQSVRRNRKRSKKKNTLYPFKTYSQDELANLEEVAKNSNSSSGSGSSTYGSDDES
                     NRSDQDTFQTPLPNIKKEASSTLPTPPNTSNITVSVPPEHCNKTVLSPAQSTAMTIKP
                     CQTPLPSVKDALSSIPMSSNIVKPRMAESVTPVSSLPVSNSQESMNTTITNLINYSKQ
                     FSIDSKYSSASSSSVSDITADDVPIFLKKKLFNQIHRSRTCLTLVDNNKNLILENNFV
                     NLENLGEMSVKASTSFVLERYFGNLGQSAITNMISITSSTEYYATISSSLFSSIFASS
                     IISKDHQIKLLYLIMGSIVKDFGFDSILYPLNEVIHHILLNYNNKSNEASIKTEKSVK
                     PLTLEPTNNNKLNGLSILSAVSLHASSPETAKQQAANSTLPRASIPLSSTSSLETSSL
                     DSIMNRITKNSKTVSNSPFLTVRKSFENGTLPQPKPLLGNSN"
     gene            complement(<1083749..>1085434)
                     /gene="NDAI0E04820"
                     /locus_tag="NDAI_0E04820"
                     /db_xref="GeneID:11499048"
     mRNA            complement(<1083749..>1085434)
                     /gene="NDAI0E04820"
                     /locus_tag="NDAI_0E04820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670494.1"
                     /db_xref="GeneID:11499048"
     CDS             complement(1083749..1085434)
                     /gene="NDAI0E04820"
                     /locus_tag="NDAI_0E04820"
                     /inference="similar to DNA sequence:INSDC:YER065C"
                     /note="similar to Saccharomyces cerevisiae ICL1 (YER065C);
                     ancestral locus Anc_7.247"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670542.1"
                     /db_xref="GeneID:11499048"
                     /db_xref="GOA:G0WAM6"
                     /db_xref="InterPro:IPR006254"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018523"
                     /db_xref="UniProtKB/TrEMBL:G0WAM6"
                     /translation="MPTSVLDSSEKEFYDVQNQIEKSCADIESWWSQPRWSSTKRAYT
                     ARDIAIRRGSFPSVEYQSSLMATKLFKLLQNHYNNNTVSKTFGALDPVQVTQMAKYLD
                     TIYVSGWQCSSTASTSNEPGPDLADYPMDTVPNKVEHLFKAQLFHDKKQFQDRAQCSS
                     PNDLKKLGPAIDYMRPIIADADAGHGGLTAVFKLTKMFIERGAAGIHIEDQTSTNKKC
                     GHMAGRCVIPVQEHINRLTTIRMCADILNSNLILVARTDSEAGTLISSTIDVRDHYFI
                     VGATNPDVKISFADVMNDAINKGYDSNQLETLEKEWCEKAGLKLFHEAFRDEVLSDNK
                     LSKQEKDEKIKKFNAQVGPLTETSHNDAQELGKQLLGHKIHFNWELPRVREGLYRYRG
                     GTQCAVMRARAFAPYADLVWMESNYPDYEQAKEFAEGVKAKYPNQWLAYNLSPSFNWT
                     KVMSPDDQKTFIQRLGDLGYIWQFITLAGLHTTALASHNFTRDFAEYGMMAYAQNVQQ
                     KEMDNGVDVLKHQKWSGAEYIDGLLKLAQGGVSATAAMGKGVTEDQFKEVSKL"
     gene            complement(1086198..1086279)
                     /gene="NDAI0Etrna19S"
                     /locus_tag="NDAI_0Etrna19S"
                     /db_xref="GeneID:11499049"
     tRNA            complement(1086198..1086279)
                     /gene="NDAI0Etrna19S"
                     /locus_tag="NDAI_0Etrna19S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCA"
                     /db_xref="GeneID:11499049"
     gene            <1091882..>1092901
                     /gene="NDAI0E04830"
                     /locus_tag="NDAI_0E04830"
                     /db_xref="GeneID:11499089"
     mRNA            <1091882..>1092901
                     /gene="NDAI0E04830"
                     /locus_tag="NDAI_0E04830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670495.1"
                     /db_xref="GeneID:11499089"
     CDS             1091882..1092901
                     /gene="NDAI0E04830"
                     /locus_tag="NDAI_0E04830"
                     /inference="similar to DNA sequence:INSDC:YIR019C"
                     /note="similar to Saccharomyces cerevisiae MUC1 (YIR019C)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670543.1"
                     /db_xref="GeneID:11499089"
                     /db_xref="InterPro:IPR018789"
                     /db_xref="UniProtKB/TrEMBL:G0WAM7"
                     /translation="MLSSVLLIIIQATYVLSSLINYQDQSLWKRGTLTCQTVMNGCPD
                     LNFGWHAANTNILKYYLDILNVEWLGNNLYEITIQVTGEEQIDLKYLYSLKIIGVQGP
                     KSTIQLYGKNENTFLIDSPTNYTVTFQVYGGAKKDECNIWLPNFQIQYEYLQGDASKY
                     QNTWKWGTTSFDLSTGCTNYDNQMNSQTDFPGFYWNMDCRNECGKSATLWRPSTVSSK
                     VKSTAASIIIPTIDGSSTSTSDSSSFLSTFSQRNSVPVSDPLSSVDSVTSSREPLTSS
                     NLPSTTRQLYVTSTITQYLSTVYNTYITYTTRSDITRVSIIIEIITSYEKLSNRPSIT
                     TATDV"
     gene            <1097841..>1098326
                     /gene="NDAI0E04840"
                     /locus_tag="NDAI_0E04840"
                     /db_xref="GeneID:11499050"
     mRNA            <1097841..>1098326
                     /gene="NDAI0E04840"
                     /locus_tag="NDAI_0E04840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670496.1"
                     /db_xref="GeneID:11499050"
     CDS             1097841..1098326
                     /gene="NDAI0E04840"
                     /locus_tag="NDAI_0E04840"
                     /inference="similar to DNA sequence:INSDC:YER067W,YIL057C"
                     /note="similar to Saccharomyces cerevisiae YER067W and
                     YIL057C; ancestral locus Anc_7.248"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670544.1"
                     /db_xref="GeneID:11499050"
                     /db_xref="InterPro:IPR022554"
                     /db_xref="UniProtKB/TrEMBL:G0WAM8"
                     /translation="MGKKDKGPKMTTVTTKDGEQVKVFEELDDFERYLKSEFEDTTRF
                     DNMHLKLNYYPPFVMHHSHDDPDKIKDTDNSHNKKFVRHLHQHVEKHLLKDIKEAVNH
                     PDLKWHDKSKDESFEKIVWHYAEDTEYNKKPFKMEVNVACNHLDAMVEVDYRTVPITP
                     A"
     gene            <1100709..>1102691
                     /gene="NDAI0E04850"
                     /locus_tag="NDAI_0E04850"
                     /db_xref="GeneID:11499051"
     mRNA            <1100709..>1102691
                     /gene="NDAI0E04850"
                     /locus_tag="NDAI_0E04850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670497.1"
                     /db_xref="GeneID:11499051"
     CDS             1100709..1102691
                     /gene="NDAI0E04850"
                     /locus_tag="NDAI_0E04850"
                     /inference="similar to DNA sequence:INSDC:YER068W"
                     /note="similar to Saccharomyces cerevisiae MOT2 (YER068W);
                     ancestral locus Anc_7.249"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670545.1"
                     /db_xref="GeneID:11499051"
                     /db_xref="GOA:G0WAM9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G0WAM9"
                     /translation="MTMNPHVHDNLHDIQNTLSNYDTSFLSDDEEDFCPLCIEPLDIT
                     DKNFFPCPCGYQICQFCYNNIRQNPELNGRCPACRRKYDDDSVRYVVLSPEELKLERA
                     KLARKERERKQKEKERKENEHPNRKHLAGMRVIQKNLVYVVGINPPVPYEEVSNVLRS
                     DNYFGQYGRINKIVVNRKSSHNNDYHSSSSPPGYGVYITFASKDDAAKCIAQVDGTYM
                     DGRLIKAAYGTTKYCSSYLRGLPCQNPNCMFLHEPGEEADSYNKRELHNRQQAQQQQQ
                     QQQQQQQQQAHESPSNIYNSRTPLNNHHVPLLSHSNSHLSGIGTSPAPIKTQLHHNDH
                     TNTSTPVLTPAAVPSGSNPWGVTQNSTPVTTSFNLSKPNSSIQLPTLNDTLGQLNNDN
                     DLSTNNNNNNTNNISNSVQTSDSTTNNNNNNKKKNNASIENEYVDPYDALNVAVKFLD
                     SRLNSFDNYKNETFKLKSNIIDDETFGQYPSLFSWNNIKESNESEGILTKKLIEILAI
                     KPVDHSASVIQFLQSFSNLNASSSTSNSPTNLEINMNTLSLNNTNTNANTNNPDSNQV
                     GTPASQYYAIPQQFQGQMPQQLPQQQQQQQQQQVHLNLDMVPPPPPGMFAAPPLQQQA
                     GNQDPQQQPPMKDSSTNSTDLLNQLISGRRMATARN"
     gene            <1103131..>1104102
                     /gene="NDAI0E04860"
                     /locus_tag="NDAI_0E04860"
                     /db_xref="GeneID:11499052"
     mRNA            <1103131..>1104102
                     /gene="NDAI0E04860"
                     /locus_tag="NDAI_0E04860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670498.1"
                     /db_xref="GeneID:11499052"
     CDS             1103131..1104102
                     /gene="NDAI0E04860"
                     /locus_tag="NDAI_0E04860"
                     /inference="similar to DNA sequence:INSDC:YIL061C"
                     /note="similar to Saccharomyces cerevisiae SNP1 (YIL061C);
                     ancestral locus Anc_7.250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003670546.1"
                     /db_xref="GeneID:11499052"
                     /db_xref="GOA:G0WAN0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR022023"
                     /db_xref="UniProtKB/TrEMBL:G0WAN0"
                     /translation="MAPSSRITDVSKISSDISTIFKPRPPLRHFKPTDYPVHRRRTNP
                     NITGISKYINSHLLSYVKEYSTTTTTNSEVTENNEVVLGNKIAQENKEALDKWNPHED
                     PNIKDTDPYRTIFVGRLPYDIDELQLQKHFLKFGQIEKIRIVRDKFNNNKSKGYGFIV
                     FHDPISSKMACKEIGVHRGLEINGRICIVDIERSRTVKYFRPRRLGGGLGGRGYNQRD
                     IFTSASSLSSVRSRNYPEVRHRPVAGEGRYRGSGFTDEYQNKMPGSHGRFNPSFPQSS
                     RYNSTIPLPSYEDGTSATEKVTATIGYKSRTSRTKEKVSKKPEIPDY"
     gene            <1104815..>1107439
                     /gene="NDAI0E04870"
                     /locus_tag="NDAI_0E04870"
                     /db_xref="GeneID:11499053"
     mRNA            <1104815..>1107439
                     /gene="NDAI0E04870"
                     /locus_tag="NDAI_0E04870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670499.1"
                     /db_xref="GeneID:11499053"
     CDS             1104815..1107439
                     /gene="NDAI0E04870"
                     /locus_tag="NDAI_0E04870"
                     /inference="similar to DNA sequence:I