GenomeNet

Database: RefSeq
Entry: NC_016485
LinkDB: NC_016485
Original site: NC_016485 
LOCUS       NC_016485            1565278 bp    DNA     linear   CON 05-JUN-2017
DEFINITION  Naumovozyma dairenensis CBS 421 chromosome 7, complete genome.
ACCESSION   NC_016485 HE580278
VERSION     NC_016485.2
DBLINK      BioProject: PRJNA79341
            BioSample: SAMEA2272418
            Assembly: GCF_000227115.2
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Naumovozyma dairenensis CBS 421
  ORGANISM  Naumovozyma dairenensis CBS 421
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Naumovozyma.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 1565278)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1565278)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE580273.
            On Nov 5, 2012 this sequence version replaced NC_016485.1.
            Accession numbers for all the chromosomes in this genome project:
            HE580267-HE580278.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1565278
                     /organism="Naumovozyma dairenensis CBS 421"
                     /mol_type="genomic DNA"
                     /strain="type strain:CBS 421"
                     /db_xref="taxon:1071378"
                     /chromosome="7"
     gene            <263..>1186
                     /gene="NDAI0G00100"
                     /locus_tag="NDAI_0G00100"
                     /db_xref="GeneID:11495698"
     mRNA            <263..>1186
                     /gene="NDAI0G00100"
                     /locus_tag="NDAI_0G00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670981.2"
                     /db_xref="GeneID:11495698"
     CDS             263..1186
                     /gene="NDAI0G00100"
                     /locus_tag="NDAI_0G00100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671029.2"
                     /db_xref="GeneID:11495698"
                     /db_xref="UniProtKB/TrEMBL:G0WDC5"
                     /translation="MPSLQVFFAYASFVQAAFPFYDEIRLGLHAAYWYFEPESPVLTD
                     LAFWGSFAEGSITSVREIMNTCRVCEQDDKEPNWDCRDSALALVKTLVMNVITICVGW
                     KHAGRPNGSMEGADTTAIAKRDLSNLCSADSGDFVQDCVDVWLTDYLNTNYPEHWSVI
                     GNSLVKRDENIGGIHVKNHNDSMVYHLLFKPNTVGNGAVAMKPLYREQSGNLTKRDYP
                     LYAPSCSSYLVADYCANQSKWGGVYDSGEMENMLNEIYTNDFDGTWTADYYKLYTKEQ
                     DDKTQDWELSWRTYEAKVGNSIYWSQCDTGH"
     gene            <2613..>3578
                     /gene="NDAI0G00110"
                     /locus_tag="NDAI_0G00110"
                     /db_xref="GeneID:11497183"
     mRNA            <2613..>3578
                     /gene="NDAI0G00110"
                     /locus_tag="NDAI_0G00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670982.2"
                     /db_xref="GeneID:11497183"
     CDS             2613..3578
                     /gene="NDAI0G00110"
                     /locus_tag="NDAI_0G00110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671030.2"
                     /db_xref="GeneID:11497183"
                     /db_xref="UniProtKB/TrEMBL:G0WDC6"
                     /translation="MDSPTVNGLKLRRPFSESRRNNIWRFLSSYFSINSAPVTNTYSV
                     KQENWILDEPTNLALDNRGTTNTIFKEYIMKYFLIDKGRSFPGTVLEAPFHKLMLKDN
                     NPTLLVLGPNLYKEQAFYSCDIEETGKELLNIKYEIGTLELNGFLHCIHERVNVRYEG
                     YSYKGSYKISENPMKPNRLLYLPPSQYSNIPLLAFFYRFSQEDAIIYRDLLVVYRIRA
                     IRRGYEPIIDNVLSVFFDPPYEIYVISSPHGDDSKQEYIDVDRCEDVTEEERQAYQAY
                     FMLKMKFMLGDKLKYSIFCELLENTNHAYSESVYLEESDHFESGV"
     gene            <5343..>6245
                     /gene="NDAI0G00120"
                     /locus_tag="NDAI_0G00120"
                     /db_xref="GeneID:11497184"
     mRNA            <5343..>6245
                     /gene="NDAI0G00120"
                     /locus_tag="NDAI_0G00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670983.2"
                     /db_xref="GeneID:11497184"
     CDS             5343..6245
                     /gene="NDAI0G00120"
                     /locus_tag="NDAI_0G00120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671031.2"
                     /db_xref="GeneID:11497184"
                     /db_xref="UniProtKB/TrEMBL:G0WDC7"
                     /translation="MPQIINHPIFQIDMKFLKTIDQKRVRHVSYRKNELPSKEIDMLF
                     MYRIIQSEGGNIKKINGKEFFETLRTSHPRTRIFLVPSYYHSIYKEYLSPEEKVVELY
                     FKDEYIHLTKAYFFMVGTAVVIGLERGAFDTGAASELVSEFARLNPDAADTEWYLNQS
                     VRILTGFFEKVILDWKDQYRPDNRKTDQEIREEINRLNEVAKLLDMVPEIIASNLEIA
                     KGMQQQDFDEMKKDVNKETIVAKKKIYKCKITLLRRIYPRLSLELFGELVALMQAVVK
                     LFTLVLTAVLELKTSTKLRNSLFW"
     gene            complement(<6528..>7181)
                     /gene="NDAI0G00130"
                     /locus_tag="NDAI_0G00130"
                     /db_xref="GeneID:11497185"
     mRNA            complement(<6528..>7181)
                     /gene="NDAI0G00130"
                     /locus_tag="NDAI_0G00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670984.2"
                     /db_xref="GeneID:11497185"
     CDS             complement(6528..7181)
                     /gene="NDAI0G00130"
                     /locus_tag="NDAI_0G00130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671032.2"
                     /db_xref="GeneID:11497185"
                     /db_xref="UniProtKB/TrEMBL:G0WDC8"
                     /translation="MGQLVVGGNGSFPLLANEDGNIIAKTHIDIDLSAFELIGSSPIE
                     KRDDNTDWFNITYRDTSNLFFDNLLDLEKRLNIHACVTWVVGAVNCTNIIWEGLENIW
                     DIAFKIKQLANSKQCSEIHGQQRGMYYRYWVSGGDCGTTAEQKTFAGVIDTVLRKLEG
                     EWDCNIYCITMTHGGTWIGTLLIGANEKAQYASCGGQFKGCYDEGCGELTGWYNCNS"
     gene            complement(<17397..>17960)
                     /gene="NDAI0G00140"
                     /locus_tag="NDAI_0G00140"
                     /db_xref="GeneID:11497186"
     mRNA            complement(<17397..>17960)
                     /gene="NDAI0G00140"
                     /locus_tag="NDAI_0G00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670985.2"
                     /db_xref="GeneID:11497186"
     CDS             complement(17397..17960)
                     /gene="NDAI0G00140"
                     /locus_tag="NDAI_0G00140"
                     /inference="similar to DNA sequence:INSDC:YKL214C"
                     /note="similar to Saccharomyces cerevisiae YRA2 (YKL214C);
                     ancestral locus Anc_1.535"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671033.2"
                     /db_xref="GeneID:11497186"
                     /db_xref="GOA:G0WDC9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G0WDC9"
                     /translation="MFSFRSIILLQPYRRRDLRNNLASRLGMEDKAGQKWLAEHKTPE
                     LPKKRVRFNSIPLDVSDFTIEDMLKEFGTPVYIKFYEMKDARSCIVEFEDLSIMEKII
                     KNFNGKDLNGTKLEVEMYEQYPKKSPRNKPSRPDSRDDYSQYRRNNSRGSRGSHYSLE
                     SKSSRPASSQKKTAEDLDAELDAYMNS"
     gene            complement(<18719..>20887)
                     /gene="NDAI0G00150"
                     /locus_tag="NDAI_0G00150"
                     /db_xref="GeneID:11497187"
     mRNA            complement(<18719..>20887)
                     /gene="NDAI0G00150"
                     /locus_tag="NDAI_0G00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670986.2"
                     /db_xref="GeneID:11497187"
     CDS             complement(18719..20887)
                     /gene="NDAI0G00150"
                     /locus_tag="NDAI_0G00150"
                     /inference="similar to DNA sequence:INSDC:YKL213C"
                     /note="similar to Saccharomyces cerevisiae DOA1 (YKL213C);
                     ancestral locus Anc_1.534"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671034.2"
                     /db_xref="GeneID:11497187"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013535"
                     /db_xref="InterPro:IPR015155"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G0WDD0"
                     /translation="MSTYQLRATLRGHRQDVKDVVAIDDTKIASVSRDGTVRLWTNDP
                     NDPTNWSDTILATNEKYLNALTYDEERGIIFYSGQDSIVNGVLLSSNLEEDPIFTLVG
                     HESNVCSLEMSNETLVSGSWDKTAKVWQNGSLKYDLKGHEASVWCAKSFPGVENKYVS
                     VSADQTIKIWENNVAIKTLGGIHTDVIRRVEISKSNPNEIITCSNDSTIKLSNIESGE
                     IIRNWCGHESFVYSVKQFNLSNDLVSCGEDRSVIIWDSNNSGPKQVIKLPAVSIWSID
                     ILPNDDIIIGSSDQLIRIFTKNETRMASPEAMKELAEEVSKISINAQTMGFDESKVSP
                     YEVLNAPGKKEGQVVVVRAPTGALEAHLYSSNHWSKVGDVVGSGGATGNDQKTEYEGK
                     LYDYVFDVDIQEGVPPLKLPINVSDNPYTVADHFIAKYELSPSYKNDIVNFILKNTNG
                     MSFDEVPTELNKNTETDKKWKILPIKTYLSLRNYNADSIFNGIVKFNSKEKTFDDEQI
                     ATIGADLQDADENWEALYSYAVIIRSKWENKTPAYDILRLIVQKLPAAVNLAEFVEEG
                     LGNKSISIVMLTVRMLANCFENQIWGLELMSSNKVYESIFETIDVNFENATKKQAQNL
                     ALAVSTLILNYSVRVVQSGTEKLDIGPVVIEAMNTKYAPLEEYQENEEAAYRLVVAYG
                     NFATVEPTLRHFAKSISWLLNVKKMYGIIPRFKDIFDDLD"
     gene            <21194..>22069
                     /gene="NDAI0G00160"
                     /locus_tag="NDAI_0G00160"
                     /db_xref="GeneID:11497188"
     mRNA            <21194..>22069
                     /gene="NDAI0G00160"
                     /locus_tag="NDAI_0G00160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670987.2"
                     /db_xref="GeneID:11497188"
     CDS             21194..22069
                     /gene="NDAI0G00160"
                     /locus_tag="NDAI_0G00160"
                     /inference="similar to DNA sequence:INSDC:YNL003C"
                     /note="similar to Saccharomyces cerevisiae PET8 (YNL003C);
                     ancestral locus Anc_1.404"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671035.2"
                     /db_xref="GeneID:11497188"
                     /db_xref="GOA:G0WDD1"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G0WDD1"
                     /translation="MVLSSFLTSLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFANG
                     GYHGIYRGLGSAIVASAPSASLFFISYDTMKVEARPYIEKLIQNTTKNDAPSTQLADT
                     LTHMFSSSVGEVAACLVRVPAEVIKQRTQVHKTNSSLQTLKIILRNENGDGIRKNLYR
                     GWSTTIMREIPFTCIQFPLYEFLKKKWKEADASDGPLNPVKGAISGSIAGGVAAATTT
                     PLDFLKTRLMLNKTSIPVRHLVQNIYRDEGFKIFFSGIIPRTMWISAGGAIFLGVYEM
                     THYVIDTSHLLSTFP"
     gene            complement(<22207..>22506)
                     /gene="NDAI0G00170"
                     /locus_tag="NDAI_0G00170"
                     /db_xref="GeneID:11497189"
     mRNA            complement(<22207..>22506)
                     /gene="NDAI0G00170"
                     /locus_tag="NDAI_0G00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670988.2"
                     /db_xref="GeneID:11497189"
     CDS             complement(22207..22506)
                     /gene="NDAI0G00170"
                     /locus_tag="NDAI_0G00170"
                     /inference="similar to DNA sequence:INSDC:YCL012C"
                     /note="similar to Saccharomyces cerevisiae YCL012C;
                     ancestral locus Anc_1.407"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671036.2"
                     /db_xref="GeneID:11497189"
                     /db_xref="InterPro:IPR018559"
                     /db_xref="UniProtKB/TrEMBL:G0WDD2"
                     /translation="MYTRFRYRLGGRIELNDSFVDDLEQGFNSRHFDIISNNVDDERS
                     GLDDATKEEIRRIMQAQNISFDKARLLYTERQFNENGIASDGMPLDPKAVTFGRH"
     gene            complement(<23120..>24514)
                     /gene="NDAI0G00180"
                     /locus_tag="NDAI_0G00180"
                     /db_xref="GeneID:11497190"
     mRNA            complement(<23120..>24514)
                     /gene="NDAI0G00180"
                     /locus_tag="NDAI_0G00180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670989.2"
                     /db_xref="GeneID:11497190"
     CDS             complement(23120..24514)
                     /gene="NDAI0G00180"
                     /locus_tag="NDAI_0G00180"
                     /inference="similar to DNA sequence:INSDC:YCL011C,YNL004W"
                     /note="similar to Saccharomyces cerevisiae GBP2 (YCL011C)
                     and HRB1 (YNL004W); ancestral locus Anc_1.408"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671037.2"
                     /db_xref="GeneID:11497190"
                     /db_xref="GOA:G0WDD3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G0WDD3"
                     /translation="MSDDGQRSRPDDRRSYRSKPSNDSYVSSSRYDRPDRGYRNDNGY
                     RRDDRRNDKRYDDHRGYHGSRDTGRFQRSGGRGRMDRRSDKGDYGPVLARELDSTYEE
                     KVNRNYSNSIFVGNLTYDCTPEDLREYFSGIGEVVRADIITSKGHHRGMGTVEFTNSK
                     DVEDAIRQYDGSYFLDRQIFVRQDNPPPDGGRSSRRSDESISSSRGYQDKSSSSYDRA
                     PSTRQPNRQGYKVFIANLPFSINWQALKDMFKEFGDVLRADIELDSRGRSRGFGTVIL
                     REKSAMEKAIATLNGTEMEGRRIDVKEGYSNRQDPSDYKYGNDYRNDINTAPNHDQSR
                     MDVDEDNQMPNIETEQNPVGARAIPTQPSYAPPILKNSTFTENVTGSGERNHLIYCNN
                     LPASTARSDLYDLFESIGRISNAELKYNDKGEPTSEAVVEYINLEDADVCIERLNGYN
                     YGGCELQISYGKRS"
     gene            <25439..>26560
                     /gene="NDAI0G00190"
                     /locus_tag="NDAI_0G00190"
                     /db_xref="GeneID:11497191"
     mRNA            <25439..>26560
                     /gene="NDAI0G00190"
                     /locus_tag="NDAI_0G00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670990.2"
                     /db_xref="GeneID:11497191"
     CDS             25439..26560
                     /gene="NDAI0G00190"
                     /locus_tag="NDAI_0G00190"
                     /inference="similar to DNA sequence:INSDC:YNL005C"
                     /note="similar to Saccharomyces cerevisiae MRP7 (YNL005C);
                     ancestral locus Anc_1.410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671038.2"
                     /db_xref="GeneID:11497191"
                     /db_xref="GOA:G0WDD4"
                     /db_xref="InterPro:IPR001684"
                     /db_xref="InterPro:IPR018261"
                     /db_xref="UniProtKB/TrEMBL:G0WDD4"
                     /translation="MSSLVKRFACVIVQQVRHSTKRAAGSRTSMKDSAGRRLGPKKYE
                     GQQVKTGQILMRQRGTKFYPGENVGIGKDHTLFALEPGIVRYYLDPFHPKRKFLGVAL
                     SRDYSLPKDHFAPNVRRFGRVEIKNEKVAQMEEETLPRKQDLLKSSILEKLQSRDSKR
                     VELEDQYSKLVKDQFKLPITDEEDLPLATKYLARLRSSLKNGFPLEDAQFYSKCYLEM
                     NMKLKSQKEKWSQDIIEKEQTRIAELTTLLDKSVSFSNKLDLIPYLSQETRNNLKSEF
                     IDKLRTNFPEIKTKKDRKAIKELFNDANRFLTLSEEVKLRRTYLKPIMSESLEDTLIK
                     DKNIDKKTMKKITIIKRFNYERHRVDTIVRTNSAFLNKL"
     gene            complement(<26754..>27959)
                     /gene="NDAI0G00200"
                     /locus_tag="NDAI_0G00200"
                     /db_xref="GeneID:11497192"
     mRNA            complement(<26754..>27959)
                     /gene="NDAI0G00200"
                     /locus_tag="NDAI_0G00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670991.2"
                     /db_xref="GeneID:11497192"
     CDS             complement(26754..27959)
                     /gene="NDAI0G00200"
                     /locus_tag="NDAI_0G00200"
                     /inference="similar to DNA sequence:INSDC:YJR054W,YML047C"
                     /note="similar to Saccharomyces cerevisiae YJR054W and
                     PRM6 (YML047C); ancestral locus Anc_1.495"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671039.2"
                     /db_xref="GeneID:11497192"
                     /db_xref="UniProtKB/TrEMBL:G0WDD5"
                     /translation="MIYKPNWNYPSNSRKFAEFDIDTFKVANFKTLSNYVLLIWGISF
                     LKTALLISDIYTCIKLLAFNTWSNDYVKPFLPFRISKWLFSTCILISVLLLLYDVING
                     LRIYGTKVITTCYMNNFARTSLSLSNYSVFCFFENITPDNRLQKIAFFSYFELKSCLR
                     LLLADSPRQVINGLTLWSTLIAVNNSGDDPQSSDLKKLESLHGLINKIKRIGETNHEE
                     AVILSFMLFSFILWTFFISKFIAALCCLYYVYKRLKNEYHLKGGLREYIWITINYNIE
                     RLIDKRLLSEDTSLEKETYVSSDITWERRLGDPQERIPSMIMGSNLQAYKHTIKGPYG
                     MIAVHNGSSKYSLERIRSCSSANTLPSYYYSTPLTEANILTIDQNNWEPMHVFTPAKA
                     YFRDNNYSY"
     gene            complement(<28400..>29248)
                     /gene="NDAI0G00210"
                     /locus_tag="NDAI_0G00210"
                     /db_xref="GeneID:11497193"
     mRNA            complement(<28400..>29248)
                     /gene="NDAI0G00210"
                     /locus_tag="NDAI_0G00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670992.2"
                     /db_xref="GeneID:11497193"
     CDS             complement(28400..29248)
                     /gene="NDAI0G00210"
                     /locus_tag="NDAI_0G00210"
                     /inference="similar to DNA sequence:INSDC:YJR053W"
                     /note="similar to Saccharomyces cerevisiae BFA1 (YJR053W);
                     ancestral locus Anc_1.494"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671040.2"
                     /db_xref="GeneID:11497193"
                     /db_xref="UniProtKB/TrEMBL:G0WDD6"
                     /translation="MQKPSIKYQGRKKPNQRLQFTLYMSAGTSVTDKWPSPTVSSMFS
                     TLREKCKQITQVSFFSGKHNKKFKEILTTSDVVHRPFTSQTSIFDHNAMNDGLQNTDK
                     PVYNMVVPYSKFPPFVNEIFPVENLEIWHLNAPNGPLPLVDKEEVESLRHSFEKLNIV
                     QISIVTEVSVEEEIFLKGCSIQNMDSRISKKLVEVKSINRIKPMGEEKLINNVKSLIK
                     DRIHITELDNTSKTFLLNTFLLEKFYHEENQFKKTVMKWFEEQNNHPNFYEIQYMVRN
                     NVSPSI"
     gene            <29472..>31436
                     /gene="NDAI0G00220"
                     /locus_tag="NDAI_0G00220"
                     /db_xref="GeneID:11497194"
     mRNA            <29472..>31436
                     /gene="NDAI0G00220"
                     /locus_tag="NDAI_0G00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670993.2"
                     /db_xref="GeneID:11497194"
     CDS             29472..31436
                     /gene="NDAI0G00220"
                     /locus_tag="NDAI_0G00220"
                     /inference="similar to DNA sequence:INSDC:YML046W"
                     /note="similar to Saccharomyces cerevisiae PRP39
                     (YML046W); ancestral locus Anc_1.493"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671041.2"
                     /db_xref="GeneID:11497194"
                     /db_xref="GOA:G0WDD7"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="UniProtKB/TrEMBL:G0WDD7"
                     /translation="MSIPNEAGILRAGVDQNTDALKGLDASFLKENPDFVDAYRQIRW
                     DDINTLNKLIAMTEQLVVKYKDPNDTIKQSIEIIFYQILQRYPLFFGYWKKFTAIEYQ
                     LYGLEKSIATLAKSVEAFPTSLELWCDYLNVLLTNNPDEVDLIRSNFLVARTLVGYHF
                     LSHPFWDKYIEFESKQEQWDKVNEIYQELITIPLHQYAKYCTAYKNFLHGPNATNAFK
                     DPQLEVKFKKTYDLVNKLWVYESRIRQNFFNLTPLSAEEIQNWEQYLNFIIENQSILG
                     LKTELIKYIFERCLIPCLYIEKFWLLYTQWMKTQVNMKEEKENESFFTLQDVIYLYQR
                     GAKMLPVQLKEYRIDYIVYLKTIYRKEKEYVFVIFTEAIFELIQMWPHEPRLMTEYLI
                     LLKRHDFPSSIEQTSQEILGQQTSFASFLDSTIKNFLSNKPKKENPIDDMINQSNFSI
                     VVVELIKVIWLVLKNIIQTRKYFNYFSKLPALKSSTTFWSTYYKFEKSTKNFAKLNKF
                     ITNLGKEITLPTATINDILTDYQSFYLINSNLNDYQTSDTSANSNDITIDPLLQSQFK
                     INDPQWIPEKHHTTLRSEWYKTKQYRENGHVGIIFDRPYIVNQILDRDSKSFKNVPPP
                     SPICKNLEKINHIGKSKDIFTEEYLNKLYN"
     gene            complement(32226..32296)
                     /gene="NDAI0Ltrna3G"
                     /locus_tag="NDAI_0Ltrna3G"
                     /db_xref="GeneID:11498044"
     tRNA            complement(32226..32296)
                     /gene="NDAI0Ltrna3G"
                     /locus_tag="NDAI_0Ltrna3G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11498044"
     gene            complement(<34422..>34877)
                     /gene="NDAI0G00230"
                     /locus_tag="NDAI_0G00230"
                     /db_xref="GeneID:11495708"
     mRNA            complement(<34422..>34877)
                     /gene="NDAI0G00230"
                     /locus_tag="NDAI_0G00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670994.2"
                     /db_xref="GeneID:11495708"
     CDS             complement(34422..34877)
                     /gene="NDAI0G00230"
                     /locus_tag="NDAI_0G00230"
                     /inference="similar to DNA sequence:INSDC:YEL048C"
                     /note="similar to Saccharomyces cerevisiae YEL048C;
                     ancestral locus Anc_1.491"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671042.2"
                     /db_xref="GeneID:11495708"
                     /db_xref="GOA:G0WDD8"
                     /db_xref="InterPro:IPR006722"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:G0WDD8"
                     /translation="MSTIIPSFITVIDTRDVPIIVFVPRQESDDVNKVLKYNTFSNIS
                     LDYFESRLINWSITDDVTPIKLLFQLEGVSVFGMFIKQTNLKIVIGFTGNLPDPTDNA
                     LVGIFKSVRKTYIDIKCNPFLNYSLDDGANQELKEKIDAKFHELFSSKI"
     gene            complement(<35613..>37517)
                     /gene="NDAI0G00240"
                     /locus_tag="NDAI_0G00240"
                     /db_xref="GeneID:11497196"
     mRNA            complement(<35613..>37517)
                     /gene="NDAI0G00240"
                     /locus_tag="NDAI_0G00240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670995.2"
                     /db_xref="GeneID:11497196"
     CDS             complement(35613..37517)
                     /gene="NDAI0G00240"
                     /locus_tag="NDAI_0G00240"
                     /inference="similar to DNA sequence:INSDC:YBR259W"
                     /note="similar to Saccharomyces cerevisiae YBR259W;
                     ancestral locus Anc_1.344"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671043.2"
                     /db_xref="GeneID:11497196"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="UniProtKB/TrEMBL:G0WDD9"
                     /translation="MRRYGDIPLPVVFDKTLTAFKNCPTRDLAAEIYQYAVYICEMSD
                     AIDGDIPSKDWIKQKLKGYLDETIEECKYMRNKCRPFDQWQKVFDIKRKFDMRLALLT
                     GTIGYIEDGDEYISSKERGLDMVSSYKYTIIEMINHEVKSLRDFFQDAYRNYVIHDVK
                     NAYNDAVEIYNTIETFERIRSNRREEPYYDLSEYEGGFGLSIVTNGISGSLTKPLPIG
                     EILQIFERAVRLELQFSLKGSALVKHQALTRFIKNSELLLKSLSGVQLTADTICSLIE
                     ASYNAESPDSFKEAFINERKSSFVDDFNDIIIKNINLTEPNQTKKSHRFPFSEGTQQY
                     KDRLLLNLRTAFKDSVSDIPSFNKKLIKYCNLKIKSNYDEIRIYAEKEGVLSNSDRKW
                     VNWMRLFFQYYVPTNTNFINQYYLPSTLKRILMLNMEYTTFFKNKRSIEAALNKEFTK
                     YLPIEYTPVNELIQQALHMKPELINNDETSLFLLHLKSEGFGYGLPDHSKDTVQPLWL
                     HKSFTDTWQQKRDEYKKQGKTLHNSFGMHVMEMSSNITLTDNRCLTLVVNPNIAAILY
                     QFNDADTIPVSVLKEKLMVERNQELQFNASLKKLLRHGILLLNNKQLTFNDDFKPNPH
                     ENETGVLKLM"
     gene            complement(<38383..>39825)
                     /gene="NDAI0G00250"
                     /locus_tag="NDAI_0G00250"
                     /db_xref="GeneID:11497197"
     mRNA            complement(<38383..>39825)
                     /gene="NDAI0G00250"
                     /locus_tag="NDAI_0G00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670996.2"
                     /db_xref="GeneID:11497197"
     CDS             complement(38383..39825)
                     /gene="NDAI0G00250"
                     /locus_tag="NDAI_0G00250"
                     /inference="similar to DNA sequence:INSDC:YEL047C,YJR051W"
                     /note="similar to Saccharomyces cerevisiae YEL047C and
                     OSM1 (YJR051W); ancestral locus Anc_1.490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671044.2"
                     /db_xref="GeneID:11497197"
                     /db_xref="GOA:G0WDE0"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR010960"
                     /db_xref="InterPro:IPR027477"
                     /db_xref="UniProtKB/TrEMBL:G0WDE0"
                     /translation="MASTITTDLKNLSISEPVVIIGSGLAGLASANQLVNKYKIPIVI
                     LEKESSLGGNSIKASSGINGAHTTTQSNLNVNDTPELFFNDTTKSAKGKGVETLMDKL
                     AKDSHLAVEWLQSEFDLKLDLLAQLGGHSVPRTHRSSGKLPPGFEIVSALSKNLKNLA
                     ESNPELVKINLDSKVTDIKVEDKKVTGVEFINTQNDKVETLNTSNVIFCSGGFGFSKE
                     MLQEYAPDLVNLPTTNGKQTTGDGQKILSKLGADLIDMDQIQVHPTGFVDPQDPESHW
                     KFLAAEALRGLGGILLSPSTGKRFVNELDTRDVVTEAIQIQCSKANNKALLVLGEGIY
                     EDLKNNLDFYMFKKLIKKITLKQVVEDYKLPITSDELAEHLNQYSTAAKDTFNRPLVV
                     KNLGDEITSETNVFIGEVTPVVHFTMGGAKINTKSQVINKDGQILAQGLYAAGEVSGG
                     VHGANRLGGSSLLECVVFGRTAADSIANVN"
     gene            complement(<40958..>41416)
                     /gene="NDAI0G00260"
                     /locus_tag="NDAI_0G00260"
                     /db_xref="GeneID:11497198"
     mRNA            complement(<40958..>41416)
                     /gene="NDAI0G00260"
                     /locus_tag="NDAI_0G00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670997.2"
                     /db_xref="GeneID:11497198"
     CDS             complement(40958..41416)
                     /gene="NDAI0G00260"
                     /locus_tag="NDAI_0G00260"
                     /inference="similar to DNA sequence:INSDC:YEL044W"
                     /note="similar to Saccharomyces cerevisiae IES6 (YEL044W);
                     ancestral locus Anc_1.488"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671045.2"
                     /db_xref="GeneID:11497198"
                     /db_xref="GOA:G0WDE1"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="InterPro:IPR029525"
                     /db_xref="UniProtKB/TrEMBL:G0WDE1"
                     /translation="MNNNSNNNAANDNRLEFIRKVTEQNTLPVPSPFKRVQQKKSRRH
                     KAVKQLLSEENKRINAIFQQEQQDNDADKNIKHKRLVPKVTYFNVDAPPSLRPPKKYC
                     DITGLKGPYRSPTTNIRYHNAEIYQLIVKPMAPGVDQEYLKLRGANFVLK"
     gene            <41767..>45216
                     /gene="NDAI0G00270"
                     /locus_tag="NDAI_0G00270"
                     /db_xref="GeneID:11497199"
     mRNA            <41767..>45216
                     /gene="NDAI0G00270"
                     /locus_tag="NDAI_0G00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670998.2"
                     /db_xref="GeneID:11497199"
     CDS             41767..45216
                     /gene="NDAI0G00270"
                     /locus_tag="NDAI_0G00270"
                     /inference="similar to DNA sequence:INSDC:YEL043W"
                     /note="similar to Saccharomyces cerevisiae YEL043W;
                     ancestral locus Anc_1.487"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671046.2"
                     /db_xref="GeneID:11497199"
                     /db_xref="InterPro:IPR003961"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="UniProtKB/TrEMBL:G0WDE2"
                     /translation="MLVYTLFTAMALLWLSYRLLKFLSIPVFNIVSTLKIKTPPATKV
                     SIDKISTNSITIHWENEPLKQSPNANPISHYLLYLNNSQIAIFPNNSNSLYTCCSITN
                     LLPEKQYQLDFITINKMGFINKLPSIFCMTKKASPSSSGSASASTSSSATKYSGNNTN
                     IPSISASTSNLMDNPDMNSLSMHDNMQPIDSNNPSSSDANSNPNTNSDTSDHKKNDMI
                     KTRKWRRNTLNTAIPPYPNNASNNNGNFQSALQNANFVISSHGSSVSLSKLNVPSNAN
                     STSSPLVNSTLNTTTSSATNLPSYTSLTSLQDLESYSIDDLKKILICSQEDLHDVLNQ
                     KQSILQDFQETDLELKLELDNLKLHWNHEIDLRKSLKSNIKSLENSKLLSDLKIDKLN
                     KKIAKLNDKILKMQKEMNLWSVNEFHDFNKENLNEKYSKLMDHANENIKNLNNQILIL
                     QNQINLQDDSNKKLNVLKKNKQNNSSSWVSISEETNGINNDDISNNADIINDVSISTE
                     QSQKSSPSPSSSGPITTSADIVALNSLLKKINDQTLERSGLLTNYGEELLSKFSANNN
                     SMLVQLIRDQLKIDQELDSKAKIRRSRMTKRIEYLENNFNDISINNRNLMATLIAQPY
                     NNNPPATVNTSQSRDHYPPPTNLLSSEDQINTNNINGSPILNTTDLNLNMLPNNQQMP
                     LISNQLFDPAQMQSPNQGTNLIPMVSTNSSLLPSNHSINNADIILNPQNSFSHGVPTT
                     VITNTTVTNPDFQWSIANQQQQQQQQQPPQQSPLVLSSPSQEHQVLQREQSAGNDLDQ
                     AFAYDNANHLISGLQDIIYDETDYPDSISNYSKGFTTDQLDNYWANQNTLSSPPSIPP
                     TNITSSPFINNQVSSSLRNISMGGDIGTNQSQSLLANISGNHLNMMSSRNSEMKVLSN
                     TLSPQNSNSQQMGHHDRSVSHVHNLITNIDGNSSTISNATNNTNTPHQRHEATFTSPS
                     FNQIWHTMSPVPSTPSNMMDGLTAPSPTDQVESTNKGKVHDSKKAKPMSASASASASK
                     ASHIRNQSSNSITSWGTKLGLTHKSTHSSTSTYQNNNNTNENVNVALDTGGSNSTFSS
                     SASSLNKNKDIIEDKKDKSREKAKDKEPGAGSSSTRKMSKLLSRTTMNSLFKLPNQHD
                     TQS"
     gene            <46005..>47621
                     /gene="NDAI0G00280"
                     /locus_tag="NDAI_0G00280"
                     /db_xref="GeneID:11497200"
     mRNA            <46005..>47621
                     /gene="NDAI0G00280"
                     /locus_tag="NDAI_0G00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003670999.2"
                     /db_xref="GeneID:11497200"
     CDS             46005..47621
                     /gene="NDAI0G00280"
                     /locus_tag="NDAI_0G00280"
                     /inference="similar to DNA sequence:INSDC:YEL042W"
                     /note="similar to Saccharomyces cerevisiae GDA1 (YEL042W);
                     ancestral locus Anc_1.485"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671047.2"
                     /db_xref="GeneID:11497200"
                     /db_xref="GOA:G0WDE3"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="UniProtKB/TrEMBL:G0WDE3"
                     /translation="MAALIRNYRFLIGAFAAVMLILLLRSSSRETTIDIARNVASSAT
                     RPSVPPEDTKETQFKTLPISNEPGYVTDSKTDSKNPKVADAVKLTSSSSASSSSSSSS
                     GSKCTKDHSFVIMIDAGSTGSRIHVYEFDTCTQPPTLINETFEMLKPGLSSFDTDAEG
                     AAKSLDPLLEKALEAVPQDKRSCTPVAVKATAGLRLLGEAKSSKILQAVRSHLENDYP
                     FPVVEGSAGIEIMSGDDEGVYAWITTNYLLGNIGTGSKIPTTAVFDLGGGSTQIVFEP
                     TFPGEEKMIDGEHKYDLNFGGYDYTLYQFSHLGYGLMQGRNKINSILLESALKKGSIV
                     EGDFKSKNNKISTPCLPPNVNATDVEVKLGDSTYIIDFIGPKVPAGAQCRFLADHILN
                     KDAKCSNPPCSFNGVHQPSLVRTFKETNDLYIFSYFYDRTRPLGMPLSFTLNELVDLA
                     RLVCDSQQTWNSVLSGIDGSLEELEKDPYFCLDLSFQVSLLHTGYDIPLHRELKTAQT
                     IAGNELGWCLGASLPLLESDNWKCKVKQIN"
     gene            <48128..>49924
                     /gene="NDAI0G00290"
                     /locus_tag="NDAI_0G00290"
                     /db_xref="GeneID:11497201"
     mRNA            <48128..>49924
                     /gene="NDAI0G00290"
                     /locus_tag="NDAI_0G00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671000.2"
                     /db_xref="GeneID:11497201"
     CDS             48128..49924
                     /gene="NDAI0G00290"
                     /locus_tag="NDAI_0G00290"
                     /inference="similar to DNA sequence:INSDC:YEL041W,YJR049C"
                     /note="similar to Saccharomyces cerevisiae YEF1 (YEL041W)
                     and UTR1 (YJR049C); ancestral locus Anc_1.484"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671048.2"
                     /db_xref="GeneID:11497201"
                     /db_xref="GOA:G0WDE4"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="InterPro:IPR017437"
                     /db_xref="InterPro:IPR017438"
                     /db_xref="UniProtKB/TrEMBL:G0WDE4"
                     /translation="MAITSDLKTGTSLHSKDNRIMSSTNLRRNDSEATTAVGSSDQLL
                     ATSQMHHYGRNEDESGYNSVGHDDRRCVTKILKPDGREIILKGNLHSRDDSDDVSELT
                     SSKQDELETTREIIRTISNNRKKQTEEDALQDNEGDEKYTMKHRSSSSAKSKQHLEFV
                     STAYGVRLLSKNLTKTKVSLNVENLILVTKISDVSLIYLTRELVEWLLITFPNLVVYV
                     EDDFKKSSQFAAKEICHDTNCTEARIKYWNSELVKKNNDLFDLCITLGGDGTVLFVSS
                     LFQKSVPPTVSFSLGSLGFLTNFNFEYFKQDLRKILERKIKINLRMRLECKIYHRHKP
                     KYDHKTGKKICIMELMSTHHVLNEVIIDRGTSPFISMLELFGDGSLMTVAQADGLIVA
                     TPTGSTAYSLSAGGALMYPSINAISVTPVCPHTLSFRPIVLPENMNLKVKVSLKSRGT
                     AWASFDGKGRFELQKGDYVTISASPYAFPTVESSPNEFFDGINRTLNWNVRDQQKSFT
                     HMLSLKNRKKLATEHKDANILDTDEEDIIEKRIDNTTFLKTFSSSSDDDEDDSIVENE
                     IENYSGAITDEVADDLHAFNGDVDEVRQLETY"
     gene            <51175..>52545
                     /gene="NDAI0G00300"
                     /locus_tag="NDAI_0G00300"
                     /db_xref="GeneID:11497202"
     mRNA            <51175..>52545
                     /gene="NDAI0G00300"
                     /locus_tag="NDAI_0G00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671001.2"
                     /db_xref="GeneID:11497202"
     CDS             51175..52545
                     /gene="NDAI0G00300"
                     /locus_tag="NDAI_0G00300"
                     /inference="similar to DNA sequence:INSDC:YEL040W"
                     /note="similar to Saccharomyces cerevisiae UTR2 (YEL040W);
                     ancestral locus Anc_1.483"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671049.2"
                     /db_xref="GeneID:11497202"
                     /db_xref="GOA:G0WDE5"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR017168"
                     /db_xref="UniProtKB/TrEMBL:G0WDE5"
                     /translation="MRGSLFYLLSLATLIVKTGAVTTCNATKSCPEDLPCCSQGGECG
                     KGNYCLGDCNPSFSFDIDSCMPVPVCKDSSTKFNGYSSKMLNEYTYLGNVSSAEWLYS
                     GNVIDYDDEESLILAMPKNSGGSLLTSTRALWYGKVSVRMKASHLAGVITAMTLFSGV
                     QDEIDYEFVGADIEKVQTNYYWQGSLNWTNSANITVDDVFDNYHIYEIDWHEDHITWS
                     VDGVVGRTLFKNDTYNSTTKEYRFPQTPSKVHLSIWPGGNATNAPGTIAWAGGEIDWD
                     STDITETGYYYAILNEVNVTCYDPPSGTKKNGTKAYKYVDTDGFSEKSVMITDDEVML
                     GSYNGTGNDPMLTTSISVSSSSSSSSSSSSSSSSSSKTSSHSSSKSSTSSSRTTSSSS
                     SSTPRSSSQSSASSVTSTGNRAATDIASQSNSSSSSATSSQNNASVINVTNLLTIFSV
                     IVGYLI"
     gene            complement(<52916..>53263)
                     /gene="NDAI0G00310"
                     /locus_tag="NDAI_0G00310"
                     /db_xref="GeneID:11497203"
     mRNA            complement(<52916..>53263)
                     /gene="NDAI0G00310"
                     /locus_tag="NDAI_0G00310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671002.2"
                     /db_xref="GeneID:11497203"
     CDS             complement(52916..53263)
                     /gene="NDAI0G00310"
                     /locus_tag="NDAI_0G00310"
                     /inference="similar to DNA sequence:INSDC:YEL039C,YJR048W"
                     /note="similar to Saccharomyces cerevisiae CYC7 (YEL039C)
                     and CYC1 (YJR048W); ancestral locus Anc_1.482"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671050.2"
                     /db_xref="GeneID:11497203"
                     /db_xref="GOA:G0WDE6"
                     /db_xref="InterPro:IPR002327"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="UniProtKB/TrEMBL:G0WDE6"
                     /translation="MPPKKESTGFTPGSEKKGATLFKTRCLQCHTVEEGGPNKVGPNL
                     HGIFGRTSGQAPGYSYTDANIKKNVKWDENNMSEYLTNPKKYIPGTKMAFGGLKKDKD
                     RNDLITYLKKATE"
     gene            <53633..>54394
                     /gene="NDAI0G00320"
                     /locus_tag="NDAI_0G00320"
                     /db_xref="GeneID:11497204"
     mRNA            <53633..>54394
                     /gene="NDAI0G00320"
                     /locus_tag="NDAI_0G00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671003.2"
                     /db_xref="GeneID:11497204"
     CDS             53633..54394
                     /gene="NDAI0G00320"
                     /locus_tag="NDAI_0G00320"
                     /inference="similar to DNA sequence:INSDC:YEL038W"
                     /note="similar to Saccharomyces cerevisiae UTR4 (YEL038W);
                     ancestral locus Anc_1.481"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671051.2"
                     /db_xref="GeneID:11497204"
                     /db_xref="GOA:G0WDE7"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023943"
                     /db_xref="InterPro:IPR027511"
                     /db_xref="UniProtKB/TrEMBL:G0WDE7"
                     /translation="MMNKRGNNDYYCYVRSIYQSCIMTYQVYLLDIEGTVCPIAFVKD
                     VLFPYFASQVPLLTHSKDGKIIELLSQFGIENDDELTKHILDLVNRDVKDSILKNLQG
                     HVWAKGYETGEIKAPIYSDAIQFIERYGDVSGCKETKIYIYSSGSVKAQKLLFAHVEG
                     GDSKEVLDLQPYINGYFDINTSGKKTEIQSYVNILKDINMVEAPEKVLFLSDNPLELD
                     AAKIAGISTGLALRPGNVPVPNMDKYSQYSEFSSL"
     gene            complement(<54805..>56088)
                     /gene="NDAI0G00330"
                     /locus_tag="NDAI_0G00330"
                     /db_xref="GeneID:11497205"
     mRNA            complement(<54805..>56088)
                     /gene="NDAI0G00330"
                     /locus_tag="NDAI_0G00330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671004.2"
                     /db_xref="GeneID:11497205"
     CDS             complement(54805..56088)
                     /gene="NDAI0G00330"
                     /locus_tag="NDAI_0G00330"
                     /inference="similar to DNA sequence:INSDC:YEL037C"
                     /note="similar to Saccharomyces cerevisiae RAD23
                     (YEL037C); ancestral locus Anc_1.480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671052.2"
                     /db_xref="GeneID:11497205"
                     /db_xref="GOA:G0WDE8"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR004806"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015360"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G0WDE8"
                     /translation="MVNVIFKDFKKEKIPLDLEPSNTILDVKSQLAQAKACEESQIKI
                     IYSGKVLQDGQTVEECQLKEGDQIIFMISKKKSTVTKVTEPPAAAAAQAQAPGANPEI
                     TTASNSATPGLIETAAASGTPEGTPQTGNDTTASASANTATDAGAPATTTAATELSPS
                     SAGFVTGTQRNETVERIMEMGYEREEVERALRAAFNNPDRAVEYLLMGIPENLQQQHQ
                     QQQQQPTQASPQNIANEGSATATATGDDAHAEEPPAEDDLFAQAAQGSGNAGSAGSAV
                     GGSTGEGTPGSIGLTIQDLLSLRQAVSGDPESLSSLLENLSTRYPQLREQIMSNPQTF
                     ISMLLEAVGDNLQSLEGLGDIGGDLGEINEGDNDTMGEASAAPPTIQLTPEDEQAISR
                     LCELGFERSLVIQVYFACDKNEEIAANMLFSDYAD"
     gene            complement(<56898..>58412)
                     /gene="NDAI0G00340"
                     /locus_tag="NDAI_0G00340"
                     /db_xref="GeneID:11497206"
     mRNA            complement(<56898..>58412)
                     /gene="NDAI0G00340"
                     /locus_tag="NDAI_0G00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671005.2"
                     /db_xref="GeneID:11497206"
     CDS             complement(56898..58412)
                     /gene="NDAI0G00340"
                     /locus_tag="NDAI_0G00340"
                     /inference="similar to DNA sequence:INSDC:YEL036C"
                     /note="similar to Saccharomyces cerevisiae ANP1 (YEL036C);
                     ancestral locus Anc_1.479"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671053.2"
                     /db_xref="GeneID:11497206"
                     /db_xref="InterPro:IPR005109"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G0WDE9"
                     /translation="MEHIKRFKLKHTLISPTTISIAGTLLTLYFLSKFLFSISPSIAN
                     IITFPITLISIIFSPSSSTISESSSTSIFLNPYVPNFRNNPGVEFYDLANYQGNKDGW
                     QKNDRILFCVPLRDAAEHLPMFFDHLNKMSYPHNSIDLSFLVSDSSDDTMGVLLSNLQ
                     NAQSQQDKSKRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAI
                     KPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKE
                     SEGGLQLADTLGEDDVIVEGYPEYATWRSHLAYMRDPNGNPEDEMELDGIGGVSILAK
                     AKVFRTGSHFPAFSFEKHAETEAFGKLSRKMNYNVIGLPHYVIWHIYEPSKEDLKHMA
                     WMAEEEKRKLEEEKLEEFYDKIWEIGFDDVREDWETERDSILKNIDFKGSENDIFVDW
                     SDDPENENNDKANKANSNQNAKNGQGNGEGASGDNPGQAQYPKEVPLEFDPDKN"
     gene            <60735..>61211
                     /gene="NDAI0G00350"
                     /locus_tag="NDAI_0G00350"
                     /db_xref="GeneID:11497207"
     mRNA            <60735..>61211
                     /gene="NDAI0G00350"
                     /locus_tag="NDAI_0G00350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671006.2"
                     /db_xref="GeneID:11497207"
     CDS             60735..61211
                     /gene="NDAI0G00350"
                     /locus_tag="NDAI_0G00350"
                     /inference="similar to DNA sequence:INSDC:YEL034W,YJR047C"
                     /note="similar to Saccharomyces cerevisiae HYP2 (YEL034W)
                     and ANB1 (YJR047C); ancestral locus Anc_1.478"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671054.2"
                     /db_xref="GeneID:11497207"
                     /db_xref="GOA:G0WDF0"
                     /db_xref="InterPro:IPR001884"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR019769"
                     /db_xref="InterPro:IPR020189"
                     /db_xref="UniProtKB/TrEMBL:G0WDF0"
                     /translation="MSDDEQHTFETADAGSSATYPMQCSALRKNGFVVIKGRPCKIVD
                     MSTSKTGKHGHAKVHLVAIDIFTSKKLEDLSPSTHNMECPVVKRTEYQLLDIDDGYLS
                     LMTMDGETKDDVKMPEGELGETMRAAFDEGKDLMVTIIAAMGEEAAISFKEAPQGN"
     gene            complement(<61916..>64048)
                     /gene="NDAI0G00360"
                     /locus_tag="NDAI_0G00360"
                     /db_xref="GeneID:11497208"
     mRNA            complement(<61916..>64048)
                     /gene="NDAI0G00360"
                     /locus_tag="NDAI_0G00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671007.2"
                     /db_xref="GeneID:11497208"
     CDS             complement(61916..64048)
                     /gene="NDAI0G00360"
                     /locus_tag="NDAI_0G00360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671055.2"
                     /db_xref="GeneID:11497208"
                     /db_xref="InterPro:IPR021988"
                     /db_xref="UniProtKB/TrEMBL:G0WDF1"
                     /translation="MSRPTFDNELDFLDNDDTISRKTSSPFLNNSSSSSSSSSSSSSS
                     SSSSNLKKKLNQLYLTIERYTLSTLRKLLFFFRKNPLLKFIILVITLIIIISVTHPKG
                     KKSIQKVGYQYYNTIYGSKEVSRKEDLLNIDVTQKLRFKNWENSPITHQMRHQDYIED
                     ELIGYVSNLDLKKLNIEKDNDDNDNNGHGHGSKKLENEFHKDYDTLVKCEDLQYTNII
                     EHSRWNKILEDDLMELRRDLRKNDKFLGKELSSDNEKDWSEEKIINEHWMRFGGSSVW
                     LEREQCHVMFSRIVYTRNGVRDHPHVSMIRAQAFDKDWNELIGKRIPYNDLIPHKDIE
                     LEIQKLDEELGMHSCDHLKKDKTLYETCVVDNTRREMEAKKRKEEILSQYFITYPTVL
                     DIKYNTNGDWKGPEDPHVILRKTDNMEEPLVIFNMEDDEEEKRRVFSFMPHRRNTPLI
                     KFTLPDASRKFKEKEKNWAPFFHQTSSESAFSRGIIYFIYSFSPLEILKCSLNDGICE
                     MVFEAKTLDLSDDNKFGGMRGGTQFVPLPELLPHVKGKQIWVGFPKLHIEHCGCGERF
                     YRPMLSLLVESNGVYHQELAVPDIDFDMDVLSWDQKGTHCGQHNVLSPNSIDSWEVAS
                     QTSHPKRFEDYMTLTFSEADANTRVIILRGILNYILNMYKEKDMMENFEVSKKSSIII
                     GQTLKCVVKQSKEDCKVYGDAHPEPKEN"
     gene            <65893..>68838
                     /gene="NDAI0G00370"
                     /locus_tag="NDAI_0G00370"
                     /db_xref="GeneID:11497209"
     mRNA            <65893..>68838
                     /gene="NDAI0G00370"
                     /locus_tag="NDAI_0G00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671008.2"
                     /db_xref="GeneID:11497209"
     CDS             65893..68838
                     /gene="NDAI0G00370"
                     /locus_tag="NDAI_0G00370"
                     /inference="similar to DNA sequence:INSDC:YEL032W"
                     /note="similar to Saccharomyces cerevisiae MCM3 (YEL032W);
                     ancestral locus Anc_1.477"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671056.2"
                     /db_xref="GeneID:11497209"
                     /db_xref="GOA:G0WDF2"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008046"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:G0WDF2"
                     /translation="MATDIAASGSTQGYQFDTTNLYAPDAVFVDRVRRFQEFLDTFSD
                     YKESIRNIQLYNSAKDQIDPNDDVDNFLDEDDDIDKAKKASSSSKSNILPQRVTISLD
                     DLREFDRSFWTGILTEPAYFIPPAEKALTDAAHSMEELSTHNNSNATASSKSQWHLSF
                     KGSFGSHALSPRTLNAQFLNKLISVEGIVTRTSLVRPKLIRSVHYAEQTGRFHYRDYT
                     DATTTLTTRIPTPAVYPTEDPDGNKLTTEYGYSTFVDHQRITVQEMPEMAPAGQLPRS
                     IDVILDDDLVDKTKPGDRINIIGVFKSMGAGGMNSNNKSAGSLGGFRTLIIGNTVYPL
                     HARSTGVSARQNLSDFDIRNINKLSKRKDIFDLLAQSLAPSIYGHDHIKRAILLMLMG
                     GVEKNLPNGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAA
                     VTTDKETGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIH
                     TTLNARCSVIAAANPVFGQYDVNRDPHHNIALPDSLLSRFDLLFVVTDDINEIRDRSI
                     SEHVLRTHRYLPPGYLEGEPIRERLNLSLAVGVDDANEDENEDVDGEGDEEDRIFEKF
                     NPLLQAGAKLATNKGNHNGTKIPKLVTIPFVRKYIQYAKERVVPQLTQKAIDIIVKNY
                     ADLRNDENIKKSPITARTLETLIRLATAHAKVRLSKTVDKRDAMIAAGLLRFALLGEE
                     VGDEFYESDQEESLLNRSPKRSPKKRQRITRRSTEDNDNANATYSPLRATRLTTASAA
                     SSVKASPARRKLQLSDEDEAEEAYEDEEESDDNMTKLPEEEEEDLRKRLELGLRVSPR
                     RREQLIQGGPLTDAPKMTNVSSLSTDEKEKEEEQEEQEQEISSFANVKMGSISTGRVS
                     LISGIIAGIMQTEVFDDECYPVTDLYERINEQLPEEEKFSIPEYLAGLKIMADRNNLM
                     IADEKVWRV"
     gene            <70349..>74029
                     /gene="NDAI0G00380"
                     /locus_tag="NDAI_0G00380"
                     /db_xref="GeneID:11497210"
     mRNA            <70349..>74029
                     /gene="NDAI0G00380"
                     /locus_tag="NDAI_0G00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671009.2"
                     /db_xref="GeneID:11497210"
     CDS             70349..74029
                     /gene="NDAI0G00380"
                     /locus_tag="NDAI_0G00380"
                     /inference="similar to DNA sequence:INSDC:YEL031W"
                     /note="similar to Saccharomyces cerevisiae SPF1 (YEL031W);
                     ancestral locus Anc_1.476"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671057.2"
                     /db_xref="GeneID:11497210"
                     /db_xref="GOA:G0WDF3"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006544"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:G0WDF3"
                     /translation="MTSKSFVSSPLVRDSTLLVPRSVTSKPYFLPFLPLYATFFHIYF
                     NEYERYIKGGEWTFVFLGSIVTINILVMLMPSWNVKINTKFNYSVVNDVTTATHILIN
                     TTPNNGADDIVEIQRITESGVLQTFFQFQKKRFLWYEDEQVFASPKFIVDEYPKIKDF
                     KDSTGNSNNLTHMKRLYGENSFDIPIPSFMELFKEHAVAPLFVFQVFCVALWLLDEFW
                     YYSLFNLFMIVSMEAASVFQRLNALKEFRTMGIKPYPINVFRNGKWSTLQTNELLPMD
                     VVSVTRTAEESAIPCDLILIDGSCIVNEAMLSGESTPLLKESIKLRPNEDDLQLEGVD
                     KISVLHGGTKALQVTGPESSSDSHIPLPSDGGALAVVTKTGFETSQGSLVRVMIYSAE
                     RVSVDNKEALMFIFFLLIFAVIASWYVWIEGTKMGRIQSKLILDCILIITSVVPPELP
                     MELTMAVNSSLAALSKFYVYCTEPFRIPLAGRIDVCCFDKTGTLTGEDLVFEGLAGLS
                     TNTKDIRHLYSGSDAPQNTTLVIGAAHALVKLDDGEVVGDPMEKATLKALGWKVDYND
                     VITKSGTEKLNILRRFQFSSSLKRSSSIASHNGSLFAAVKGAPETIRERLSHVPENYD
                     EIYKSFTRSGSRVLALATKSLPKMSPKKIDDLVRENIEHGLEFSGFLVFHCPLKDDAI
                     ETIKMLNESAHRSIMITGDNPLTAVHVAKEVGIVFGETLILDRVDDNNDADGKLIFHN
                     VEDTINIPFDPSKDSIDHSAIFDKYDVAVTGYALNLLENHSQLRDVLRHTWVYARVSP
                     SQKEFILNNLKEMGYQTLMCGDGTNDVGALKQAHVGVALLNGTEEGLKQLVVKNREEN
                     MKNMYIKQCAFVARWNQPQPPVPPLIAHLFPPGSNNPHYLEAIEKKGTVITPELREKV
                     AEANKKAIEILDPNTTTSEKGDKPSGSDIASLLLNKAEDAQEDDVPTLKLGDASCAAP
                     FTSKLANVSSVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSIIYMAGVKFGDAQA
                     TVSGLLLSVCFLSISRGKPLQKLSKQRPQKGIFNIYITGSILSQFAVHIATLVYITLE
                     IYKLEPREPQVDLEKEFAPSLLNTGIFIIQLVQQVSTFAVNYQGEPFRENIRNNKGMY
                     YGLLGVTGLALASATEFMPEMNEAMKFVPMSDIFKFKLTLTLLLDFFGSWGAEHFFKY
                     FFMDDKPSDITIRKVKISESKI"
     gene            complement(<74329..>75291)
                     /gene="NDAI0G00390"
                     /locus_tag="NDAI_0G00390"
                     /db_xref="GeneID:11497211"
     mRNA            complement(<74329..>75291)
                     /gene="NDAI0G00390"
                     /locus_tag="NDAI_0G00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671010.2"
                     /db_xref="GeneID:11497211"
     CDS             complement(74329..75291)
                     /gene="NDAI0G00390"
                     /locus_tag="NDAI_0G00390"
                     /inference="similar to DNA sequence:INSDC:YEL029C"
                     /note="similar to Saccharomyces cerevisiae BUD16
                     (YEL029C); ancestral locus Anc_1.471"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671058.2"
                     /db_xref="GeneID:11497211"
                     /db_xref="GOA:G0WDF4"
                     /db_xref="InterPro:IPR004625"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:G0WDF4"
                     /translation="MPRLLATQSHVVHGYVGNKAATFPLQCLGWDVDCCNSVQFSNHT
                     GYGMDKVFGNITEHNHLDQLLSGIFKNFPNEYNALLSGYLPNKDSVKCMGINYKKFKK
                     QNPNSIWLMDPVMGDEDELYVNEDVIPEYRNLILSDSSDVDIITPNQFELEILYGKKI
                     IDQNELKLALNHLHKRIPVIIVTSCDPRIFHDEDYVYCVASMRGHAHPLVYRVPLIDS
                     YFTGVGDLFAAILLDRIYSLLNKEDEEISAVSDELVFEKQINDVLNVLQRVLHLTKKL
                     APKNVKSKIGSALDMKEMELRIIEARDLYGTDINPNEDFLYSRL"
     gene            <78577..>84067
                     /gene="NDAI0G00400"
                     /locus_tag="NDAI_0G00400"
                     /db_xref="GeneID:11497212"
     mRNA            join(<78577..79731,79733..>84067)
                     /gene="NDAI0G00400"
                     /locus_tag="NDAI_0G00400"
                     /product="hypothetical protein"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_003671011.2"
                     /db_xref="GeneID:11497212"
     CDS             join(78577..79731,79733..84067)
                     /gene="NDAI0G00400"
                     /locus_tag="NDAI_0G00400"
                     /artificial_location="low-quality sequence region"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671059.2"
                     /db_xref="GeneID:11497212"
                     /db_xref="GOA:G0WDF5"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013103"
                     /db_xref="UniProtKB/TrEMBL:G0WDF5"
                     /translation="MAYFQHGDPSEESQKSENLRLIKSKNEDIKSLKQLIEVLDESKK
                     ESRTQLTKILSNVKDTERFNKIKQVQSELQQIESMAEYHATSLIKLQKELSRLTLSDN
                     NNTTEKKTNIKENKINTNVLKITPKNNILEYNSPEPTLLLSNNDSRGKFYEVRTSNGK
                     EVRFYYEDPSAQLSEKLEELSTFPKWCDNLSSLCNIWHLDNITKGEDITEGEEVILRK
                     VIQNSLGKKLYSFGKLGSTATEIFLELENVTKKKFPRVTKDKMWKKILIDKYCSNTNE
                     IRHVLDNIILLEIYTEDPENAKPLDNKFINMKIYKCLSNDLRTSLMNSAMGLEELLNK
                     SPREMITVIIANINLIKELAEVYEEDERPCQTCNSLLHGYWNCPLKKVTDLGKIQEIE
                     SGKIIRRVTNKKTKNIEKSPKIKEKNYKTEKIKNNNTTNKPLDIAIDTCSGINLTPEL
                     QWIEDYESLDTRPTFFGVGEGNAIKITGKGKLKIKTNTNKTDYLPVFYAPKEDATILS
                     AICLRDKVGFTIDSNYRYLKNKNFLVPMKIVNKTLWVHHEDILTVPTTQKVRRITPMN
                     PTAINKTIEYKEAHQRLSHASSQAIIESIKKGIFADVKDITNSENTECEICLLGKSTR
                     HNHYKGAMNYHYKDKEPGYSWSLDIFGPVATNVPNNPKYMLVMIDSVSRYLITSFHTT
                     KDKITIGNQIEKNINRIEKQFERTVKELRMDRGTEFHNEYLQGILNGLGIVPIYTSTQ
                     DHAGNARAERVIRTISGDIRTLLTQTTMSQRFWHYAARAATEVRNCIYNKQIKTSPVK
                     LVSKPNIEIYLRSFIPFGAPAVIWQPTKNKQKPTGYIARALCKNIEGDGYVFFVPQGK
                     SHKIIPTNNYTILNPNNIETKTKDYDQFYKDILHQNNGKFEMTDYDAQEIEHLFHNEE
                     NLTDNEIDYFSDIEEHNDTDMELENLAEELVSENELVISDESITDDDIEQVSDTDVEE
                     ETELFNEQEQNKNNEGTTNTVNQLTDDIETVTSMEDQDNSMADKIFENEEQIKDHNTV
                     DDEGNDKIDPTIEEYNETSFSPNTIDDEPQTQVTKDVVKQHTENENIYEKDVGDTSTD
                     HHKEIKEPNKNSEQTQNNTKINESKSTKINKRIWWKDNKTTKPRNIPKFLTKKLKSLE
                     KPVVRNKKNNTKINESKSTKINKRIWWKDNKTTKPRNIPKFLTKKLKSLEKPVVRNKK
                     NNRRTIEELDDTENDSESDNSEGSDMIIPSSLKESTTNALKNIKNDGRPVSIRTRKNK
                     KMRLRRIKLKNKNNNKIKFNKVRSIYLRDAITNNKNVEEKIKFKQALQKEINSFIQTK
                     TIDPTIKLNKREVPGDQVIPIQPIFDIKRDGTYKARIVARGDLQSDESYGDIDTSLLN
                     MESLKLFLILALEKELTIRTMDINHAFLYADIEEKLYIQHPQDRSKITPLYKSIYGLK
                     QSPKNWNDTLRTFMNKNGLYDTEYSPGFYTNEDRSVMIAAYVDDTVIAAKSEEDIDKI
                     IIMFQKEFTLKIVGTMKNNRLSTDILGLDLEYDLNTGQATLSLNGYIQRMMKEFPEIQ
                     TKRKFKTPFPSEYKYNPIYEKSDFNENEMKDKVKKLQQIVGKITYIRSRGRLDIEFAA
                     AKVARLTKLPHSKVFEWVERIIKYLDQTRDLKLTLKKDIQKCPKLTMISDASVATEYD
                     YKSRIGVHIWYGNNLILSQSKQTTKTCNSSPEAELYGINYGTLMALMLKEKIEKITRR
                     KILVDVISDCQPALDWIKQPYMKTRKKPILIPLTRLREEFEKNNINLFKISGVENVAD
                     EHTKVVTAEKFKTLINIMNGTVNPQTLLPYIEKIEINYIGRPDPE"
     gene            84587..84658
                     /gene="NDAI0Ltrna4M"
                     /locus_tag="NDAI_0Ltrna4M"
                     /db_xref="GeneID:11498062"
     tRNA            84587..84658
                     /gene="NDAI0Ltrna4M"
                     /locus_tag="NDAI_0Ltrna4M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:11498062"
     gene            <85939..>86421
                     /gene="NDAI0G00410"
                     /locus_tag="NDAI_0G00410"
                     /db_xref="GeneID:11497213"
     mRNA            <85939..>86421
                     /gene="NDAI0G00410"
                     /locus_tag="NDAI_0G00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671012.2"
                     /db_xref="GeneID:11497213"
     CDS             85939..86421
                     /gene="NDAI0G00410"
                     /locus_tag="NDAI_0G00410"
                     /inference="similar to DNA sequence:INSDC:YEL027W"
                     /note="similar to Saccharomyces cerevisiae CUP5 (YEL027W);
                     ancestral locus Anc_1.469"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671060.2"
                     /db_xref="GeneID:11497213"
                     /db_xref="GOA:G0WDF6"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR011555"
                     /db_xref="UniProtKB/TrEMBL:G0WDF6"
                     /translation="MSDLCPVYAPFFGAMGCAAAIVFTSFGAAYGTAKSGVGICASCV
                     LRPDLLVKSIIPVVMAGIIAIYGLVVSVLVSSSLAQSQALYTGFLQLGAGLSVGLSGL
                     AAGFAIGIVGDAGVRGTAHQPRLFVGMVLILIFAEVLGLYGLIVALLLNSRSTQDVSC
                     "
     gene            complement(<86779..>89292)
                     /gene="NDAI0G00420"
                     /locus_tag="NDAI_0G00420"
                     /db_xref="GeneID:11497214"
     mRNA            complement(<86779..>89292)
                     /gene="NDAI0G00420"
                     /locus_tag="NDAI_0G00420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671013.2"
                     /db_xref="GeneID:11497214"
     CDS             complement(86779..89292)
                     /gene="NDAI0G00420"
                     /locus_tag="NDAI_0G00420"
                     /inference="similar to DNA sequence:INSDC:YJR042W"
                     /note="similar to Saccharomyces cerevisiae NUP85
                     (YJR042W); ancestral locus Anc_1.468"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671061.2"
                     /db_xref="GeneID:11497214"
                     /db_xref="InterPro:IPR011502"
                     /db_xref="UniProtKB/TrEMBL:G0WDF7"
                     /translation="MTKSTNDLLMDTNNFDFIDDNESINDDDNMGLDQESKHSDAVDS
                     DKEEEEQNDEDEDIDDTSFEIDPVSNVPIIRLTKKKSDLPLKNTSTLSSSSHLKFKLG
                     PLNSQNLAFITENSTKSHAYNSILYPIQLPNVDNSKEFPVYVSKLFEIYNDLGDDRVF
                     TIPTFGLIKSSSLKNHNVVVNMAMETMINELEIFINTLQKNYESEKEHQQEEQEQERQ
                     QYVEIGSKFFMLEDSLTILNCLKTFHFICDNNNIETNDDEQDFISNDEFDTDSIRNKF
                     ITSLLCWINRSDGQPDEAYIEQVFNNNTTGVNEHESKGVFGTIFFWKLLNQLLLRGLF
                     QQAILCIERSNILEYLETQCSSSFQIMKDLISLLENYPTDSYTKFREWKAYTLQLLSN
                     FNDSENKISGELRDSIEDTLLIISGNENKILYYSKTWYESLSGFLLYYIPSLKLIQQY
                     LQLSLERHSLDLTNNWENSCVKIIQNNIHSILPQLESLDSCTAAFTAAICEAKGLLEP
                     FEYTTNDLTDENANEIEDLFSRKNGMASYLINNFALELCSSNDKQLWPIAIGLISLCP
                     QQNGLNNYSIKKLTISELLLHYPFETNDDIEWMLSICAQWKLPRVAKSLYTILGNQML
                     YQGSTIEAITNFSKAGKFELVKQYSWTLFEASILNNAPLDDQILNAIATYNTTNSNSA
                     NKIVSIPNYIIYNLLTSAMRQTLAPYAVLYQFYQARDNQEWAKALRLLISLIEFPYLP
                     KCYLILLVMKFLYPIYLCDDDDSKVKGDDVVFDEFLILNIIESLEDKWDNDDIKSKEF
                     YEKEKTIASTNCPSFPKELHEFNKIVKKRLNFKIYEEFM"
     gene            <90174..>90842
                     /gene="NDAI0G00430"
                     /locus_tag="NDAI_0G00430"
                     /db_xref="GeneID:11497215"
     mRNA            <90174..>90842
                     /gene="NDAI0G00430"
                     /locus_tag="NDAI_0G00430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671014.2"
                     /db_xref="GeneID:11497215"
     CDS             90174..90842
                     /gene="NDAI0G00430"
                     /locus_tag="NDAI_0G00430"
                     /inference="similar to DNA sequence:INSDC:YEL024W"
                     /note="similar to Saccharomyces cerevisiae RIP1 (YEL024W);
                     ancestral locus Anc_1.461"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671062.2"
                     /db_xref="GeneID:11497215"
                     /db_xref="GOA:G0WDF8"
                     /db_xref="InterPro:IPR004192"
                     /db_xref="InterPro:IPR005805"
                     /db_xref="InterPro:IPR006317"
                     /db_xref="InterPro:IPR014349"
                     /db_xref="InterPro:IPR017941"
                     /db_xref="UniProtKB/TrEMBL:G0WDF8"
                     /translation="MLPILRSKVTTSLVKSPQQISLPLTRLISSTPNPINKSTYKTPN
                     FDDVLKEDHTNNDKSRSYAYFMVGSLGLLSSAGAKSTVETFISSMSASADVLAMAKIE
                     VNLATIPVGKNVVVKWQGKPVFIRHRTSHEIQEANEISMTDLKDPQTDSDRVQNPEWL
                     IMLGICTHLGCVPIGESGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPNYEFDGDK
                     VIIG"
     gene            complement(<91234..>93021)
                     /gene="NDAI0G00440"
                     /locus_tag="NDAI_0G00440"
                     /db_xref="GeneID:11497216"
     mRNA            complement(<91234..>93021)
                     /gene="NDAI0G00440"
                     /locus_tag="NDAI_0G00440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671015.2"
                     /db_xref="GeneID:11497216"
     CDS             complement(91234..93021)
                     /gene="NDAI0G00440"
                     /locus_tag="NDAI_0G00440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671063.2"
                     /db_xref="GeneID:11497216"
                     /db_xref="UniProtKB/TrEMBL:G0WDF9"
                     /translation="MEFDFDLKCFPKQEPPSVEDFLNFQNTNDTDKELSLKRVYTRIL
                     ELNQKKIEDMEEKLVNYEEDLKRYKDREHDLDSILRNKDEEIDDLRNKLKNIIRNKRR
                     CIQRNVMETVNDAVNTDIVTNELANNEESTIASNALDLVNNGISSGRIGRDNNVVSNV
                     RHGMGHATSGLGGRQQTLQQERQYETSKDSSIDIELRENERNEEGNEDELEGQDQDED
                     RDAVDGETTEARFELDDSHNLLFHEERVQTLKRMILQINCETLTARQSVLLCIKTMLG
                     LTPHNLRMSGDYAKDKEETFIKYLLLKCGHHFEMTVDLLFAYSLCQDGICLSIRNSLR
                     RNVVGYELECLFCGELQYKIIFDNSRVKFVFRNKHEHKDVEQGERKHVCTFGSVKRHQ
                     IHVKKGQLTPYMEQEYATDIEKLRPLLHNDGNLLIHLLLIIKERILVLTKPIKAVASV
                     CRLIVDYSDGFVKPSYAGNNTMSNNLSMDISDSRENSIPISKSNNSNNNDNSTDSADD
                     KVMKQRKKAVEKLVKNVLLETLHFEEKFDTLNQIKDEINKLGLGSALEDRETYSRRLH
                     DRLRKSLAYAVDKAYSSEAFNIDNFFDTE"
     gene            complement(<93266..>95314)
                     /gene="NDAI0G00450"
                     /locus_tag="NDAI_0G00450"
                     /db_xref="GeneID:11497217"
     mRNA            complement(<93266..>95314)
                     /gene="NDAI0G00450"
                     /locus_tag="NDAI_0G00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671016.2"
                     /db_xref="GeneID:11497217"
     CDS             complement(93266..95314)
                     /gene="NDAI0G00450"
                     /locus_tag="NDAI_0G00450"
                     /inference="similar to DNA sequence:INSDC:YEL023C"
                     /note="similar to Saccharomyces cerevisiae YEL023C;
                     ancestral locus Anc_1.460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671064.2"
                     /db_xref="GeneID:11497217"
                     /db_xref="InterPro:IPR018712"
                     /db_xref="UniProtKB/TrEMBL:G0WDG0"
                     /translation="MPLSTGTTASETQIFTTSKEETNSATLKTSKNIILCFDGTRENF
                     GPQPFTNILKIFGLLENDKDQICYYQPGVGINGDLDRIDENLNLRRFTWSKFYNILDS
                     MFAFSLDSHIVSAYIFLMQNYEIGDKIYMFGFSRGAFIARVLAGMIGKVGLLHPGLEE
                     LVTLAWKIYQSWEYSEQPNQSTYTTTLASEFKNIFCRDYEVRICFQGLFDSVNSVGIL
                     RDRLFPFTQRSNIVDHVRHCVSIDERRGKFKQQGFSSNSYSTRLFSLQFRTYILEEFS
                     NNLTPVESNASENISTKEIRNPLIDFTIGKTKSTDTDCENPCQRFINRKCLPIETSRK
                     SVEGIFQICEKLDNDRCCFNSDGRDIQGDKNILTPDLIEKWFIGDHSDIGGGWEMDRN
                     TENFVSLIPLRWIIMESMKFGVRFKNEPLKNFLKENLTVGSILSLTHDFLDLCQLKEN
                     NHKKTFQLEKESNIPLIRSYLDQQAQKPEFQQDTDEFRERMNRKIKYTRGGYFTTRMS
                     LGWWILEFLPIGLKLQNRRGKWRKVYIPNLGQTRSIPENADLHWSVYWKIKFDPNYRP
                     TNLPKYARDIIEEFLQIKLDNGRERKTKTIMSHMKSYPNRIENEGEWVLEGSSTVTTT
                     TATLSFSSLSDQLDNTNKGINATRYYELRSNFLKWQETDWKKIPDDMVLESFLDSSCI
                     "
     gene            <96075..>100646
                     /gene="NDAI0G00460"
                     /locus_tag="NDAI_0G00460"
                     /db_xref="GeneID:11495706"
     mRNA            <96075..>100646
                     /gene="NDAI0G00460"
                     /locus_tag="NDAI_0G00460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671017.2"
                     /db_xref="GeneID:11495706"
     CDS             96075..100646
                     /gene="NDAI0G00460"
                     /locus_tag="NDAI_0G00460"
                     /inference="similar to DNA sequence:INSDC:YEL022W,YJR031C"
                     /note="similar to Saccharomyces cerevisiae GEA2 (YEL022W)
                     and GEA1 (YJR031C); ancestral locus Anc_1.455"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671065.2"
                     /db_xref="GeneID:11495706"
                     /db_xref="GOA:G0WDG1"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR023394"
                     /db_xref="UniProtKB/TrEMBL:G0WDG1"
                     /translation="MDSKELMTAVDPVTIVIKECINLSTAIRKYSKIASQSSGVAALL
                     GGGSEIFSNQDASLAHTFNNLSANKHNDPFLSGFIQLRLMLNKLNSLDGIDSLTLLQP
                     FLLTISTSSISGYITSLALDSLQKFFTLNVINFDSLNYIGAYREVANALTHCRFEGSE
                     QLSDDSVLLKVVLLLQDLINSPYGELLTDSTMYDIVQTIMSLACNKRRTEVLRKAAES
                     TMTIITLKIFSSLKTMEPLDSTEKYINDEGYSKNTLKDDVIVISNQESEQPTMQIVPS
                     IVDDKSVASNDAESVLSSNEDEVGTNLEIEKQPFELQNTEQEAIATQNEDTDGENETN
                     KLKVEIKEKDLTISSGTYGLPLAKQYLSLLLSLIIPENQAKHTNSTRIFALQLINTII
                     EIVGDKFPLYPPLFTLISDPIFKCIFYIIQNTNKLSLLQGALQLFTSLVLILGNHLPM
                     QIELTLTRIFSMLLDDTTEANNPTMTPNNASSTSINTANEYQPKSPAIKELLIEQISI
                     LWTRSPSFFTSMFINFDCNLERSDVSVNIIKALTKLSLPEAAISTTDSVPPICLEGLI
                     SLVDDMFDHMQDVDRNEYMKQFNGKINEILKQRERKTEFIKSAELFNENPKLGIPSLI
                     EKGFIKSNSDEDIAEFLFENNSRMNKRTIGLLLCNPKRTPLLKCFIDLFDFKGLRVDE
                     AIRILLTKFRLPGESQQIERIIEAFSTKYVDNQDYKPIETGNDLEEEADLGSSPTDNA
                     ESRVEGDTEESEQIEDISTVQPDSDSVFVLSYSIIMLNTDLHNPQVKEHMSFNDYSGN
                     LRGCCNEKDFPHWYLDKIYCSIRDKEIVMPEEHHGNEQWFEDAWNNLISSTTVLTEIQ
                     RDSTNIIDKLSSLELLLFDRAIFKHVGNAIVSTLFKIYKVASDDHISSRMLTTLDKCS
                     FIASFFNFKTLYNDILRHIARFTTLLKIKPSNKKNANAASVANDDVDDIPLVEVTIEG
                     QEKKVPVSSEIIRLGRSFKGQLCTVVLFRILQRNIDSEIIIPELWNDIVKILLTLYEN
                     LLISPDIFSDLQSNLKIGKLPKPSSQAAIMKSNENKGLLSTFASYLKGDEEPTDEEIH
                     YSRRAMTCIESSHVAAALFGNEKNITPGLIQSLLNSIKLERNNENDKFFEAETLFLLE
                     LSVAMLVFCKNGGSLGNETLEKIITFSQLPGSKKGTHRRLLTYKILLISLLDQQPDNL
                     LKVINDELVTKRDLYTDKYFISDTGTEVIRRLLELTNVDNYKSVMLEDEGFWKLLRMN
                     ASIKEHTEMIFDYLAKSLAKDGCFMTSTNFMLILGLLDEISSVGSVGARWEQEYKMSI
                     QSGHQVDNKNPYQALVRISLRSIDLTSQLIENSKKFELGKTEIFTICQALAHQCSNPC
                     QEISSHAIVTLTSFLTEKVSLPRVELTNMEELIEGGLLPVLKTHEESKSDNANILLGN
                     ILDVISKTYIYYLKDGITTNETFLEVLNIFNRYVEIPEIEKQLQQLIIEKKDIEKQAR
                     ESSTTPSVVDEAAAADDNIPVDAGAPGDA"
     gene            <101051..>101851
                     /gene="NDAI0G00470"
                     /locus_tag="NDAI_0G00470"
                     /db_xref="GeneID:11497219"
     mRNA            <101051..>101851
                     /gene="NDAI0G00470"
                     /locus_tag="NDAI_0G00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671018.2"
                     /db_xref="GeneID:11497219"
     CDS             101051..101851
                     /gene="NDAI0G00470"
                     /locus_tag="NDAI_0G00470"
                     /inference="similar to DNA sequence:INSDC:YEL021W"
                     /note="similar to Saccharomyces cerevisiae URA3 (YEL021W);
                     ancestral locus Anc_1.453"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671066.2"
                     /db_xref="GeneID:11497219"
                     /db_xref="GOA:G0WDG2"
                     /db_xref="InterPro:IPR001754"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR014732"
                     /db_xref="InterPro:IPR018089"
                     /db_xref="UniProtKB/TrEMBL:G0WDG2"
                     /translation="MSTLTYEERAKNHASPVASKLLTIMFEKQTNLCASLDVRTTEEL
                     LRLVDILGPYICLLKTHVDILSDFSMEGTVIPLKQMALKYNFLIFEDRKFADIGNTVK
                     LQYASGVYKIAEWADITNAHGITGPGIVAGLKEAAMEVSNEPRGLLMLAELSSKGSLA
                     HGEYTRGTVEIAQTDKEFVFGFIAQRDMGGRTEGFDWLIMTPGVGLDDKGDALGQQYR
                     TVEDVVSTGSDIIIVGRGLFAKGRDPKVEGERYRKAGWDAYLKRCQST"
     gene            <102226..>102489
                     /gene="NDAI0G00480"
                     /locus_tag="NDAI_0G00480"
                     /db_xref="GeneID:11497220"
     mRNA            <102226..>102489
                     /gene="NDAI0G00480"
                     /locus_tag="NDAI_0G00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671019.2"
                     /db_xref="GeneID:11497220"
     CDS             102226..102489
                     /gene="NDAI0G00480"
                     /locus_tag="NDAI_0G00480"
                     /inference="similar to DNA sequence:INSDC:YEL020W-A"
                     /note="similar to Saccharomyces cerevisiae TIM9
                     (YEL020W-A); ancestral locus Anc_1.452"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671067.2"
                     /db_xref="GeneID:11497220"
                     /db_xref="GOA:G0WDG3"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="UniProtKB/TrEMBL:G0WDG3"
                     /translation="MDALNAREQQDFQKLVEQKQMKDFMRLYSNLVERCFSDCVNDFT
                     SSKLTTKEQNCIMKCSEKFLKHSERVGQRFQEQNAALGQGLGR"
     gene            complement(<102674..>104494)
                     /gene="NDAI0G00490"
                     /locus_tag="NDAI_0G00490"
                     /db_xref="GeneID:11497221"
     mRNA            complement(<102674..>104494)
                     /gene="NDAI0G00490"
                     /locus_tag="NDAI_0G00490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671020.2"
                     /db_xref="GeneID:11497221"
     CDS             complement(102674..104494)
                     /gene="NDAI0G00490"
                     /locus_tag="NDAI_0G00490"
                     /inference="similar to DNA sequence:INSDC:YCR023C"
                     /note="similar to Saccharomyces cerevisiae YCR023C;
                     ancestral locus Anc_1.451"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671068.2"
                     /db_xref="GeneID:11497221"
                     /db_xref="GOA:G0WDG4"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G0WDG4"
                     /translation="MARSKLTFKQQMDGFPWAQLLAVSLVRFSEPIAFSSLFPYVYFM
                     VKDFHITPDDADVAKYSGYLSSTFAFCQVLSAFHWGKFSESHGRKITLQLGLIGTSIS
                     LLILGFSRNFTEAFIARSLMGLLNGNVGVIRTMIGEIATQRKHQALAFSTMPLLFQFG
                     TVMGPLLGGFLVFRNANDNDVVPSWFPLSIKKLIDIYPYCLPNLFLVGLLMLGLVNST
                     LFLEETHPTYKFRKDYGIETGDFIKKRIFGITPKVRPWNVVPENESDIEHMPDIESQS
                     ATEMTPLIDDDDDDSDVESVQSLGHVLTRRESVGLIRTYSLHEPTDIPLESLHLASDG
                     CSENSMRHHLLHTDVFYPISVAFIMSLHLIVYNEFLPVFLAYDLAKDPQDPTKLASKF
                     PWKITGGIGYQPEQTGTLLSTTGIFGCFVVIFIFPIVDRSFDCLTIFRTLVKLYPLIY
                     FMIPYVVFLQNDNVPQWCTIVYLYVITGLKTLCGALSSPQIMLLIHNSSPLHCRAIVN
                     GATISIQSSARFLGPLIMGYIMSWAQKHNVAWVSWWSLSLFCIIALYQSYKIKPIDEN
                     DEIETEAITTNTDATGSFTGPSRQILTHRSSLGSLSNKRG"
     gene            <106930..>109815
                     /gene="NDAI0G00500"
                     /locus_tag="NDAI_0G00500"
                     /db_xref="GeneID:11497222"
     mRNA            <106930..>109815
                     /gene="NDAI0G00500"
                     /locus_tag="NDAI_0G00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671021.2"
                     /db_xref="GeneID:11497222"
     CDS             106930..109815
                     /gene="NDAI0G00500"
                     /locus_tag="NDAI_0G00500"
                     /inference="similar to DNA sequence:INSDC:YNL041C"
                     /note="similar to Saccharomyces cerevisiae COG6 (YNL041C);
                     ancestral locus Anc_2.273"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671069.2"
                     /db_xref="GeneID:11497222"
                     /db_xref="GOA:G0WDG5"
                     /db_xref="InterPro:IPR010490"
                     /db_xref="UniProtKB/TrEMBL:G0WDG5"
                     /translation="MDFLDYQTFSVGDQNNLQDDTSLPEPTSRLDLSSIPTMAAQERE
                     FKLPFIGAALKNAVGNTTSAASATSTAIASTSSTKKNDTTAAPSISRNIVDSTLYTKM
                     SVYATKSIDTLTSSLSTSSENGVAFDNINSQIIDDHYNNIPLPNSNIPDNENDNEQKT
                     KKDVTNLVLSKKLSRILNDYSINNDYNNTVKLRNSLKFLEEKKKSYNSNSNNEKLITP
                     EYIGILARKTLRSDLENELLKEHIIVLEEFKPIVRRIKRFSSSVENISKISEQLIDRA
                     NETSNHGTTDSVFNQVEALQNQVNLLRLKHQLLTNIQKNFTLTQIEDDIIINGPIDLE
                     FFKVINKVLKIKKNATFLLALDNMEPGTNLINQINSIIQIINKKIFNFLIDFVYDTSH
                     INNGTNNNNNDNNNNNNNNSYSNVNDNVIIFQKSLIFLSNDLPYFDEFFKRVTSIRSK
                     IILDEFLSQFELAHHHSSSSSHKNNSKTNSSDLNKPLILSAHDPIRYIGDVLASIHSI
                     IANEADFIKSLFKFKQILQQEEAQEDAHNDSISYLQDKNLEFLTGLDLKLLNEIIQSL
                     SNSIKLRIEQIIKFESNPITNFEILQLLKLYQMMFIKKGIKSNSSLINNLIILQNLSN
                     DKIINSFTQFIDNVKESNQFALTTAATTGTNTTTTTHTAKKNISIKHNGNFGDDLLPP
                     EWLSTYLSKITELFEEIDKRGTPFNDDAHDDDDDDTIATEDSHDVINQYNMERLIESP
                     IFDVLMKEIKNTFPLAKKNESVKISLLTVQINCFDLINSRLQPFNHSRMIFSKSKNPN
                     IHKILDKINDNLQQFIDTMKELQEKLLFEKTGLSIYNNLFNMIFPIDAVQDKLDYDMY
                     QSLLDNPLMNIDTINNTVHTKLNEYLPNALNDIQENLLFKLNSPSIVDAICDHCFGKI
                     SLFYKIFRDVLFHLYANEDVKNANEKKQKISDILNFSSEEFNTLLGL"
     gene            complement(<110059..>111585)
                     /gene="NDAI0G00510"
                     /locus_tag="NDAI_0G00510"
                     /db_xref="GeneID:11497223"
     mRNA            complement(<110059..>111585)
                     /gene="NDAI0G00510"
                     /locus_tag="NDAI_0G00510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671022.2"
                     /db_xref="GeneID:11497223"
     CDS             complement(110059..111585)
                     /gene="NDAI0G00510"
                     /locus_tag="NDAI_0G00510"
                     /inference="similar to DNA sequence:INSDC:YNL042W"
                     /note="similar to Saccharomyces cerevisiae BOP3 (YNL042W);
                     ancestral locus Anc_2.270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671070.2"
                     /db_xref="GeneID:11497223"
                     /db_xref="InterPro:IPR021216"
                     /db_xref="UniProtKB/TrEMBL:G0WDG6"
                     /translation="MNTPKSNCPNLQNRSPNLNSTNNTETNTEGINNNGDIKTKPPIH
                     SNSLLETIFGSTVSIENLPQQAILKSLDLKIEQEKTKQQYYKLENIAKSIELFRLATS
                     SGLHSSHIFKLFDNSAISSPTNHSSSLGNPIANDNSNPSNNSLAYVEQEHPNQPSALA
                     QQRQQQQQQQQQQQMGEPQSYKFPPIIVNNEDENENARYTINSLLSSTKTFPPSTFAN
                     GRTNSPARIGAHAVAVLNEAVKMNEYQETNDSNNSKYGPKIESPLSVRKNHNYNHTPV
                     TSTTHTRNSSLPALTTFSHNTSNNSNAVVNDNNNGSLSNNIDLDSNNTKSIPPGMVSI
                     LSFHNTNNSTNMPKMRKSGMINKKHRRVKSTSSQPNLHQRQYTSNPSLHKMNTLTPSS
                     TISSSNSIQRSLSPHNRPIDLNVINNSGTNGKIKNEMGQQQQDIIDNNETCSENSSRA
                     ESPLRLTPPLDDVSIKKRANEAENDNNSNNNNNKNKILTNPNRQTQSQNSVKKILNTT
                     "
     gene            complement(<112068..>113795)
                     /gene="NDAI0G00520"
                     /locus_tag="NDAI_0G00520"
                     /db_xref="GeneID:11497224"
     mRNA            complement(<112068..>113795)
                     /gene="NDAI0G00520"
                     /locus_tag="NDAI_0G00520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671023.2"
                     /db_xref="GeneID:11497224"
     CDS             complement(112068..113795)
                     /gene="NDAI0G00520"
                     /locus_tag="NDAI_0G00520"
                     /inference="similar to DNA sequence:INSDC:YEL020C"
                     /note="similar to Saccharomyces cerevisiae YEL020C;
                     ancestral locus Anc_1.450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671071.2"
                     /db_xref="GeneID:11497224"
                     /db_xref="GOA:G0WDG7"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G0WDG7"
                     /translation="MVDLPKGDTIEITEYFIGLLKYYEIDTVFGIVGIPIVELANSMI
                     THGIKFISCRNEQAASYAASAYGFLTGKPAVLLVVGGPGLIHALAGVYNSTSNKWPLI
                     VIAGSNHDEIQENLGGFQDLDQVSLLKDKVKYCGRLNGSNINSVWYNAYNSAIQPPTG
                     VSYIDFPEHLISNNVRVPNMKQNISIPRAIKSSADPLVTKEVAQLLRRNSDQNVLVII
                     GKGAVNYSKGLSAFIHKYQFPFLPTPMGKGIISDMDPLNVSSARSSALSKSDIVLVFG
                     ARLNWLLHFGKPPKWKSTVKFILCDNDPHAIGNNNMQSINYSLLGDIGLIINELTEEL
                     DRVENEWGRKYGVTKELRSEILKNQFKLQEKESRSNTNGALLNYHVVYRTLREMLDLK
                     NTFLVTEGANTMDIARISFPSLKPKQRLDAGTNATMGVGLGYGIAARLSQDYMKSKPD
                     ILVIQGDSAFGFSAIEIETAVRFKLGLIIIVINNSGIYHGTEQSKKISPYSFPATKLS
                     QKCRYDLLGIGLGAHGYLVENIKQLQTAFERSLNSARTSSETSVINVIIEPGKQRQIS
                     FGWQNKSKL"
     gene            complement(<114258..>115082)
                     /gene="NDAI0G00530"
                     /locus_tag="NDAI_0G00530"
                     /db_xref="GeneID:11497225"
     mRNA            complement(<114258..>115082)
                     /gene="NDAI0G00530"
                     /locus_tag="NDAI_0G00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671024.2"
                     /db_xref="GeneID:11497225"
     CDS             complement(114258..115082)
                     /gene="NDAI0G00530"
                     /locus_tag="NDAI_0G00530"
                     /inference="similar to DNA sequence:INSDC:YEL019C"
                     /note="similar to Saccharomyces cerevisiae MMS21
                     (YEL019C); ancestral locus Anc_1.448"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671072.2"
                     /db_xref="GeneID:11497225"
                     /db_xref="GOA:G0WDG8"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR026846"
                     /db_xref="UniProtKB/TrEMBL:G0WDG8"
                     /translation="MSSSSTIPECLPLHPGASTYFHGLHTSDTTKYVDLCDKQFNETL
                     DQIINSAAPNTEELIKSLTKTYAALNTERLTAKRLAGKLNTVKQEYKMKSDQCEQISL
                     SNWDLYRTGEMTAPNLLKLYDDAKDSRINNTQTAEDGGVTTAYLLKIFPYIWENPTCV
                     LPDLTKSGNAKKTRAADDDEIHIEGGNIELICPITCKPYERPLISKKCGHVFDHEGIV
                     NYLRGHGSRDCPQGGCGKVVSMRDFVPDKIMSLRCKIDKIQKIKANKEDNENLDTL"
     gene            <116135..>116962
                     /gene="NDAI0G00540"
                     /locus_tag="NDAI_0G00540"
                     /db_xref="GeneID:11497226"
     mRNA            <116135..>116962
                     /gene="NDAI0G00540"
                     /locus_tag="NDAI_0G00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671025.2"
                     /db_xref="GeneID:11497226"
     CDS             116135..116962
                     /gene="NDAI0G00540"
                     /locus_tag="NDAI_0G00540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671073.2"
                     /db_xref="GeneID:11497226"
                     /db_xref="UniProtKB/TrEMBL:G0WDG9"
                     /translation="MRNAFINSSTNSSARAKAGLAGLDARTILPFGQEVMIHDYTQTS
                     KLKSRGITGFALTPSKESHGYLIFVPSLRKVIGTSNYAIVVHDSTSLSESSTHSVFDN
                     LLESYHVTDADTDLQKAAVEDIPLPDVCTTVTSVIPADSANSTDFTQTIEPTIDFDSE
                     NVSSNIINDTQPDATVAIDSTIDDPNLSLHKSNSSILVKSDSNCSTTKDIHPTPANDS
                     SSAVHDNPHPTEQYIPIDSHLLDSISEPLSPDSPNADISKRYRTTKMTLDLMLLPLI"
     gene            complement(<116985..>118223)
                     /gene="NDAI0G00550"
                     /locus_tag="NDAI_0G00550"
                     /db_xref="GeneID:11497227"
     mRNA            complement(<116985..>118223)
                     /gene="NDAI0G00550"
                     /locus_tag="NDAI_0G00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671026.2"
                     /db_xref="GeneID:11497227"
     CDS             complement(116985..118223)
                     /gene="NDAI0G00550"
                     /locus_tag="NDAI_0G00550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671074.2"
                     /db_xref="GeneID:11497227"
                     /db_xref="GOA:G0WDH0"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:G0WDH0"
                     /translation="MESYNYNITGINWKRCFRAVGHTAKRCPKIQDLKTAVEANFTVS
                     TRSKSTKKSGNKRNHVHHLNSTVPADELRCLRRAPSSNELNIDNFFVLNSAAEISPID
                     SKFLHSRNDNPPDPLFGAGNEEIPVAASGNLTFHWLNNTSHSLYAISSPHVDLNLIST
                     DALEDVGIIVDNRRKALVRLDSDEVLAPITKIGKYRCVPLSFGKLPKHKSPSPCAFQK
                     FPLTFVHRLFDHINVKDTRKSIESKLITNIRINDVDWTGIDKFQCKDCLAGKLTKHKH
                     IVGSRLKYQKYYEPFEYIHTDLFGPVSGVDITSPKYFISFTDENTRFRWVFPLKKKDA
                     DHILPIFQQLVNYIKTQFKVRVLTFHMDRGSEYTSTMVRDYFKVKGIIPIYTTVGDSS
                     SNGIAERANLTFLNDCRTLY"
     gene            119280..119352
                     /gene="NDAI0Ltrna4T"
                     /locus_tag="NDAI_0Ltrna4T"
                     /db_xref="GeneID:11498077"
     tRNA            119280..119352
                     /gene="NDAI0Ltrna4T"
                     /locus_tag="NDAI_0Ltrna4T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:11498077"
     gene            complement(<119533..>122742)
                     /gene="NDAI0G00560"
                     /locus_tag="NDAI_0G00560"
                     /db_xref="GeneID:11495697"
     mRNA            complement(<119533..>122742)
                     /gene="NDAI0G00560"
                     /locus_tag="NDAI_0G00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671027.2"
                     /db_xref="GeneID:11495697"
     CDS             complement(119533..122742)
                     /gene="NDAI0G00560"
                     /locus_tag="NDAI_0G00560"
                     /inference="similar to DNA sequence:INSDC:YIL101C"
                     /note="similar to Saccharomyces cerevisiae XBP1 (YIL101C);
                     ancestral locus Anc_2.274"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671075.2"
                     /db_xref="GeneID:11495697"
                     /db_xref="GOA:G0WDH1"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="UniProtKB/TrEMBL:G0WDH1"
                     /translation="MSINPSSEKYPRHTFSISQVKLRDHPLDDYQRLFFATLMSKNDK
                     PCDPNQIVDLHVKKVTYKSNMAQNFSNPIYLQDSEGMSAADTTNTTSTEVFTKKGSKK
                     TKNVLECFEYQLPDIQMSSINGNTDFYSLITDSKIRENLFPNDDCKNRFIEGKIISHL
                     NGNDNKTSRRNFDKNDNHSQGSMIGNKGSKQRGVEDDEGEDNDNENLRPEKPLSNVID
                     SLTKNQQFKLQKIGYNLNLNENLINANNCILWSHNTGYVFLTGIWRLYQDVMNGLTTS
                     ARTNRKDEQENESLLKQCQLAFDFIMSNAFYEPTNHPHPHHIDFQIRKRNRSNSYPDN
                     SLNTMLQLEKNENNDIEGYGKTDNNKEKPSKVESNKKRRHSTIPTSSSGKAALGPNNN
                     ETYSDLHWNNISSNIKNFLCDSFKQYLTKRENIPAETLKNLTLSMLIQRIRGGYIKIQ
                     GTWLPMEICRSLCLRFCFPIRFFLIPIFGPDFPKECEFWYDVLHNEMIEQKFEQKLEK
                     SQFLQQNAQQGKEYLRSLKRKNADNKSIFKNNILQKKDGEDNDKDQKSKVKRRRKLKP
                     KVSSKKERRNSESLSPMSSNINTNNIQKGNNEIIHPWPKLHPEMKPFPTNNAQPQIPQ
                     HNNNNNNTGRFHSLSWSAADSYNRNQLTGEIKQASSNFTLPPLKSVIQTLPQNEDQNM
                     PGNQTRGLTLEQFQYLLQLDLVQQKEFPNSPPFVERLPEHLRGEYLMLKDQQQRYYFE
                     REQERLRHYQEVQRLRYYQQYNNPRQTIDGVILQNQSPLVTEPSIRTLSNLATFYTTH
                     GHQYMYPNPISIQQAPQWVPQRQSQEHHRHQSQSEQQQDQPLPLPHPQLRQEPQPKLQ
                     QQVSNYYNLQQQQQQQQQQQQQQQQQQQQQQRAQEQYSGQQVQGQRMFGNRRASWEQP
                     GSVNYAQFLEQRQSSGPTANSHYLLQEQFSRKQEQQGQQGLQGQDEPRVPVFGSTIAP
                     SSHNYPGVSYTNYQMTSGSAGNTNATVSSKNGDDAKNNTNNATIPVDQYSRYMQQRYE
                     QTGNMQSPVPRLLQPEQPKQNASNAASSRNQKNSNKEVL"
     gene            complement(<124967..>125707)
                     /gene="NDAI0G00570"
                     /locus_tag="NDAI_0G00570"
                     /db_xref="GeneID:11497229"
     mRNA            complement(<124967..>125707)
                     /gene="NDAI0G00570"
                     /locus_tag="NDAI_0G00570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671028.2"
                     /db_xref="GeneID:11497229"
     CDS             complement(124967..125707)
                     /gene="NDAI0G00570"
                     /locus_tag="NDAI_0G00570"
                     /inference="similar to DNA sequence:INSDC:YNL036W"
                     /note="similar to Saccharomyces cerevisiae NCE103
                     (YNL036W); ancestral locus Anc_2.275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671076.2"
                     /db_xref="GeneID:11497229"
                     /db_xref="GOA:G0WDH2"
                     /db_xref="InterPro:IPR001765"
                     /db_xref="InterPro:IPR015892"
                     /db_xref="UniProtKB/TrEMBL:G0WDH2"
                     /translation="MAPIINTSELKTNRTRLQDPVEETHRENGNDSSIFTLSKDSKLP
                     DIINSNSIWVNNMNKSYPLLFPEYNGKGQKPHTLFIGCSDSRYNESILGVLPGEVFTW
                     RSIANLCLPDCNIFKSTLEYALLCLKVNKIIICGHTDCGGIMTCLRNERDSLLKQGCS
                     TLYDYLEDVENMYNDHLEQVKIIKGGEYEKGKYLSTINLVKQFDRIVSYDIVQNGIKN
                     NQLEVYGLIYNVHSGLVDVVETKTLKNI"
     gene            <127092..>129050
                     /gene="NDAI0G00580"
                     /locus_tag="NDAI_0G00580"
                     /db_xref="GeneID:11497230"
     mRNA            <127092..>129050
                     /gene="NDAI0G00580"
                     /locus_tag="NDAI_0G00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671029.2"
                     /db_xref="GeneID:11497230"
     CDS             127092..129050
                     /gene="NDAI0G00580"
                     /locus_tag="NDAI_0G00580"
                     /inference="similar to DNA sequence:INSDC:YIL099W"
                     /note="similar to Saccharomyces cerevisiae SGA1 (YIL099W);
                     ancestral locus Anc_2.276"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671077.2"
                     /db_xref="GeneID:11497230"
                     /db_xref="GOA:G0WDH3"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR011613"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="UniProtKB/TrEMBL:G0WDH3"
                     /translation="MFPPRIMDNFSYRRYETNVTHRYPTNTLLPSTRSLRRKAFMTFF
                     SLSLLFFLLYLKLSNVDQEHNHQIDESFQQKKTNNITIYDFYKKPDLTTTISTNQKEF
                     YKRINLRPTSPYSIPKENFSLWINEQSQLSFERILLNIADENHNDLMSKFNVTEGVII
                     ASPSKSKPDYFYQWIRDGSICMNSLSSNLLIMSSHDVHQKEKVGINKTLSTTILKYLN
                     NSYNLQRLDNPSGKSITINKDSLTGLGEPKWYANNTAFNLHWGRPQNDGPALRTITVL
                     NLLNHLASNNLKFEDLIKVSFSSSSDNSNNNNNNNNNNNNNNKLPFVNDLEVFQKIVF
                     WDLKFICLHWNDETYDLWEEIYGKHFFTTIVQLSAVKKGLEFIRKQNNMDEYSQFEDL
                     LQETYDKMLNFILSQDYFINSNKNHIVESPNFLDSRSGLDIAVILGSLYSHHNSLNDP
                     EDNPISMSSLPFDIDDSGILNTLFGLVRSMSMIYPINHQRVNLKIGVALGRYPEDVYD
                     GVGFSEGNPWFLATSGAAELLYKLIWKNYKFEKDLMIPLNSWDSQFWTLIFDGFNDIE
                     HDGKTYQLVIPYKSPAFEQTMTLLFDLAESFLDKLREHVSDHGDMSEQFNKFSGYLQG
                     ADHLTWSYSSFWNCYQIRLKAMKFLNYI"
     gene            complement(<129757..>130347)
                     /gene="NDAI0G00590"
                     /locus_tag="NDAI_0G00590"
                     /db_xref="GeneID:11497231"
     mRNA            complement(<129757..>130347)
                     /gene="NDAI0G00590"
                     /locus_tag="NDAI_0G00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671030.2"
                     /db_xref="GeneID:11497231"
     CDS             complement(129757..130347)
                     /gene="NDAI0G00590"
                     /locus_tag="NDAI_0G00590"
                     /inference="similar to DNA sequence:INSDC:YNL038W"
                     /note="similar to Saccharomyces cerevisiae GPI15
                     (YNL038W); ancestral locus Anc_2.281"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671078.2"
                     /db_xref="GeneID:11497231"
                     /db_xref="GOA:G0WDH4"
                     /db_xref="InterPro:IPR019328"
                     /db_xref="UniProtKB/TrEMBL:G0WDH4"
                     /translation="MDTNGLYITKRVRKNYIELIEQNENNDYIKFTVIPRSFSIQRIA
                     RIISCIIITFLLYLKLIKRFDLTIMQESLIIIVILVMILSYFKNPRIESFTVLKDNGI
                     QISKIDGYLFLPMKYNEQLCCQNEFFPNDKIIDIIINEGFYPGSQVIFYMAVLIKDYK
                     ELKLLFDSTKIKLDDQIEIYNKSRDCLYMNKKPFEK"
     gene            complement(<130877..>132343)
                     /gene="NDAI0G00600"
                     /locus_tag="NDAI_0G00600"
                     /db_xref="GeneID:11497232"
     mRNA            complement(<130877..>132343)
                     /gene="NDAI0G00600"
                     /locus_tag="NDAI_0G00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671031.2"
                     /db_xref="GeneID:11497232"
     CDS             complement(130877..132343)
                     /gene="NDAI0G00600"
                     /locus_tag="NDAI_0G00600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671079.2"
                     /db_xref="GeneID:11497232"
                     /db_xref="GOA:G0WDH5"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:G0WDH5"
                     /translation="MDERLQEFLLMKQKFSGSFNEEITVAASGNLTFHWLNNTSHSLY
                     AISSPHVNLNLISTDALEDVGIIVDNRRKALVRLDSDEVLAPVTKIGKYRCVTLSFGK
                     LPKHKSPVHVLSQKFSLTLIHRLFGHINVRDIKKSIESKSITTIRINDVDWSGIDKFQ
                     CKDCLTGKLTKHKHIVGSRLNIKSPMSYIHTDLFGPVSGVDITSPKYFISFTDENTRF
                     RWVFPLKKKDADHILPIFQQLVNYIKTQFKVRVLTFHMDRGSEYTSTMVRDYFKDKGI
                     IPIYTTVGDSSSNGIAERANLTFLNDCRTLLSSSNLPASLWFYAVDFATLRRNAFINS
                     STNSSARAKAGLAGLDARTILPFGQEVMIHDYTQTSKLKSRGITGFALTPSKESHGYL
                     IFVPALRKVIDTSNYVIVVHDSTSLSESSTHSVFDNLLESYHVTDADTDLQKAAVEDV
                     PVSDISPTVTSVIPAGSDNPADFSQPSEHIIDVDIWHA"
     gene            complement(<132631..>133830)
                     /gene="NDAI0G00610"
                     /locus_tag="NDAI_0G00610"
                     /db_xref="GeneID:11497233"
     mRNA            complement(<132631..>133830)
                     /gene="NDAI0G00610"
                     /locus_tag="NDAI_0G00610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671032.2"
                     /db_xref="GeneID:11497233"
     CDS             complement(132631..133830)
                     /gene="NDAI0G00610"
                     /locus_tag="NDAI_0G00610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671080.2"
                     /db_xref="GeneID:11497233"
                     /db_xref="GOA:G0WDH6"
                     /db_xref="InterPro:IPR005378"
                     /db_xref="UniProtKB/TrEMBL:G0WDH6"
                     /translation="MESYNYNITGLTGNARKYTMECMQRSIRIADSIMDGLISCQLLI
                     EILNQCIYFNTKALSDGVFSEVVAPLTTLKVISQSKSLPTNLPNSSLRFNVPSNGQKP
                     AFEKPFVTPPPGLDSTAYDGFNKGFIPNNAYSGFNDYGVPPQASPFYFHSHMYPIMGN
                     QRIPFQPPFMAFSPASNVPSFIPPFHQPSDDNISQGMDSTTYNGSHATMPKMSQFSAG
                     NRLMPISNESEFNGWIKTFIKYLRHQNLGHVIPDRLGNTGNIKEPEKDFIIEAFNYCV
                     PSTAYPKWFQFALTNEYIELIDVIGRAMSLAEDKAGVDEIYEQLLAVKYDGKSDAILF
                     KKLLNSLIAKGEKVGIHIPNEVLCQRIASNLTDSYRPIADFYRMNYGNVSLEDLLVNY
                     RYLSSRV"
     gene            134364..134453
                     /gene="NDAI0Ltrna4P"
                     /locus_tag="NDAI_0Ltrna4P"
                     /db_xref="GeneID:11498509"
     tRNA            join(134364..134400,134417..134453)
                     /gene="NDAI0Ltrna4P"
                     /locus_tag="NDAI_0Ltrna4P"
                     /product="tRNA-Pro"
                     /note="codon recognized: CCA"
                     /db_xref="GeneID:11498509"
     gene            complement(<134586..>136523)
                     /gene="NDAI0G00620"
                     /locus_tag="NDAI_0G00620"
                     /db_xref="GeneID:11497234"
     mRNA            complement(<134586..>136523)
                     /gene="NDAI0G00620"
                     /locus_tag="NDAI_0G00620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671033.2"
                     /db_xref="GeneID:11497234"
     CDS             complement(134586..136523)
                     /gene="NDAI0G00620"
                     /locus_tag="NDAI_0G00620"
                     /inference="similar to DNA sequence:INSDC:YNL039W"
                     /note="similar to Saccharomyces cerevisiae BDP1 (YNL039W);
                     ancestral locus Anc_2.282"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671081.2"
                     /db_xref="GeneID:11497234"
                     /db_xref="GOA:G0WDH7"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017174"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:G0WDH7"
                     /translation="MSSVVNKSGTRFAPKARQRRAGTSTPTPVPLPMPVQKPIITNDE
                     ALHNQEVEGEDEIPAKNSDHDNNAEPPSPKAKTVVEETSTYNKLTTKVNTFAMHLQNG
                     DSISPSQTSTQLNQQDDAIPIPKSAVINPPTTVRSGRLASLSKTINAPLFKTDYTANT
                     TVTDGKKERRLSTISTSLPKKIKMANAMVTENDNATLNALKRRRMSSRSSVSKKTGSQ
                     RRISVVSKINVPVGKSTSSSSSASSSKATSRATSINSSLNGVYTATPIPNPARIKVGE
                     EEEFFQKTDALYGKYIIKNFKEIPKNIRDDDSKRYMIDEEKFTIAELCKPNLPIGEIS
                     ENFEKSKMANKLKLTKRKYKREMRKRAREEFRSLRSLNKEEEEEERENRKQAAEKLLN
                     TDVPDSYKPHTAIQLKLNPDGTLAVDEESTVVDRHKNASLENAHKQKVDENPFEKLYN
                     SATYGRNSFTDPWTTEEIIKFYKALSMWGTDFNLIAQLFPYRTRRQIKSKFINEEKKH
                     PIMIELALRSRLPPNFDQYCADIRRELGTVSDFNKKLEDLQLEHQENLKQIQLAKDNA
                     KMEDSTLVKEDASNTNKKGPGGFMSNDLKVYRKTEVVLGTIDDIKRKREEEEDEGDND
                     SDADKHEVGHHHRINKIEMAK"
     gene            complement(<137826..>139019)
                     /gene="NDAI0G00630"
                     /locus_tag="NDAI_0G00630"
                     /db_xref="GeneID:11497235"
     mRNA            complement(<137826..>139019)
                     /gene="NDAI0G00630"
                     /locus_tag="NDAI_0G00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671034.2"
                     /db_xref="GeneID:11497235"
     CDS             complement(137826..139019)
                     /gene="NDAI0G00630"
                     /locus_tag="NDAI_0G00630"
                     /inference="similar to DNA sequence:INSDC:YNL035C"
                     /note="similar to Saccharomyces cerevisiae YNL035C;
                     ancestral locus Anc_2.283"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671082.2"
                     /db_xref="GeneID:11497235"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0WDH8"
                     /translation="MSISPYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCL
                     DFGTCQSKQSIRVSNLSINDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLH
                     NDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKF
                     HPSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHME
                     TFAIHELNDKSEELKEPQPLDFGDVREKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIP
                     TNGENISVKDSVVIPSAHGDEVIRDVFIPPSHSELVYSCGEDGFVNLWKNNNGALNVP
                     EQFWDYSKRTMHVLDGDFSLESGNEVEKSKLGVEKREKSKKSKSKKSKKKEKKHSKSQ
                     RFKPY"
     gene            complement(139227..139300)
                     /gene="NDAI0Ltrna3I"
                     /locus_tag="NDAI_0Ltrna3I"
                     /db_xref="GeneID:11498164"
     tRNA            complement(139227..139300)
                     /gene="NDAI0Ltrna3I"
                     /locus_tag="NDAI_0Ltrna3I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:11498164"
     gene            <139655..>141520
                     /gene="NDAI0G00640"
                     /locus_tag="NDAI_0G00640"
                     /db_xref="GeneID:11497236"
     mRNA            <139655..>141520
                     /gene="NDAI0G00640"
                     /locus_tag="NDAI_0G00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671035.2"
                     /db_xref="GeneID:11497236"
     CDS             139655..141520
                     /gene="NDAI0G00640"
                     /locus_tag="NDAI_0G00640"
                     /inference="similar to DNA sequence:INSDC:YIL095W,YNL020C"
                     /note="similar to Saccharomyces cerevisiae PRK1 (YIL095W)
                     and ARK1 (YNL020C); ancestral locus Anc_2.284"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671083.2"
                     /db_xref="GeneID:11497236"
                     /db_xref="GOA:G0WDH9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G0WDH9"
                     /translation="MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPI
                     DPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGS
                     YEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDI
                     KIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLG
                     KGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIR
                     ITLNVQPSQRPNIYQLLEEVSKIQNVPCPIPDFYLQRKLAQAQAQTQAQDVVMNVPIP
                     SYPVAIPAITNNNGSYNYNMSIASATINPQNANNNNTNNNPYTVASNNVTGILQSINA
                     PLLNVPLQPNRPISSQKKHIQKSQTMPMPSMDANLKKSTCQLGHTTLSIPNKNNDVIQ
                     KRASVSSSRSSPLLQERIISTDMSFSSDDDKDDDSSIHTDEQNVKIDTQPLTHTISKT
                     KSLFDNNDNVEHGRSLNKHATKREKHRSLPPLQRNTLKNNFDQMYDDTTQSNSKSSTP
                     EKSILSNQETKEQIKKKMLEKLQRVKSITASTPTLPTTSNDKEVAQKKKQNQLFL"
     gene            complement(<141981..>144050)
                     /gene="NDAI0G00650"
                     /locus_tag="NDAI_0G00650"
                     /db_xref="GeneID:11497237"
     mRNA            complement(<141981..>144050)
                     /gene="NDAI0G00650"
                     /locus_tag="NDAI_0G00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671036.2"
                     /db_xref="GeneID:11497237"
     CDS             complement(141981..144050)
                     /gene="NDAI0G00650"
                     /locus_tag="NDAI_0G00650"
                     /inference="similar to DNA sequence:INSDC:YNL021W"
                     /note="similar to Saccharomyces cerevisiae HDA1 (YNL021W);
                     ancestral locus Anc_2.285"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671084.2"
                     /db_xref="GeneID:11497237"
                     /db_xref="GOA:G0WDI0"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR017321"
                     /db_xref="InterPro:IPR019154"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:G0WDI0"
                     /translation="MNGGETTSNNDTIKKRKIDPESRQIIVPPRDAQIHYTPLKTGLC
                     YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLML
                     KIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKATESGDSVYFNSDSYASAKLP
                     VGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPES
                     VRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGE
                     GFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVT
                     PSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGEPPDELPDVTRDP
                     KPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNFPLQSAIRQQQVR
                     NLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAIQGTIDP
                     SSSIIVDSSLDMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDNYLKY
                     FPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLGEW
                     YFKNSLVFSNKNHIYWGDKENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILDSF
                     EEWSDSE"
     gene            <144471..>145961
                     /gene="NDAI0G00660"
                     /locus_tag="NDAI_0G00660"
                     /db_xref="GeneID:11497238"
     mRNA            <144471..>145961
                     /gene="NDAI0G00660"
                     /locus_tag="NDAI_0G00660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671037.2"
                     /db_xref="GeneID:11497238"
     CDS             144471..145961
                     /gene="NDAI0G00660"
                     /locus_tag="NDAI_0G00660"
                     /inference="similar to DNA sequence:INSDC:YNL022C"
                     /note="similar to Saccharomyces cerevisiae YNL022C;
                     ancestral locus Anc_2.286"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671085.2"
                     /db_xref="GeneID:11497238"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0WDI1"
                     /translation="MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNP
                     KHVYAVIDSCWKYKPYLEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKR
                     IQMGKHPIKEYVLKHKSRLHSELVRLKLKLKVKNLSEIVDNNDSTEDVTPVRWIRINP
                     LRCYQGRDVNAVLEELGKKFPKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHEL
                     YKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQ
                     IYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGS
                     GIFGRKYVDSLNRQRNNDTTDKDKKSTEEDDEVPDEQEDYNKKEDLKTRLAKLSSFQF
                     QVIKHAMSFPTAKKIVYSTCSIHAEENERVVLDLLLDSKVKQWGWKVAAKESVIPTWP
                     RRGKIEEFEEVFRDDPAKCQALADGCIRALPRDDGGIGFFAVCFER"
     gene            <146574..>149480
                     /gene="NDAI0G00670"
                     /locus_tag="NDAI_0G00670"
                     /db_xref="GeneID:11497239"
     mRNA            <146574..>149480
                     /gene="NDAI0G00670"
                     /locus_tag="NDAI_0G00670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671038.2"
                     /db_xref="GeneID:11497239"
     CDS             146574..149480
                     /gene="NDAI0G00670"
                     /locus_tag="NDAI_0G00670"
                     /inference="similar to DNA sequence:INSDC:YNL023C"
                     /note="similar to Saccharomyces cerevisiae FAP1 (YNL023C);
                     ancestral locus Anc_2.288"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671086.2"
                     /db_xref="GeneID:11497239"
                     /db_xref="GOA:G0WDI2"
                     /db_xref="InterPro:IPR000967"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="UniProtKB/TrEMBL:G0WDI2"
                     /translation="MSDTELNEVSTHPDPKSLILQASADEIKSSENVSSTSDNDEYDQ
                     EDEYAAATAADEDMKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYD
                     CIREWAVKSTEKTVDRIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQ
                     TCNAKICVHGCTNICHLGPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKD
                     ECGLPLSCGIHKCKRKCHSGLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKI
                     PESAKYSSDAEGNKWIGVFACKEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKL
                     LKTCPCGKTPLQKLAKPRTLCTDPIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQ
                     IETRKCSCEQQSFLVPCQFTGSPHCNIKCESLMSCRRHRCLERCCSGRPAAEKRKKTL
                     FRSQDLMDETLVEAEHICLKECNLLLSCGIHRCQRKCHPGKCPPCLESDSNDLVCPCG
                     KTIVEAPVRCGTKLPPCPFQCIKVVRNEYPCGHTPMPHTCHPLDEPCPPCTAPVFKPC
                     KCGKVKEVRTLCFQNDVSCGKICGLPLKDCPHKCMKRCHIPGDCQTKCKQICGKRRIN
                     CDHTCSRPCHGNTECPDVPCTVSAKVTCECGRRETYVTCGAMSNIASAVTTTILECDE
                     ECEMLERHRQLKEAFGIKEIISSSTDLEFERLKDIVPTAIAFEELQLPFTEATLSIFS
                     RQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHFIHELSKAYNLYCESQDPEPKR
                     SVFIKKNTTSSKPSFSLSKVLPLYQTFKELEKERKLQEFEARTSKRLVNVEVPEGPTD
                     NYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNPQYLVLQDGKSGVIYPEDYP
                     TITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLSTERLATPAIDESTP"
     gene            <150212..>150979
                     /gene="NDAI0G00680"
                     /locus_tag="NDAI_0G00680"
                     /db_xref="GeneID:11497240"
     mRNA            <150212..>150979
                     /gene="NDAI0G00680"
                     /locus_tag="NDAI_0G00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671039.2"
                     /db_xref="GeneID:11497240"
     CDS             150212..150979
                     /gene="NDAI0G00680"
                     /locus_tag="NDAI_0G00680"
                     /inference="similar to DNA sequence:INSDC:YNL024C"
                     /note="similar to Saccharomyces cerevisiae YNL024C;
                     ancestral locus Anc_2.289"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671087.2"
                     /db_xref="GeneID:11497240"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0WDI3"
                     /translation="MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGE
                     SGCGGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLL
                     EKNNFHKDIDAYITDIDQIVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSR
                     DKEEDFREEKKVDLILAADCVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADK
                     HFFQKIKKNFDIVEIKDFEKYEYYLKQRTHLFQLIRQ"
     gene            <151360..>151578
                     /gene="NDAI0G00690"
                     /locus_tag="NDAI_0G00690"
                     /db_xref="GeneID:11497241"
     mRNA            <151360..>151578
                     /gene="NDAI0G00690"
                     /locus_tag="NDAI_0G00690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671040.2"
                     /db_xref="GeneID:11497241"
     CDS             151360..151578
                     /gene="NDAI0G00690"
                     /locus_tag="NDAI_0G00690"
                     /inference="similar to DNA sequence:INSDC:YNL024C-A"
                     /note="similar to Saccharomyces cerevisiae YNL024C-A;
                     ancestral locus Anc_2.291"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671088.2"
                     /db_xref="GeneID:11497241"
                     /db_xref="InterPro:IPR009653"
                     /db_xref="UniProtKB/TrEMBL:G0WDI4"
                     /translation="MSALFNFRSLLQVILLLICSCTYVHSQWPSILDRYKDHGALGAF
                     WKMARIGERASPYVSLACIIMAINQFNS"
     gene            <151716..>153050
                     /gene="NDAI0G00700"
                     /locus_tag="NDAI_0G00700"
                     /db_xref="GeneID:11497242"
     mRNA            <151716..>153050
                     /gene="NDAI0G00700"
                     /locus_tag="NDAI_0G00700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671041.2"
                     /db_xref="GeneID:11497242"
     CDS             151716..153050
                     /gene="NDAI0G00700"
                     /locus_tag="NDAI_0G00700"
                     /inference="similar to DNA sequence:INSDC:YNL025C"
                     /note="similar to Saccharomyces cerevisiae SSN8 (YNL025C);
                     ancestral locus Anc_2.294"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671089.2"
                     /db_xref="GeneID:11497242"
                     /db_xref="GOA:G0WDI5"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015429"
                     /db_xref="InterPro:IPR028367"
                     /db_xref="UniProtKB/TrEMBL:G0WDI5"
                     /translation="MLYSFIIKNNHGFEKYHSFISRRLIFPFILSFFQYFLSIIKEFG
                     NYSCKGTNRENNHLQLKQLSYKAILLTFEAIPYRFEVIIYSTSNNKMSGTYWTSTQRH
                     SWQYTKSSLAKERQKLWILECQLFPQGLNITMDTRQNQSNDQQQQNTNGNGNGKTNHN
                     NTSTVITSTTKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQCALATAHVYLS
                     RFLLKVSVREVNLYLLATTTVYLACKVEECPQYIRTLVSEARSLWPEFVPPDPTKVTE
                     FEFYLLEELESYLVVHHPYRSLEQIVNVLKQEPYQLNINAEELQNCWSLINDSYITDA
                     NLIYPPHIIAIASLFITISMKKNEHSRSSSRNNITTNDENQNDKVSSSSHSHRQEILN
                     LFIAESLIDLEEVMDTIQTQITLYDHWDKYHEPWVKFLLHTLYLRPSPVSAS"
     gene            complement(<153261..>154736)
                     /gene="NDAI0G00710"
                     /locus_tag="NDAI_0G00710"
                     /db_xref="GeneID:11497243"
     mRNA            complement(<153261..>154736)
                     /gene="NDAI0G00710"
                     /locus_tag="NDAI_0G00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671042.2"
                     /db_xref="GeneID:11497243"
     CDS             complement(153261..154736)
                     /gene="NDAI0G00710"
                     /locus_tag="NDAI_0G00710"
                     /inference="similar to DNA sequence:INSDC:YNL026W"
                     /note="similar to Saccharomyces cerevisiae SAM50
                     (YNL026W); ancestral locus Anc_2.304"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671090.2"
                     /db_xref="GeneID:11497243"
                     /db_xref="GOA:G0WDI6"
                     /db_xref="InterPro:IPR000184"
                     /db_xref="UniProtKB/TrEMBL:G0WDI6"
                     /translation="MTTNTITSEIHEQHIENLLRENENLPIKVTEINTLGANQINPST
                     FQSHLDATILKAQTLTELSLQTQILNNKLISNGLIKDIYQNYDSLGKLPSSDITKSHP
                     LLNIISNINVLPINKFMARTGTNVGNGEGDGYLEFQIRNMFGNGESLKFNIMKGTKIQ
                     SSYLLNYSSLLLPNKTPFWNMNIDLFKNVSQLGQNLPLELDMLGGKFSIRSSFITPSR
                     HTPDKRGLWNYEFFMQSVIRSCGNTSLNNTSNSLLFQTGEDWKNSLGSNFVWDSRNNS
                     VLDPNAFPSNGQLFKWFNELNFIGNRSSTANGGPFWKNQLEFTQIRSWLPNDFITMNC
                     TFRTGYIKQLLTKNEVQKGSSSFLHISDKFQNGGPNDIRSFQTMGLGPKDIFNSIGGD
                     AFVSYGISIFSKLPIKDWSKSNFRLHWFLNGGKLINHNGMSINNCFTDLSRQHSISTG
                     VGILLRHPMARFELNFSVPLTIHQGDDVRKGFQFGVGLSFL"
     gene            complement(<155060..>157186)
                     /gene="NDAI0G00720"
                     /locus_tag="NDAI_0G00720"
                     /db_xref="GeneID:11497244"
     mRNA            complement(<155060..>157186)
                     /gene="NDAI0G00720"
                     /locus_tag="NDAI_0G00720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671043.2"
                     /db_xref="GeneID:11497244"
     CDS             complement(155060..157186)
                     /gene="NDAI0G00720"
                     /locus_tag="NDAI_0G00720"
                     /inference="similar to DNA sequence:INSDC:YNL027W"
                     /note="similar to Saccharomyces cerevisiae CRZ1 (YNL027W);
                     ancestral locus Anc_2.303"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671091.2"
                     /db_xref="GeneID:11497244"
                     /db_xref="GOA:G0WDI7"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0WDI7"
                     /translation="MSKNNNNNNNDNADDGLNKNFKLGDVDFDLNNWTSNLNINDLNL
                     PLQDNNTNTTTAENDAGGNIGPFSATVDNSSSSQLKNNGNNAVQMSPLEANILEQYLL
                     NNEIANSLTNNNNNYNRSENIQTSHVPQQQEQQHILTQSLDSENNSLSTLPVSNLTPG
                     SSAGLSASTNASNTNRPSLTLQLDSSSNVDNIRDNNNDNNYPISNINTNYLSPVSNNF
                     NAKISKSNNGTINFGTSFNSNSNSNSNPHSPYLNTQDNSSIYSSNTLNPNNLAVSPSI
                     SYLSPGGISSNADFDNLTDLDDVDNDDLMSVYSSASSNFVLPLNDEGLKQIGNLNDLD
                     LILNRKQINADDLDQYQYQSMIYDNEDSKNNNTQVQTPIIKPPIISIQEFQGNYNDND
                     KNNNNNNLIINTESNSIFNFPSSSPIDNNFSSPINSSTITSNFLNPFESNNNNNNNQQ
                     TLHDDNEKESIIDLRKARRKSQTAHSYNSSTVSRSRSRSRRSSIYYSPEDKARSISEN
                     RDKLLEMADLPIPLSSSVQKDEKFTNDTNMNKYISPLSASPSPQHTDSNVNENDNNNN
                     NNTNNKTRQSTGGYICELCNKTFTRPYNLKSHLRTHTNEKPFICKICNKAFARQHDRK
                     RHEDLHTGKKRYICGGKLKNGDTWGCGKKFARSDALGRHFKTESGKKCIAPLYAEAIS
                     EQEQQGSHDDSHNENSNDQKVIGLGL"
     gene            complement(<157848..>159104)
                     /gene="NDAI0G00730"
                     /locus_tag="NDAI_0G00730"
                     /db_xref="GeneID:11497245"
     mRNA            complement(<157848..>159104)
                     /gene="NDAI0G00730"
                     /locus_tag="NDAI_0G00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671044.2"
                     /db_xref="GeneID:11497245"
     CDS             complement(157848..159104)
                     /gene="NDAI0G00730"
                     /locus_tag="NDAI_0G00730"
                     /inference="similar to DNA sequence:INSDC:YML005W"
                     /note="similar to Saccharomyces cerevisiae TRM12
                     (YML005W); ancestral locus Anc_2.302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671092.2"
                     /db_xref="GeneID:11497245"
                     /db_xref="GOA:G0WDI8"
                     /db_xref="InterPro:IPR003402"
                     /db_xref="InterPro:IPR026274"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0WDI8"
                     /translation="MVLEITIPNEQIQLIKPIKTALEAHDNFIKPILTHPSSPSCKVI
                     RTNLEDVPTYLSKYIDSNHLQVQRSTLELVSGKKAKNDILKFTKDWFSLYHAINDNTL
                     IDRLIEHTPYRYSKYPPLLLFNNSTVRSFDHDVWKYNVPDDVRGQYFHDLLKYLSNND
                     NESTYRYIGINKPIIYDDVMRQPKNIKIVYPSDSTDEIWCQLKQNGIWQVWNPLYTMF
                     SRGNIKEKKRILDTFHGSCKDIDVVDLYCGIGYFSFSYLFNGARNVFGFDINPWSIKG
                     LQEGLRLNKFGPTRCHFYNESNEMSIERIQQYRDSECNGEKLLIRHINLGLLPSSRQG
                     WPIALKIIDIHSDLERVPDQRVTLHIHENVHIDQIEDDSFVQDTVIPGLRHLNAKYHY
                     RKVHVEKIKTFAPDIWHVCIDIDVYR"
     gene            <159367..>161007
                     /gene="NDAI0G00740"
                     /locus_tag="NDAI_0G00740"
                     /db_xref="GeneID:11497246"
     mRNA            <159367..>161007
                     /gene="NDAI0G00740"
                     /locus_tag="NDAI_0G00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671045.2"
                     /db_xref="GeneID:11497246"
     CDS             159367..161007
                     /gene="NDAI0G00740"
                     /locus_tag="NDAI_0G00740"
                     /inference="similar to DNA sequence:INSDC:YIL085C,YNL029C"
                     /note="similar to Saccharomyces cerevisiae KTR7 (YIL085C)
                     and KTR5 (YNL029C); ancestral locus Anc_2.300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671093.2"
                     /db_xref="GeneID:11497246"
                     /db_xref="GOA:G0WDI9"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G0WDI9"
                     /translation="MLKRILVRKILPIIARCNPIVIIILISFITTILMIKSTLDADAE
                     PQYHPLAYSFQDLSTKMDSPFFYGCTNTHAYINENPTYYKMNATFVMLTRNEELNDVL
                     KTIRSIESHFNQWFHYPYVFLNDEPFTQEFMDKIRSVTTTMNDDEVYFGQLNELEWEF
                     AQDVRESVEYIQWIDSQGDRGILYGNMESYHKMCRFYSGLFYKHPLVRQFEWYWRLEP
                     DVEFFCDLSYDPFWEMERTKKYYGFTVVIPELYWTVPNLFRFVKSFVKERQSYVKFKS
                     LWKLFATNYHYKTTNEDDPYNTNLNRFVNDDDELHHELSRDVAIENLFTTHENETIRN
                     NNTHADSHLAVEKSWKSLIEKSKSKIPIKEDKFDDEEYNLCHFWSNFEIAKISIFDNE
                     IYDEFFQYLESTGGFWKERWGDAPIHSLGLSLILNLNEVHYFRDIGYRHSQIYHCPRN
                     SFHSDNERFPFIEGDEKYKRNKKANTYDRSWEHGTGCRCKCPRRLREIEDTMHHCFEL
                     WLELTHNLDTYGSDRENIDVTNIKDKLRKDFLEKFINA"
     gene            complement(<161276..>161587)
                     /gene="NDAI0G00750"
                     /locus_tag="NDAI_0G00750"
                     /db_xref="GeneID:11497247"
     mRNA            complement(<161276..>161587)
                     /gene="NDAI0G00750"
                     /locus_tag="NDAI_0G00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671046.2"
                     /db_xref="GeneID:11497247"
     CDS             complement(161276..161587)
                     /gene="NDAI0G00750"
                     /locus_tag="NDAI_0G00750"
                     /inference="similar to DNA sequence:INSDC:YNL030W"
                     /note="similar to Saccharomyces cerevisiae HHF2 (YNL030W);
                     ancestral locus Anc_2.299"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671094.2"
                     /db_xref="GeneID:11497247"
                     /db_xref="GOA:G0WDJ0"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR019809"
                     /db_xref="UniProtKB/TrEMBL:G0WDJ0"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEEVRAVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            <162224..>162634
                     /gene="NDAI0G00760"
                     /locus_tag="NDAI_0G00760"
                     /db_xref="GeneID:11497248"
     mRNA            <162224..>162634
                     /gene="NDAI0G00760"
                     /locus_tag="NDAI_0G00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671047.2"
                     /db_xref="GeneID:11497248"
     CDS             162224..162634
                     /gene="NDAI0G00760"
                     /locus_tag="NDAI_0G00760"
                     /inference="similar to DNA sequence:INSDC:YNL031C"
                     /note="similar to Saccharomyces cerevisiae HHT2 (YNL031C);
                     ancestral locus Anc_2.298"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671095.2"
                     /db_xref="GeneID:11497248"
                     /db_xref="GOA:G0WDJ1"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G0WDJ1"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
     gene            complement(<162781..>163800)
                     /gene="NDAI0G00770"
                     /locus_tag="NDAI_0G00770"
                     /db_xref="GeneID:11497249"
     mRNA            complement(<162781..>163800)
                     /gene="NDAI0G00770"
                     /locus_tag="NDAI_0G00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671048.2"
                     /db_xref="GeneID:11497249"
     CDS             complement(162781..163800)
                     /gene="NDAI0G00770"
                     /locus_tag="NDAI_0G00770"
                     /inference="similar to DNA sequence:INSDC:YNL032W"
                     /note="similar to Saccharomyces cerevisiae SIW14
                     (YNL032W); ancestral locus Anc_2.296"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671096.2"
                     /db_xref="GeneID:11497249"
                     /db_xref="GOA:G0WDJ2"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020428"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G0WDJ2"
                     /translation="MIHTNNNGSLNGDDDNNVINNDEGDIIVSRKNAHINNIRNKNNN
                     ERNCPSPCSSKIDELILNETDIIRMIKEEGPVLTDYGDGSDIHHIISDDRILEGEFNE
                     VLKQFRKGSDILNLRDNETTIERGINDLEDEDEDDVYDSKEHHAKSKEILSYSTKHTV
                     DTGNSVETEENEEVIPPENFSHVIGEIYRSSFPRIENFPFLKKRLKLKSIIVLIPEEY
                     PQENFDFLEESNIKLFQVGMSGNKEPFVNIPSDLLTNALEIVLNPANQPILIHCNRGK
                     HRTGCLVGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDKEIKRIANRNNW
                     LPLQW"
     gene            164166..164239
                     /gene="NDAI0Ltrna4I"
                     /locus_tag="NDAI_0Ltrna4I"
                     /db_xref="GeneID:11498178"
     tRNA            164166..164239
                     /gene="NDAI0Ltrna4I"
                     /locus_tag="NDAI_0Ltrna4I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:11498178"
     gene            <164452..>165912
                     /gene="NDAI0G00780"
                     /locus_tag="NDAI_0G00780"
                     /db_xref="GeneID:11497250"
     mRNA            <164452..>165912
                     /gene="NDAI0G00780"
                     /locus_tag="NDAI_0G00780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671049.2"
                     /db_xref="GeneID:11497250"
     CDS             164452..165912
                     /gene="NDAI0G00780"
                     /locus_tag="NDAI_0G00780"
                     /inference="similar to DNA sequence:INSDC:YDL122W"
                     /note="similar to Saccharomyces cerevisiae UBP1 (YDL122W);
                     ancestral locus Anc_2.307"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671097.2"
                     /db_xref="GeneID:11497250"
                     /db_xref="GOA:G0WDJ3"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G0WDJ3"
                     /translation="MTEVIGGLNNDDGNSCFINSILQSSASCNYLLQFLDNVIENKTT
                     GTDANVAEFTTTIEKKPKCIISKSKYGKKKKNKKQNQKNPLAEKNSKYHNNEKFFIEL
                     RKLLTNVNTRYTHKKGLSFSTSKFISTLSSQTIINATDQQDAQEFLQILFNDLEKSQI
                     FHTTVKITSNDALQIKTPFEGILMARMKCLTCDEISNPNFKLFSNLTLSLPRYSKQET
                     FNDILSTFWNQLDYVENVSCNRCTLLKHANSNSEYQNLLVKDVIKDDDMENILKRDNL
                     EMVKSNKIKQIKILKPPKILSFHFNRSIFDRKQFKFKKNNCKVLLTPKLNISKFCIVD
                     SDLAVDVADGYAPDFYYKNKNGNSEKDKKYYEKLHQSYETEYAQSDEDDDFNESRDEN
                     QYNSRQDIPENIDLFDSQNFPLKELGHIIGNNKCVYSLKSIVVHYGSHDYGHYISYRR
                     FEDQWWRISDESVLKVDEDEVFSASGIFIVFYEQDI"
     gene            <166185..>166730
                     /gene="NDAI0G00790"
                     /locus_tag="NDAI_0G00790"
                     /db_xref="GeneID:11497251"
     mRNA            <166185..>166730
                     /gene="NDAI0G00790"
                     /locus_tag="NDAI_0G00790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671050.2"
                     /db_xref="GeneID:11497251"
     CDS             166185..166730
                     /gene="NDAI0G00790"
                     /locus_tag="NDAI_0G00790"
                     /inference="similar to DNA sequence:INSDC:YDL120W"
                     /note="similar to Saccharomyces cerevisiae YFH1 (YDL120W);
                     ancestral locus Anc_2.309"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671098.2"
                     /db_xref="GeneID:11497251"
                     /db_xref="GOA:G0WDJ4"
                     /db_xref="InterPro:IPR002908"
                     /db_xref="InterPro:IPR017789"
                     /db_xref="InterPro:IPR020895"
                     /db_xref="UniProtKB/TrEMBL:G0WDJ4"
                     /translation="MLRRSLGTVNTMLIKRSLSSLIAKQVYCSRISTNAKSCMNKRNL
                     INHNAKRFYAMGITTTKGEIIPDEILHLSMQTYHEQSDEFLENLMNIMETLSETYPEN
                     FGSEVEYSDGVFTMTVPRVGSYIINKQPSNKQIWVSSPISGPNRFDFYKNDWRSLRDG
                     KLLTDLLNDEFKDIVPGAFEL"
     gene            <167611..>167838
                     /gene="NDAI0G00800"
                     /locus_tag="NDAI_0G00800"
                     /db_xref="GeneID:11497252"
     mRNA            <167611..>167838
                     /gene="NDAI0G00800"
                     /locus_tag="NDAI_0G00800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671051.2"
                     /db_xref="GeneID:11497252"
     CDS             167611..167838
                     /gene="NDAI0G00800"
                     /locus_tag="NDAI_0G00800"
                     /inference="similar to DNA sequence:INSDC:YNL015W"
                     /note="similar to Saccharomyces cerevisiae PBI2 (YNL015W);
                     ancestral locus Anc_2.310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671099.2"
                     /db_xref="GeneID:11497252"
                     /db_xref="InterPro:IPR009020"
                     /db_xref="UniProtKB/TrEMBL:G0WDJ5"
                     /translation="MAKDFIVTLKKNTPKEDAHKVVESINHLGGTVVHEFSLIKGFKV
                     KVPDGLHLDALKKKHGDTIVNIEEDKEVHAN"
     gene            <169366..>172515
                     /gene="NDAI0G00810"
                     /locus_tag="NDAI_0G00810"
                     /db_xref="GeneID:11497253"
     mRNA            <169366..>172515
                     /gene="NDAI0G00810"
                     /locus_tag="NDAI_0G00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671052.2"
                     /db_xref="GeneID:11497253"
     CDS             169366..172515
                     /gene="NDAI0G00810"
                     /locus_tag="NDAI_0G00810"
                     /inference="similar to DNA sequence:INSDC:YLR249W,YNL014W"
                     /note="similar to Saccharomyces cerevisiae YEF3 (YLR249W)
                     and HEF3 (YNL014W); ancestral locus Anc_1.391"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671100.2"
                     /db_xref="GeneID:11497253"
                     /db_xref="GOA:G0WDJ6"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR015688"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WDJ6"
                     /translation="MSESELSLEFLQELFNNLEIASPDTRDDICSQLSSFLNGNIIEH
                     DLPQKFFDKLHKAIIDKKTSSNALDAIIYIANQTNLSPSVEPFIVSTVPSICAKAGDK
                     DSSIQEIAKRALFAVVNAINPIATKALLPHLINCLSSTNKWQEKIAILESIAILVDVA
                     KEQIALRMPELIPILSESMWDTKKEVKETATKTITKATETIENKDIEIFIPQLINCIA
                     NPSNVPETVHALGATTFVSDVTPATLSIMVPLLNRGLQERDTSIKRKSAVIIDNMCKL
                     VEDPQIVAPFLNDLLPGLKNNFSNIADPEAREVTLRALKTLRRVGNVADDDTIPEISH
                     AGDVSVNLQLFKTLLANAKVTDIDSRFEVVIQYIAAIAANLIDERIIDQQAWFTHVTP
                     YMTIFLHEQQSKDMLDEFRKRAVDNIPIGPNFDDEEDEGEDLCNCEFSLAYGAKILLN
                     KTQLRLKRGRRYGLCGPNGAGKSTLMRAMANGQVEGFPTQDECKTVYVEHDIDNTHSD
                     TSVVDFVFESGVGERDAIISKLNEFGFSNDAVNQPISSLSGGWKMKLALARAVLKNAD
                     ILLLDEPTNHLDTVNVAWLVDYLNNCGITSIIVSHDSGFLDNVCQYIIHYEGLKLRKY
                     KGNLSEFVKRCPTAKSYYELGASDLEFQFPTPGYLEGVKTKQKAIVKVSNMSFQYPGT
                     SKPQVSDVTFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTTGDVYTHENCRIAYIK
                     QHAFAHIENHLDKTPSEYIQWRFQTGEDRETMDRANRQINESDTEMMNKIFKIEGTPR
                     RVAGIHSRRKFKNTYEYECSFLLGENIGMKSERWVPMMSVDNAWLPRGELVESHSKLV
                     AEVDMKEALASGQFRALTRKEIEEHCSMLGLDSELVSHSRIRGLSGGQKVKLVLAAGT
                     WQKPHLIVLDEPTNYLDRDSLGALSKALKAFEGGVIIITHSAEFTKDLTEEVWAVKEG
                     KMTPSGHNWVTGQGAGPRIEKKEAEGDVFDAMGNKIVGANAKKKSKLSSAEMRKKKKE
                     RMKKKKEMGDEYVSSEEDF"
     gene            <172846..>174885
                     /gene="NDAI0G00820"
                     /locus_tag="NDAI_0G00820"
                     /db_xref="GeneID:11497254"
     mRNA            <172846..>174885
                     /gene="NDAI0G00820"
                     /locus_tag="NDAI_0G00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671053.2"
                     /db_xref="GeneID:11497254"
     CDS             172846..174885
                     /gene="NDAI0G00820"
                     /locus_tag="NDAI_0G00820"
                     /inference="similar to DNA sequence:INSDC:YNL012W"
                     /note="similar to Saccharomyces cerevisiae SPO1 (YNL012W);
                     ancestral locus Anc_1.392"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671101.2"
                     /db_xref="GeneID:11497254"
                     /db_xref="GOA:G0WDJ7"
                     /db_xref="InterPro:IPR002642"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:G0WDJ7"
                     /translation="MITYLKYLTIISVLLFATLYGLDEGPYEVNCPDYPLIREANVCL
                     INETFCVNKSNILTHKYFMTSLKNELCPEEELYLKNRKRLLQNNIRQYLTGLDRINFT
                     PEMYDLIAKHPPRLGVAISGGGYRSMLTGSGFLKGLDEFKLIDCLSYISGLSGGSWIL
                     MDLIIHGFDIDKLLKNWDLKDGLLEGIPEFDISQKDIVSGMGKNRALMEKRLEKRMYH
                     FKNLETNGKQFDEFYDFFENIWTPLDEEGSKIFNGTLVKRGDHPLERLKLLIFGNSTS
                     QNSSVIYSFKKFRQVLDFYTDLHLEVRKKKIQGFYVSFTDYWGKALIKRLKHNDNNTS
                     IIGTTNSLTKLIQNNDKFQKFEAPIPIFIANCRNGHLRNKIFEFTPFEFGSWDDMLRL
                     FVKLPYLGSKIIKGVPEICYNDFDDIGFITATSSSIFNNVILYIWQLISESSHEVMKA
                     IETVMGLFGISSKQLEQLDEMNSMIQPETDYAVYHYNPFYQYPGNDNDFTRDSHLYLV
                     DGGEDGENIPLRPLLIPERDMDVIFVIDSSSDKNNFANGTKLLYIFKELEKQGIHYKV
                     PKELKKFGKSQNHPLIIGCHAKSNNGVPLPIIIYYPNAEYSFPSNTSTFKVMYDDNET
                     SSMLQNGKDIFTDDNNPFYKNCLGCIISKRSIDKHGDGINYSKFCNKCFKKYCAS"
     gene            complement(<175022..>176419)
                     /gene="NDAI0G00830"
                     /locus_tag="NDAI_0G00830"
                     /db_xref="GeneID:11497255"
     mRNA            complement(<175022..>176419)
                     /gene="NDAI0G00830"
                     /locus_tag="NDAI_0G00830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671054.2"
                     /db_xref="GeneID:11497255"
     CDS             complement(175022..176419)
                     /gene="NDAI0G00830"
                     /locus_tag="NDAI_0G00830"
                     /inference="similar to DNA sequence:INSDC:YNL011C"
                     /note="similar to Saccharomyces cerevisiae YNL011C;
                     ancestral locus Anc_1.394"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671102.2"
                     /db_xref="GeneID:11497255"
                     /db_xref="InterPro:IPR002882"
                     /db_xref="UniProtKB/TrEMBL:G0WDJ8"
                     /translation="MNIVVLSGGTATNSLTPCFSEISVSKGFDLTYILPISDNGGSTS
                     EILRIVGGPAIGDIRSRIVRIMNDPQLVKLLGYRLSEDEITAKKDWNNIVEGTHIIWS
                     NVPTEVKEMCRAFFIHIQSELLKKNRSSNNFQFAKASLGNMFLTGARLFLGSLDAAIE
                     LMMRIGRCSEKVHVIPCINTNHTHHISAVLKNGTIITGQSQISHPSKIVPKKPILKTT
                     KDQFIHLLELDDDLMNSSMASSNESRNEQGKKQINQEIVEEEEAEYANPIYILPELKH
                     SQLHYDKVDDNEMLPAPIKKILYINPYGEEIKPKGNSRAISKIKNANMIVYSIGSLMT
                     SLLPIIILGNLAEVILEAKQTRKVLLINNKYDRETFGLDGTHYVKMVVKSLLEAVSSY
                     RQSKDLPIESLKNITWSHFITDIVYLKQSEIKIDEPKMLSHGIHCYSINSNLMENDSL
                     AEILKNIITHHKNSM"
     gene            <177902..>178648
                     /gene="NDAI0G00840"
                     /locus_tag="NDAI_0G00840"
                     /db_xref="GeneID:11497256"
     mRNA            <177902..>178648
                     /gene="NDAI0G00840"
                     /locus_tag="NDAI_0G00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671055.2"
                     /db_xref="GeneID:11497256"
     CDS             177902..178648
                     /gene="NDAI0G00840"
                     /locus_tag="NDAI_0G00840"
                     /inference="similar to DNA sequence:INSDC:YNL010W"
                     /note="similar to Saccharomyces cerevisiae YNL010W;
                     ancestral locus Anc_1.395"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671103.2"
                     /db_xref="GeneID:11497256"
                     /db_xref="GOA:G0WDJ9"
                     /db_xref="InterPro:IPR006383"
                     /db_xref="InterPro:IPR006384"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G0WDJ9"
                     /translation="MTNTNSKMVKAVIFTDFDGTVTWQDSNDYLTDHYGFGKEARAKI
                     FEGVLDGSKSFRDGFTAMIDSIQTPLEECKKILETKIQLDPGFKDTFEWAQQNNVPIV
                     VVSSGMRPIIKDLLSRLLGADSIDKIDIESNEVEVDEQNQWKVIYKDETPFGHDKSIT
                     IDDYKKKFESGLKQGETRPTYFYCGDGISDLSAAKECDLLFAKRGKDLVTFCKRQNVP
                     FHEFDTYADILASMKDVLDGKKTVTELMEN"
     gene            <179074..>180333
                     /gene="NDAI0G00850"
                     /locus_tag="NDAI_0G00850"
                     /db_xref="GeneID:11497257"
     mRNA            <179074..>180333
                     /gene="NDAI0G00850"
                     /locus_tag="NDAI_0G00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671056.2"
                     /db_xref="GeneID:11497257"
     CDS             179074..180333
                     /gene="NDAI0G00850"
                     /locus_tag="NDAI_0G00850"
                     /inference="similar to DNA sequence:INSDC:YLR174W,YNL009W"
                     /note="similar to Saccharomyces cerevisiae IDP2 (YLR174W)
                     and IDP3 (YNL009W); ancestral locus Anc_1.396"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671104.2"
                     /db_xref="GeneID:11497257"
                     /db_xref="GOA:G0WDK0"
                     /db_xref="InterPro:IPR004790"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:G0WDK0"
                     /translation="MSKIQVKTPIVEMDGDEMTRIIWHLIKEKLILPYLQIDIKYFDL
                     SIQNRDATNDQVTIDAANATLKHGVGVKCATITPDEARVKEFNLKKMWKSPNGTIRNI
                     LGGTVFREPIIIPKIPRLVSNWEKPIIIGRHAYGDQYKATDLEIPPNKDIKLLIQDKA
                     DKEDSKIINVFSFPNDGTGGIAMVMYNTVDSIKGFAKASFIMALKRKLPLFLATKNTI
                     LKKYDGRFKSIFDDMYQNEFKEKFEKLGLTYEHRLIDDMVAQMLKSKGGFIIAMKNYD
                     GDVQSDIVAQGFGSLGLMTSQLITPDGKTFQSEAAHGTVTRHYRQYQQGKPTSTNSIA
                     SIFAWTSGIIQKGEMDGTPDVVKFGELLQKATIDTVQIDNKMTKDLASLLGQPNYVTT
                     EEFIYAVQKRLNKYISKTYHNHHRCKL"
     gene            <181464..>183035
                     /gene="NDAI0G00860"
                     /locus_tag="NDAI_0G00860"
                     /db_xref="GeneID:11497258"
     mRNA            <181464..>183035
                     /gene="NDAI0G00860"
                     /locus_tag="NDAI_0G00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671057.2"
                     /db_xref="GeneID:11497258"
     CDS             181464..183035
                     /gene="NDAI0G00860"
                     /locus_tag="NDAI_0G00860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671105.2"
                     /db_xref="GeneID:11497258"
                     /db_xref="UniProtKB/TrEMBL:G0WDK1"
                     /translation="MSIRALSSFEKKVLSQTLDSKRNGISYTARYVSKVGSSSDSTLS
                     DAATLLATKDIRLNIGIVTRVLERLIKKHIELYSTINENYEFQILTKIKPEDVISVIT
                     FDTYKDEQINCHSGAPPYLLRHIFNKEKFELNKPLWKLYIIDETMIIFHGFDMLFDIF
                     SAANFHKLFFDELNDYFLTNTFSKSNSKPLDVVFKINVSDKNFVPNFEEFPRSIFDNP
                     KLHLPAMTPDLFNLQTKSFFKTIYSNTIKKPIDLFNGSNSHTKNDITSQLKEYQTHNY
                     LDMLGITSSLCGTTVFGTVSPTRYNYLKGMMKQDEICLRSFICGIVMICLKPSIKNYS
                     GNIIFSIPINLRNYIDGAKNFGLFYKDVKIDCPLSLIDDRNFKYNGYKDSSIPDENDL
                     EFNEKLLEYQFKQVTEFIENVILERLKIWEKFNFNDDDIKRMKFDHDEVLGQNSKIIQ
                     INDTTEIMLGENDNNNKAFTLTNPNFTRTLSGNEFMSVSFAICEETGLNVCIHYPDGY
                     SMETFVECFQTFIEE"
     gene            <183437..>184396
                     /gene="NDAI0G00870"
                     /locus_tag="NDAI_0G00870"
                     /db_xref="GeneID:11497259"
     mRNA            <183437..>184396
                     /gene="NDAI0G00870"
                     /locus_tag="NDAI_0G00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671058.2"
                     /db_xref="GeneID:11497259"
     CDS             183437..184396
                     /gene="NDAI0G00870"
                     /locus_tag="NDAI_0G00870"
                     /inference="similar to DNA sequence:INSDC:YFR047C"
                     /note="similar to Saccharomyces cerevisiae BNA6 (YFR047C);
                     ancestral locus Anc_3.563"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671106.2"
                     /db_xref="GeneID:11497259"
                     /db_xref="GOA:G0WDK2"
                     /db_xref="InterPro:IPR002638"
                     /db_xref="InterPro:IPR004393"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR022412"
                     /db_xref="InterPro:IPR027277"
                     /db_xref="UniProtKB/TrEMBL:G0WDK2"
                     /translation="MYCEAPESKSTTKEELFGEEQPRNKFENLLPINGAWKKDVANWL
                     EEDVPSFDYGGFVVGDHSKTATLYMKEDGLIAGIPFVNEIFKHCEVQFKWLYEEGSFL
                     TPSVQSTEGKLPVAFVKGNARNILLAERTALNVLSRASGVATMSWNFVSAARKVGYKG
                     IIAGTRKTTPGLRRLEKYCMLVGGCDTHRYDLSSMVMLKDNHIWSRGSITEAIKDARN
                     VCGFALKIEVECRSEIEANEAIEAGADIIMLDNFSSEELKICARHLKEKWSQKGKVFL
                     ECSGDLKLNTIEEYFCNDIDIYSTSSIHKGTKAIDFSLKLSDI"
     gene            complement(<184970..>185176)
                     /gene="NDAI0G00880"
                     /locus_tag="NDAI_0G00880"
                     /db_xref="GeneID:11497260"
     mRNA            complement(<184970..>185176)
                     /gene="NDAI0G00880"
                     /locus_tag="NDAI_0G00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671059.2"
                     /db_xref="GeneID:11497260"
     CDS             complement(184970..185176)
                     /gene="NDAI0G00880"
                     /locus_tag="NDAI_0G00880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671107.2"
                     /db_xref="GeneID:11497260"
                     /db_xref="UniProtKB/TrEMBL:G0WDK3"
                     /translation="MKLSSIILSAATIVGIASAQTSGSNNTGGAAGSNTSNAAAPRVG
                     GVASNAVYAGSVGVVIAAAAAVLF"
     gene            complement(<186538..>187302)
                     /gene="NDAI0G00890"
                     /locus_tag="NDAI_0G00890"
                     /db_xref="GeneID:11497261"
     mRNA            complement(<186538..>187302)
                     /gene="NDAI0G00890"
                     /locus_tag="NDAI_0G00890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671060.2"
                     /db_xref="GeneID:11497261"
     CDS             complement(186538..187302)
                     /gene="NDAI0G00890"
                     /locus_tag="NDAI_0G00890"
                     /inference="similar to DNA sequence:INSDC:YGR135W"
                     /note="similar to Saccharomyces cerevisiae PRE9 (YGR135W);
                     ancestral locus Anc_3.499"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671108.2"
                     /db_xref="GeneID:11497261"
                     /db_xref="GOA:G0WDK4"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G0WDK4"
                     /translation="MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGI
                     VLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTY
                     NEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGW
                     KAISVGANTSAAQTLLQMDYKDDMRLDEAIELALKTLSKTTDSSSLTYDKLEFATIKK
                     GKNDGEVYQKIYKPDEIKELLIKTGVTKKKDDETEE"
     gene            complement(<187653..>191492)
                     /gene="NDAI0G00900"
                     /locus_tag="NDAI_0G00900"
                     /db_xref="GeneID:11497262"
     mRNA            complement(<187653..>191492)
                     /gene="NDAI0G00900"
                     /locus_tag="NDAI_0G00900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671061.2"
                     /db_xref="GeneID:11497262"
     CDS             complement(187653..191492)
                     /gene="NDAI0G00900"
                     /locus_tag="NDAI_0G00900"
                     /inference="similar to DNA sequence:INSDC:YGR134W"
                     /note="similar to Saccharomyces cerevisiae CAF130
                     (YGR134W); ancestral locus Anc_3.497"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671109.2"
                     /db_xref="GeneID:11497262"
                     /db_xref="UniProtKB/TrEMBL:G0WDK5"
                     /translation="MAKKKSNSKPKSQSKSTIPDMHQPTFTTIQTAPDTNLEPVREPE
                     VKFKTSADDDSNFYSEEDEIMLTPMSELIPTIFTNHKFKIYKPTIENLQDFLEDEHFF
                     LEMRKIKKVKKFSIMLETLVIAYFTTKSGQSILNYLFDTKRKPPTVQNKILRKTWEVN
                     EFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIKFLLTFHPLSNIETPSIILDSNYNM
                     LTDYLDATSNWLILLIKMTILNVGPFFYNTIIRYNRIPQFNGHFQWYTSLPNDKPLYI
                     KESSNSCNTSSSNKILSSESFIEIITRSNHDFEDDKSFKMSKTSKPVVLWAIEEILSR
                     LSFKDSSRYKKNNINGNGQNYPQMERAQNQSDINYLNRNDGADEYDDDYLHRIDDLKD
                     GEEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQFKLMLGL
                     VDPLSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQNNLGFNWKTHVCFQMVKIINNC
                     MEKLNCNDLQKLYDLTGFQGENNKEELLQQQQQQQQQQQQTDRFVDGNWRSTLEQWLP
                     HGLNTQDLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDID
                     RSEEAHETYKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGR
                     KLCNGALYCDIKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNA
                     ALKENHEDLGKTLKSNDDNSDIYVLNEVKLDRYQRRCNCIFEDDKILQDDDDGNGDEQ
                     QGEQEEQEGTPKNVASFQDPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYST
                     SYSFIDDSSLDTMINLTSKASTQKLNHDDSIQLLQLLASSIKEEQNDMIMKDLLKGKD
                     QLHSNIINPLVNSKEEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEML
                     MCNGYRRVLIWYITHMKLNHSLIQYIFELLMGLRGSPFANNNECKNELLHELMLGKKI
                     VDNHTYPFSRQGPLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTEDISI
                     NSDEIENNENHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGI
                     LKEAKELFFKLKSDIEETSESTDGGDDDDFESIDSRKSSESNGKWEGSRIGKMNDFNK
                     RLLRLLAPIHSGDTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPLPK
                     VGHSLIAEEEEEKAKIN"
     gene            complement(<191811..>192302)
                     /gene="NDAI0G00910"
                     /locus_tag="NDAI_0G00910"
                     /db_xref="GeneID:11497263"
     mRNA            complement(<191811..>192302)
                     /gene="NDAI0G00910"
                     /locus_tag="NDAI_0G00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671062.2"
                     /db_xref="GeneID:11497263"
     CDS             complement(191811..192302)
                     /gene="NDAI0G00910"
                     /locus_tag="NDAI_0G00910"
                     /inference="similar to DNA sequence:INSDC:YGR133W"
                     /note="similar to Saccharomyces cerevisiae PEX4 (YGR133W);
                     ancestral locus Anc_3.495"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671110.2"
                     /db_xref="GeneID:11497263"
                     /db_xref="GOA:G0WDK6"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:G0WDK6"
                     /translation="MSRIIKEYKTIQKQLNNNRNNQDDEFNNIIVSLAPIDPDQDLTK
                     WEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDI
                     LKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYLNI
                     NVV"
     gene            <192573..>193463
                     /gene="NDAI0G00920"
                     /locus_tag="NDAI_0G00920"
                     /db_xref="GeneID:11497264"
     mRNA            <192573..>193463
                     /gene="NDAI0G00920"
                     /locus_tag="NDAI_0G00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671063.2"
                     /db_xref="GeneID:11497264"
     CDS             192573..193463
                     /gene="NDAI0G00920"
                     /locus_tag="NDAI_0G00920"
                     /inference="similar to DNA sequence:INSDC:YGR132C"
                     /note="similar to Saccharomyces cerevisiae PHB1 (YGR132C);
                     ancestral locus Anc_3.494"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671111.2"
                     /db_xref="GeneID:11497264"
                     /db_xref="GOA:G0WDK7"
                     /db_xref="InterPro:IPR000163"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="UniProtKB/TrEMBL:G0WDK7"
                     /translation="MSGPGFNPQQTQKFFNLLTKVALPIGLLVTGVDYSMYDVKGGSR
                     GVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDLQMVSLTLR
                     VLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREIVSQRIK
                     SELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQERQA
                     SVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSPNVTYLPGQNRHS
                     GSGTDGGNSSPNSLLLNIGR"
     gene            complement(<194039..>194569)
                     /gene="NDAI0G00930"
                     /locus_tag="NDAI_0G00930"
                     /db_xref="GeneID:11497265"
     mRNA            complement(<194039..>194569)
                     /gene="NDAI0G00930"
                     /locus_tag="NDAI_0G00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671064.2"
                     /db_xref="GeneID:11497265"
     CDS             complement(194039..194569)
                     /gene="NDAI0G00930"
                     /locus_tag="NDAI_0G00930"
                     /inference="similar to DNA sequence:INSDC:YGR131W,YPR149W"
                     /note="similar to Saccharomyces cerevisiae YGR131W and
                     NCE102 (YPR149W); ancestral locus Anc_3.493"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671112.2"
                     /db_xref="GeneID:11497265"
                     /db_xref="GOA:G0WDK8"
                     /db_xref="InterPro:IPR008253"
                     /db_xref="UniProtKB/TrEMBL:G0WDK8"
                     /translation="MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFT
                     CVYCLLTDSFFGILANFFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQS
                     YLDRNKITQGSGNRCRESQALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRR
                     RRNGAAEVGVPSISQV"
     gene            <196273..>198243
                     /gene="NDAI0G00940"
                     /locus_tag="NDAI_0G00940"
                     /db_xref="GeneID:11497266"
     mRNA            <196273..>198243
                     /gene="NDAI0G00940"
                     /locus_tag="NDAI_0G00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671065.2"
                     /db_xref="GeneID:11497266"
     CDS             196273..198243
                     /gene="NDAI0G00940"
                     /locus_tag="NDAI_0G00940"
                     /inference="similar to DNA sequence:INSDC:YGR130C"
                     /note="similar to Saccharomyces cerevisiae YGR130C;
                     ancestral locus Anc_3.492"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671113.2"
                     /db_xref="GeneID:11497266"
                     /db_xref="UniProtKB/TrEMBL:G0WDK9"
                     /translation="MSLKLGSKKNDPFEHLLNPQPKTTGSSDSSRPRSSSLFLQRVIS
                     STSSIQKTPTTSSSSKKKVSTEEYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYT
                     NRTSKEMGFKKIPKDKNFAKDIFFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNI
                     IDLTKQPSQSQSPSPLDDSANAEKPPLEKPIDPKLTPMVSFQLSTPPVNNKNKKTQVV
                     PEEEEKERNPKATPNSKEEIVKTKKFGILSKSIYDQLQYDQQQHEQYLASYKAEMQEK
                     YDVKMQEYENELKSLDEKIVASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDD
                     KMKIFSETKLIKREKIDEKINVEELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIA
                     EQLDAKLFKIKQINITQMNLQNKIDGLNNEKLGLTKEIEANKFTHANNVETIENVDNK
                     QYLPKLNNIDSQINDLLNQLTLIKQENANEKIQLSELTQKLEKERMDHEEKLKLDAEE
                     RKRQEENLLGKQREELEQKANDLQLNHETEMTNLKTSYEQQLADFKSKLMEQQDKVDD
                     LKLQKSRLEGSKAIEDQDRQKQSDNVLKNEILSKQHQQAEAYNAVQLAQKKKNASPVA
                     EDLMKESHIPALSKAKDDSLFEYETEEEIMYV"
     gene            complement(<198741..>199382)
                     /gene="NDAI0G00950"
                     /locus_tag="NDAI_0G00950"
                     /db_xref="GeneID:11497267"
     mRNA            complement(<198741..>199382)
                     /gene="NDAI0G00950"
                     /locus_tag="NDAI_0G00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671066.2"
                     /db_xref="GeneID:11497267"
     CDS             complement(198741..199382)
                     /gene="NDAI0G00950"
                     /locus_tag="NDAI_0G00950"
                     /inference="similar to DNA sequence:INSDC:YGR129W"
                     /note="similar to Saccharomyces cerevisiae SYF2 (YGR129W);
                     ancestral locus Anc_3.490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671114.2"
                     /db_xref="GeneID:11497267"
                     /db_xref="InterPro:IPR013260"
                     /db_xref="UniProtKB/TrEMBL:G0WDL0"
                     /translation="MKQEELDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKP
                     KVYDIKAVEDDDNHHTDYDGLGDFSNEEEKRKFKLMNYTIREYEEWDKQQKDKQRKRV
                     DGSDLTELATFTYEKELSKLNSKLENISHEQKHQIGVNTRNGKLNVKDEERLLNNLVN
                     NLNETAKKRYMVRKKKLQSKASSDIAGNYFKDKNKQFNEKLERELKERDNGGD"
     gene            <199784..>201886
                     /gene="NDAI0G00960"
                     /locus_tag="NDAI_0G00960"
                     /db_xref="GeneID:11497268"
     mRNA            <199784..>201886
                     /gene="NDAI0G00960"
                     /locus_tag="NDAI_0G00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671067.2"
                     /db_xref="GeneID:11497268"
     CDS             199784..201886
                     /gene="NDAI0G00960"
                     /locus_tag="NDAI_0G00960"
                     /inference="similar to DNA sequence:INSDC:YGR128C"
                     /note="similar to Saccharomyces cerevisiae UTP8 (YGR128C);
                     ancestral locus Anc_3.489"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671115.2"
                     /db_xref="GeneID:11497268"
                     /db_xref="InterPro:IPR018843"
                     /db_xref="UniProtKB/TrEMBL:G0WDL1"
                     /translation="MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVV
                     IGVSGSAISQYIINPTPKLIFNYPIPSTNIVTACDVLENDNDNTNNEVWCFGLVANKT
                     YTLTLITKDKQKSSATMEDDEDVVDVIDTTIKDEFNVKLDSKIVDIKIIKKKADDISI
                     MIVLENGLIQFFNSSLKLLNTVKINYKNVKFVEHFKEDNKDFMFTICDLGDNNKVCIK
                     LFQINNDSAIELNSIIMENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTI
                     PMIKTDDQIVSMKPISTNRILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVI
                     GKGENNNKTITIGVSTKFGVNPTSSLEIINVDVGSNTLKDSLGKCFQNLNLQNQIQIS
                     TQALKPLFDPNTDGDKDDDLFKKLVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFN
                     IKKEHYTENDRFIYNHEFFLKLIDLIFEKFGSTATTAQTNEYPKTLTFLLTHPLFPME
                     RTQSLLSRFANHPRLFKQAIVTCPNLPLPELLNELLTIKNNELSLDISLRILQDYSKD
                     SIKQELRNLPRLEIENFIDFILNDEIKDDQNSPQLFQLLALVLDSIGLFALSDNILEN
                     LSAYIDRQVSIVEKNTELWYLIDSNNNIFSHNKKDNSFSSASASTNSKSNNISSNNKK
                     SFTQKEALPMYSVDYLEL"
     gene            complement(<202186..>203184)
                     /gene="NDAI0G00970"
                     /locus_tag="NDAI_0G00970"
                     /db_xref="GeneID:11497269"
     mRNA            complement(<202186..>203184)
                     /gene="NDAI0G00970"
                     /locus_tag="NDAI_0G00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671068.2"
                     /db_xref="GeneID:11497269"
     CDS             complement(202186..203184)
                     /gene="NDAI0G00970"
                     /locus_tag="NDAI_0G00970"
                     /inference="similar to DNA sequence:INSDC:YGR127W"
                     /note="similar to Saccharomyces cerevisiae YGR127W;
                     ancestral locus Anc_3.487"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671116.2"
                     /db_xref="GeneID:11497269"
                     /db_xref="InterPro:IPR008551"
                     /db_xref="UniProtKB/TrEMBL:G0WDL2"
                     /translation="MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPY
                     DMAKECKYNDKKVFGTWLGINKDGKIATVLNLKLNKSLSLKQLVAPKSRGMLPFVYLS
                     DMTEDSFAEWDGYDNFTKKYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNC
                     QYLVVSNDVFTCNGQLGELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIV
                     EKQDEDTIISECFKLSSTCSVTVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLP
                     IGEYYGTRSQIVILIKRGTYEVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTLNR"
     gene            complement(<203951..>204655)
                     /gene="NDAI0G00980"
                     /locus_tag="NDAI_0G00980"
                     /db_xref="GeneID:11497270"
     mRNA            complement(<203951..>204655)
                     /gene="NDAI0G00980"
                     /locus_tag="NDAI_0G00980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671069.2"
                     /db_xref="GeneID:11497270"
     CDS             complement(203951..204655)
                     /gene="NDAI0G00980"
                     /locus_tag="NDAI_0G00980"
                     /inference="similar to DNA sequence:INSDC:YGR126W"
                     /note="similar to Saccharomyces cerevisiae YGR126W;
                     ancestral locus Anc_3.486"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671117.2"
                     /db_xref="GeneID:11497270"
                     /db_xref="UniProtKB/TrEMBL:G0WDL3"
                     /translation="MTHSGNIISADNTDNEFDDISSFSSIDSYQPEPFTGLKGNELPN
                     AQPSTTATTTEQDHDDTVISSHSHDTKHGEEPSRTSTATLKKLDSNVNDIEKTMTTNI
                     MNDKTETLDSLVKQGLNTRKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKTIESL
                     RRQESIASANSRRSQDQGSFKSARTNNTRKSRASSSLDPNKLNMAVEKNKKELEKYSK
                     HKQQKGIKGFFNRLFD"
     gene            complement(<205221..>208385)
                     /gene="NDAI0G00990"
                     /locus_tag="NDAI_0G00990"
                     /db_xref="GeneID:11497271"
     mRNA            complement(<205221..>208385)
                     /gene="NDAI0G00990"
                     /locus_tag="NDAI_0G00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671070.2"
                     /db_xref="GeneID:11497271"
     CDS             complement(205221..208385)
                     /gene="NDAI0G00990"
                     /locus_tag="NDAI_0G00990"
                     /inference="similar to DNA sequence:INSDC:YGR125W"
                     /note="similar to Saccharomyces cerevisiae YGR125W;
                     ancestral locus Anc_3.485"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671118.2"
                     /db_xref="GeneID:11497271"
                     /db_xref="GOA:G0WDL4"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:G0WDL4"
                     /translation="MRRQKNNRHSISDTISVSLGLQNQDPQILQQPNGGPTVTLGNMS
                     DTSNYLGRSYVSGFLSASPAINHDNNNNTLPIANQHLNKSIHASQNLHRQTAAISEDF
                     NNDPTFEDDINMKEYISNLEDDATGNNGKRYTAYYIDNEDRIDNILTEEAEPVTDFYP
                     QDENSRLLLSPIPSDSLLAGENLLPSISEQEQETAQRRRTSAYQSIRHRNSESTEYSS
                     IPTWRKYIATPSEIIQYLPASILGLLLTILDALSYGMIIFPITEPIFSHLGPTGISMF
                     YISTIISQSIFSGGWSSFPCGIGSEMIEVTPFFHTMAFAIKDALPEGSNDDIITTTLF
                     CYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRVAKF
                     QYTIPFITHLFTDVVTLWQWLLPTLLTVILIIAQKCAQNSLVLPSFYILTLILFHFMV
                     AIIPSLSLNQLRDSGWIFPQAATDSKWYDHYKLFNLHKVHWTLILKQIPTMLALTFFG
                     ILHVPINVPALAMSLQMDRYDVDKELIAHGVSNFVSGMFGSIQNYLVYTNSVLFIRAG
                     ADSALAGHILIVLTIIIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDPLGKISK
                     FEYITIVIIVFTMGIFDFVLGVIVGILIACFSFLIDSTKLQTINGEFDGTVAKSTVYR
                     DLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIEEKIDKLLEISDMDSSKHRIKYLILD
                     FKNINADNIDYSAAEGFNRIKRFTQTKRIRLIISSIRERDHIYNAFNNVGLLEGVELF
                     NDLNSALEWCENEFLFKYKTLREKTRQKRKNKIDINLAITNGNPTEERNMHLEIPRNI
                     MSLPMNTPRNNQMLSVAQNVFRNEEQAAKALKQQFKNEPSVLPLLLFVLKQYRPRIVS
                     NDKSIEEKEIKFWSQLCPYLSERFLVAQSTLKHNNNFFFIVESGILKATFTLPSGTLY
                     ETMSNRTCYGKILGSNNETTVLNEQDLTIKTETDCNLWVIDMDALTRMRAENLELYIE
                     LVLLIMSIRDTRFKELLGYTLVSA"
     gene            complement(209680..209753)
                     /gene="NDAI0Ltrna5I"
                     /locus_tag="NDAI_0Ltrna5I"
                     /db_xref="GeneID:11498200"
     tRNA            complement(209680..209753)
                     /gene="NDAI0Ltrna5I"
                     /locus_tag="NDAI_0Ltrna5I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:11498200"
     gene            complement(<212559..>213770)
                     /gene="NDAI0G01000"
                     /locus_tag="NDAI_0G01000"
                     /db_xref="GeneID:11497272"
     mRNA            complement(<212559..>213770)
                     /gene="NDAI0G01000"
                     /locus_tag="NDAI_0G01000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671071.2"
                     /db_xref="GeneID:11497272"
     CDS             complement(212559..213770)
                     /gene="NDAI0G01000"
                     /locus_tag="NDAI_0G01000"
                     /inference="similar to DNA sequence:INSDC:YGR122W"
                     /note="similar to Saccharomyces cerevisiae YGR122W;
                     ancestral locus Anc_3.476"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671119.2"
                     /db_xref="GeneID:11497272"
                     /db_xref="UniProtKB/TrEMBL:G0WDL5"
                     /translation="MELPLQLTKKSALQKCLTSDGILLRERCIKLLDAHSAKKIDALL
                     AIDTFFEYGNILLTYIHADEIPQELSVNTLLDETIEILIDIAFYHENIILNLLQRAYD
                     TPDLSSTLWSKSGCYLKNGLGILDYLSSLINKFQYHSKYYELMNQLSLEFKLLQQLSI
                     IVLSLSKLRSKIYNEKNDAILDFQEEDLRELASNSSFYAKICIGCRELLFQHNKKEFK
                     SLLLTTALGYYLDSLTFLLLSMDQYNNDECGIAIGMLEQSIKSLSGIIPLSELNTTIL
                     NEKTIKKKDIFKLKIQSKKNPLRMDSKITNYGTKTGKNNNNNTLIPVLQDSLDDFVIP
                     LITLLRYRYNITNEKLSFKPVENDRTKLERFFPRGKIPDLNGTKWVFHNNKLVQEGNI
                     VIKHGQQTNYF"
     gene            complement(214014..214087)
                     /gene="NDAI0Ltrna2N"
                     /locus_tag="NDAI_0Ltrna2N"
                     /db_xref="GeneID:11498201"
     tRNA            complement(214014..214087)
                     /gene="NDAI0Ltrna2N"
                     /locus_tag="NDAI_0Ltrna2N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:11498201"
     gene            <214314..>215105
                     /gene="NDAI0G01010"
                     /locus_tag="NDAI_0G01010"
                     /db_xref="GeneID:11497273"
     mRNA            <214314..>215105
                     /gene="NDAI0G01010"
                     /locus_tag="NDAI_0G01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671072.2"
                     /db_xref="GeneID:11497273"
     CDS             214314..215105
                     /gene="NDAI0G01010"
                     /locus_tag="NDAI_0G01010"
                     /inference="similar to DNA sequence:INSDC:YGR120C"
                     /note="similar to Saccharomyces cerevisiae COG2 (YGR120C);
                     ancestral locus Anc_3.472"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671120.2"
                     /db_xref="GeneID:11497273"
                     /db_xref="InterPro:IPR024602"
                     /db_xref="UniProtKB/TrEMBL:G0WDL6"
                     /translation="MDFLKDEDLTLDLPNVTEISRDLFEDESEKLIELQKEDPNKTFD
                     VDEFLIKNNFHYVPLDTLIRDLSSLSEEVIDALFGQVNADYDEYLKFCQIYSKDEAEN
                     ETILDLQQTRLELKNFISHLEQLTSRDIARTQEVVSDTLEYLERLDHIQILLNNHSNI
                     LEIITLGKQLSKTLHGVCGIEPLEESISVELTRQLFILVTRARELLETLTSLNSPYVH
                     HLRNEFQGLVQEFQISLKILTNKCLENPSECPELSKLLVEISQAA"
     gene            <217099..>218862
                     /gene="NDAI0G01020"
                     /locus_tag="NDAI_0G01020"
                     /db_xref="GeneID:11497274"
     mRNA            <217099..>218862
                     /gene="NDAI0G01020"
                     /locus_tag="NDAI_0G01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671073.2"
                     /db_xref="GeneID:11497274"
     CDS             217099..218862
                     /gene="NDAI0G01020"
                     /locus_tag="NDAI_0G01020"
                     /inference="similar to DNA sequence:INSDC:YGR119C"
                     /note="similar to Saccharomyces cerevisiae NUP57
                     (YGR119C); ancestral locus Anc_3.471"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671121.2"
                     /db_xref="GeneID:11497274"
                     /db_xref="GOA:G0WDL7"
                     /db_xref="InterPro:IPR024864"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="InterPro:IPR025712"
                     /db_xref="UniProtKB/TrEMBL:G0WDL7"
                     /translation="MFNFGGNANTNNNAGSMGSTTGTSLFGSSQQPQQQNTTLGGGFG
                     FNNNQQQQQQQPQQQQGGSLFSAGNATTTGTTGLFGNKSTLGGPSMQSNTNTGGGLFG
                     QQQPQQQQQGGSLFGSNATTNTAGRGGLFGNSSTTQQQQPSGGLFGSNTNQPSVGGGL
                     FGSNQQQQQPAVTATTGGLFGNKPQGLSTGTSGGLFGNKPSGTSGGLFGSRAPTTGGG
                     LFGSNNNNQTTNTQTGLFGNTTNTQGGLFGNPQGQGTTTPGGGLFGQQQQQQQQQQPT
                     LTTVQPSFSWSQQAPQQMNQQSQSTMPRLQAQIQMQQQQLQQQNTVYPQQIQEQIIKC
                     KESWDPNSSKSKLRTFVYNKVNETEAMLYNKPMNANQEEWNIAIENKPSNDVIPIQIH
                     GFEGLNVRNQLQIENVAQARVILNQVLEKSTQLQQKHDLDTAARILKAKSRNVEIERR
                     ILKLGSQISILKNRGVPLNINEEKMWSQFKQLLKKSEDPAALGKTNELWARLAVLKER
                     AKNVSDKLDSTLVVIGDNGGSSTSSTNSKENMVNKLADDEEKNKIDKIAEILSNQQRG
                     IYYLNEVLENDQRAIDKALKS"
     gene            complement(<219901..>220709)
                     /gene="NDAI0G01030"
                     /locus_tag="NDAI_0G01030"
                     /db_xref="GeneID:11497275"
     mRNA            complement(join(<219901..220273,220645..>220709))
                     /gene="NDAI0G01030"
                     /locus_tag="NDAI_0G01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671074.2"
                     /db_xref="GeneID:11497275"
     CDS             complement(join(219901..220273,220645..220709))
                     /gene="NDAI0G01030"
                     /locus_tag="NDAI_0G01030"
                     /inference="similar to DNA sequence:INSDC:YGR118W,YPR132W"
                     /note="similar to Saccharomyces cerevisiae RPS23A
                     (YGR118W) and RPS23B (YPR132W); ancestral locus Anc_3.467"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671122.2"
                     /db_xref="GeneID:11497275"
                     /db_xref="GOA:G0WDL8"
                     /db_xref="InterPro:IPR005680"
                     /db_xref="InterPro:IPR006032"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:G0WDL8"
                     /translation="MGKGKPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFG
                     GSSHAKGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEV
                     LLAGFGKKGKAKGDMPGVRFKVVKVSGVSLLALWKEKKEKPRA"
     gene            <221385..>222752
                     /gene="NDAI0G01040"
                     /locus_tag="NDAI_0G01040"
                     /db_xref="GeneID:11497276"
     mRNA            <221385..>222752
                     /gene="NDAI0G01040"
                     /locus_tag="NDAI_0G01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671075.2"
                     /db_xref="GeneID:11497276"
     CDS             221385..222752
                     /gene="NDAI0G01040"
                     /locus_tag="NDAI_0G01040"
                     /inference="similar to DNA sequence:INSDC:YGR117C"
                     /note="similar to Saccharomyces cerevisiae YGR117C;
                     ancestral locus Anc_3.466"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671123.2"
                     /db_xref="GeneID:11497276"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0WDL9"
                     /translation="MKESTSEKYIRTLVAQYLQKKGFKSTLASFLNEANVPLAVTKNE
                     NQEQLDDLETIIKERIQFNEHNISDKLKRLTLNDFSTNNNNTSEYSSHFSSWDYKKIF
                     VEQSHVECSGIPLSVGFDAPNDEDIVVSTSAKEVNIYGNKSGDLLGSLKPISGIAKLC
                     GSIGNYYYTASMDGSLNIYGDDLNLLVNRCSKIHGRMITNVKFWYNGNEKCWFIISTG
                     LDHILKLTKMKISPDCAVTFEELASTGVQACTGLELHPNGDNMPSILVCKADFTKVTC
                     YEIMNDHQFTISYNIALNNTEFSSHSFSVRAMTIIEHSNPILSSYDNDTDFLIVLTSH
                     IPYMRVIVAELPKRENIKDELSEKDPIIPTYWDKIRRNIATEIFQDNYSQPVVTVLDQ
                     CKGIIIGADKGIYGLDVNTGDSWKLDMPNFVNDERVKCLSSNRGGSAFAAGLANKSVH
                     QWSVL"
     gene            complement(<223130..>224302)
                     /gene="NDAI0G01050"
                     /locus_tag="NDAI_0G01050"
                     /db_xref="GeneID:11497277"
     mRNA            complement(<223130..>224302)
                     /gene="NDAI0G01050"
                     /locus_tag="NDAI_0G01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671076.2"
                     /db_xref="GeneID:11497277"
     CDS             complement(223130..224302)
                     /gene="NDAI0G01050"
                     /locus_tag="NDAI_0G01050"
                     /inference="similar to DNA sequence:INSDC:YPR129W"
                     /note="similar to Saccharomyces cerevisiae SCD6 (YPR129W);
                     ancestral locus Anc_3.464"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671124.2"
                     /db_xref="GeneID:11497277"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR019050"
                     /db_xref="InterPro:IPR025609"
                     /db_xref="InterPro:IPR025761"
                     /db_xref="InterPro:IPR025762"
                     /db_xref="InterPro:IPR025768"
                     /db_xref="UniProtKB/TrEMBL:G0WDM0"
                     /translation="MSQYIGKTISLISVTDNRYVGLLEGIDSEKGTVTLNEVRCFGTE
                     GRKGWGPDEIYPTNNIYKSVKFNGNEVKDLSILEVSIEDVHPVLPPSATPVVPVPIAE
                     QQAAPPQVPQAMAGYGVYAPNQGGITSTADQYQHQQQAQQHQQQQEEPAPSAAAVHQE
                     EPAPIASVPTEEVASQNEQPRKEQQQQQQQQQQHVEGEEPRRHDHHPHNNEHKNHSHS
                     HTRRSQQRNIEIPKSDFDFQSNNAKFTKQELSQSHHDAVAEPVASTIEQTIQTQTVTA
                     QQAAQADPETFYNRKSSFFDTISTSTETNTNMRWQEEKVLNLDTFGQTSARPNFHGGR
                     GGRGRGNYRGRGGRGRGNYRGRGGNRGGYNNNNRNNYHSSNDGQQFQSQSQPQVEF"
     gene            complement(<224557..>225765)
                     /gene="NDAI0G01060"
                     /locus_tag="NDAI_0G01060"
                     /db_xref="GeneID:11497278"
     mRNA            complement(<224557..>225765)
                     /gene="NDAI0G01060"
                     /locus_tag="NDAI_0G01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671077.2"
                     /db_xref="GeneID:11497278"
     CDS             complement(224557..225765)
                     /gene="NDAI0G01060"
                     /locus_tag="NDAI_0G01060"
                     /inference="similar to DNA sequence:INSDC:YGR113W"
                     /note="similar to Saccharomyces cerevisiae DAM1 (YGR113W);
                     ancestral locus Anc_3.458"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671125.2"
                     /db_xref="GeneID:11497278"
                     /db_xref="GOA:G0WDM1"
                     /db_xref="InterPro:IPR013962"
                     /db_xref="UniProtKB/TrEMBL:G0WDM1"
                     /translation="MNQEQSEHGNNTNINELGTTTALPTTDYKLSISSNPGSRRSSMN
                     DGDFSSSNNLHQQHLKYSDDLHRTPGSDAADAFHSNTDNNGDDGNVLLQTYLLPQIQE
                     LTESMVTLDTNFTRLNFIHESLVDLNESVGSLLYGLMCNSWCVEFPNVPHDLEKELKI
                     MKRLENLKDEKKRLQRQLAAVKDHRAAAQKPRPNSSSSSSNNSNLPQQRGKFAQPLFP
                     STQGTKRTASIHAEHLHKNLREDEQEQDIDDNSSEASFVSNPAIDTQRIRSQTAGTNR
                     LGANNRNAENSKLRRHSILHTIRNSVASNADMYGSRNERTTATQDNGGARRSLGHRAT
                     RVVVKGNNVQASSTAQRRGTILQGYAARISKPMSKRPSMGTNALNNTRTHENPDKNSS
                     NSNSYRPPFR"
     gene            complement(<226260..>227435)
                     /gene="NDAI0G01070"
                     /locus_tag="NDAI_0G01070"
                     /db_xref="GeneID:11497279"
     mRNA            complement(<226260..>227435)
                     /gene="NDAI0G01070"
                     /locus_tag="NDAI_0G01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671078.2"
                     /db_xref="GeneID:11497279"
     CDS             complement(226260..227435)
                     /gene="NDAI0G01070"
                     /locus_tag="NDAI_0G01070"
                     /inference="similar to DNA sequence:INSDC:YGR112W"
                     /note="similar to Saccharomyces cerevisiae SHY1 (YGR112W);
                     ancestral locus Anc_3.457"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671126.2"
                     /db_xref="GeneID:11497279"
                     /db_xref="GOA:G0WDM2"
                     /db_xref="InterPro:IPR002994"
                     /db_xref="UniProtKB/TrEMBL:G0WDM2"
                     /translation="MIRRTTKLLTIVYPRIELIGPVPLRTMHTTLPFHRKPQSISRRN
                     HMSSTVDWKPIKTHHNPNEDPNLHDRGIGRKIALGLMIAMPVISFYLGTWQLRRLKWK
                     TRLIATCETKLTYEPIPLPKNFTVDMCEDWEYRKVILKGEFLHDQEMFVGPRSKNGTK
                     GYLLFTPFIRADTGEKVMIERGWIAEEKIPPENRTLHHLSLPQGKNVEVVCMVRPPKE
                     RGQFQWAKEDKNSRLWQVADVWDMAKTSGCAPIHFQAIYDMKDHPITPEAPNNFAKQQ
                     EQLAPFWKFWAKKDIGNHIKETQVTVASEKPLRKMNDDDTAEFNEFQFIKAGVPIGKK
                     PTIDLRNAHLQYLVTWYGLSLLSTVFLIIAIKKYWKRGVVSPEQLKKDKLKHAKKYM"
     gene            complement(<227765..>228979)
                     /gene="NDAI0G01080"
                     /locus_tag="NDAI_0G01080"
                     /db_xref="GeneID:11497280"
     mRNA            complement(<227765..>228979)
                     /gene="NDAI0G01080"
                     /locus_tag="NDAI_0G01080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671079.2"
                     /db_xref="GeneID:11497280"
     CDS             complement(227765..228979)
                     /gene="NDAI0G01080"
                     /locus_tag="NDAI_0G01080"
                     /inference="similar to DNA sequence:INSDC:YGR111W"
                     /note="similar to Saccharomyces cerevisiae YGR111W;
                     ancestral locus Anc_3.456"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671127.2"
                     /db_xref="GeneID:11497280"
                     /db_xref="UniProtKB/TrEMBL:G0WDM3"
                     /translation="MSNTNSLIFEEYNDPELIGYSHSQNGEAWKGILSLEDYAAREWT
                     LGQSSIAQKQKSPEIQEKFPDCYQNLGIKYFMLKDLNLEATSKTSQIVSSCETLNRIG
                     YCIRPGTNNTIEPSLVVCIGGVFTPEMHRRNGYARVMIEKLNQHYDKIRDSPNAPPLL
                     KNLVINLYSEVDEYYEKVGYYSLHVPLHHVTALDEFNEKFCNGYAMEQNDSGRLLGYD
                     NYEDLVKLQDIEFKKNLLASAKAHPDSFVFTVAPDIDIYKWFEDRDIFIQRKITPNGS
                     VKIPPFGYALKDNSHIIWHHNWNNNLLVIIKLYISEDAKKEKKKEEKVLRELMFYAIE
                     ETKAHNLTKLQFWDEELPLKEFPTLQNTLSKLEHESKLYATNGSVSAVRPPIGFNKDT
                     IVWENNTKFCWF"
     gene            complement(229153..229202)
                     /gene="NDAI0Ltrna3Y"
                     /locus_tag="NDAI_0Ltrna3Y"
                     /db_xref="GeneID:11498162"
     tRNA            complement(join(229153..229189,229153..229202))
                     /gene="NDAI0Ltrna3Y"
                     /locus_tag="NDAI_0Ltrna3Y"
                     /product="tRNA-Tyr"
                     /note="codon recognized: UAC"
                     /db_xref="GeneID:11498162"
     gene            <230932..>232302
                     /gene="NDAI0G01090"
                     /locus_tag="NDAI_0G01090"
                     /db_xref="GeneID:11497281"
     mRNA            <230932..>232302
                     /gene="NDAI0G01090"
                     /locus_tag="NDAI_0G01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671080.2"
                     /db_xref="GeneID:11497281"
     CDS             230932..232302
                     /gene="NDAI0G01090"
                     /locus_tag="NDAI_0G01090"
                     /inference="similar to DNA sequence:INSDC:YGR110W"
                     /note="similar to Saccharomyces cerevisiae YGR110W;
                     ancestral locus Anc_3.454"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671128.2"
                     /db_xref="GeneID:11497281"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0WDM4"
                     /translation="MWKKVTLSREIIKTSITKLIKRDRKLQTPQTSPQIFQNKEGNES
                     KRSTTTTTTILSSPATTTKINTIAPTPPTAIPLLRIITSLPKLFPRSIKQSIQDYKIF
                     QKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQIEDNDDYYINEFCITPDTNININSA
                     DVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRD
                     SQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYAFKFPSHFQKLIMC
                     SPAGVTKSSIKKLNNSPPWWYEKLWDLNFSPFSIVRNSGIYGSKITSAWSYRRFKPLD
                     LDHKQFEALHRYAYSIFNRPGCGEYLLSFILSCGGNPRFSLEDTLFQRENLSTELCDW
                     GWIYGDNDWMDINGAKRVSRLINEQQKGKSDVHVIPSAGHHLYLDNYKDFNKLLIKEM
                     EMFGER"
     gene            234330..234401
                     /gene="NDAI0Ltrna2C"
                     /locus_tag="NDAI_0Ltrna2C"
                     /db_xref="GeneID:11498210"
     tRNA            234330..234401
                     /gene="NDAI0Ltrna2C"
                     /locus_tag="NDAI_0Ltrna2C"
                     /product="tRNA-Cys"
                     /note="codon recognized: UGC"
                     /db_xref="GeneID:11498210"
     gene            <235052..>236293
                     /gene="NDAI0G01100"
                     /locus_tag="NDAI_0G01100"
                     /db_xref="GeneID:11497282"
     mRNA            <235052..>236293
                     /gene="NDAI0G01100"
                     /locus_tag="NDAI_0G01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671081.2"
                     /db_xref="GeneID:11497282"
     CDS             235052..236293
                     /gene="NDAI0G01100"
                     /locus_tag="NDAI_0G01100"
                     /inference="similar to DNA sequence:INSDC:YGR109C,YPR120C"
                     /note="similar to Saccharomyces cerevisiae CLB6 (YGR109C)
                     and CLB5 (YPR120C); ancestral locus Anc_3.453"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671129.2"
                     /db_xref="GeneID:11497282"
                     /db_xref="GOA:G0WDM5"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:G0WDM5"
                     /translation="MSQYIPAISNTTNNDENNNTLSIGGPEHATTKRTVLGEVPINPK
                     KGNIKPSIDLQNSKIRSIINITRKRRLPNENEGDRDPLTKKLKIYKDTESIGDETNDE
                     TLIGDIEENDKENKKPNKPINWKDLDTLEQDDISMVTEYSNDIFQYLYEKEISMVPTH
                     NYLLDSNSKYHIRPSMRAILIDWLVEVHEKFHYANETLFLGINIMDRFLSFNKVTVTK
                     LQLLAVTSMFIAAKFEEVKLPKLSNYSYITDGAASNNDIKNAELYILKNLNFNIAWPN
                     PMNFLRRISKVDKYDFQTRFIGKFLLEYLMCSHKFISLKSSMLSAIAMYVARMITSPK
                     LKWDNTCIHYSGDIDAENCQAFEENCQELIEEIVNPTITIDSLITKYKKPKFNAIYFK
                     VHDWCSNYLNNENDNSFKKTL"
     gene            complement(<236585..>238162)
                     /gene="NDAI0G01110"
                     /locus_tag="NDAI_0G01110"
                     /db_xref="GeneID:11497283"
     mRNA            complement(<236585..>238162)
                     /gene="NDAI0G01110"
                     /locus_tag="NDAI_0G01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671082.2"
                     /db_xref="GeneID:11497283"
     CDS             complement(236585..238162)
                     /gene="NDAI0G01110"
                     /locus_tag="NDAI_0G01110"
                     /inference="similar to DNA sequence:INSDC:YGR108W,YPR119W"
                     /note="similar to Saccharomyces cerevisiae CLB1 (YGR108W)
                     and CLB2 (YPR119W); ancestral locus Anc_3.452"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671130.2"
                     /db_xref="GeneID:11497283"
                     /db_xref="GOA:G0WDM6"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:G0WDM6"
                     /translation="MANMEDTVVQYYIHNHFLTAAKPGEIGSNYNIVTIKALNSVACG
                     CFVIFFDDVVSIFYNQNNVRKIINNQNSATRSSFLKTQKSFSRYKKKNNIINWKIILV
                     KINSVEIMSSKTSVLTAYSTAYQLPQNSQTNSIQIENPLARAALTNVTNKTMGFNIKA
                     LKNLKLIAREENSKVSKTEVDLENKIIDSYLSTGKENEVPLYPYEERNIPLQKKKRHI
                     SGTIWEKDSPKKIKIGSKQQQIVLEEIWDDLDEEDLDDPLMVFEYVQDIFTYLHELEL
                     ITLPNKQKILRHKNIRENRDILIDWLVKIHVKFQLLPETLFLAINLIDRFLTKESVQL
                     DKLQLVGTSCLFIASKYEEIYCPSIKNFANETDGACSTDDIKKGEKYILKALDFNLNY
                     PNPMNFLRRISKADDYDIQSRTLAKFLLEITIIDCRFIGILPSLCAAAAMFISRKMLG
                     KCQWDRNLIHYCGGYRKEDLQKVCELIMDYLIEPTIHEEFIRKYRSRKFLKASIISVQ
                     WAKKVRENNLDLMTLHE"
     gene            240750..240848
                     /gene="NDAI0Ltrna5K"
                     /locus_tag="NDAI_0Ltrna5K"
                     /db_xref="GeneID:11498209"
     tRNA            join(240750..240787,240812..240848)
                     /gene="NDAI0Ltrna5K"
                     /locus_tag="NDAI_0Ltrna5K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAA"
                     /db_xref="GeneID:11498209"
     gene            complement(<243018..>245867)
                     /gene="NDAI0G01120"
                     /locus_tag="NDAI_0G01120"
                     /db_xref="GeneID:11497284"
     mRNA            complement(<243018..>245867)
                     /gene="NDAI0G01120"
                     /locus_tag="NDAI_0G01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671083.2"
                     /db_xref="GeneID:11497284"
     CDS             complement(243018..245867)
                     /gene="NDAI0G01120"
                     /locus_tag="NDAI_0G01120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671131.2"
                     /db_xref="GeneID:11497284"
                     /db_xref="InterPro:IPR011658"
                     /db_xref="UniProtKB/TrEMBL:G0WDM7"
                     /translation="MISKKYSLVISSFLLWISVPLFKFSNAQSTIAFCNPFLNPGTST
                     GFNVGLYYYSDLSYGSSYDYTKFVSSSSLYMSGGSSNTITGVTSLTIKVSPSIFTAYM
                     ATVYGKLILANAFVAEATGYFVPPTTGTYTFSLSSSDDVVGFFLDTDKAFNCCGDGTS
                     VPVAPTTLQLFQQTPTTTGSVKLTLTQGVPYPIKYVYLNRQGDGAFNPSFTDPAGTSH
                     TDWTGYIITDTKLASLCPTYPKSTRSSLVPWTGISSLTLSSFTDVVVGTNTATTLEYV
                     YVIRTPSPFSLPTPYTTGATFGTSLVTESISFYRTTDSLGHTFTGSTMTILPDPNYVA
                     PFCNPPKNAVGSDGFNVNFYSYTDANYGSSYDFTYFFTSTEYTKGGSAGTASGVTSPN
                     FAVTGNALFPSGSVYGTTVRRTNFVAELYGYFVPPTSGTYSFVATGADDFVAYFFSDS
                     TSFTCCAGAQPSAFQASNLLFTETYTGAQTNSAIVNLIAGVPYPIGIRYLNRQGDATL
                     NIAFIDPAGVTHTDWSGYIAQASTLNALCPKIPVVTKTRYTTWSGASTITSATSDIIV
                     GSDWLSTGEIIYVIKTPAPFSLPPPYTTTVTSGTLTYSGIVSYYPVSSTNGLTATGRT
                     TSTIPPPFTLPPPYTTTFRSGTQTYSGVVSYYPVSSTNGWTATGRTTSTIPPIFSLPP
                     PYTTTVTNPTTTYSAVVSYYPATSANGWTVTRTTTSTIPPPFSLPPPYTTTVSNPTTT
                     YSAVVSYYPMSSSNGLTATGRTTSTIPPPFSLPPPYTTTVSNPTTTYSAVVSYYPMSS
                     SNGLTATGRTTSTIPPPFSLPPPYTTTVLKSSSTVTELISFYATEDAVGMTITGTTTS
                     TIFASTTTASSSIRASSEVKASSESHTNTASNSKCVSTIPTTIYGSTQYSTRYSYVTV
                     DTITKPKTVSTIATTYLITDNGSVTYTNPITKTNV"
     gene            <250046..>250960
                     /gene="NDAI0G01130"
                     /locus_tag="NDAI_0G01130"
                     /db_xref="GeneID:11497285"
     mRNA            <250046..>250960
                     /gene="NDAI0G01130"
                     /locus_tag="NDAI_0G01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671084.2"
                     /db_xref="GeneID:11497285"
     CDS             250046..250960
                     /gene="NDAI0G01130"
                     /locus_tag="NDAI_0G01130"
                     /inference="similar to DNA sequence:INSDC:YGR106C"
                     /note="similar to Saccharomyces cerevisiae YGR106C;
                     ancestral locus Anc_3.450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671132.2"
                     /db_xref="GeneID:11497285"
                     /db_xref="UniProtKB/TrEMBL:G0WDM8"
                     /translation="MQLNQRIFLALSLIFYNLARLANATASTFTTEHDSKNSVSFISW
                     NSESSSVEDESINEQNIEEFLNDKVSLQNPIVIYQFTNFHLLQQLLQPSSSSYPFLTN
                     FFESGNLQEMQTPSSFEPSMISDDISEKNLTRFNIDTLPSTAGDLLFNNEEIESSSIV
                     WFQFNDDSYDLNTLDEFLESTIIFLNENTSNDCKFNVFLNSLDYADNDEDLKINELAQ
                     LYHKRVSQDIEALKHEELKKKKNNSKEDGKDDDDKLSKIWTEGLIMCLIVSLLLLIIL
                     IMAISWVSDIGISYGALETTTNPLKKNN"
     gene            complement(<251141..>251371)
                     /gene="NDAI0G01140"
                     /locus_tag="NDAI_0G01140"
                     /db_xref="GeneID:11497286"
     mRNA            complement(<251141..>251371)
                     /gene="NDAI0G01140"
                     /locus_tag="NDAI_0G01140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671085.2"
                     /db_xref="GeneID:11497286"
     CDS             complement(251141..251371)
                     /gene="NDAI0G01140"
                     /locus_tag="NDAI_0G01140"
                     /inference="similar to DNA sequence:INSDC:YGR105W"
                     /note="similar to Saccharomyces cerevisiae VMA21
                     (YGR105W); ancestral locus Anc_3.449"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671133.2"
                     /db_xref="GeneID:11497286"
                     /db_xref="InterPro:IPR019013"
                     /db_xref="UniProtKB/TrEMBL:G0WDM9"
                     /translation="MAVDIPKSVVRKLIFFTVAMITLPLVTFFTVQKLTPNTLISGGL
                     AAAMANVVLIAFVIAAFTEDIEVEEINEKKQE"
     gene            <251697..>252503
                     /gene="NDAI0G01150"
                     /locus_tag="NDAI_0G01150"
                     /db_xref="GeneID:11497287"
     mRNA            <251697..>252503
                     /gene="NDAI0G01150"
                     /locus_tag="NDAI_0G01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671086.2"
                     /db_xref="GeneID:11497287"
     CDS             251697..252503
                     /gene="NDAI0G01150"
                     /locus_tag="NDAI_0G01150"
                     /inference="similar to DNA sequence:INSDC:YGR104C"
                     /note="similar to Saccharomyces cerevisiae SRB5 (YGR104C);
                     ancestral locus Anc_3.448"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671134.2"
                     /db_xref="GeneID:11497287"
                     /db_xref="GOA:G0WDN0"
                     /db_xref="InterPro:IPR019095"
                     /db_xref="UniProtKB/TrEMBL:G0WDN0"
                     /translation="MVQQISLFGVIDEESYDLFISTITTLSGTSPILFSRFSTVWKPL
                     SQQYDIDNIDAKNQITEPNRITVSKSIPFNQFQFSSSSDAEYDYKILKSLSDDTIPMD
                     PQEIISIIYKTNAQGSSSSSCSWSLAISDIPAAGANKKVSLQTINESVLLYSTGEKSS
                     LSDTMNALGYNLDYNYVTIGVKFYLKHELIIEVQKIWTINNNNDTANTLQVTKNGYLI
                     KAYVDVNRSTDIDRINYTETLLLNLQRELQGYVDLVIPDRKSMDSRMSYF"
     gene            complement(<252677..>254317)
                     /gene="NDAI0G01160"
                     /locus_tag="NDAI_0G01160"
                     /db_xref="GeneID:11495700"
     mRNA            complement(<252677..>254317)
                     /gene="NDAI0G01160"
                     /locus_tag="NDAI_0G01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671087.2"
                     /db_xref="GeneID:11495700"
     CDS             complement(252677..254317)
                     /gene="NDAI0G01160"
                     /locus_tag="NDAI_0G01160"
                     /inference="similar to DNA sequence:INSDC:YGR103W"
                     /note="similar to Saccharomyces cerevisiae NOP7 (YGR103W);
                     ancestral locus Anc_3.447"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671135.2"
                     /db_xref="GeneID:11495700"
                     /db_xref="GOA:G0WDN1"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR010613"
                     /db_xref="UniProtKB/TrEMBL:G0WDN1"
                     /translation="MHEPVLAKFREHKTFAKKLTRALGRGEVSSAKKLEENRSVYKLD
                     HIIKERYPSFPDAIRDIDDALNMLFLFANLPATNQISARVTKDAQTICNQWLAFVTKE
                     RLVRKVFVSIKGVYYQANVMGEDVRWLVPYKFPENIPSDIDFRIMLTFLEFYSTLLHF
                     VLFKLYTDRGLVYPPKLDSNKDKIISGLSSYILESRMEKNAITSVPAAKENSENDKVQ
                     TLDSKTLKLAMKADDAKVEEEIKDKIEQADNSKDETVENVNLDEFEDVNKNKGDILIQ
                     PTEFNSPVATLFSNFVFYIGREVPIDILEFLILSCGGNIISEAALDQLDNEKNDIDLS
                     KVTHQIVDRPVLKNKIAGRTYIQPQWIFDSINKNELVPANLYLPGETLPPHLSPWSDA
                     LGYDPEAKEEGTEEEEEESESESASESEAEVEDEDEEAAAIIANEDDEDDNDDELKAQ
                     KELELEAKGITYTEATENGEEILDASKDKKKSKKRKISEEEEEKNLKMIMMSNKQRKL
                     YKKMQYSNKQKEDKIENLKKKKKQINKTKAKLQKLNKK"
     gene            <255492..>256055
                     /gene="NDAI0G01170"
                     /locus_tag="NDAI_0G01170"
                     /db_xref="GeneID:11497289"
     mRNA            <255492..>256055
                     /gene="NDAI0G01170"
                     /locus_tag="NDAI_0G01170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671088.2"
                     /db_xref="GeneID:11497289"
     CDS             255492..256055
                     /gene="NDAI0G01170"
                     /locus_tag="NDAI_0G01170"
                     /inference="similar to DNA sequence:INSDC:YGR102C"
                     /note="similar to Saccharomyces cerevisiae YGR102C;
                     ancestral locus Anc_3.446"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671136.2"
                     /db_xref="GeneID:11497289"
                     /db_xref="GOA:G0WDN2"
                     /db_xref="InterPro:IPR027499"
                     /db_xref="UniProtKB/TrEMBL:G0WDN2"
                     /translation="MSLSHITSLLKRRCCCPCYSQLARCYHSSVSKPWIGPVLKSNHE
                     LDQFFNTYNWSVSKYLQDTSSITKDKLPSREVVLKLLKLSGLSSLHADIEAIQYTLAR
                     QLQLISKLHNAPVDTTELDPNHARLFPRENKLLTYETLMKKIECENLEPEEQLDSSNK
                     SWKATDTATISKNGYFIFRHGLLKDRN"
     gene            complement(<256171..>257259)
                     /gene="NDAI0G01180"
                     /locus_tag="NDAI_0G01180"
                     /db_xref="GeneID:11497290"
     mRNA            complement(<256171..>257259)
                     /gene="NDAI0G01180"
                     /locus_tag="NDAI_0G01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671089.2"
                     /db_xref="GeneID:11497290"
     CDS             complement(256171..257259)
                     /gene="NDAI0G01180"
                     /locus_tag="NDAI_0G01180"
                     /inference="similar to DNA sequence:INSDC:YGR101W"
                     /note="similar to Saccharomyces cerevisiae PCP1 (YGR101W);
                     ancestral locus Anc_3.445"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671137.2"
                     /db_xref="GeneID:11497290"
                     /db_xref="GOA:G0WDN3"
                     /db_xref="InterPro:IPR002610"
                     /db_xref="InterPro:IPR022764"
                     /db_xref="UniProtKB/TrEMBL:G0WDN3"
                     /translation="MLPFYSTKLLLRNQGRKFFINNSTISSRQILKSSIPLFNLTSRT
                     KLIPSTTKRSQNILRCTRFYSQRTNLLREWRRRFFPDTDTSDRYIRLNRFQQYNRNND
                     HNSYNNNEDNRIRNITLIGLGSMVGIYFTTPYLFQLPPFNHFKRNPKHLVYTLLGLNL
                     FVFTLWQIPRNWHFLQKYMLLQKSNIQSNWSIIGSAFSHQEFWHLGMNMLALWSFGTT
                     LSTVLGASGFFSLYMNSAIMGSLFSLWYPRIARMGLLVMGPSLGASGALFGVLGCFSY
                     LFPTSKILLFVFPVPGGAWVAFLASVVWNGAGCVLKWGSFDYAAHLGGSLIGVAYGWY
                     IKTKLEKQREERRRRIVRSRGGGGFPWF"
     gene            complement(<257644..>260529)
                     /gene="NDAI0G01190"
                     /locus_tag="NDAI_0G01190"
                     /db_xref="GeneID:11497291"
     mRNA            complement(<257644..>260529)
                     /gene="NDAI0G01190"
                     /locus_tag="NDAI_0G01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671090.2"
                     /db_xref="GeneID:11497291"
     CDS             complement(257644..260529)
                     /gene="NDAI0G01190"
                     /locus_tag="NDAI_0G01190"
                     /inference="similar to DNA sequence:INSDC:YGR100W"
                     /note="similar to Saccharomyces cerevisiae MDR1 (YGR100W);
                     ancestral locus Anc_3.444"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671138.2"
                     /db_xref="GeneID:11497291"
                     /db_xref="GOA:G0WDN4"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:G0WDN4"
                     /translation="MSFFTSLREKTLDKISESFTPVLTRDEKFKLEYKLPPGEAIIDD
                     INADLSFIPAKNAPSTDKNFWEKNTPQEPATAIIFSGKIYLTNHFILFKDIFDQSCST
                     LVLNISTVKRVERSPSESYSSTLLITLYSGSQLLVQFIGLKYRAEQFCDALKKNLKDN
                     IPNAKLLVDFLQTCYSEFLIAKNVLGMKDVKPPSGGLGQHFKYPGNPTLSKEKAKLKL
                     WFEYFKNNGRNMAIWKTHMFQKLIRIGVPNRLRGEIWEISSGSIYLRFANPGFYEKLL
                     IDNAGKSSQAVDEIEKDLKRSLPEYSAYQTELGIKRLRNVLTAYSWKNPDVGYCQAMN
                     IVTAGLLIYMSEEQAFWCLSNLCDIYIPGYYSKTMYGTLLDQRVFEAFVEDKMPVFWD
                     YIVKHDIQLSIVSLPWFLSLFFTSMPLEYAVRIMDIFFLNGAKTLFQVALAVLKINSE
                     DILQADDDGMFIAIIKHYFQNLGESAHPDSPDLKYRQITKFQELLVTAFKEFNVITET
                     MIYQERRKHEKGIMQNIETFVKRTQLRHMPRTFHLTEENLSNIYDIYYDRIETHKISK
                     GTGSSNMVFDVFVQFLSKICDWCKPCENDSDPAFREQKSNFLRKLFNNWDTAKIGELT
                     LNDVVVGIDKLLTPDLLEMVNYFFSLYDEDQDGELHREDVLQMSEGLLLLTEPWKSGR
                     FVDLLTKKSIEDDIADTIVKETITDDRTGVNSTLDQIELPSGVTIDEGKYRAEQAERY
                     LKAASNFLQRSFEYARSLDIAEEVDLIDLSDEDDGDADSAKKEQKKKKYESILANVAL
                     DPTHPKVIDLATFRMIILADETYELFFAQTLRSSIHVDQCIESGANNKALRGMFDGII
                     ADGRRVAEQVRRRVDSVATRNSTTSLESAGNQTVTSINTANTMDRYDDLEDLNSEQQG
                     EHEDLLSNPWLDIPDEDEQEGEVKRQELPINTMTPKEGGNDLIEFEA"
     gene            complement(<260958..>263078)
                     /gene="NDAI0G01200"
                     /locus_tag="NDAI_0G01200"
                     /db_xref="GeneID:11497292"
     mRNA            complement(<260958..>263078)
                     /gene="NDAI0G01200"
                     /locus_tag="NDAI_0G01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671091.2"
                     /db_xref="GeneID:11497292"
     CDS             complement(260958..263078)
                     /gene="NDAI0G01200"
                     /locus_tag="NDAI_0G01200"
                     /inference="similar to DNA sequence:INSDC:YGR099W"
                     /note="similar to Saccharomyces cerevisiae TEL2 (YGR099W);
                     ancestral locus Anc_3.442"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671139.2"
                     /db_xref="GeneID:11497292"
                     /db_xref="InterPro:IPR019337"
                     /db_xref="UniProtKB/TrEMBL:G0WDN5"
                     /translation="MVDIEVLRNHPTDTVINNVFTELLSTTFHGEDRNADLDLGAILL
                     ILQYVVPIYPSLGKDTKQTLQHLLSRSFLFLSQLVSFSASLVQERSTSPRQSNKSLYG
                     KLLIDTLSKEYSCLTNYILFVGRSRLQVNNLKSLFFGSKIFNLISSDIDIIQYIQIMK
                     SQWKSYIDSKGDLQTFSTIDGELLVSSFTLNQILTMDIILGELFLTTTPYLAYFKSIV
                     RSATPLDQQRLINKYLLKFLEPRTNMNNYYVVYAIVSSGLPLNSTIDLDALIALRATV
                     LQEIIVRSLTIESIMKMLPLEIARFGEVNEETDEVICLIFVMFLKFHINKDGAIDIMS
                     HNSDFLDAVTKRLAHKDRIIRERTMFVAKLASRNKLEYESDFTIEIPDLKLNVTASST
                     TDFSLLNEHDGRESDSQSVEVVSAAVGELVLDDGNVSDSDDEDSDDSSNKNINDIVFI
                     KDLVKELEMLDNNNHRNSFIPLLKKSIKLVRQKRHFPLEVEYYCTALLSSITLMNNNF
                     DESQFEGWRVNALVSLLVVVPEKVTELYKLFLNSELSLQQRMSVLTSLGLAARELRGF
                     DDKNIVKPQYDFPTSRLPWDKPSTETNVSLIEDLSGTTEETSLLRQSKTVWKSKKLEK
                     GSKIQEVNRFRKYASLFFFPLAHTWLNGIDMGTFDILFKTHYISTLRIIYTCANPVHD
                     YESMTLLMERIMQQAEAEGVVALV"
     gene            <263427..>268373
                     /gene="NDAI0G01210"
                     /locus_tag="NDAI_0G01210"
                     /db_xref="GeneID:11497293"
     mRNA            <263427..>268373
                     /gene="NDAI0G01210"
                     /locus_tag="NDAI_0G01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671092.2"
                     /db_xref="GeneID:11497293"
     CDS             263427..268373
                     /gene="NDAI0G01210"
                     /locus_tag="NDAI_0G01210"
                     /inference="similar to DNA sequence:INSDC:YGR098C"
                     /note="similar to Saccharomyces cerevisiae ESP1 (YGR098C);
                     ancestral locus Anc_3.441"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671140.2"
                     /db_xref="GeneID:11497293"
                     /db_xref="GOA:G0WDN6"
                     /db_xref="InterPro:IPR005314"
                     /db_xref="UniProtKB/TrEMBL:G0WDN6"
                     /translation="MSKTEDPLNEISRNGSSQAKINSFLTNSGKTNNRNHTSKPVHIY
                     DLKQGKENWPIVISHDIEKNYNLITEFLKESNVQRHRIDQIHDIFTFMYSELVKSHLL
                     RQLQTLSKQHLMLIVKLMNANELEYSQKEIFLLYNATNLIKIEDWEGILLADFNCNNR
                     HYLSTLKILSLQLLLKKKLYVTYHETIIELFSHDDRYLLQDPKLKIHTIIKLVLNMFS
                     VLPNYKILFGLKFLQYIKQFNLSFETYLKNMVQTTFEKQLLNYSVKSFHSCKYFLNSF
                     YLKYSKYNTQLNKIMLRSLIPNVDNIVSNGLFLTELKRNSDFNISCCCFTHDQMNEFV
                     TNVEKFINNKESIQNSAWLTTMNSIWKLVKNENFEKNKRILTIFDKLLNALNSNIIAY
                     KNCENELIPLIETLIQFCNDIQESRRISNIINVLFNCSVVLKNYKFLEMAAKLEILKY
                     LASDNQPDQWKMIATKFEKFISSTSNHEHKLALFSYIFNVYVLTDKFNLPMILDFCQT
                     LFLRCFSRLKLTHFIQFKHCSELMLVIVYSNSSILTIPYQDWSILSQMLFFCINGNFE
                     LTPLDINNNSNKNQYLYHYEVLIKSAYILNIDMKRHSTNNLLLLTRSFIDKWILRLEL
                     SQYKERKDDISSFEVNFVKTLFQYLNFNNFHLLIIELASAIKNIPEYYPSLIMQTEKW
                     LLESYIDLQFNNRIMDLTNNLVQLVQLDLQNAKLDKLLPFLKMKSSLFAWENNPTAFE
                     RLFIKELPTLRPDIFDTTNKSKLSSSQYVEVLLFNINVLNDASKLHMFQHDIASSVIE
                     NKKALKFATALIKKSDKLSQSSRLSLIKSLSTSFINLIEIFVQIGLAKDSDFYTKELS
                     KVISELGEPSAVYACLRYLHTYYKLTEQESHATVTLQKANKTFDYINGEQDIQSLCMF
                     LFDNNECNKIDQSLKLFFGDQIKETFLPQYWKLQMGEQIEEITCLKKFRAAHLINKLN
                     NIYQHALKSLQEDPFFKGLFESILVIPGISQPNMIKKKAPTYKQLHLFHDNDGKNDPL
                     TPVKRKLSLSIYDSPRSSNMTPKGKHMKQKFDKVAAIKNLKIIKEAIENLELQSLRHH
                     ELQKVSSLFSLSLTMLSSINDNLTLDKDFIRALTLADLPKRLPLYYDKILSTVNDGMY
                     RTGNLLPFNPQSMLTSKVELLNDLDPLSFRSNSFTFNIITIDVCSITGNLLLSKIDPV
                     TKKLNHLSIPLNRGNARDLDTLYLSFKDASMELQNIIEESNRSTSFEVTNLIKTKEQR
                     KEWWDLRHELDGRLQTLLQNIEYSWFNGFKGIFDTTKINESAFKDFKEKFYEILHQNL
                     PSRKQLGNPYMFLQIEDWILQAMLKLDPLDKQFLSQMEDLIYCILDILLFHGEENAYD
                     EIDFSLLHIQLEEQIRRYQSKSLHTSNEIDHTFLIVSNSCHSFPWESLSFMKDLSITR
                     VPSLQWLSSTLQKWNKDLFGGILVNERISMILNPYGDLNRTEERFRELFKNIATNRPS
                     SKLLINEKPDENQFLDMLSNSNLFIYVGHGGGEQYIRAREIKKQDNVAPAFLLGCSSA
                     SMKYFGKLEPTGTVHSYLLGGSPMVVGNLWDVTDKDIDKFSQEVFEKVGFVEMNRSNS
                     KPMNVARAVNESRDICHLKYLNGAAPVVFGLPLLFYLE"
     gene            <268699..>269376
                     /gene="NDAI0G01220"
                     /locus_tag="NDAI_0G01220"
                     /db_xref="GeneID:11495710"
     mRNA            <268699..>269376
                     /gene="NDAI0G01220"
                     /locus_tag="NDAI_0G01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671093.2"
                     /db_xref="GeneID:11495710"
     CDS             268699..269376
                     /gene="NDAI0G01220"
                     /locus_tag="NDAI_0G01220"
                     /note="ancestral locus Anc_3.439"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671141.2"
                     /db_xref="GeneID:11495710"
                     /db_xref="GOA:G0WDN7"
                     /db_xref="InterPro:IPR002563"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:G0WDN7"
                     /translation="MFRNITRSQSTFTTTQLRFKDIMSRISHSVMIITSAVPDTETSS
                     SYHGLTISSMTSLSLNPYPRIQFNLQIPSFTSDALHLYKYFAIHVLKPNEYSINLAKQ
                     FSKGSSIRHSNGFERTRPFVGLKEHVDFEKYPLINDKSEKLNIPILSGCERILICKND
                     HVFEVGDHEIWIGKVEDILDDSVKTDAKNHNNTEQDTKNHTKDDGTEGSLLYYNRRFH
                     IIGGHLA"
     gene            complement(<269639..>273268)
                     /gene="NDAI0G01230"
                     /locus_tag="NDAI_0G01230"
                     /db_xref="GeneID:11497295"
     mRNA            complement(<269639..>273268)
                     /gene="NDAI0G01230"
                     /locus_tag="NDAI_0G01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671094.2"
                     /db_xref="GeneID:11497295"
     CDS             complement(269639..273268)
                     /gene="NDAI0G01230"
                     /locus_tag="NDAI_0G01230"
                     /inference="similar to DNA sequence:INSDC:YGR097W,YPR115W"
                     /note="similar to Saccharomyces cerevisiae ASK10 (YGR097W)
                     and YPR115W; ancestral locus Anc_3.438"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671142.2"
                     /db_xref="GeneID:11497295"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="UniProtKB/TrEMBL:G0WDN8"
                     /translation="MSNLNIESDNTNTRNEGQYKNTEDVFSNNMSSSSQYQYPAVSQQ
                     QQPFSDPSSTATSISYSMSDMISPQQFGVKETVLPKTNPKSPYYISVPIPQALLSPND
                     PNAKYKSSDDLEDDQYVKEYPTSIMADRFHKWKKILKGLINYLREVAYAQEQFARINL
                     QLRSSVKFPFLTDIQEGSNKLIDPLTTTKPIKRQQPLTLAEKKKQEEMALYNGSPAPP
                     TQTRSMSAIIDESSMTLNDYQAIKPEEYDDTSATSGFMKFGSGSIQDTQVILKKYHLS
                     LANQQFKISKEITTTLLPKLEELRKDLRIKIQEIKEIHGDFKTNINQHIKLTTQLLNK
                     YMTSIKVMSSISSNHSHHEYQPKHDPYLLKLQLDLQLKRQLSEENYLKDAYINLQTSG
                     MQLEKIIYSKIQHTLQRYSALIDSEARLMIKNLCQELQQGLLSRPPAFEWDHFVAHHP
                     LCLMNWKSNDPVPTPRKISEIIYPNMKSPLAKCIRAGYFLKNDHKSYFILTSNYIHEF
                     KSSNFFNPSLNNSSTTLPLSKNSSDSQSTIQLDQQNQNESLSSSQRHVRHHSTEVYIP
                     GQKKLHHTNSNGLLPLNSISLNDCQVTEATDNHFTIVGKLSENTTTQSSSTTLSGQSL
                     AKPKAANALSKSTQSSSTSLAPHHKYRLPNLLKSTVKSKKDSKVNLNNSSHSMVPLAN
                     ATQGSSNKQETVTWVFKPVSKDLTEEELNHFKKWIQDLKNLTKQKTIKDRSKFIEDRL
                     MKAHNRSKSKIIQYQQSEQQKFSHQQQQQQQQQQQQQASINDYNTNKPQYIQIQNTPA
                     ADMSGFRSKLNTPAIDDNGNLITLNERRYVPSIAMVPSPTISPSGSSQSSNTYSYNLH
                     NQQQMQQQTEQLQKQQQQQQQQQQQQQKYGGMAQNSRPGSAPGSGASTPNPSVMLHQR
                     QISLNNVVMNQTQNITRPLNSPDSYNSESSNGGYFALPVRGQQVGNYSLMNNNNNQSQ
                     ASTPDNQPVQQQYYVNPLSRTSSRGTPASSRHPSQYQVSLNMQQVIPKVKLNNEEMRN
                     ISNPNGLVEDPNVMMATVTPSSQSQVQNSLVNNADQSFDTQPDFPHRTLKKFTSTGSV
                     PQIVHTDSSPNLSSPSNWGINNGSLPTTTASSSAAASMYQRSNHSAQNLTTPTSNSAN
                     PTGTMQRIHPVRKHKKNVSFSSLNSLMFSKKAPNISSQFMGSGGIQEDDGDSDSIKLT
                     RSIYS"
     gene            complement(<274097..>275080)
                     /gene="NDAI0G01240"
                     /locus_tag="NDAI_0G01240"
                     /db_xref="GeneID:11497296"
     mRNA            complement(<274097..>275080)
                     /gene="NDAI0G01240"
                     /locus_tag="NDAI_0G01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671095.2"
                     /db_xref="GeneID:11497296"
     CDS             complement(274097..275080)
                     /gene="NDAI0G01240"
                     /locus_tag="NDAI_0G01240"
                     /inference="similar to DNA sequence:INSDC:YGR096W"
                     /note="similar to Saccharomyces cerevisiae TPC1 (YGR096W);
                     ancestral locus Anc_3.435"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671143.2"
                     /db_xref="GeneID:11497296"
                     /db_xref="GOA:G0WDN9"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G0WDN9"
                     /translation="MARDLNHRTVHVDHLRKGEDVLVSNSLIAGSLSGLIARSVIAPL
                     DTLKIRLQIVPLEQQQKQASKITSVARYQSRSLMMIKQMIQKEGIRSFWKGNVPGSAM
                     YIVYGGVQFGSYSLYNNILGSKMSWNAQLNGLFIGALAGMSSSFCSYPFDVLRTRFVA
                     NRTLQSSNINLKIQEIWTHEGVQGFFRGCSWSMFTISLSASILFGCYETLKVYGESHD
                     NKFILGSASSISGVLSKVVVFPLDTIRRRIQLRSAASLQDVVNSEHMVETYKKYHGMG
                     FIQMGNYILRQEGLASLYRGVTMALCKSVPSTIVSLWSYEAVLRLLPSSNN"
     gene            <275415..>276092
                     /gene="NDAI0G01250"
                     /locus_tag="NDAI_0G01250"
                     /db_xref="GeneID:11497297"
     mRNA            <275415..>276092
                     /gene="NDAI0G01250"
                     /locus_tag="NDAI_0G01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671096.2"
                     /db_xref="GeneID:11497297"
     CDS             275415..276092
                     /gene="NDAI0G01250"
                     /locus_tag="NDAI_0G01250"
                     /inference="similar to DNA sequence:INSDC:YGR095C"
                     /note="similar to Saccharomyces cerevisiae RRP46
                     (YGR095C); ancestral locus Anc_3.434"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671144.2"
                     /db_xref="GeneID:11497297"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027408"
                     /db_xref="UniProtKB/TrEMBL:G0WDP0"
                     /translation="MSFQAETGILTQVDGSSQIQSQKTKIFCSVTGPIEPKARQELPT
                     QLALEIIVRPSLGVPNTREKLIEDKLRAVFTPLITRYLYPRQLCQITLQILSSGESEQ
                     EFTQREVANSINATLLALIDAGIALNSMCAAISLAISSDDKLIMDPNDEQLKAAKSVH
                     VLALELVESSTVVKNVLLLDSYGDFNEKQLFDILEQGEISLLKLGKEIRSIVESKIIN
                     SNLIIQK"
     gene            complement(<276187..>279246)
                     /gene="NDAI0G01260"
                     /locus_tag="NDAI_0G01260"
                     /db_xref="GeneID:11497298"
     mRNA            complement(<276187..>279246)
                     /gene="NDAI0G01260"
                     /locus_tag="NDAI_0G01260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671097.2"
                     /db_xref="GeneID:11497298"
     CDS             complement(276187..279246)
                     /gene="NDAI0G01260"
                     /locus_tag="NDAI_0G01260"
                     /inference="similar to DNA sequence:INSDC:YGR094W"
                     /note="similar to Saccharomyces cerevisiae VAS1 (YGR094W);
                     ancestral locus Anc_3.433"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671145.2"
                     /db_xref="GeneID:11497298"
                     /db_xref="GOA:G0WDP1"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002303"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR010978"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR019499"
                     /db_xref="UniProtKB/TrEMBL:G0WDP1"
                     /translation="MLQSYTRIPIRRPVNPSTLIRALNQCYPYSTSNSYNHIIPPPPT
                     LKPFPKAYNPELVEQKWYDWWLQTRAFEPEFTADGKIKPEGLFCIPAPPPNITGALHI
                     GHALTISIQDSLVRYYRMKGKTVLFLPGFDHAGIATQSVVEKQIWRQERKTKYDYGRE
                     EFVKKVWDWKEIYHEKIKNQVKQLGASYDWIREAFTLDPKLSSAVVEAFVRLHDEGVI
                     YRALRLVNWSTKLSTTISNLEVDNRIIPGRTLIPVPGYEKKIEFGVLTYFAYRVAGSN
                     NGEQLIVATTRPETIHGDTAVAIHPDDPRYIHLHGKSVQHPFLDKKLPIILDDKIVDM
                     GFGTGAVKITPGHDFNDYEVSTRHDIDVVNILTEDGKLNSNCGPKWAGMKRFDAREKI
                     IEDLKELGLFIKQEGHEMTIPICSRSGDIIEPMLKPQWWVSQKQLAKDAMDVIKKGEI
                     KMWSNRTKSEYLRWLENIHDWCISRQLWWGHRCPVYFVNIENKDNSREDGNYWIAGRS
                     HDEALIKAKKKFPSEKFTLEQDEDVLDTWFSSALWPFSTLGWPQKTKDMEQFYPFSIL
                     ETGWDILFFWVTRMILLGIKLTGSVPFKEVYCHSLIRDSQGRKMSKSLGNVIDPLDII
                     HGVTLKELNAKTVNSNLSEKEVKRVIREQQKIYSRGIPQCGTDALRFTLCAYTTGARD
                     INLDLLRVEGYRRFCNKIYQATNFAISRLNNNYIPKLNNKNLTECHRLVEKWSLYQMN
                     NCAKVMNESFEERNFLTGTTAIYQYWYMICDVYIEYFKSLHHTNDAIKMDLAKDVLYE
                     LIKNGLKMIHPFMPYISEELWQRITRNGEFEKCVTITKASYPIYDPTIANYFADAQIY
                     DVILNTTKAIRSLLSEYNIIKNGQIYISVQDDDETTSAFVMEKEALVSMIKGLSDIAI
                     LSNSSENIVLNDCVMKSVNDKVKIYLLVKGQYEDIRKEIEKNQKKLKKLEGIKENLKR
                     TLSNSEFLKKATMEVQRINKEKLTNIQGQILGLQTTVNNLKRFQDDR"
     gene            complement(<279788..>281341)
                     /gene="NDAI0G01270"
                     /locus_tag="NDAI_0G01270"
                     /db_xref="GeneID:11497299"
     mRNA            complement(<279788..>281341)
                     /gene="NDAI0G01270"
                     /locus_tag="NDAI_0G01270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671098.2"
                     /db_xref="GeneID:11497299"
     CDS             complement(279788..281341)
                     /gene="NDAI0G01270"
                     /locus_tag="NDAI_0G01270"
                     /inference="similar to DNA sequence:INSDC:YGR093W"
                     /note="similar to Saccharomyces cerevisiae YGR093W;
                     ancestral locus Anc_3.431"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671146.2"
                     /db_xref="GeneID:11497299"
                     /db_xref="InterPro:IPR006767"
                     /db_xref="InterPro:IPR006768"
                     /db_xref="UniProtKB/TrEMBL:G0WDP2"
                     /translation="MAESKILVVHANKNNAEAVFQKLRKLNIKSGPFANIFVLGDIQS
                     IIPDIDIEGLSTIFTISSGNDDRTNEIKTNLIELNGFGVYELSNKLRIGYIGLNESQL
                     KEQNTEINEKFNKVKQPVDIFITREWSMDIAKLKGKLSGNKTIDAIAKKLQPKYHFTY
                     SDPVAFFELDPFKWDSSERITRFINIAEFGSPAKWAYAFNIKIQSEDDDEDDDDESVP
                     DNLISNPYETMPSKKRPLEKEIEDANKGLDRKSALVKKARTVLPSSCHFCFTNPNLED
                     HMILSISNNAYVTIAKGPLTVPHGEMDFSGHCLIIPIEHIPKLNFKIDSSTTSTDTAT
                     NNIFASPLALDFQTYERSLVSMNYKKFDMCTIVFEINSDRSIHFHKQVLPIPKYLIMK
                     FQEALDRQVYINNEKFTRNRKLELETFESSLDEKYMELVNDSSSNYLQFTVYETPETD
                     PKIYVARFNSEDRIDLQFGRRVIAFLLRLPKRVKWDSQICQQTKEQEIKEVEKFQKAY
                     KDYDTSESK"
     gene            complement(<281834..>283573)
                     /gene="NDAI0G01280"
                     /locus_tag="NDAI_0G01280"
                     /db_xref="GeneID:11497300"
     mRNA            complement(<281834..>283573)
                     /gene="NDAI0G01280"
                     /locus_tag="NDAI_0G01280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671099.2"
                     /db_xref="GeneID:11497300"
     CDS             complement(281834..283573)
                     /gene="NDAI0G01280"
                     /locus_tag="NDAI_0G01280"
                     /inference="similar to DNA sequence:INSDC:YGR092W,YPR111W"
                     /note="similar to Saccharomyces cerevisiae DBF2 (YGR092W)
                     and DBF20 (YPR111W); ancestral locus Anc_3.430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671147.2"
                     /db_xref="GeneID:11497300"
                     /db_xref="GOA:G0WDP3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:G0WDP3"
                     /translation="MLPISEKKIDTLTGNMNQLSFDTTTDSQQYNGPGNAVNTRNILS
                     TPSKYRGNRMQGSPRNPNVSLYGNGNGEDSKMDIDGISLDGVDISKSPKKLPNGFYEK
                     AAHNNTQRVVSVCKMYFLDYYCDMFDYVISRRQRTKKVLEYLEHKRAQNMSDQTLNME
                     WNGYIQQEHDVLRKRRLKPKHKDFEMITQVGQGGYGQVYLARKRDTNEVCALKILNKK
                     LLFKLNETNHVLTERDILTTTRSEWLVKLLYAFQDTQSLYLAMEFVPGGDFRTLLINT
                     RYLKSAHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAKGHIKLTDFGLAAGTIS
                     NERIHSMKIRLEEVKNLEFPAFKEKSIEDRRKIYHKLRENEVNYANSMVGSPDYMALE
                     VLEGKKYDFTVDYWSLGCMLFESLVSYTPFSGSTTNETYENLRQWKRTLRRPRLDNGR
                     PAFSDRTWDFITRLIADPLNRLRSFEHVKRMAYFADIDFNTLRQISPPFIPQLDNEVD
                     AGYFDDFTNEADMAKYADVFKRQNKLSAMVDDSAVDSKLVGFTFRHRNGKQGSSGILF
                     NGMEHSDPFATFY"
     gene            complement(<284145..>285635)
                     /gene="NDAI0G01290"
                     /locus_tag="NDAI_0G01290"
                     /db_xref="GeneID:11497301"
     mRNA            complement(<284145..>285635)
                     /gene="NDAI0G01290"
                     /locus_tag="NDAI_0G01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671100.2"
                     /db_xref="GeneID:11497301"
     CDS             complement(284145..285635)
                     /gene="NDAI0G01290"
                     /locus_tag="NDAI_0G01290"
                     /inference="similar to DNA sequence:INSDC:YGR091W"
                     /note="similar to Saccharomyces cerevisiae PRP31
                     (YGR091W); ancestral locus Anc_3.429"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671148.2"
                     /db_xref="GeneID:11497301"
                     /db_xref="GOA:G0WDP4"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR012976"
                     /db_xref="InterPro:IPR019175"
                     /db_xref="InterPro:IPR027105"
                     /db_xref="UniProtKB/TrEMBL:G0WDP4"
                     /translation="MSDLGEDEEDFLNDLEADLGGDVDEVDSEEQDEEAVIDVPIIGK
                     DVAEEEDDLQFLDSLVRKFTPVISANSLFEKQHVETLSIIYEKHQRINSIISSQNIQF
                     SSLLPRLNEITHIIKHELQKIYHYLRFLYSKKFNELDTITSSQLQYARIVKIFESHQD
                     LSSGELNNLFENEAKLTKEQIIVLNISMKSSFDISFKLDHQKQKEILKSTDMITTLSA
                     LQELITHYITSNISHIAPNLCALIGSQIAALLISHAGSILDLSQIPSCNLASIGKSKH
                     QSHELHTSLSGVRQEGYIYDCDLIQDQPSENHKQMLRMVCAKASLAARVDAGSKTHKG
                     DGTLGQNWKNELLEKIQKLKEPPNQSAVKPLPIPEDKPKKKRAGRKFRKYKQQFELSH
                     LRQLQNRMEFGNQEQTTLDAFGEEIGMGMATSSVQNAMGSASLKGLSVNNSAKMTKVM
                     KRRLKDAEYQSNAYMVSLTSDNVDNPEFKKQKPNNDTDTDWYSHHR"
     gene            complement(<286003..>289686)
                     /gene="NDAI0G01300"
                     /locus_tag="NDAI_0G01300"
                     /db_xref="GeneID:11497302"
     mRNA            complement(<286003..>289686)
                     /gene="NDAI0G01300"
                     /locus_tag="NDAI_0G01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671101.2"
                     /db_xref="GeneID:11497302"
     CDS             complement(286003..289686)
                     /gene="NDAI0G01300"
                     /locus_tag="NDAI_0G01300"
                     /inference="similar to DNA sequence:INSDC:YGR090W"
                     /note="similar to Saccharomyces cerevisiae UTP22
                     (YGR090W); ancestral locus Anc_3.426"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671149.2"
                     /db_xref="GeneID:11497302"
                     /db_xref="InterPro:IPR005554"
                     /db_xref="UniProtKB/TrEMBL:G0WDP5"
                     /translation="MTGIKRKVSEITEPESPYSKKALIEQVETGVTEPKQNEPEKEES
                     KSDDEEEEEEEEEVTANKVKNGPTSGSTASQDIHIARETAELFQSNIFKLQIDELLEQ
                     VKLKESHVLKVEKFLHKLYDMIQQVPEWEEKTITEVESFFKGKIVAVPFVDPKPTPAS
                     THYKFNYKKPDVSLIGSFALKTGIYQPKGSSIDVLLTMPETLFEKKDFLNFRALHKRS
                     VYLAYLTHHLSIALKNEKLDGYLSVEYTYFNDDPLLPILKISCDKAPTSQANEEYNFY
                     KTKFSINLIIGFPHKMFDAKKLLPNKNCIRVVQDENTKELPATPLYNFAVLSSTTYEV
                     YLKYLYKTKKQTVSFKEATNLGRLWLQQRGFSSSSGHSKMTGGFGTFEFVTLMAALLN
                     GGGINGNKILLHGFSSYQLFKGVIKYLATMDLCTDGYLQFYSEPEEDSTTRVSKYIEE
                     GFQIPTLFDMSTKVNILTKMSIASYQALKLYAKHTLAMLNNVVQDQFANIFLTNISRV
                     DNLKFDLCYDLHLPLGNSTHTDSLLASAFGPLERIKFITIENFLVNKLLNVVKIALGE
                     RITLAEVELVDSKSSFPINKRKVHSTSGENHFNFDYIKLKLLVNPEESEKLVTKGPAH
                     SEEASPEATFFKNFWGPKSSLRRFKDGSITHCCIWTTSSSEPIISNVLDFVLKKHISE
                     KLIIQNPITKQFQDILPLPNLPASTNTSVLNLNSYFNLKKSFDNLYKIMFKMNLPLSI
                     KSILPVGSAFRYTSLCQPVPFAYSNPDFFQELILEFESSQRWPDEITSLEKAKTAFLL
                     KMQEQLQAENGNQYKSFFTRDESIPYNLEIVTLNILTPEGYGFRIRVLTERDEVLYLR
                     AISNARNEIKPELEKTFLKFTAKYLASIRHTRTIENISHSYHFYSPVVRLFKKWLDTH
                     LLFGHLPEELVELIAMKPFVDCSPYNIPGSVENGFLKILKFISQWNWKEDPLILDLVK
                     PEDKLEDSLETSIGGSDLDSKTMKKLSEKLTLAQYKGIQTNFNNLRNSDPNGIHLQFF
                     VASKNDPSGLLYSSDIPLAIATRLTALAKVATNLLHTHGINEQTIGLLFTPGLKDYDF
                     VVHLKTPVPLKTSSGILGSSEFRNIANDQAPTAFPSDLAALSEKMDPTFQLMKYLNMK
                     YKNSLIFSSHRYIGVCGGNKGNKNVITGLIKPLFKKSHKFKVNLDCNMKPIDKENVIL
                     NKEAIFQEISAFGHELVVDFETN"
     gene            complement(290145..290216)
                     /gene="NDAI0Ltrna5T"
                     /locus_tag="NDAI_0Ltrna5T"
                     /db_xref="GeneID:11498231"
     tRNA            complement(290145..290216)
                     /gene="NDAI0Ltrna5T"
                     /locus_tag="NDAI_0Ltrna5T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACA"
                     /db_xref="GeneID:11498231"
     gene            complement(<290871..>293945)
                     /gene="NDAI0G01310"
                     /locus_tag="NDAI_0G01310"
                     /db_xref="GeneID:11497303"
     mRNA            complement(<290871..>293945)
                     /gene="NDAI0G01310"
                     /locus_tag="NDAI_0G01310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671102.2"
                     /db_xref="GeneID:11497303"
     CDS             complement(290871..293945)
                     /gene="NDAI0G01310"
                     /locus_tag="NDAI_0G01310"
                     /inference="similar to DNA sequence:INSDC:YGR089W"
                     /note="similar to Saccharomyces cerevisiae NNF2 (YGR089W);
                     ancestral locus Anc_3.425"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671150.2"
                     /db_xref="GeneID:11497303"
                     /db_xref="UniProtKB/TrEMBL:G0WDP6"
                     /translation="MIAVQRDSQPLAFAKRHRFKDTLALFIVFLSFNHFNSLCLLVSF
                     VVATKCRNFIANCFITLFLNKLPSPSIAKVAHLEPENDTKHNTASTTITTIPYSTNST
                     GYDNCTGIAPQLVQQQGKRPIRHVSGQSISSIAPLSTTSTVTTTNSTSSSSSSSATIM
                     PSFTVKYTKNLFLPVIAAELILASLLQVYGGNYFIHPIENLSMSIIASFLINDPADCL
                     NYATSCSVLYALVTNIYQRLTPFANLETVNHFNTELLTVFHLNSLFSAKDFQGNYRMT
                     PSVSLKLYSILKKLLSMIFNPNWTKNVLLEKYIKYLCYYISFHIVISQFCQSLKNPYN
                     PYTNSNNNNNNNNNNNNIITSHSLLNTNTGINTNTDERKTGSRQLGGPNRISLSKNEL
                     NRSSGSQRIPSTGSTRNVSSNADANNNTITINGNNMNYVNNNNNTIPFPEANQKNNNI
                     KTNSFEVSENSTPHFSNAIIECKKFDPVTTFASNSNIQAVMTTSDQKVTPNTTTSMAT
                     KYKSIASKTPNNTMNPEVENTFTNQLFELKVDLNNLTESSNLKTDVNVTTNLENFIRH
                     LFKRKNQHLIPPLWSIVVTLKTTNFEKKYLNETSNNSNNFNATLTNSNDLSTTLSNET
                     NNINNDIIMTRKSVFNNFEQANTMALIAQTTSDDYDQLNLISTRTNIFNKNENDYKVC
                     IIDIGTHSIIFHIENLYDGELIVLVNGLIWTEVSCALILESVGEEYVVVSGLVPSCSY
                     DIQFVNRLNQTDDYLISDLMIRTNAINNNNHTTTNATDEDISEIFQNLDFSFPSYYHR
                     KFLSPLLTLKHSVLTTNANLADERSKLKKTKKEINKKLNSTRQEIDHFKDRIEQNATN
                     DEKNTLKVDNLKIALQQNEKSFKHLEKEFKELTDKEISLEDEYLQKKDDHLKKELEYS
                     KIEENLKKELEIVQKKETKLTNEFNQLSSKREKLLVRHEKLKKELDENDEMIKIFKEQ
                     FLTKKIQERSKREEFRMRELNNYELNIKGLEQDISRLEAENEHIQKLLQGYP"
     gene            complement(<294808..>296532)
                     /gene="NDAI0G01320"
                     /locus_tag="NDAI_0G01320"
                     /db_xref="GeneID:11497304"
     mRNA            complement(<294808..>296532)
                     /gene="NDAI0G01320"
                     /locus_tag="NDAI_0G01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671103.2"
                     /db_xref="GeneID:11497304"
     CDS             complement(294808..296532)
                     /gene="NDAI0G01320"
                     /locus_tag="NDAI_0G01320"
                     /inference="similar to DNA sequence:INSDC:YGR088W"
                     /note="similar to Saccharomyces cerevisiae CTT1 (YGR088W);
                     ancestral locus Anc_3.424"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671151.2"
                     /db_xref="GeneID:11497304"
                     /db_xref="GOA:G0WDP7"
                     /db_xref="InterPro:IPR002226"
                     /db_xref="InterPro:IPR010582"
                     /db_xref="InterPro:IPR011614"
                     /db_xref="InterPro:IPR018028"
                     /db_xref="InterPro:IPR020835"
                     /db_xref="InterPro:IPR024708"
                     /db_xref="InterPro:IPR024711"
                     /db_xref="UniProtKB/TrEMBL:G0WDP7"
                     /translation="MFDDKSKKLEKPTVYALENGVAYPHHPYSSQYSRPDGPLLLQDI
                     NLIETLAHFDRERVPERVVHAHGGGCRVEFELTDSLSDITFAKPYQEVGYKFPGVVRF
                     STVGGEKGSADTVRDPRGASFKFYTPWGNHDWVFNNTPVFFIKDALKFPHFIHSQKRH
                     PQTNLNAASDSSMYWDYLTQNPESIHQVTYMFGDRGIPKNWAEMSSYSGHAFKFINRK
                     GEITYVQIHVKPEKDFTTLSVEEGNELAGSNPNYNQEKLYEQVASGTAPKLECFIQTM
                     TPKQAELFRYSINDLTKIWPHKDFPLRKFGEIRFTENVENFFEEIEQIAFSPSNTCIP
                     GIEPSNDPVLQSRLFSYPDTQRHRLGGNYNQLPVNRPRNVVCPVTGKRMAGNGGVGSL
                     NGTPLECPYNPANYHRDGTATLYNYGNQPNFISTLPSANMKFANLTLDDDKVEDSKYQ
                     GVVLEDAVKADVKKQEEKFLEHENVINNKINSYTYVNGVSPLDFEQPRALYENVFNDD
                     DKKTFVKNVVDHASTCKTEIVKVRVAQYFGLLNKDLGSQIAEGLKVPWKPVDFEGYAK
                     AIGMAPPS"
     gene            <299502..>300614
                     /gene="NDAI0G01330"
                     /locus_tag="NDAI_0G01330"
                     /db_xref="GeneID:11497305"
     mRNA            <299502..>300614
                     /gene="NDAI0G01330"
                     /locus_tag="NDAI_0G01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671104.2"
                     /db_xref="GeneID:11497305"
     CDS             299502..300614
                     /gene="NDAI0G01330"
                     /locus_tag="NDAI_0G01330"
                     /inference="similar to DNA sequence:INSDC:YGR086C"
                     /note="similar to Saccharomyces cerevisiae PIL1 (YGR086C);
                     ancestral locus Anc_3.420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671152.2"
                     /db_xref="GeneID:11497305"
                     /db_xref="InterPro:IPR028245"
                     /db_xref="UniProtKB/TrEMBL:G0WDP8"
                     /translation="MHRTYSLRNSRAPTAAQLQSPPPPTSSTKSRFFGKGGIAYNFRT
                     KTAGSFGPELSRKLSQLVKIEKNVLRSLEIASNERRDAAKQLSVWGLENDDDVSDITD
                     KLGVLIYEVSELDDQFIDRYDQYRLTMKSIRDIEGSVQPSRDRKDKITDKIAYLKYKD
                     PQSTKIEVLEQELVRAEAESLVAEAQLSNITRSKLRAAFNYQFDSIIEHSEKIALIAG
                     YGKALLELLDDSPVTPGETRPAYDGYEASKQIIIDAESALNEWTLDSAQVKPTLSFKQ
                     DYEDYEEEEDDEGQEPQIPEEEEEEEEEEEEEMEDQGQEQSIVEDNLDSHPSQLDPEQ
                     QQQTWSEEEVDEEHDLQESLQEGEHEQVHEAAVSNI"
     gene            <301254..>302261
                     /gene="NDAI0G01340"
                     /locus_tag="NDAI_0G01340"
                     /db_xref="GeneID:11497306"
     mRNA            <301254..>302261
                     /gene="NDAI0G01340"
                     /locus_tag="NDAI_0G01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671105.2"
                     /db_xref="GeneID:11497306"
     CDS             301254..302261
                     /gene="NDAI0G01340"
                     /locus_tag="NDAI_0G01340"
                     /inference="similar to DNA sequence:INSDC:YNL326C"
                     /note="similar to Saccharomyces cerevisiae PFA3 (YNL326C);
                     ancestral locus Anc_3.12"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671153.2"
                     /db_xref="GeneID:11497306"
                     /db_xref="GOA:G0WDP9"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:G0WDP9"
                     /translation="MQGGTWSTISTLFPRCLTTFLFLWTSYVIITRINTIPTIPPHDI
                     DITINLYFHIFIFQNHNNGTRKSIRLPRSISRKIYMMQDLVKNYHHNILTKKSYTMKR
                     NGRYRLCQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLIYCT
                     IYAFVALGLISYQFVNWYKNQNYMNEYIDFTLLIVGLLAFVISISVLAFSSFSIYQVL
                     KNRTTIEMYGIRRYNRDFAILNGTEESDFKNIFELDSNLLNWKEVMGDSWIEWIFPIV
                     TFKISRNRHSTDEKGLYFNINSHARREMLDSIDLQDRLLRRVTPRSSVESTRPLIIDD
                     I"
     gene            complement(<302708..>305203)
                     /gene="NDAI0G01350"
                     /locus_tag="NDAI_0G01350"
                     /db_xref="GeneID:11497307"
     mRNA            complement(<302708..>305203)
                     /gene="NDAI0G01350"
                     /locus_tag="NDAI_0G01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671106.2"
                     /db_xref="GeneID:11497307"
     CDS             complement(302708..305203)
                     /gene="NDAI0G01350"
                     /locus_tag="NDAI_0G01350"
                     /inference="similar to DNA sequence:INSDC:YNL327W"
                     /note="similar to Saccharomyces cerevisiae EGT2 (YNL327W);
                     ancestral locus Anc_3.11"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671154.2"
                     /db_xref="GeneID:11497307"
                     /db_xref="UniProtKB/TrEMBL:G0WDQ0"
                     /translation="MVSLINILLTATTAFASTTKYFTNTTTIIPSSPKPFFSDIQLKD
                     AYSMTTNCTDPNHWFLVQAELFVPQGSKNDIYMTLPEQFGSFPTESFNLLHNSDKIGS
                     VMGNSSNIFTISFDQDKTNDNNLTATFNFLTRLSAEYQLEISNPQSISFSFQSSNGEP
                     QNKTINFIPSEISTINTNGGIDTVNKTAWFTIDIPIETFLQPVYFIAQPSNIENNSFQ
                     YNTALTTIEIVSTVGSFNQPITSVPFSAFKDQSVGSQIKIFFNTKINGGKYLRIKYFT
                     DVISTNMISNSVHFTYPNSSISSNSYAKRDEISEISTTNLYGDSIANVDLANDETSNT
                     FLQNEIFETYRLESTIRSAIVTEYGTYIPIATLNQNSSSGTSITTTSTSQFSSSLLNS
                     SSILLSSLTSSKASTSNSLSSSRNLSSTLRTKIVSSSSSNITTSTYILSSSVQSTLNS
                     SSASSSSIPTLTYISSKSAYSIQNSSYAPSTSSSSSTPIPTSSNITAITKESSRTYLN
                     SSSFPTSKSFYVSTTILSSLPLSSNTSKIYPITTNSTTSKTSERISTLYDTNILYSLI
                     TSKQSEELGYVTKLFPIETLKNKTTTSIKIQTTSCPGGCSHITTKTALLEDIFTNQTK
                     ITSTIPAQVTTLISLLGHNTKTITRTSCSKGCSKQEIKTSQIQDIFTNKTEITSTYQP
                     QVTTLLSLIGHNTKTITKKTSCSDSSGSTGQRIKTTQIEDISIGNSKTTLSITPEVTE
                     IVSLLGHSSLIKTSSIVETITSSSLLNQPVQAQVTSITSLLGQSTLSTRKTTTIYTAT
                     TSSMAHVTIMEGSGNHLTIAFSGLFIMFFSLLF"
     gene            <306043..>306477
                     /gene="NDAI0G01360"
                     /locus_tag="NDAI_0G01360"
                     /db_xref="GeneID:11495689"
     mRNA            <306043..>306477
                     /gene="NDAI0G01360"
                     /locus_tag="NDAI_0G01360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671107.2"
                     /db_xref="GeneID:11495689"
     CDS             306043..306477
                     /gene="NDAI0G01360"
                     /locus_tag="NDAI_0G01360"
                     /inference="similar to DNA sequence:INSDC:YNL328C"
                     /note="similar to Saccharomyces cerevisiae MDJ2 (YNL328C);
                     ancestral locus Anc_3.10"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671155.2"
                     /db_xref="GeneID:11495689"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:G0WDQ1"
                     /translation="MVLPLIIGSGVTIVALTLRSGLRAWTIYKSLSPITIARMNNIRI
                     QQSQIQYPWKFQSTQLPSDLKRQLDQYQGGFYERMSEPEALLILNISAKEVNHLDEKF
                     LNKKHRKAMYMNHPDKGGSPYLAIKINEAKDVLMHSVLLRKR"
     gene            <306715..>309921
                     /gene="NDAI0G01370"
                     /locus_tag="NDAI_0G01370"
                     /db_xref="GeneID:11497309"
     mRNA            <306715..>309921
                     /gene="NDAI0G01370"
                     /locus_tag="NDAI_0G01370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671108.2"
                     /db_xref="GeneID:11497309"
     CDS             306715..309921
                     /gene="NDAI0G01370"
                     /locus_tag="NDAI_0G01370"
                     /inference="similar to DNA sequence:INSDC:YNL329C"
                     /note="similar to Saccharomyces cerevisiae PEX6 (YNL329C);
                     ancestral locus Anc_3.9"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671156.2"
                     /db_xref="GeneID:11497309"
                     /db_xref="GOA:G0WDQ2"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WDQ2"
                     /translation="MLQASLLFDFTNQCGQCEVSGDVFHEWSKQNISTMQTYASIELP
                     SYTYETKRFVVYCTLNESLNRNTIKIPAKLARVFTKTPAIESCSFVHHHDLQPPTLET
                     VSILLKSTLYAKLMKLNSSREKLEFLRLKYHIEDMKTVIHSHDILDYSLCEVLTCSPF
                     SQGVIDFNETQIIFVSSSDKKNNQLCATPNNIPIKALSLSKSQNTNLIVKLQCLMKSI
                     PRELMIPTPSSTDDDSLFAFTDVQTFINLNITSGSFVKLSQIVGNNYQENATSCIVRL
                     FLLLEPNDFKTNRIIYISPRICSNFPNDNTIKITPYDSFNINKVPVATKVSISRVGSW
                     NNSQKLYQNIIFNNLKIFFLSKKRILQIGDLLPITFDSNFALLLNDTNDDDHDDDDDG
                     DDGADIDNDDQQEVDSLVWFRIENVEFQDYKPDSTNAKVQFVIDPLQTKLSTSKFIKY
                     PKLPLSKYEYKRFFNLPSIFPYDQGSIFPYAKQLSDILESSLFYAEKDIPMNISILLY
                     SNHPNVGKKTLVKHTADWLGFHLLEIDCSSLPLNNGSLDSTNKILGSIRAKIENVLSY
                     TTSTIITLSNLEYILSKTDPNQDPESTKLSQTMDLGINEIINHFTTNFKGVVFIIIMN
                     NIDILPQNIRTKLKFEYLIPVPNEDQRLAIFQWYLTQEQLNNQKNKNSYKFKLSNNVN
                     VSNLALHSASLTPLAIKSIVQTAKYKALKDRQEEENTDTGMIMWDNNYIFITMEHLQY
                     AMDQAREGFSMSIGAPKIPKVTWDDIGGVELIKDEIMDTIDMPLRHPELFATGMKKRS
                     GILFYGPPGTGKTLMAKAIASNFSLNFFSVKGPELLNMYIGESEANVRKVFQRARDAK
                     PCVIFFDEIDSVAPKRGNQGDSGGVMDRIVSQLLAELDGMSTGDDGIFIIGATNRPDL
                     LDEALLRPGRFDKLLYLGVPDTNEKQLNILKALTRKFTLHENVKLPILADKCPFNYTG
                     ADFYALCSDSMLNAMTRIASEIDEKVETYNKENGKGISIRYWFDNVATEEDTNVIVNM
                     EDFIKAIKELKPSVSQDELDHYLSIKQNFEGASPSPSY"
     gene            complement(<310025..>310657)
                     /gene="NDAI0G01380"
                     /locus_tag="NDAI_0G01380"
                     /db_xref="GeneID:11497310"
     mRNA            complement(<310025..>310657)
                     /gene="NDAI0G01380"
                     /locus_tag="NDAI_0G01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671109.2"
                     /db_xref="GeneID:11497310"
     CDS             complement(310025..310657)
                     /gene="NDAI0G01380"
                     /locus_tag="NDAI_0G01380"
                     /inference="similar to DNA sequence:INSDC:YOL146W"
                     /note="similar to Saccharomyces cerevisiae PSF3 (YOL146W);
                     ancestral locus Anc_3.4"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671157.2"
                     /db_xref="GeneID:11497310"
                     /db_xref="GOA:G0WDQ3"
                     /db_xref="InterPro:IPR010492"
                     /db_xref="InterPro:IPR021151"
                     /db_xref="UniProtKB/TrEMBL:G0WDQ3"
                     /translation="MGYYDIDDILADSVEIPCKFQHDIPGLGYLENNPGKPISKNAKL
                     DLPIWLARILAIVGGDANPDTMEDEEPLPFVELLTPDMFSPKVINAIKADPASLDLHA
                     INSYFYSLATKWITLFNDKQLAEVVHNLLLERSQIINKYAGSVPVDLFHSSTDIGSGK
                     KTGHSSHGGNSSMVRVSNSTFLLTLDEFEKKIYKKSHESYKDTKRWMFEK"
     gene            <310886..>311662
                     /gene="NDAI0G01390"
                     /locus_tag="NDAI_0G01390"
                     /db_xref="GeneID:11497311"
     mRNA            <310886..>311662
                     /gene="NDAI0G01390"
                     /locus_tag="NDAI_0G01390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671110.2"
                     /db_xref="GeneID:11497311"
     CDS             310886..311662
                     /gene="NDAI0G01390"
                     /locus_tag="NDAI_0G01390"
                     /inference="similar to DNA sequence:INSDC:YOL147C"
                     /note="similar to Saccharomyces cerevisiae PEX11
                     (YOL147C); ancestral locus Anc_3.3"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671158.2"
                     /db_xref="GeneID:11497311"
                     /db_xref="GOA:G0WDQ4"
                     /db_xref="InterPro:IPR008733"
                     /db_xref="UniProtKB/TrEMBL:G0WDQ4"
                     /translation="MIIDYQKIDTITIRRKMVLDTLVYHPTITRLIKFFDTSSGREKI
                     LRLLQYLCRFLALQDDNLATSPKKRLELQFLLIRKVLRFLKPLNFIRAASKAYDNKLT
                     SDSLVRYCKIWKNVAFALYLALDQINLLHMLNLIPLTRFVTQTIPHWTNLAWLLSLFI
                     GIVLDTRKVQIAQTCIYHVKHRSEKDKQNELDGDEDKKVLASARRERSMATRKLLWDI
                     LDSLIVLKNLSYIKTNDGYISLAGITTSLMGLQDLWNGTI"
     gene            complement(<312005..>314056)
                     /gene="NDAI0G01400"
                     /locus_tag="NDAI_0G01400"
                     /db_xref="GeneID:11497312"
     mRNA            complement(<312005..>314056)
                     /gene="NDAI0G01400"
                     /locus_tag="NDAI_0G01400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671111.2"
                     /db_xref="GeneID:11497312"
     CDS             complement(312005..314056)
                     /gene="NDAI0G01400"
                     /locus_tag="NDAI_0G01400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671159.2"
                     /db_xref="GeneID:11497312"
                     /db_xref="GOA:G0WDQ5"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:G0WDQ5"
                     /translation="MTAKSSLSSKLASNTTPIESTNDSLNRFYKVQNACAQLETAIKT
                     IYSEGLTNEELTYMVNDGTAQEKLIASSPASFIGTYLKNAQASLDISKIFEYYQYDSE
                     SSPLDNYIKEPIITDTNLQKLASSTVSNGITSIDRNRLEYLGANWMNALISIVLFNQF
                     PNANKKGLENLHDQILNDKQDWIKSTTFNTMNHNNENLNSYFGALIFDRSIPQFNDIL
                     KWLSISTKDKLNSIKYNYLIDVNAKTPKEALIEFMKDNKDGLKLRFIRLTVNSPFIIE
                     VKLGNVSLGKGEDNVIEIAEQKAAQDALSKPELIENYSKYPIVSPIIIDEDEQKTITN
                     VKEPAPIKQEIGKNETLTENPTEKPITKPIAKPLATKEAKKEVKIEPRDIEKQSPIIT
                     KPIKKEEKQTVQPPAPAKKPEMKPVAAVKSAPNPVAATVSTEPSAPTSLNPDDLLKEI
                     MNRMQSQVSEMVAKVASDLITKSELVPATASTIPSIPLNSASKSNKTAVQVESESEEE
                     EETETETETESETETESESESESESESESESESESESESESESDSDSESEEESDNESE
                     DEEPELKIEPPQSKVPVMIPSKITKDDSGQYLYTDVEVECDKSSKASLYAILGKVNLF
                     PEYKTSQIDMNDFYSFCILRGTAIILGEGRGSNKQISQQIAAEHAIEGEALAELLEES
                     S"
     gene            complement(<314324..>314977)
                     /gene="NDAI0G01410"
                     /locus_tag="NDAI_0G01410"
                     /db_xref="GeneID:11497313"
     mRNA            complement(<314324..>314977)
                     /gene="NDAI0G01410"
                     /locus_tag="NDAI_0G01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671112.2"
                     /db_xref="GeneID:11497313"
     CDS             complement(314324..314977)
                     /gene="NDAI0G01410"
                     /locus_tag="NDAI_0G01410"
                     /inference="similar to DNA sequence:INSDC:YGR081C"
                     /note="similar to Saccharomyces cerevisiae SLX9 (YGR081C);
                     ancestral locus Anc_3.409"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671160.2"
                     /db_xref="GeneID:11497313"
                     /db_xref="UniProtKB/TrEMBL:G0WDQ6"
                     /translation="MVAKKRNTLRNKASQKLLLTTASSSSSSPIISSNDQDVRGSISE
                     LPPDPKAYLHQARESKKDKQLNKQLSFLSKMKSKSTGKESNFDGISKSSIRRRKRKLR
                     DDLKPKMEDLLTSLAQEQDLKEHVRNNQRQRDDRRGHDVLCQPKLLNLLSMRNYTNMN
                     EPGSVIIKKNQPNIRNQKGAKALSQLESKRFTQVLTNQTFQQNPFASLREIIKMQKR"
     gene            <315491..>316063
                     /gene="NDAI0G01420"
                     /locus_tag="NDAI_0G01420"
                     /db_xref="GeneID:11497314"
     mRNA            <315491..>316063
                     /gene="NDAI0G01420"
                     /locus_tag="NDAI_0G01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671113.2"
                     /db_xref="GeneID:11497314"
     CDS             315491..316063
                     /gene="NDAI0G01420"
                     /locus_tag="NDAI_0G01420"
                     /inference="similar to DNA sequence:INSDC:YGR082W"
                     /note="similar to Saccharomyces cerevisiae TOM20
                     (YGR082W); ancestral locus Anc_3.410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671161.2"
                     /db_xref="GeneID:11497314"
                     /db_xref="GOA:G0WDQ7"
                     /db_xref="InterPro:IPR002056"
                     /db_xref="InterPro:IPR023392"
                     /db_xref="UniProtKB/TrEMBL:G0WDQ7"
                     /translation="MSQTSPILRALSAVTVIGALSATGYIIYFDYQRRNNAQFRKNLK
                     TNLKKQQKETKLKEEKEAKENLSKVSTFLIEELKKNPIDPTPSKREEIFTSSLEEGEL
                     LATKAKNENDQLLAASKFYRALSVYPNPSELLEIYQKTLPSSVYNFVVLMIAILPPSN
                     VSSFLNGLGEKMNDLKNQAETLAEINDIDG"
     gene            complement(<316296..>318341)
                     /gene="NDAI0G01430"
                     /locus_tag="NDAI_0G01430"
                     /db_xref="GeneID:11497315"
     mRNA            complement(<316296..>318341)
                     /gene="NDAI0G01430"
                     /locus_tag="NDAI_0G01430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671114.2"
                     /db_xref="GeneID:11497315"
     CDS             complement(316296..318341)
                     /gene="NDAI0G01430"
                     /locus_tag="NDAI_0G01430"
                     /inference="similar to DNA sequence:INSDC:YGR083C"
                     /note="similar to Saccharomyces cerevisiae GCD2 (YGR083C);
                     ancestral locus Anc_3.413"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671162.2"
                     /db_xref="GeneID:11497315"
                     /db_xref="GOA:G0WDQ8"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:G0WDQ8"
                     /translation="MSESKPRDENLSSNSKGASSPVSPSINSTSTNGSTPASAASAEA
                     SEGAKDPTDKVLSNKELKEVEEKEKAAKRAAQKQASGISIEQQQQSAQLKKEKKQQQR
                     EKQLREEQKKLEKKNRKLNFKQQQQKLKSTLFGHLETTEERRATILALSSALTSPHAS
                     RITATGLMVPMVASAISGSQVYTTSSLANTIINNDNTSSSTNINTSAAATASAVSQMD
                     TALQSSSNIPPTISNANELGKALATITLESDKQTLVPGITSILNQSTFENNPSLVSSI
                     KELLSNKDYIHPAIQLLTSHLANYKIVGSIPRCIAMLEAFQIVIHDYQTPKGTTLSRN
                     LTNYLSHQIDILKKARPLSVTMGNSIRWLKQEISLIDPGMNDSEAKLDLCEKIAQFAK
                     EKIELADQLIIDNASNHIENGATIVTYGSSKVLTEMILHNVLKLKKNIKVIVVDSRPL
                     FEGRKMADKLRENGVNVMYSLVTSLNTIFNMDVDCVFLGAHSILSNGFLYSRTGTAMI
                     AMSANRRNIPVLVCCESLKFSQRVQLDSVTFNELADPNDLITIGYENPVEKRGNKGIL
                     LKQFIKERNEMKKHSELDNTTNHKKQQQQQQQGKSDGSKGKSGKNGVSTDNITANDSD
                     ITDKNILDGWQELPSLNIVNILYDLTPPEYIKKIITEFGALPPSSVPVILREYKGSA"
     gene            complement(<318871..>319908)
                     /gene="NDAI0G01440"
                     /locus_tag="NDAI_0G01440"
                     /db_xref="GeneID:11497316"
     mRNA            complement(<318871..>319908)
                     /gene="NDAI0G01440"
                     /locus_tag="NDAI_0G01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671115.2"
                     /db_xref="GeneID:11497316"
     CDS             complement(318871..319908)
                     /gene="NDAI0G01440"
                     /locus_tag="NDAI_0G01440"
                     /inference="similar to DNA sequence:INSDC:YGR084C"
                     /note="similar to Saccharomyces cerevisiae MRP13
                     (YGR084C); ancestral locus Anc_3.414"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671163.2"
                     /db_xref="GeneID:11497316"
                     /db_xref="UniProtKB/TrEMBL:G0WDQ9"
                     /translation="MIQSTIYKRFLSTQAETYRSQLDSFLRYHKTEKSLKPLIYRPKN
                     ASKLLTMDMKDPKTHELLKPLPAISTLSKSVLVSYVDCMEFGDRAVLLKWFHEWVSVT
                     PRKKLLWKYLDSSLISKLMYSSFFKIGGYTQLINMLYNNRVKFITAKNSAVFDIEGYF
                     NTWMMCNLHRNQLMKFEDMELLRKKLMNAWRKVAHIERRTGLHLLLMDAWEKQMGYNP
                     KDILKNVPEFKLKLPSLEKVSEEPITEVSMEKFVKDNERNYVLSRTILDFNPVEKDNM
                     VLNKFIKEYQTYSAEVNGTTKDIYDEYTKSMGKIWEPKEEEKETRNNDESNNEQQEGE
                     TGEEKVDNSNA"
     gene            <320752..>321492
                     /gene="NDAI0G01450"
                     /locus_tag="NDAI_0G01450"
                     /db_xref="GeneID:11497317"
     mRNA            <320752..>321492
                     /gene="NDAI0G01450"
                     /locus_tag="NDAI_0G01450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671116.2"
                     /db_xref="GeneID:11497317"
     CDS             320752..321492
                     /gene="NDAI0G01450"
                     /locus_tag="NDAI_0G01450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671164.2"
                     /db_xref="GeneID:11497317"
                     /db_xref="UniProtKB/TrEMBL:G0WDR0"
                     /translation="MANVLVPRKQRHANVNQTVNVVLGVHVVPFFANYGFHPRLPGFT
                     NPILDHSQNNEEQQTPSTSQSNLDYHLQALQNIMVSIQTNMVDAQDRQSIHFNEHHRV
                     TNFKVGDPVLVHKDAYNNKPFTKFHHLWYGPFKIIETLGDQTYRLNSQLGNRRTNTFH
                     VRRLKLYNHRQDNAYNVPHTDYKSKLHLIERVVRIFRNSTCEVQWSNAETWDTSIIPL
                     HIIFNSEYRHLLDPYYNPSTQEITVTSS"
     gene            complement(<323262..>323720)
                     /gene="NDAI0G01460"
                     /locus_tag="NDAI_0G01460"
                     /db_xref="GeneID:11497318"
     mRNA            complement(<323262..>323720)
                     /gene="NDAI0G01460"
                     /locus_tag="NDAI_0G01460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671117.2"
                     /db_xref="GeneID:11497318"
     CDS             complement(323262..323720)
                     /gene="NDAI0G01460"
                     /locus_tag="NDAI_0G01460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671165.2"
                     /db_xref="GeneID:11497318"
                     /db_xref="UniProtKB/TrEMBL:G0WDR1"
                     /translation="MGRAQRWLEEVEEKTIWMLLILIFKIIIDHHIFSSKITNGEKLS
                     AENANSWNASSNYTYYISLAKLCDGVCIFLLVVGRHHYFLNFLFMLALSFVLSGIVAA
                     SESATIKLILANLIDLLSTSTKPSNGFGNSMIALTSTITKTVTATPFPEC"
     gene            <324888..>325607
                     /gene="NDAI0G01470"
                     /locus_tag="NDAI_0G01470"
                     /db_xref="GeneID:11497319"
     mRNA            <324888..>325607
                     /gene="NDAI0G01470"
                     /locus_tag="NDAI_0G01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671118.2"
                     /db_xref="GeneID:11497319"
     CDS             324888..325607
                     /gene="NDAI0G01470"
                     /locus_tag="NDAI_0G01470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671166.2"
                     /db_xref="GeneID:11497319"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:G0WDR2"
                     /translation="MKIDNSNQQRGFLPHDSTENVVLPKEKFSLWVIYLLDEYVHQLE
                     CHICAGLVILFTALTLIFTHLKNFPFTLSCCRFFMKLSLFSFLLMFLISSYWMFKLCK
                     MNLQSEIKILLEVIECKPNASPHSWDIIACHMNEYLYSEGFYSTPNFFYDGSGVYRWF
                     RFAIMKRLQAQLARENRLTDDGSEIGKYEVVAFRVFRETVDKYWADEYPVAFEEVINT
                     RNMRNASSSKQDNAPADGDMV"
     gene            complement(<326180..>328936)
                     /gene="NDAI0G01480"
                     /locus_tag="NDAI_0G01480"
                     /db_xref="GeneID:11497320"
     mRNA            complement(<326180..>328936)
                     /gene="NDAI0G01480"
                     /locus_tag="NDAI_0G01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671119.2"
                     /db_xref="GeneID:11497320"
     CDS             complement(326180..328936)
                     /gene="NDAI0G01480"
                     /locus_tag="NDAI_0G01480"
                     /inference="similar to DNA sequence:INSDC:YNL325C"
                     /note="similar to Saccharomyces cerevisiae FIG4 (YNL325C);
                     ancestral locus Anc_3.14"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671167.2"
                     /db_xref="GeneID:11497320"
                     /db_xref="GOA:G0WDR3"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="UniProtKB/TrEMBL:G0WDR3"
                     /translation="MDQEQFINTIRNDQPYTTYNNQEQQQQQEQGQHNEQQPQSQPQS
                     QPQPQLQTEHPIEPIKQRKTTKFILSKYTIYEMKDRMYIVGSNKRESMFRILEIDLTV
                     PQSELNVLEDNVFFTRNEIMNVLSGLEEASPEGLHKRLTGYGLLGFIRFTSCYYLVVI
                     TKCSQVAVIGGHFVSHIDGTELIPISNNYKKPDKGSVEARLMQTFQNLDLSKTFYFSY
                     TYDVTNTLQVNLLREKFKAVGRSDIVVPCGIPDYNEMFVWNNNLLKPILSCIDSVYDW
                     FQCIIHGFIDQVNVCLMGKNIYITLLARRSHHFAGARFLKRGVNTEGFVANEVETEQI
                     VADMVLTPFHKPGNGYFDSDRYTSFVQHRGSIPLYWTQEVSNLTAKPPIEINVVDPFF
                     SPAALHFDKLFQRYGGGVIQILNLIKTKEKKPREVKLLKEFEQCINYLNRFLPKEKKM
                     EYTSWDMSRVSKQDGQGVIEFLEIYAAGSVQKTGIFHNGSDFKSTKIQEGICRSNCID
                     CLDRTNAAQFVIGKRALGVQLKELGIIDNSYLEYDSDIVNILTELFHDLGDTIALQYG
                     GSHLVNTMETYRKINQWSSHSRDMIESIKRFYSNSFVDAQRQDATNLFLGNYVWKKGY
                     PSLWEMNTDFYLHNEYIQDGLKRSYTHWWNNYHIRSIRQLIYDRIILQNNDITFNKTV
                     KYVRGFPEAFDNYWNEYYRPRCITWISDLFVFNMNSTRRYRSATKNNEDLSPFSSRKQ
                     SGFNKKLREKTQDPTCGSDRIYLKKEEMSLDSGFRKLGYLDEIQLSQQYLGTIQLTKD
                     KIEGILASYTKNEIPIFCNDSLDEDANNILTDQRKKEVESVNVTENNDYSLNNDEMDI
                     EHFCKDVSVDLDFYRKAFDVSNYRPTDDYEGSTKLYPHDVAAIESTEVSNFMMNNRYE
                     FTFL"
     gene            complement(<329545..>330849)
                     /gene="NDAI0G01490"
                     /locus_tag="NDAI_0G01490"
                     /db_xref="GeneID:11497321"
     mRNA            complement(<329545..>330849)
                     /gene="NDAI0G01490"
                     /locus_tag="NDAI_0G01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671120.2"
                     /db_xref="GeneID:11497321"
     CDS             complement(329545..330849)
                     /gene="NDAI0G01490"
                     /locus_tag="NDAI_0G01490"
                     /inference="similar to DNA sequence:INSDC:YNL322C"
                     /note="similar to Saccharomyces cerevisiae KRE1 (YNL322C);
                     ancestral locus Anc_3.18"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671168.2"
                     /db_xref="GeneID:11497321"
                     /db_xref="UniProtKB/TrEMBL:G0WDR4"
                     /translation="MLSIAFFVWLLLLPFSRGVITTQLITVTDAAGAVAIQTSIFDPA
                     TVAAAAVDAVTAAGLVTTTNAVGALITITNTAATTATTATTKTTNGAATTTPPVTRTI
                     TTVNAAGAPITITTTGAAAATGALAAAVANSPTTATTLVPFTSVIVTTNVANVPVTLT
                     TVITPIQSLITTVNAAGVTATLTTTILPTANAATAATTATAVTPIPTVITTTNDLGIT
                     VTLTSTLTPILSTYTTTNAAGLPQTITTARLPTTATTAVATAVATTAVGSTSLITTTN
                     AAGIIVTLTTVIPVSSSSSKATVTTTEKYTGTRPDPSTEYTPPPLSAVTTIPIDTYLT
                     LTEGTTRTYTTTRAKTSIWVTITSQGHLITAPTTFAQRFSQQYVTVASPSSGSIGMGS
                     HSGTVGVIKTNMVSTISNSTNMASTMYLSLSGIIIALISWIL"
     gene            <331856..>334879
                     /gene="NDAI0G01500"
                     /locus_tag="NDAI_0G01500"
                     /db_xref="GeneID:11497322"
     mRNA            <331856..>334879
                     /gene="NDAI0G01500"
                     /locus_tag="NDAI_0G01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671121.2"
                     /db_xref="GeneID:11497322"
     CDS             331856..334879
                     /gene="NDAI0G01500"
                     /locus_tag="NDAI_0G01500"
                     /inference="similar to DNA sequence:INSDC:YNL321W"
                     /note="similar to Saccharomyces cerevisiae VNX1 (YNL321W);
                     ancestral locus Anc_3.19"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671169.2"
                     /db_xref="GeneID:11497322"
                     /db_xref="GOA:G0WDR5"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="InterPro:IPR005185"
                     /db_xref="UniProtKB/TrEMBL:G0WDR5"
                     /translation="MSREPDHVRRVFSVDDDPHEVENDVRYLEGLHDGLKYALQNKSI
                     TPQSPAVEITSQSKNSSAPDLLSPAISNHSQHLKLKKKLIIKYNYNHLTAHSPTTITT
                     RPSNFLKKKNSSRLSTLNSPKIRSNNTVGADYFTNKHNHIHDHTDFSEESRDRFIIHN
                     PPHNNTGHDLLIEELDPADAYNPDNDNNNDDMDEDIEDRISMASSLESFTLRERQDAI
                     NKTHPFGIRIWKPALYKKKRSVQKAADEDIHETQLKMITWPVHISNIIWSFTVGLFLA
                     SLFSLGGIIVAILGLFTKSAREYSIVCFRLARYLFLPFGKVVYLIADEHYLEEDNQEG
                     ISVNQFYKWVTSYSNRLFFHESQANNNSLNDNTHPSYGSIHNFMTHQSKRLPTLPARA
                     GDRQSSSSSTPMIPHANSQVTTNLPAPLPNNPESQNQINSTSSQRRFFGRGKWTCGRL
                     IFYFCFHLFLQPFVLIFALLSWLFVFTIPMSNILWNLMYHCRKHPLALGFKNIKNSNA
                     NSNPIIKIYNNGSSDDSLANNKSILLCTFRCAGWHYYKFTVDGTNIIVVNLIAIVFFT
                     IFDFYLLKNSWHFRFWFTDESTIFMLCLTSIIPLAFYIGQAVASISAQTSMGVGAVIN
                     AFFSTIVEIFLYCVALQQRKGPLVEGSMIGSILGAVLLLPGLSMCGGAWNRKTQRYNP
                     ASAGVSSALLIFSMLVMFVPTILYDVYGGYIVKCEDGFEQPISLKTVMMPLATSSNCS
                     FYHPPLEFDRMYTNVIQPMSVSCAIVLFLAYTIGLWFTLRTHAAMIWHLPISDPQKET
                     PINVGINSEQNSILLQHPNEIAAHTEPNSGGHDAPNWSRTKSTWILLVATLLYAVIAE
                     ILVACVDSVLEDFPSLNPKFLGLTIFALVPNTTEFLNAISFAIHGNVALSMEIGSAYA
                     LQVCLLQIPALVIYSIWYTWSWDRSMINIREQMFSMIFPRWDLIASMGSVFLFTYLYA
                     EGKSNYFKGSMLILLYVIVILGFFFQDVLTNWKWE"
     gene            <335324..>336181
                     /gene="NDAI0G01510"
                     /locus_tag="NDAI_0G01510"
                     /db_xref="GeneID:11497323"
     mRNA            <335324..>336181
                     /gene="NDAI0G01510"
                     /locus_tag="NDAI_0G01510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671122.2"
                     /db_xref="GeneID:11497323"
     CDS             335324..336181
                     /gene="NDAI0G01510"
                     /locus_tag="NDAI_0G01510"
                     /inference="similar to DNA sequence:INSDC:YNL320W"
                     /note="similar to Saccharomyces cerevisiae YNL320W;
                     ancestral locus Anc_3.21"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671170.2"
                     /db_xref="GeneID:11497323"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR029059"
                     /db_xref="UniProtKB/TrEMBL:G0WDR6"
                     /translation="MLWLRYMKMLVGGTLALTSISLSILYFCQNRLIYPSWAQGARKF
                     VDTPDSRGLPYKRVVLTTKDGVNIEAYDLQNEKSTSTVLILCPNAGNIGYFIPILDIF
                     YRQFGLSVFIYSYRGYGHSQGSPNENGMKLDAERVVSYLATDPHHKERRLILYGRSLG
                     GANALYIASKFPQLCDGVILENTFLSIRKVIPYIFPWLSRFSFMCHEIWNSEGLMTQC
                     SETTSFLFLNGSRDEIVPPAHMKKLYELCPARKKKFFEFPLGHHNDTIIQDGYWNIIK
                     DFLKSNNFI"
     gene            complement(<336365..>337957)
                     /gene="NDAI0G01520"
                     /locus_tag="NDAI_0G01520"
                     /db_xref="GeneID:11497324"
     mRNA            complement(<336365..>337957)
                     /gene="NDAI0G01520"
                     /locus_tag="NDAI_0G01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671123.2"
                     /db_xref="GeneID:11497324"
     CDS             complement(336365..337957)
                     /gene="NDAI0G01520"
                     /locus_tag="NDAI_0G01520"
                     /inference="similar to DNA sequence:INSDC:YNL318C"
                     /note="similar to Saccharomyces cerevisiae HXT14
                     (YNL318C); ancestral locus Anc_3.23"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671171.2"
                     /db_xref="GeneID:11497324"
                     /db_xref="GOA:G0WDR7"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G0WDR7"
                     /translation="MSISVDREEIQHVITPTDRITITVPDDPLIVTSNKKSNEQDGRY
                     VNKPEKSHLLIPILICIAIAFAGFTLGWDIGTIGGMTSMESFQNRFGTSYDSQRGVQY
                     FPDLLLGLIISIFNIGCAVGSVTLAKLADWFGRKTGLYVTVIIYVIGLLIQIINDRTW
                     IQFFIGRIVCGFAIGSSNVVAPMFLAEVAPVRIRGGIIVFYQIMLTFGILMGNIVNYA
                     CHQSFPGPNQNEAWKTPLGLGFAWACIMMGGIWCSPEPAPYLALKKGRIDSAKESFAM
                     MNGVSKDSKLTDEFIEDMNQKMKEEIILKKQPRKWFEFVRGEPRLGYRVFIGTILMAS
                     QQLSGINYFFYYGVTLFKNAGLNDPYVAAIVMSIVNFVGTFGGIYLVERVGRKLCLVY
                     GSFGMFCCMIVYSTIGSFALNLPGTNIGMIVVACIYIAFFATTLGPVTVVLVAELFPL
                     RTKAISMATCSDANWLANFAISFTSPLIISQIGFRYGYVFAACLFFSTIFSVTNVPET
                     KDKTTSEIDDMFIKGRRQRFSF"
     gene            complement(<338482..>339522)
                     /gene="NDAI0G01530"
                     /locus_tag="NDAI_0G01530"
                     /db_xref="GeneID:11497325"
     mRNA            complement(<338482..>339522)
                     /gene="NDAI0G01530"
                     /locus_tag="NDAI_0G01530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671124.2"
                     /db_xref="GeneID:11497325"
     CDS             complement(338482..339522)
                     /gene="NDAI0G01530"
                     /locus_tag="NDAI_0G01530"
                     /inference="similar to DNA sequence:INSDC:YNL316C"
                     /note="similar to Saccharomyces cerevisiae PHA2 (YNL316C);
                     ancestral locus Anc_3.29"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671172.2"
                     /db_xref="GeneID:11497325"
                     /db_xref="GOA:G0WDR8"
                     /db_xref="InterPro:IPR001086"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="UniProtKB/TrEMBL:G0WDR8"
                     /translation="MNDGVTKTKLKVLFLGPKGTYSHQAALQHFGHLCDSSIYFVPTR
                     SIPQCFDDLEKDTSVNYSSCPLRVILLMDKWFFSYALLRDQMIQSKNKIHNRIITPLE
                     VVGEQYVSISHCLISPVTFPKGDNLSNYNHVKIYSHPQVWGQVSLYLTDLKAKYRHMK
                     FECIDTTSTSEAVRIALETQNNGTQDSKVLNLAIASQTAANLFNGVIIDNEINDKKGN
                     TTRFLVLQRRDSNKGTRLHKKGMESDNANLNINFTTFTARKDDPGSLVDILMILKSHS
                     LNMCSISSRPCNRGLDGRNWHYIFFIEYYNFSEHIDWEKFHEEFDKHCLEWCLWGSFP
                     RNERYYAHVDKQ"
     gene            complement(<339851..>340810)
                     /gene="NDAI0G01540"
                     /locus_tag="NDAI_0G01540"
                     /db_xref="GeneID:11497326"
     mRNA            complement(<339851..>340810)
                     /gene="NDAI0G01540"
                     /locus_tag="NDAI_0G01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671125.2"
                     /db_xref="GeneID:11497326"
     CDS             complement(339851..340810)
                     /gene="NDAI0G01540"
                     /locus_tag="NDAI_0G01540"
                     /inference="similar to DNA sequence:INSDC:YNL315C"
                     /note="similar to Saccharomyces cerevisiae ATP11
                     (YNL315C); ancestral locus Anc_3.30"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671173.2"
                     /db_xref="GeneID:11497326"
                     /db_xref="GOA:G0WDR9"
                     /db_xref="InterPro:IPR010591"
                     /db_xref="UniProtKB/TrEMBL:G0WDR9"
                     /translation="MHLIRYSSPIIPITKAKSFSVFYRLNSKTVKVNQASTTTAGADI
                     IQQNYKEKLLKKAQEEGFQTIEKLQNHWKNIIEEKKKQFNKIDILKDLEEYQQKMSNN
                     NATGFTKSKGPLPAEDKKLKVPFKTLGSYLQLEKITELSKQEIEFLWRAKWAATKDSL
                     CAVVPVDIFNKMLGNAKANPVFVLPLPRVVGEGKEPEGMELHYIQWQFLGSNTIHCII
                     TSLAEYKLHTEFARPHTTFQFHLDLESEKKIVLMNGHVQTDMNVSVQDAQLLLLNIQR
                     FYGAMGEETPMAKERLKILRDFTKGSTAFNVDTLIECAQSMEN"
     gene            complement(<341271..>342143)
                     /gene="NDAI0G01550"
                     /locus_tag="NDAI_0G01550"
                     /db_xref="GeneID:11497327"
     mRNA            complement(<341271..>342143)
                     /gene="NDAI0G01550"
                     /locus_tag="NDAI_0G01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671126.2"
                     /db_xref="GeneID:11497327"
     CDS             complement(341271..342143)
                     /gene="NDAI0G01550"
                     /locus_tag="NDAI_0G01550"
                     /inference="similar to DNA sequence:INSDC:YBR002C"
                     /note="similar to Saccharomyces cerevisiae RER2 (YBR002C);
                     ancestral locus Anc_3.203"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671174.2"
                     /db_xref="GeneID:11497327"
                     /db_xref="GOA:G0WDS0"
                     /db_xref="InterPro:IPR001441"
                     /db_xref="InterPro:IPR018520"
                     /db_xref="UniProtKB/TrEMBL:G0WDS0"
                     /translation="MEGIESSSNIPGYNITLKWVKNIFSRSLRVSNNVPKHVGFIMDG
                     NRRYARKNGIEVKEGHETGFFTMSKILELCYESGVTCATVYAFSIENFKRSPYEVDAL
                     MNLARLRIKQIVDKGEMAEKYGIKVKIIGDTSLLDADLIKDIQNAMEITKNNNRAILN
                     ICFPYTGREEIYHSMKECMAKYCDNGEPEFKINESSLDLNLYTGGEPPLDLLIRTSGV
                     ARLSDFMLWQISNKGVVIELIDCLWPDFGPLRMAWILLKFAFQKSFSNRTKKFEEEDI
                     DLDEDYANGSKKDI"
     gene            complement(342607..342679)
                     /gene="NDAI0Ltrna6T"
                     /locus_tag="NDAI_0Ltrna6T"
                     /db_xref="GeneID:11498335"
     tRNA            complement(342607..342679)
                     /gene="NDAI0Ltrna6T"
                     /locus_tag="NDAI_0Ltrna6T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:11498335"
     gene            <344848..>345711
                     /gene="NDAI0G01560"
                     /locus_tag="NDAI_0G01560"
                     /db_xref="GeneID:11497328"
     mRNA            <344848..>345711
                     /gene="NDAI0G01560"
                     /locus_tag="NDAI_0G01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671127.2"
                     /db_xref="GeneID:11497328"
     CDS             344848..345711
                     /gene="NDAI0G01560"
                     /locus_tag="NDAI_0G01560"
                     /inference="similar to DNA sequence:INSDC:YBR011C"
                     /note="similar to Saccharomyces cerevisiae IPP1 (YBR011C);
                     ancestral locus Anc_3.191"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671175.2"
                     /db_xref="GeneID:11497328"
                     /db_xref="GOA:G0WDS1"
                     /db_xref="InterPro:IPR008162"
                     /db_xref="UniProtKB/TrEMBL:G0WDS1"
                     /translation="MVYTTRQIGAKNTLDYKVFIEDDGKVVSPFHDIPLYADKENNIF
                     NMVVEIPRWTNAKLEITKEEPLNPIIQDTKKGKLRFVRNCFPHHGYIHNYGAFPQTWE
                     DPNETHAETKAVGDNDPIDVLEIGETIAYTGQVKQVKVLGVMALLDEGETDWKVIAID
                     INDPLAPKLNDIEDVEKYFPGLLRATNEWFRIYKIPDGKPENQFAFSGEAKNKKYALD
                     IIRETNESWKQLIAGKSSDSKGISLENSTLSDSPTYSATVAASIPPASPKEDAPIDKS
                     IDKWFFISGSA"
     gene            complement(<345924..>346607)
                     /gene="NDAI0G01570"
                     /locus_tag="NDAI_0G01570"
                     /db_xref="GeneID:11497329"
     mRNA            complement(<345924..>346607)
                     /gene="NDAI0G01570"
                     /locus_tag="NDAI_0G01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671128.2"
                     /db_xref="GeneID:11497329"
     CDS             complement(345924..346607)
                     /gene="NDAI0G01570"
                     /locus_tag="NDAI_0G01570"
                     /inference="similar to DNA sequence:INSDC:YDR007W"
                     /note="similar to Saccharomyces cerevisiae TRP1 (YDR007W);
                     ancestral locus Anc_3.192"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671176.2"
                     /db_xref="GeneID:11497329"
                     /db_xref="GOA:G0WDS2"
                     /db_xref="InterPro:IPR001240"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G0WDS2"
                     /translation="MDAFTNLRKDGIKPIIKICGIQTEEAAKCAINSGTNLLGIICVP
                     NRKRTIMPDIARSISSFIHDQDEKQLQYLVGVFRNQSKEDVSRIVEDYGIDIVQLHGD
                     EDWEEYYEFLQKPIIKRMIFPRDCDDVIQICNSDNKLRKVLPLFDSEAGGTGDILDWN
                     AISQWAKNEIGKGNKVEYILTGGLVPENVQKAVSLSGVIGADVSGGVETDEVKDMEKI
                     KSFIANGKQ"
     gene            complement(<347081..>347491)
                     /gene="NDAI0G01580"
                     /locus_tag="NDAI_0G01580"
                     /db_xref="GeneID:11497330"
     mRNA            complement(<347081..>347491)
                     /gene="NDAI0G01580"
                     /locus_tag="NDAI_0G01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671129.2"
                     /db_xref="GeneID:11497330"
     CDS             complement(347081..347491)
                     /gene="NDAI0G01580"
                     /locus_tag="NDAI_0G01580"
                     /inference="similar to DNA sequence:INSDC:YBR010W"
                     /note="similar to Saccharomyces cerevisiae HHT1 (YBR010W);
                     ancestral locus Anc_3.193"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671177.2"
                     /db_xref="GeneID:11497330"
                     /db_xref="GOA:G0WDS3"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G0WDS3"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRLQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
     gene            <348196..>348507
                     /gene="NDAI0G01590"
                     /locus_tag="NDAI_0G01590"
                     /db_xref="GeneID:11497331"
     mRNA            <348196..>348507
                     /gene="NDAI0G01590"
                     /locus_tag="NDAI_0G01590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671130.2"
                     /db_xref="GeneID:11497331"
     CDS             348196..348507
                     /gene="NDAI0G01590"
                     /locus_tag="NDAI_0G01590"
                     /inference="similar to DNA sequence:INSDC:YBR009C"
                     /note="similar to Saccharomyces cerevisiae HHF1 (YBR009C);
                     ancestral locus Anc_3.194"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671178.2"
                     /db_xref="GeneID:11497331"
                     /db_xref="GOA:G0WDJ0"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR019809"
                     /db_xref="UniProtKB/TrEMBL:G0WDJ0"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEEVRAVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            <349960..>350994
                     /gene="NDAI0G01600"
                     /locus_tag="NDAI_0G01600"
                     /db_xref="GeneID:11497332"
     mRNA            <349960..>350994
                     /gene="NDAI0G01600"
                     /locus_tag="NDAI_0G01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671131.2"
                     /db_xref="GeneID:11497332"
     CDS             349960..350994
                     /gene="NDAI0G01600"
                     /locus_tag="NDAI_0G01600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671179.2"
                     /db_xref="GeneID:11497332"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:G0WDS5"
                     /translation="MSKLVKQVQFGNTGIKISPLIVGCMSYGSKAWAQWVEDDKEKIF
                     QIFKHCYDIGFRTFDTADVYSNGKSERLLGEFLRKFEIRRETVVILTKTYFRVDETLD
                     LPLGEFPHSENDVLDLVNQQGLSRKHILDSVKNSVGRLGTYIDVLQIHRFDPTTPIKE
                     TMKALNDVVENGDVRYIGASSMLPTEFVEMQAIADKYDWFQFVNVQSQYNLLYREDER
                     DLMKYCKKHNIALTPWSPNYQGLLTRPVGVESTRSKTDKVIDAWHLKNLDPAQKEIIN
                     RVEELSKKKGVAMAAISTAWVMAKGCQPILGMSSIKRVDEAKDALDVKFTEEELAYLE
                     EPYKPREFMI"
     gene            <352894..>355398
                     /gene="NDAI0G01610"
                     /locus_tag="NDAI_0G01610"
                     /db_xref="GeneID:11497333"
     mRNA            <352894..>355398
                     /gene="NDAI0G01610"
                     /locus_tag="NDAI_0G01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671132.2"
                     /db_xref="GeneID:11497333"
     CDS             352894..355398
                     /gene="NDAI0G01610"
                     /locus_tag="NDAI_0G01610"
                     /inference="similar to DNA sequence:INSDC:YDR006C"
                     /note="similar to Saccharomyces cerevisiae SOK1 (YDR006C);
                     ancestral locus Anc_3.195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671180.2"
                     /db_xref="GeneID:11497333"
                     /db_xref="InterPro:IPR008862"
                     /db_xref="UniProtKB/TrEMBL:G0WDS6"
                     /translation="MQNLRQITESSSSSTDLEKTTSDPPSNATTVTVSVVAEAASSPD
                     SSSSSTTSANTMIKNSNVGNGIMKHVPDTVLNDELDHTNIENQITNEQQDYYGSSSYK
                     MFKKILTYRILQQTLRLKRPLEEDQTSPSENRRKFRKRSYSLPNLLATRSNNISSEYD
                     RSSSHYFMKPVNSSNHNEQRNRMARAKSRTKNSNVPPFTLNYNHDNICTIVYNSNNCD
                     RVDDDNYDDYDDDFDDDFDDDDDDSDENYDSDGNRNVESFTYRENTEDNLLPPINLKY
                     LEDLELSQVIRNAQLRHDLIFDPFLKFKPNQDQDQAQAPNDKSYLESQDQSKLYWNFI
                     RVELALSANTSSLSPATHNTLVKKAQSSKLLFNLFETLKKILLTIVPEAKYVPTASSP
                     FNNNNNSQEETHSIFTSIITDFDANLIVQELYLGVFDIPKFSTWITTLLRKCCAPIRD
                     PLIGYIEQNFQSIFTNDDNNTVISISKFVDCLNQIFKILKLMKLDIVNYELRLFRPNL
                     LLYTIDFEKNYFEKLYQFDSCQIMNSTLAWFQENLDNEKKRLILKNEVVEGDNANVSV
                     IPQEKNQFYYRLFLKSVLNLLSCCNIVEKFPEGFFFDFDKLVLLRVDVRQMICQYICK
                     MLYETMVRRDTHISPMDKTYLLSKKATNQVINGIDTIIKNKNGHCKWSNNINSISVQL
                     CYWVQSYYKENINMSASSPSSSSMKLDGKMVEFCNNWLTRQFNPSSKIYTMLENKLLS
                     ALEEIIFEGSEINDDGEVNCKFLFSFGIDSPFSMSHRKSAFTNTLNISSGSSKINISN
                     NIPNHPIRNYKHIDNKHPSYYSIKIDPENSILFSFR"
     gene            <357000..>359219
                     /gene="NDAI0G01620"
                     /locus_tag="NDAI_0G01620"
                     /db_xref="GeneID:11497334"
     mRNA            <357000..>359219
                     /gene="NDAI0G01620"
                     /locus_tag="NDAI_0G01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671133.2"
                     /db_xref="GeneID:11497334"
     CDS             357000..359219
                     /gene="NDAI0G01620"
                     /locus_tag="NDAI_0G01620"
                     /inference="similar to DNA sequence:INSDC:YBR007C"
                     /note="similar to Saccharomyces cerevisiae DSF2 (YBR007C);
                     ancestral locus Anc_3.196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671181.2"
                     /db_xref="GeneID:11497334"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G0WDS7"
                     /translation="MSCTGNNSSPLDDLVNPSNNGSSDIKTNNSRRSSSFRKTNISLL
                     SLNSTAPSERLLDKLDLSPEDELLLEMALKEEEETIRQRQLSCQNRSQSHILCMPASE
                     FPSLRISRNYYNNTSNNTSRSNKNNRRISRNNVSTTSLLKNKQKNPIEILAGASTVND
                     AYIDGDDENELLPENIILKDKTLAAKVEQHFATSSRYSYMVEEEEEEEEEEEENDNSN
                     KPILNFEKYRVENSKLVDMFVSKKQQENKKNPYSIHETGSSVIRNDSTNSSNTIFSDI
                     GQLSKPNTQSTFESDTSTNESRVNYNDMISSSPIKKNLSKTSTNSSETLPKEFQKIPP
                     QPPYKTHKKKSSLSSLKNLFKSSKSSHKHKHNHDKSDSTIAINTEPNSSETTPQQERF
                     SNISLPSLVNQSPLNTTSIGKYIFPPNPSFEFELNQSKVKPYSNMQSSSNSHQRTKER
                     SNTNSPFKTHYRSLSAQQDIYTNNNNTITKNSMGKPVQEQKTTTTTHVEVSPIRPKNR
                     RSLSLNMQKNVSQHPWSKYTSTSSSIHKENEIIDTAIKMRHEGRLKESAEKLKKACMT
                     GNKTAYLLYGLALRYGCGVEQDYDESFKYLQLAITSGDSGISIDKDVLHCHVDPMEIE
                     KKNNFRDKSMYQIMREPLAPALYECGISYLKGFGVEHVDEMKGLKFLEKAASLGHIDS
                     MCLSGTLWSRRSESSRRKKDTVRAAAWFRLAEMRGANLIGANWIYKEKYVNPPEKVL"
     gene            complement(<359365..>360864)
                     /gene="NDAI0G01630"
                     /locus_tag="NDAI_0G01630"
                     /db_xref="GeneID:11497335"
     mRNA            complement(<359365..>360864)
                     /gene="NDAI0G01630"
                     /locus_tag="NDAI_0G01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671134.2"
                     /db_xref="GeneID:11497335"
     CDS             complement(359365..360864)
                     /gene="NDAI0G01630"
                     /locus_tag="NDAI_0G01630"
                     /inference="similar to DNA sequence:INSDC:YBR006W"
                     /note="similar to Saccharomyces cerevisiae UGA2 (YBR006W);
                     ancestral locus Anc_3.199"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671182.2"
                     /db_xref="GeneID:11497335"
                     /db_xref="GOA:G0WDS8"
                     /db_xref="InterPro:IPR010102"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:G0WDS8"
                     /translation="MSTRKFPVPTFKNKDLISKSPLVDGEWLDPNNAKEYFEVTDPAS
                     NEIIAKMPEQTSANVEKAIDAAYRAFQTYRKTSPQERSKWLLNLYNLMIENKEDLAKL
                     ISWENGKSLEESRSEVQYAASYFQWFSQEATRVYGTTIQPSNPTSRVFTIRQPVGVCG
                     IICPWNFPSAMITRKMAAALAVGCTVVIKPDSQTPLSALALGKLQEQAGFPKGVVNII
                     LSHKNTPECGKTLCQSYRVKKVSFTGSTQVGKILMDQSSSTLKKLSFELGGNAPVIIF
                     DDCDLDAAVNQTIASKFRGLGQTCVCSNRIYVHSSIIDKFADLLAEKVKKFVIGPGLE
                     DGVTHGCIINGKAIEKIEYHANDAIKKGAKIVLKGGPLKDIGPNFYAPIILSHVPNNA
                     VVSKEETFGPLCPIFKFDTLEEVVGYANDTELGLASYVFSKNVDTIYTVVEALEAGMV
                     SCNTGIFSDAAIPFGGIKESGFGREGSLHGIEDYTVLKTITIGGLPPML"
     gene            complement(<361497..>362402)
                     /gene="NDAI0G01640"
                     /locus_tag="NDAI_0G01640"
                     /db_xref="GeneID:11497336"
     mRNA            complement(<361497..>362402)
                     /gene="NDAI0G01640"
                     /locus_tag="NDAI_0G01640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671135.2"
                     /db_xref="GeneID:11497336"
     CDS             complement(361497..362402)
                     /gene="NDAI0G01640"
                     /locus_tag="NDAI_0G01640"
                     /inference="similar to DNA sequence:INSDC:YBR005W,YDR003W"
                     /note="similar to Saccharomyces cerevisiae RCR1 (YBR005W)
                     and RCR2 (YDR003W); ancestral locus Anc_3.200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671183.2"
                     /db_xref="GeneID:11497336"
                     /db_xref="InterPro:IPR020999"
                     /db_xref="UniProtKB/TrEMBL:G0WDS9"
                     /translation="MEQQQQQQQGKIGTGAALLAGVVGGFILGSNDDDDGDRTTITTT
                     RTYATTATQGTRTTIYTATSTSKVISQSYTDPEDSGEFGKWFGVAIAGIVGAVLLIII
                     VFSIINSIRNRRKERPITGTSWIPTYNVPSTDTTFKNCRDEEDFVPQYTERVNMNDLG
                     YYDERGDFHRNEDVRTYDGNKNSQIPPPAFFPIADPAFPSSRSSLPFSNFARPSGSPP
                     GVPKINLPEEELQEEEGEEKIQGYAETGSQVEHLSAVPSNSPKYEIGKVKTVTTSTLT
                     TTSTNNGINDDGESFVDVKSSRSEV"
     gene            complement(<363022..>363939)
                     /gene="NDAI0G01650"
                     /locus_tag="NDAI_0G01650"
                     /db_xref="GeneID:11497337"
     mRNA            complement(<363022..>363939)
                     /gene="NDAI0G01650"
                     /locus_tag="NDAI_0G01650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671136.2"
                     /db_xref="GeneID:11497337"
     CDS             complement(363022..363939)
                     /gene="NDAI0G01650"
                     /locus_tag="NDAI_0G01650"
                     /inference="similar to DNA sequence:INSDC:YJL210W"
                     /note="similar to Saccharomyces cerevisiae PEX2 (YJL210W);
                     ancestral locus Anc_1.124"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671184.2"
                     /db_xref="GeneID:11497337"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G0WDT0"
                     /translation="MASRVAQLDAVALDQELYTLLGSSILQSNLLNWNSIRNKNTEEI
                     KLIIKSLIFICSTKYSVLEGVTRTYGSQLNGVSFKCRKSSLYLLTILSDYFNKKLSHY
                     FFSSNPASTTLHNQDILRKLYSRLSKIYDIAYLLNLCVFISSSGRTNKNLYLTPIFRL
                     FKIGSITDPIHLSSSSFYQDSIYGGLEYQNRQLLWNAILEVFNNTLLLSHKFYYSRSY
                     IMNNKRKKKVQAKKQQQTGDSGLQCPKCENFPVNPYRMTCCQGIYCYVCVSYVLKRGY
                     CLNCDETNDLSAQYIYHSSSTQPDNVREN"
     gene            <364213..>365586
                     /gene="NDAI0G01660"
                     /locus_tag="NDAI_0G01660"
                     /db_xref="GeneID:11497338"
     mRNA            <364213..>365586
                     /gene="NDAI0G01660"
                     /locus_tag="NDAI_0G01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671137.2"
                     /db_xref="GeneID:11497338"
     CDS             364213..365586
                     /gene="NDAI0G01660"
                     /locus_tag="NDAI_0G01660"
                     /inference="similar to DNA sequence:INSDC:YBR004C"
                     /note="similar to Saccharomyces cerevisiae GPI18
                     (YBR004C); ancestral locus Anc_3.201"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671185.2"
                     /db_xref="GeneID:11497338"
                     /db_xref="GOA:G0WDT1"
                     /db_xref="InterPro:IPR007315"
                     /db_xref="UniProtKB/TrEMBL:G0WDT1"
                     /translation="MLFSLSWRPFIKLTSIFITLRAIQYALLFFAPTAQFDTSTELLL
                     SSLAPDSDIDSFWNRHLWNKLLSWDSVYFIKGMTQHSSEPQYEHEYAFSPTWVKLIRL
                     IVSKQNNTEFYHILKVGIIMNNIIFFVSTLLLYELTFQTFRNKKSIHYSINDSLKLSN
                     LSSIFFICSSCSGFVISIYSEPLSILGSFAGMLLRELSLNSVLSSSSTLGNLFYIGSC
                     FGFILAAINRSNCILLGVFYLFDLIHGLKEFRKTRISRMITLPILCGTVLGITFIWSQ
                     YYIPYNRFCTTSNDMEWCQTSLFHIWGLKQITKTSMYSYIQNEYWNVGIFKYWTINNL
                     PNFLIGLPNFICMVFSCIYFSKIYPFNNMKPLIFVCSLFLCIILVLAHFQIINRINSF
                     IPLHVWYIADRLLKQSRRTITNANEEEGKQIVLTGDDIIVKWYIRWLIIWIPLQTILF
                     GFFLPPA"
     gene            complement(<365782..>366429)
                     /gene="NDAI0G01670"
                     /locus_tag="NDAI_0G01670"
                     /db_xref="GeneID:11497339"
     mRNA            complement(<365782..>366429)
                     /gene="NDAI0G01670"
                     /locus_tag="NDAI_0G01670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671138.2"
                     /db_xref="GeneID:11497339"
     CDS             complement(365782..366429)
                     /gene="NDAI0G01670"
                     /locus_tag="NDAI_0G01670"
                     /inference="similar to DNA sequence:INSDC:YDR002W"
                     /note="similar to Saccharomyces cerevisiae YRB1 (YDR002W);
                     ancestral locus Anc_3.204"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671186.2"
                     /db_xref="GeneID:11497339"
                     /db_xref="GOA:G0WDT2"
                     /db_xref="InterPro:IPR000156"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G0WDT2"
                     /translation="MSEEKTTPSTTPATTTSGSDAQKPPSSAIFSMFGGKKDTDAEKE
                     EGEEGLMKKKKKKIKKLKRRQKTNDEDDAPESPDVHFEPIVHLEKVDVKTMEENEKTL
                     FKIRAKLFRFDSENKEWKERGTGDCKFLQNEQTKKVRLLMRRDKTLKVCANHIIAPEY
                     ELKPNVGSDRSWVYTCTADVAEGPAEAFTFAIRFGSKENADKFKAEFEKAQELNK"
     gene            <367237..>369705
                     /gene="NDAI0G01680"
                     /locus_tag="NDAI_0G01680"
                     /db_xref="GeneID:11497340"
     mRNA            <367237..>369705
                     /gene="NDAI0G01680"
                     /locus_tag="NDAI_0G01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671139.2"
                     /db_xref="GeneID:11497340"
     CDS             367237..369705
                     /gene="NDAI0G01680"
                     /locus_tag="NDAI_0G01680"
                     /inference="similar to DNA sequence:INSDC:YBR001C,YDR001C"
                     /note="similar to Saccharomyces cerevisiae NTH2 (YBR001C)
                     and NTH1 (YDR001C); ancestral locus Anc_3.205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671187.2"
                     /db_xref="GeneID:11497340"
                     /db_xref="GOA:G0WDT3"
                     /db_xref="InterPro:IPR001661"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR011120"
                     /db_xref="InterPro:IPR018232"
                     /db_xref="UniProtKB/TrEMBL:G0WDT3"
                     /translation="MLSPTAAAEQNDRARTYRRHRRMSSLSEFNDPFSNAEIYYGPIT
                     DPRKQPTRPFLSSSSQGPNNSSAPSILANKNTISFPGSLTTTTTTTKSSAASTSPTSP
                     TTAPPPPLTSSQTAALLSSRKLNRTRTMSVFGNVSDFKKGSINEYNLKRRGSEDDSYL
                     AAKGNRRFFIEDVDKTLEELLAREDTDKNYQITIEDKGPKVIKIGTANSNGYKSVNVR
                     GTYMISNLLQELTIAKSFGRHQVFLDEARLNENPVNRLSRLISNQFWNTLTRRVDLYS
                     VGEIAMDTKIDAPGAKNPRIYVPYNCPDQYEFYIQASQMNPSLKLEVEYLPKDITPEY
                     VKSLNGTPGLLALAMEEHFNPSTGEKSLIGFPYAVPGGRFNELYGWDSYMMALGLIES
                     NKVDVAKGMVEHFIFEIEHYGKILNANRSYYLCRSQPPFLTDMALEVFKKIGGDNNPN
                     AVDLLKRAFKAAIKEYKSVWCSEPRLDPITKLSCYHPNGLGIPPETEPDHFDTILLPF
                     TRKYNVSLEEFREMYNDGKIHEPQLDEFFLHDRGVRESGHDTTYRFEGVCAYLATIDL
                     NALLYKYECDIADVIEKYFDNKFHDTNDGTTTNSEHWRHLASIRQKKINKYMWDEESG
                     FFFDYNVKAKQRTSYESATTFWALWAGLATTEQAEIMVKKALPKLEMLGGLVACTESS
                     RGPISINRPVRQWDYPFGWAPHQILAWEGLSNYDYKDIATRLSYRWLYMMTKAFVDYN
                     GIVVEKYDVTRGVDPHRVEAEYGNQGADFKGVATEGFGWVNASYLLGSKYMNNHARKA
                     LGTCIPPQPFFNSLKGEEKKLYGL"
     gene            complement(370150..370231)
                     /gene="NDAI0Ltrna7S"
                     /locus_tag="NDAI_0Ltrna7S"
                     /db_xref="GeneID:11498348"
     tRNA            complement(370150..370231)
                     /gene="NDAI0Ltrna7S"
                     /locus_tag="NDAI_0Ltrna7S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCU"
                     /db_xref="GeneID:11498348"
     gene            <370573..>371214
                     /gene="NDAI0G01690"
                     /locus_tag="NDAI_0G01690"
                     /db_xref="GeneID:11497341"
     mRNA            <370573..>371214
                     /gene="NDAI0G01690"
                     /locus_tag="NDAI_0G01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671140.2"
                     /db_xref="GeneID:11497341"
     CDS             370573..371214
                     /gene="NDAI0G01690"
                     /locus_tag="NDAI_0G01690"
                     /inference="similar to DNA sequence:INSDC:YFL046W"
                     /note="similar to Saccharomyces cerevisiae YFL046W;
                     ancestral locus Anc_8.8"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671188.2"
                     /db_xref="GeneID:11497341"
                     /db_xref="InterPro:IPR012439"
                     /db_xref="InterPro:IPR024461"
                     /db_xref="UniProtKB/TrEMBL:G0WDT4"
                     /translation="MLKLLGPHHNKLLSPTVRRCFHQNTRLFNDFETVHVSNTNNYKN
                     ILMEQGKFTHEQSSAIVNLMSDAIKGGVVHVSKDLAKRERLTQLTYQQRVDFAKLKDQ
                     LLSADRNEFHNIQNEYERIKNDLEKLRNKLKEEITKANAGFKLDLSLEKGRIREESSH
                     HNLQIKEIDSRIDQEVSNMKMQIDSVKTQVMQWLIGVCTGTFALVLAYIRLLS"
     gene            complement(<371443..>372201)
                     /gene="NDAI0G01700"
                     /locus_tag="NDAI_0G01700"
                     /db_xref="GeneID:11497342"
     mRNA            complement(<371443..>372201)
                     /gene="NDAI0G01700"
                     /locus_tag="NDAI_0G01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671141.2"
                     /db_xref="GeneID:11497342"
     CDS             complement(371443..372201)
                     /gene="NDAI0G01700"
                     /locus_tag="NDAI_0G01700"
                     /inference="similar to DNA sequence:INSDC:YFL045C"
                     /note="similar to Saccharomyces cerevisiae SEC53
                     (YFL045C); ancestral locus Anc_8.9"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671189.2"
                     /db_xref="GeneID:11497342"
                     /db_xref="GOA:G0WDT5"
                     /db_xref="InterPro:IPR005002"
                     /db_xref="InterPro:IPR006379"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G0WDT5"
                     /translation="MSDFAYKEKPDTLVLFDVDGTLTPARLTVSDEVRDTLVKLRKKV
                     VIGFVGGSDLSKQLEQLGPNVLSEFDYAFSENGLTAYRLGEQLASQSFINWIGEEEYN
                     KLAVFILRYLSELDLPKRRGTFLEFRNGMINVSPIGRNASTEERNEFERYDKEHQIRA
                     KFVNALREKFGHLGLTFSIGGQISFDVFPTGWDKTYCLQHVEKDGFKEIHFFGDKTTE
                     GGNDYEIYVDDRTVGHSVKNPSETVAVLKELFDL"
     gene            <373967..>374608
                     /gene="NDAI0G01710"
                     /locus_tag="NDAI_0G01710"
                     /db_xref="GeneID:11497343"
     mRNA            <373967..>374608
                     /gene="NDAI0G01710"
                     /locus_tag="NDAI_0G01710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671142.2"
                     /db_xref="GeneID:11497343"
     CDS             373967..374608
                     /gene="NDAI0G01710"
                     /locus_tag="NDAI_0G01710"
                     /inference="similar to DNA sequence:INSDC:YLR073C"
                     /note="similar to Saccharomyces cerevisiae YLR073C;
                     ancestral locus Anc_8.13"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671190.2"
                     /db_xref="GeneID:11497343"
                     /db_xref="InterPro:IPR015063"
                     /db_xref="UniProtKB/TrEMBL:G0WDT6"
                     /translation="MKSTTQLAAEARDYKFNPAIPLRIYLKTCVNILNKAQTAFQSRD
                     LSLAYTFYFRYVDLCTNKLSKHPEFIISSNGNSESMELSLYRQEYLQLIKLEVPAVLR
                     IIEDLQRQIDLQYNQHQLSLAKNIAKPMHHHHHQIRRNSIEGGEECTARQRQLLPPTF
                     NESRFNQSISFLRETSLSLNKNKSQNHNTLEEDRDGKPILHYPELPQLSFPTF"
     gene            complement(<374840..>377134)
                     /gene="NDAI0G01720"
                     /locus_tag="NDAI_0G01720"
                     /db_xref="GeneID:11497344"
     mRNA            complement(<374840..>377134)
                     /gene="NDAI0G01720"
                     /locus_tag="NDAI_0G01720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671143.2"
                     /db_xref="GeneID:11497344"
     CDS             complement(374840..377134)
                     /gene="NDAI0G01720"
                     /locus_tag="NDAI_0G01720"
                     /inference="similar to DNA sequence:INSDC:YFL042C,YLR072W"
                     /note="similar to Saccharomyces cerevisiae YFL042C and
                     YLR072W; ancestral locus Anc_8.14"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671191.2"
                     /db_xref="GeneID:11497344"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="UniProtKB/TrEMBL:G0WDT7"
                     /translation="MSDSNSDSDFDNWEPVSEIEKNTSTRDVVSGTKTDDITNGEQGE
                     SLEEAFQFPPSNNDDTKVDSSSIATSGSTARNKKVEDKQLQDESNNVKTEERNVKNKA
                     DLSIDTSISNESDTSPSRISISSPSFISEMFSSFRAPSTNLISTTNDGLTNSQPVKSP
                     TSPNIISHRREQSISSKRKANRNRRVSSVSSQLSNNTINSNLTMSSTTAGNIQEDMAT
                     TATPSSSSGIIVESPLQKAEKPKEVIEHLNNMSSSSSLTATPPSTATAAAASYDTKLY
                     KDTKFLDTTYRYASDERNQEFHSLFPQVPEDDNLLDEFNCSLSKEFLYQGKLYISESF
                     LCFNSKMLTWVAKEMIPFDKIVFFQKTSTAGLFNNAISIELDNDTKVQFNGFNSRDYT
                     YDFIKDIWSKNLLSEEEGGHECKELLDLEPTSPSPTPNNEKESIDGIANENENTESIS
                     KNKREIETHSSIRQKTVFKFKPNLDFQYDGPHYFHETKFPYSPEDNNEYVLTELELSA
                     PPGIIFEMMFSELNHSYVFKYLKSQDSSKISKFTKFNPSTDTIEDGESTHLSRTYNYE
                     KALHFPAGPKSTTCYTTETIIHKDFKDYIMVINSTKTPNVPSGNNFQTQTRFMFRWAS
                     ETRCIMKISFWIEWSGSSWIKSMVESNCKTTQIAATKDIIKIIQEFTTENVIEVEEEV
                     IESKNIVPKTIDNIPSKPEKSVYPQTAIATTANITDTNNDITKLLLVIGILLLLLNIT
                     YQRRLNKSINEIKNILQAEKRNRQ"
     gene            378095..378176
                     /gene="NDAI0Ltrna8S"
                     /locus_tag="NDAI_0Ltrna8S"
                     /db_xref="GeneID:11498352"
     tRNA            378095..378176
                     /gene="NDAI0Ltrna8S"
                     /locus_tag="NDAI_0Ltrna8S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCU"
                     /db_xref="GeneID:11498352"
     gene            <378934..>380835
                     /gene="NDAI0G01730"
                     /locus_tag="NDAI_0G01730"
                     /db_xref="GeneID:11497345"
     mRNA            <378934..>380835
                     /gene="NDAI0G01730"
                     /locus_tag="NDAI_0G01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671144.2"
                     /db_xref="GeneID:11497345"
     CDS             378934..380835
                     /gene="NDAI0G01730"
                     /locus_tag="NDAI_0G01730"
                     /inference="similar to DNA sequence:INSDC:YFL041W"
                     /note="similar to Saccharomyces cerevisiae FET5 (YFL041W);
                     ancestral locus Anc_8.17"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671192.2"
                     /db_xref="GeneID:11497345"
                     /db_xref="GOA:G0WDT8"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="UniProtKB/TrEMBL:G0WDT8"
                     /translation="MHLSYWHSHLLIFITLASTFFNVTLAKTRQFNFTASWITAKPDG
                     IHEKKMIGFNGKWPPPDIHVNKGDRIELYLTNGFQDNHTVTSLHFHGMFQNSTFDDNQ
                     NLMDGPSMVTQCPIVPGQTYLYNFTTGDQIGTYWYHAHHSAQYGDGMRAALIIHDDDI
                     QQPFQYDKEFVIGISDLYWKPYDQVTDKFLSRYNPTGAEPIPDLFLFNNTVNETLHFE
                     TNKTYLLRFINMGLFVSQYISLEDHQFTIVEVDGMYVKPNITDVLYLAAAQRMSVLVK
                     SKETDPGKNFALMQIVDQTMLDAIPPNLPLNMTNQVAYGDDYSKPHSIIPQDFEKLAT
                     NDFYLEPYYDNHYQVFKDYDQQIVLDVRMRNLGDGIKYAFFNNISFVDPKIPILTTIL
                     TSGKLADDPRIYGENVNPFFFKKNQIIEVVLNNYDTGRHPFHLHGHNFQIVQKSNGFH
                     IDEQFPEELQDEMTVPYNESNPLMPIPEIPMIRDTVVLEPNGHVVLRFKADNPGVWYF
                     HCHVDWHLQQGLAAVFIEDPFALQRQNSLTDNYKDICSAANIANEGNAAGNYEDWFDL
                     DGLPRQPDPLPEGFTLKGYIAFAISTLCGIWGLYTITKYGMFEDIPDNESLYTTLKTI
                     IEENEISVK"
     gene            complement(<381102..>381743)
                     /gene="NDAI0G01740"
                     /locus_tag="NDAI_0G01740"
                     /db_xref="GeneID:11497346"
     mRNA            complement(<381102..>381743)
                     /gene="NDAI0G01740"
                     /locus_tag="NDAI_0G01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671145.2"
                     /db_xref="GeneID:11497346"
     CDS             complement(381102..381743)
                     /gene="NDAI0G01740"
                     /locus_tag="NDAI_0G01740"
                     /inference="similar to DNA sequence:INSDC:YLR066W"
                     /note="similar to Saccharomyces cerevisiae SPC3 (YLR066W);
                     ancestral locus Anc_8.21"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671193.2"
                     /db_xref="GeneID:11497346"
                     /db_xref="GOA:G0WDT9"
                     /db_xref="InterPro:IPR007653"
                     /db_xref="UniProtKB/TrEMBL:G0WDT9"
                     /translation="MFSLSQRFQVVTNQAVTVGIFIVAFIVGSSWFHLYQNDVFNSAK
                     STISNIKPSINIRTSRYYGSTNGKAKENLKVSFDLSTDLSPLFNWNTKQVFVYLTASY
                     NGSSTVNEVTFWDKIIEDKNDAVLELNNEKSKYAVWDLENGFSGKELQFNLHWNIQPW
                     VGGLLYGQTNGIYHVIIPEKEKKPENSSGEEQENDSSVAKKKLKRARKQQKAN"
     gene            <382453..>384033
                     /gene="NDAI0G01750"
                     /locus_tag="NDAI_0G01750"
                     /db_xref="GeneID:11497347"
     mRNA            <382453..>384033
                     /gene="NDAI0G01750"
                     /locus_tag="NDAI_0G01750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671146.2"
                     /db_xref="GeneID:11497347"
     CDS             382453..384033
                     /gene="NDAI0G01750"
                     /locus_tag="NDAI_0G01750"
                     /inference="similar to DNA sequence:INSDC:YFL040W"
                     /note="similar to Saccharomyces cerevisiae YFL040W;
                     ancestral locus Anc_8.22"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671194.2"
                     /db_xref="GeneID:11497347"
                     /db_xref="GOA:G0WDU0"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G0WDU0"
                     /translation="MSDKKICHLGLVSFIMSIAGFILGMEITSLAVFLTSEYFNQYFN
                     NPSPFQQGILMASSTFGGLFGCIIYTLIVAKCGRVTLFHLGSILWFIGSIVGIFVYNI
                     WMIAASRFIKGITIGIFSILIPAYISELYPAKKKGRVMGYTQLACTLSTLIIHYLCVG
                     LNELGNDVSFRAAWGFEILPVLLFFGLTFWLPETPQWLTLHGDYTKAQIIQNNVATSY
                     NSRHNEVNHIDLLHKIDLAGIYGDGSNDLKYMDLFKKPYWKQTLFGTILQLLVQFSGI
                     NILLFYITYICEMIGLKGEEKFVCASIPYFINTGLSLFPIMYMDHVKRKISTLFGAFP
                     LSLIMIAIGVIMAVFGHSVKPIDGNKSIVWFIEGKPGLWILGLCLLFVVIFALTLSCM
                     PTIFTSEIFELKSRPKGMAFCISAGWLLNCILTLLAPLMMEYLKWGTFILLGGVTFVV
                     SIIISIYGKETYNLSEKQISSLFDKNKRGSFTGSSDDNKSTSTNENTTMSISIKSKEN
                     PASQPIILQKYSGSSFSV"
     gene            <384420..>385700
                     /gene="NDAI0G01760"
                     /locus_tag="NDAI_0G01760"
                     /db_xref="GeneID:11497348"
     mRNA            <384420..>385700
                     /gene="NDAI0G01760"
                     /locus_tag="NDAI_0G01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671147.2"
                     /db_xref="GeneID:11497348"
     CDS             384420..385700
                     /gene="NDAI0G01760"
                     /locus_tag="NDAI_0G01760"
                     /inference="similar to DNA sequence:INSDC:YAR018C"
                     /note="similar to Saccharomyces cerevisiae KIN3 (YAR018C);
                     ancestral locus Anc_3.178"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671195.2"
                     /db_xref="GeneID:11497348"
                     /db_xref="GOA:G0WDU1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0WDU1"
                     /translation="MYHRQVHNQEYQVLEEIGRGSFGSVRKVIHIPTKKLMVRKEIKY
                     GHMNSKERQQLISECKILSQLKFENIVDFYNWDFNDSEKVLYLYMEYCSRGDLALMIK
                     SYKSRNKYIPEKIIWGILAQLLMALHKCHYGVELSPLITIYDRMKPPTKGKNIVIHRD
                     LKPGNIFLSNENNNDDNNDDNDQQKNKDDNDLHLENNIPNASGRGNNMKVDYSQVVVK
                     LGDFGLAKSLETSIQFATTYVGTPYYMSPEVLMDQPYSPLSDIWSLGCVVYEMCSLHP
                     PFQAKTFLDLQNKIKTGKVDKIPEYYSNGLNAIIHSMIDVDLKTRPSTFELLQDIQIR
                     TARKSLQLERFERNLLAYESELVNIEKILEKQATEYERELSHLKEHFVQAVEERVREV
                     INGKKVGKAPESMYTNGYSEGLSRPAYHWQTRYR"
     gene            <386194..>388434
                     /gene="NDAI0G01770"
                     /locus_tag="NDAI_0G01770"
                     /db_xref="GeneID:11497349"
     mRNA            <386194..>388434
                     /gene="NDAI0G01770"
                     /locus_tag="NDAI_0G01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671148.2"
                     /db_xref="GeneID:11497349"
     CDS             386194..388434
                     /gene="NDAI0G01770"
                     /locus_tag="NDAI_0G01770"
                     /inference="similar to DNA sequence:INSDC:YAR014C"
                     /note="similar to Saccharomyces cerevisiae BUD14
                     (YAR014C); ancestral locus Anc_3.180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671196.2"
                     /db_xref="GeneID:11497349"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:G0WDU2"
                     /translation="MSYDGIKSKSIAASSNVIRIPPILDMSFLNDTSNNRIDEAQDKL
                     LHDPTLVENYSDVLKTKPESRFIKSSDDDSSSAAGSVVLTPTASSDISPSKLQRSSIL
                     STSSSRYSMQANIKEDKETTNVNESHQPAGYDPIMEEEDKIEEEHIETSNIDREESDS
                     DEDNNRNDYDYSDSDFEDNLEQRLHKLNSSLSDNNTDDELHPEQYTNDLERTHSQLHE
                     TLHDNDDDDVYKDLELALSADEDEENESDEEGMEEEYQPLPPPQELDPEKLYALYAFK
                     GPDSSHCQLEQDEACILLNDQDSYWWLIKRCNDGKIGFAPAEILETFPERLARLNCWK
                     NENMSSRSLDLTTSDNVVAADTLTVKESPNEHLNKDPELEKKDTKLSESSREVNKDAL
                     SILKAYKKGNKSVSFNDVISYADRFIEEHNTENEINEELSGVTHHDEFSQERLDFNDD
                     ISDTVSDVSFTTGNASPLNIKKTRQPVEEVKRIPSAFAENNSDEDIESTEKLSLTEDI
                     HAGLTDQDKQDGKPESKDDLKKIFEAPVLPFGSTASATDKIQNSTSDYSISSIGEFSP
                     SSSERTEDSPNMPSGEFSKPSSAAVIPTLRAVQDISKFVKNEDGIDTNSIEKTLIEGD
                     GENKSEADIDAASLTSSDIDNDHAEAMLDADICEQNSKSSLVSSTSEGIFMDSQKAQS
                     TTSINSTFSMAKEKLDLNTNRQDIVEKALAIDDSEPHEIIKNLYNPLFNKMDDLLQQL
                     DKIIQS"
     gene            <388763..>391579
                     /gene="NDAI0G01780"
                     /locus_tag="NDAI_0G01780"
                     /db_xref="GeneID:11497350"
     mRNA            <388763..>391579
                     /gene="NDAI0G01780"
                     /locus_tag="NDAI_0G01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671149.2"
                     /db_xref="GeneID:11497350"
     CDS             388763..391579
                     /gene="NDAI0G01780"
                     /locus_tag="NDAI_0G01780"
                     /inference="similar to DNA sequence:INSDC:YBR017C"
                     /note="similar to Saccharomyces cerevisiae KAP104
                     (YBR017C); ancestral locus Anc_3.181"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671197.2"
                     /db_xref="GeneID:11497350"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0WDU3"
                     /translation="MSVAAQWVPDEASLVQLGSYLRNSMSPDAIQRTDAMESLKSLQL
                     QPEFFNYLCYILIEGETDNTLRSHFPMNELANYRATAGLLLKNTILDDENEGILKRMD
                     LGYVKGHIVAGLVHSNGNSLVSNVTGIVITTLFSTYYRQHRNDFTGLQIISQLLELSS
                     QGNLGSTKALSKIMEDSAQFFQLEWSTSPDNNGNVIKPIDMLVDNFMNFIKDDNLDDL
                     VRAEVIKCINCIIPLQCQSFIVKIDDFLNVVFQLAQSNENNQIRIQLCIALGYLLDFR
                     PDKLVNHLNGIIQFMLHLIGTVNDEKVGIEACEFLHGFVCNSNIPSHILQPFVAEIVP
                     VLLTKMVYNKDAIAILESSNDLDDTILEDKDEDIKPIAPRIVKKRDDTEEDFTDDEDA
                     GDEDTDDDDVESQWNLRKCSASTLDAMTTILPRDVMDIAFPFLREHLTSEMWYIREAT
                     VLALGAMAEGGMKYFNDQLPVLLPFLVEQLKDQWAPVRKITCWTLSRFSSWVLQDHTE
                     FLLPILEPILETLVDKKKVVQKSAISSVATFIENCDSELIEXTLLYTDLLQSFQRCFQ
                     FYKKKNLIILYDAVGRFAEKVELDDEGMNVILPPLINKWSSLPDQDRELWPLLECLSC
                     VASSVGEKFLPMAPDVYERAFRILCHCIELEKKSHDDPRIVVPEKDFIITSLDLIDGL
                     LQGLGPLCGSLMFTNSTDSIPILQIVVVCLQDSVHEVRQSAYALWGDMVYFFADKLNF
                     YFNVNEQNKEILSQILKFIGTEIMHNDDTDGVSAVMNAIWCLGLMSTRLNLFGDYVLD
                     MSRIVLDLFVTKTRVLDSSIIENLAITIGQMGVKYPEVFSRDDFANDSNWNKWCDSVK
                     SLESIEEKSETYMGFIRILNMTDERIRASHTTLKNIISGLSENVDVNIFAQDIYNFLM
                     KYSNDLQTLNLSTEEIAFIQQFTS"
     gene            <392941..>394764
                     /gene="NDAI0G01790"
                     /locus_tag="NDAI_0G01790"
                     /db_xref="GeneID:11497351"
     mRNA            <392941..>394764
                     /gene="NDAI0G01790"
                     /locus_tag="NDAI_0G01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671150.2"
                     /db_xref="GeneID:11497351"
     CDS             392941..394764
                     /gene="NDAI0G01790"
                     /locus_tag="NDAI_0G01790"
                     /inference="similar to DNA sequence:INSDC:YBR015C"
                     /note="similar to Saccharomyces cerevisiae MNN2 (YBR015C);
                     ancestral locus Anc_3.188"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671198.2"
                     /db_xref="GeneID:11497351"
                     /db_xref="GOA:G0WDU4"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G0WDU4"
                     /translation="MFFTRKFARLLKITTILCLLCFFCIWIPSEYSTNSSISVQEYKE
                     YLQGYINKLPIQSNSNVNDDTQKEFQHLVSGENKEDIPSIKKNTVEDFYNVVFQNIID
                     YSPSGKTARNYSSKCKLDQGIASRPDSYKDWEKLSMQNLLNCLEVSPEEFTNLSTSHH
                     NFVEHVNKLVLPKGTYNNDGIVMVGGGKFTFMAYLVLKTLRNQGTTLPVEIFIPPIDT
                     VKEETFCKSEMLSELSAKCIYMSNILPQEMIEKFDFKGYQFKSLAIIASSFENLLLLD
                     ADNFPIKSLDKIFKHEPYNSTGLVMWPDFWRRTTQPIYYKLADIYVNVLKRVRNDIDD
                     ITPTKVYSDDNFDFTKIPFHDFEGTMPDDSTESGQLMINKSKHLPTVLLALYYNVNGP
                     NWYYPIFSQNAHGEGDKETFIAAATFYRLPFYQVRTKVGADGYHTKDRFQGVAMAQHD
                     FIQDYEHYQIAQREIKKRYSNVKDIKYDAEYAVQKFYDEFFNKDTTKYGEIDIMFLHS
                     NLPKFDPLKLWEDSALIDETGKHFRSFSDPKIVKKYDIEYENFKIIKDVICDKGIHFS
                     YLDEELQEKPQDWVSMCQYIKDRYIFLKDTHQDATSPVVNT"
     gene            complement(<394930..>395598)
                     /gene="NDAI0G01800"
                     /locus_tag="NDAI_0G01800"
                     /db_xref="GeneID:11497352"
     mRNA            complement(<394930..>395598)
                     /gene="NDAI0G01800"
                     /locus_tag="NDAI_0G01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671151.2"
                     /db_xref="GeneID:11497352"
     CDS             complement(394930..395598)
                     /gene="NDAI0G01800"
                     /locus_tag="NDAI_0G01800"
                     /inference="similar to DNA sequence:INSDC:YBR014C,YDL010W"
                     /note="similar to Saccharomyces cerevisiae YBR014C and
                     YDL010W; ancestral locus Anc_3.189"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671199.2"
                     /db_xref="GeneID:11497352"
                     /db_xref="GOA:G0WDU5"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR014025"
                     /db_xref="UniProtKB/TrEMBL:G0WDU5"
                     /translation="MAVVLNKRNIRVLITTCVLIVIGVFVFQNANASTYTSSKALKST
                     ITDTNSIVQAHGEDENIPALKNVDNSPVSTEITSEEDSKINADSSIVQAEAEVPFDVA
                     KEYTSILQRGPMVIFSKTFCPYSKALKELLSTNFQINPQPIVIELDKHEHGEELQAYI
                     KEQTGRGTVPNLIINGNSKGGSDDMKKLFDENVLLDSLNEWSNGAYEVQATETASNKD
                     ATSV"
     gene            <398847..>400277
                     /gene="NDAI0G01810"
                     /locus_tag="NDAI_0G01810"
                     /db_xref="GeneID:11497353"
     mRNA            <398847..>400277
                     /gene="NDAI0G01810"
                     /locus_tag="NDAI_0G01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671152.2"
                     /db_xref="GeneID:11497353"
     CDS             398847..400277
                     /gene="NDAI0G01810"
                     /locus_tag="NDAI_0G01810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671200.2"
                     /db_xref="GeneID:11497353"
                     /db_xref="InterPro:IPR021031"
                     /db_xref="UniProtKB/TrEMBL:G0WDU6"
                     /translation="MKTLIFSQKSLLWLVFQLQSYITLTGAYDISDEQYLAGLSTVSE
                     DINVSNTGTFVVSHSPSVTIDSDTITNDGNLCIGTTSSSSDMSISLDAGTLNNKADGR
                     LVISNGINSGQTSSVNLNTLNNEGYLRMELKDDGETFAVSDSFVNSGFIALKPVNPTD
                     WVVLGLTTPSTGIVNSGTIDVSGTDVIFDHPITGGGCVMASGHSQMVINTDYENDQTF
                     WLGDSDDHYTAIFLTGTTKYIPKIRGYGGYHYIGLGEPLVENTGPATVLYNTTTGIVQ
                     VTTAGQTYTIDIGTGYNATKVTTVTLVHSGGNPPNKVLVYYDDSVTFPRPSICAVDES
                     FTMGTCDPTFTVPPPYTTTLSSETDIISYYSTTDSSGFEVTATTTILVTQSSTSSSIP
                     SSSSTNLEISSSTRIPELSSSTNTEETTVNTESSSKCVVMKTETGYGQTINATKYIYT
                     TIASIDAPVTLSSFVTTYYETKSASA"
     gene            <401146..>402486
                     /gene="NDAI0G01820"
                     /locus_tag="NDAI_0G01820"
                     /db_xref="GeneID:11497354"
     mRNA            <401146..>402486
                     /gene="NDAI0G01820"
                     /locus_tag="NDAI_0G01820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671153.2"
                     /db_xref="GeneID:11497354"
     CDS             401146..402486
                     /gene="NDAI0G01820"
                     /locus_tag="NDAI_0G01820"
                     /inference="similar to DNA sequence:INSDC:YBR036C"
                     /note="similar to Saccharomyces cerevisiae CSG2 (YBR036C);
                     ancestral locus Anc_3.227"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671201.2"
                     /db_xref="GeneID:11497354"
                     /db_xref="UniProtKB/TrEMBL:G0WDU7"
                     /translation="MMKAVALWFTIVLGYVIQTKGFSHIQSKRYPSNVQTPLHSNPNR
                     DSYSNSTSAPTLHGRSNIPNATATTATGEPLNSHTLTVYLTFIYFASWLLILPISRIW
                     NETTSSSTFSTVSSNDNEQLLPLSMNDPNGNSSSSLSLDDGDTNDATLGDKIKKEEEF
                     RVLSPSTFKYVCKLFILSLLAVINVFTYNLALSLSPAFDVALIENTSIFEIVTLLYGV
                     CNVSRKNYIFRNFFVMMIALIGILIVSYTKATCDLLAGKLSINQDTGEVTDPFLFDRL
                     KGALICGLGALTIGPFAVLWNYWFATTTVTSPTSKSVKKATLTEQSSHLALIGCISMF
                     LLLPFLPTLPSPNEYISLLYSDKSFWLTIMASVMFGILPNVIAMIELNNYAPPEYLTT
                     CFLGIIIFMGLADWICEPTQTVIVRWEVIGYIMLSISCVILAFTLGEKPKKFAI"
     gene            complement(<402860..>403804)
                     /gene="NDAI0G01830"
                     /locus_tag="NDAI_0G01830"
                     /db_xref="GeneID:11497355"
     mRNA            complement(<402860..>403804)
                     /gene="NDAI0G01830"
                     /locus_tag="NDAI_0G01830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671154.2"
                     /db_xref="GeneID:11497355"
     CDS             complement(402860..403804)
                     /gene="NDAI0G01830"
                     /locus_tag="NDAI_0G01830"
                     /inference="similar to DNA sequence:INSDC:YBR024W,YBR037C"
                     /note="similar to Saccharomyces cerevisiae SCO2 (YBR024W)
                     and SCO1 (YBR037C); ancestral locus Anc_3.225"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671202.2"
                     /db_xref="GeneID:11497355"
                     /db_xref="GOA:G0WDU8"
                     /db_xref="InterPro:IPR003782"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017276"
                     /db_xref="UniProtKB/TrEMBL:G0WDU8"
                     /translation="MNQVIPQTQRMLSRSSSSGFRRSALRTVASMRAIPSSSLLINKR
                     VNIFRNFHTKFTPLYNKKPLSRVPVGGSESTSSSSKFKNSTLEFSSGKAMILFVLVGG
                     TLYYFFEKEKRRIETVKTAEANRGYGKPMIGGDFTLYDENGKEFTEKDLLGKFSIIYF
                     GFSHCPDICPDELDKLGVWLDELRKKYDIILQPIFITCDPARDSSEVLKEYLSDFHEG
                     IIGLTGSYEQVKNCCKKYRVYFSTPPSVKPGQDYLVDHSIFFYLMDPEGQFVEALGQN
                     YDEETGVEKIAGHVKNYIPEEKREALINSDKWYSFLFK"
     gene            complement(<404289..>408797)
                     /gene="NDAI0G01840"
                     /locus_tag="NDAI_0G01840"
                     /db_xref="GeneID:11497356"
     mRNA            complement(<404289..>408797)
                     /gene="NDAI0G01840"
                     /locus_tag="NDAI_0G01840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671155.2"
                     /db_xref="GeneID:11497356"
     CDS             complement(404289..408797)
                     /gene="NDAI0G01840"
                     /locus_tag="NDAI_0G01840"
                     /inference="similar to DNA sequence:INSDC:YDR011W"
                     /note="similar to Saccharomyces cerevisiae SNQ2 (YDR011W);
                     ancestral locus Anc_3.220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671203.2"
                     /db_xref="GeneID:11497356"
                     /db_xref="GOA:G0WDU9"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029481"
                     /db_xref="UniProtKB/TrEMBL:G0WDU9"
                     /translation="MSSAGSSSSSPNVGKEYHSDNQNTYNMDTLAETHTNNTKVDQPP
                     IKTTTNNKKNYSNGNEESFTYLSDNMITRVESFADALSRHTTRSGSFNTDSDDGFNIE
                     AIFSRFVRDADEQGIHLRKSGVTLEGVGAQGLDTSALEGSTFGSFLMLPYTIYKKFKA
                     KKRMKMRQIIRNCYALAEPGEMILVLGRPGAGCSSLLKTIAGEIDQFAGGVEGEMTYD
                     GISQKEMMQKFKGDVIYNGEQDVHFPHITVQQTLDFAIACKTPARRVNNVSREEYIVS
                     TRDLYATIFGLRHTYNTKVGNEYVRGISGGERKRVSIAEALAANGSIYCWDNATRGLD
                     ASTALEYAKAIRIMTNLLHSTAFVTIYQASENIYETFDKVLVLCQGKEIYYGHIENAK
                     AYFEKMGYDCPPRQATAEFLTAITDPNGYHKIKPGMESKVPRNSEELEAYWMNSVEFV
                     KLKEDISRYKEDVDTENTRNLYKDSMADEKSRFTRRKSRYNTSYWEQVRLCTIRGFQR
                     VYGNKSYTVINICAAVIQAFIIGSLFYNSPSTAQGAFSRGGILYFMLLYYSLMGLANI
                     SLEERPILQKHKGYSLYHLSAEPLGSMLAGFPFRMIGLTLFLIIIFFLTNLHRTPSAF
                     FIIYMFLTMCSEAINGLFQMVTSGCDTLAQANSITGVFMLAISLYSTYMIQLPSMHPW
                     FQWMSYVIPIRYAFESMLNAEFHGRHMDCGGTLVPTGPGYENVADDNKVCAFVGSEPG
                     QSWVLGDNYLRKQFQYEYKHTWRNFGIMWCFLIGFVVIRAVITEHKRPMQGGGDALVF
                     KKGSESFRVIAADEESSESSNNVDLKEMYYSSNSAEGEAVFEGLESRGVFIWKEILYT
                     IPYEGTQRKLLDNISGYCIPGTMTALIGESGAGKTTLLNTLAQRNEIGVVTGDILVNG
                     RPIDSSFERRTGYVQQQDIHIAELSVRESLQFSARMRRPESVPDEEKMAYVEKIIQVL
                     DMEEYAEALVGAIGYGLNVEQRKKLSIGVELCAKPDLLLFLDEPTSGLDSQSSWAIIQ
                     LLKRLTHAGQSILCTVHQPSATLFEQFDRLLLLRKGGQTVYFGDIGENSEILLSYFER
                     NSARKCSPKENPAEYILEIIGAGATASIKEDWHSIWKNSSEYKEVTNEVTSLIEELRE
                     KPDEAHIGKSPSKFATSYKYQFVYVLRRTAITFWRNLNYIMSKFMLFTVGGLYVGFTF
                     FDVGTSYTGLQNAMFAAFISIIMSAPAMNQIQGRAIAARDLYEVRESKSNMFHWSLLL
                     ITQFLNELPYQLVFSTIFFVSSYFPLRIFFEASRSGVYFLNYCIVFPLYFVGFGLMVL
                     YMAPNLPSANVLLGLALSFLIAFCGVTQPPSLMPGFWRRFMWRTSPYTYYVQNLVGIM
                     LHKKPVICSEKELNYFAPPSGQTCGEYMEPFLSRATGYITDPASTSNCSYCLYKVGDE
                     YLTRMESSYSYLWRNFGIFWIYIIFNLFGMIAVYYIFHVKKLSIFRLRLVKKFLDKIR
                     GIAPEEFD"
     gene            complement(<409416..>413918)
                     /gene="NDAI0G01850"
                     /locus_tag="NDAI_0G01850"
                     /db_xref="GeneID:11495687"
     mRNA            complement(<409416..>413918)
                     /gene="NDAI0G01850"
                     /locus_tag="NDAI_0G01850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671156.2"
                     /db_xref="GeneID:11495687"
     CDS             complement(409416..413918)
                     /gene="NDAI0G01850"
                     /locus_tag="NDAI_0G01850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671204.2"
                     /db_xref="GeneID:11495687"
                     /db_xref="GOA:G0WDV0"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029481"
                     /db_xref="UniProtKB/TrEMBL:G0WDV0"
                     /translation="MSGKNNDTTVGAAHQVDSSSASIANTELSFQGIRHHSASHDNFT
                     EGQESAGDKLSRIFTQGSGSYQASQFSADVVSNVESLAEVLSHHTTRDGPVPTEGNDF
                     DAAAIFSKFVRDANEQGIHIRKSGVTLEDVSAEGLDSSALEGATFGNILCLPLTIYKG
                     IKARKNMKMRRILNNVNVLAKAGEMVLVLGRPGAGCSSFLKVTAGEIDQFAGGIKGDI
                     TYDGIPQKEMMKHYKADVIYNGELDVHFPFLTVQQTLDFAIACKTPANRVNGVSKAEY
                     IQSTRELYATIFGLRHTYQTKVGNDFVRGVSGGERKRVSIAEALAANGSIYCWDNATR
                     GLDASTALEYTEAIRLMTNLLGSTAFVTIYQASENIYSLFDKVSLLYNGRQIYYGPVT
                     EAKEYFDRMGYECPPRQVTAEFLTALTDPNGLHQIKPGYERKIPRSAKEFEDYWLASP
                     EYAQLRKDIAEYKNSIDTDKTREIYNKSMAEEKSKGTRKKSYYTISYWDQILLCTKRG
                     FQRIYGNKSYTVINTCAAIIQSFIVGSLFYNTPSTTNGAFSRGGVLYFALLYYSLMGL
                     ANISFENRPILQKHKGYSLYHPSAEAIASTISEFPFRMIGRTLFIIILYFLAGLHTSA
                     GAFFMVYLFLTLTTEGISLMFEMIASACDTLAQANAINGVLMLAISLYSTYMIQLPSM
                     HPWFQWISYVLPIRYGFESMLNAEFHGRHMDCGGTLVPTGPGYENVADDNKVCAFVGS
                     EPGQSWVLGDDYLKKQFQYEYKHTWRNFGIIWCFLLGYLCVKAVITEFKRPVKGGGDA
                     MLYKKGTKIMKVADDEESTSDTANSLELKERFSSSNSSEVDLAGAFENLKSTAVFAWK
                     EVCFTIPYDGGQRMLLDHVSGYCVPGTMTALMGESGAGKTTLLNTLAQRNVGIITGDM
                     LINGRPIDSSFERRIGYVQQQDIHIAELSVRESLQFSARMRRDQRIPDSEKLAYVEKI
                     IQVLGMEPYAEALVGDVGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSW
                     AIIQLLRRLADAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGDIGHNSETLLR
                     YFERNGARKCTSKENPAEYILEAIGAGATASVKENWHDIWIRSPEYQASENKVSEIIN
                     ELSQKELTTGDDVNTAKYATSYAYQFNYVLRRTSLTFWRNLNYIMSKMMLLTTGGLFI
                     GFTFFGVGSSYTGLQNAMFAAFISIIMAAPAMNQIQARAIAARDLFEVRESKSNMFHW
                     SLLLITQFLNELPYHLLFSTIFFVSSYFPLRNFFQASRSGVYFLNYCIMYQLYYVGFG
                     LMVLYVSPNLPSANVILGLCLSFLISFCGVTQPPSLMPGFWTFMWKASPLTYFVQNMI
                     GIMLHDKKVVCSKKELNYFNPPAGQTCGEYMDPFLSGATGYINNPDATSDCAYCLYEV
                     GDNYLASISAPYSNLWRNFGIFWIYIVFNIIAMVSLYYLLHVKNVSPLTGVMKLATKV
                     KSKGKK"
     gene            complement(<416459..>418027)
                     /gene="NDAI0G01860"
                     /locus_tag="NDAI_0G01860"
                     /db_xref="GeneID:13926872"
     mRNA            complement(<416459..>418027)
                     /gene="NDAI0G01860"
                     /locus_tag="NDAI_0G01860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980018.1"
                     /db_xref="GeneID:13926872"
     CDS             complement(416459..418027)
                     /gene="NDAI0G01860"
                     /locus_tag="NDAI_0G01860"
                     /inference="similar to DNA sequence:INSDC:YBR020W,YDR009W"
                     /note="similar to Saccharomyces cerevisiae GAL1 (YBR020W)
                     and GAL3 (YDR009W); ancestral locus Anc_3.219"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980067.1"
                     /db_xref="GeneID:13926872"
                     /db_xref="GOA:J7S4D3"
                     /db_xref="InterPro:IPR000705"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR006206"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR019539"
                     /db_xref="InterPro:IPR019741"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:J7S4D3"
                     /translation="MSIPVFHTNDRDLPDLALKKCPQVIENFKQTYGIEPDFVSRSPG
                     RVNLIGEHIDYTDFSVLPLAIENDMLCAVKILERKENPSITLTNSDSRFAQRKFDLPL
                     DGSYVTIDPSISDWSNYFKCGLHVAQQFLKGLHPQLYLNNPLIGLQVFCQSDIPVGSG
                     LSSSSAFICAVALAVIRANLGTTYAVSKKDLTRITCIAEHYLGVSNGGMDQATSVYGQ
                     EDHALFVEFKPNLKATPFKFPKLQNHEIQFLIANTLIVANKFDTAPTNYNLRVIEVTT
                     AANVLANKYGVALPHIPDSTMERGNLRDFMDAYYARYPVSHDNESKDVIMIEIERLTK
                     MLELVEESLGEKKEGFTVDDVAEALDCSREEYTRDYLLVFPVRFQVLKLYKRAKHVFS
                     EAQRVLKALKLMTSASPIENDEEFFQQFGQLMNESQESCDKLYECSCPEIDTICSTAL
                     QNGSYGSRLTGAGWGGCTVHLVSSGPNGNVEKVKKALIDQYYKVVCPNISDKELEEVI
                     LVSKPALGSCLYEL"
     gene            <419698..>420804
                     /gene="NDAI0G01870"
                     /locus_tag="NDAI_0G01870"
                     /db_xref="GeneID:11497358"
     mRNA            <419698..>420804
                     /gene="NDAI0G01870"
                     /locus_tag="NDAI_0G01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671157.2"
                     /db_xref="GeneID:11497358"
     CDS             419698..420804
                     /gene="NDAI0G01870"
                     /locus_tag="NDAI_0G01870"
                     /inference="similar to DNA sequence:INSDC:YBR018C"
                     /note="similar to Saccharomyces cerevisiae GAL7 (YBR018C);
                     ancestral locus Anc_3.217"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671205.2"
                     /db_xref="GeneID:11497358"
                     /db_xref="GOA:G0WDV1"
                     /db_xref="InterPro:IPR001937"
                     /db_xref="InterPro:IPR005849"
                     /db_xref="InterPro:IPR005850"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019779"
                     /db_xref="UniProtKB/TrEMBL:G0WDV1"
                     /translation="MTHQEFDFTDHSHRRYNPLTDSWILVSPHRAKRPWLGQQETPSR
                     PNAPEYDDKCFLCPGNHRATGGSNPKYESTYIFQNDYAAVKTEQPTLPENYNGKDVLK
                     NRLFKVESVRGNCFVICFSPKHNVTIPQMEHGELINVVGAWQKLYNDLAKEARENEKP
                     FKYVQIFENKGTAMGCSNLHPHGQAWCLEAIPSEVSQELKSFKKYKHENHADLLGDFV
                     KLELQERSRIVIENDTFMCVVPYWAVWPFETMIVSKTKIASVAQFTESQKSDLASIMK
                     TLTIKYDNMFECSFPYSMGLHQAPLNATGEELENSWFHMHFYPPLLRSATVRKFLVGF
                     ELLGEPQRDLTAEQAAQRLRNLDGEVHYLEKLDS"
     gene            complement(<421240..>422103)
                     /gene="NDAI0G01880"
                     /locus_tag="NDAI_0G01880"
                     /db_xref="GeneID:11497359"
     mRNA            complement(<421240..>422103)
                     /gene="NDAI0G01880"
                     /locus_tag="NDAI_0G01880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671158.2"
                     /db_xref="GeneID:11497359"
     CDS             complement(421240..422103)
                     /gene="NDAI0G01880"
                     /locus_tag="NDAI_0G01880"
                     /inference="similar to DNA sequence:INSDC:YIL003W"
                     /note="similar to Saccharomyces cerevisiae CFD1 (YIL003W);
                     ancestral locus Anc_7.136"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671206.2"
                     /db_xref="GeneID:11497359"
                     /db_xref="GOA:G0WDV2"
                     /db_xref="InterPro:IPR000808"
                     /db_xref="InterPro:IPR019591"
                     /db_xref="InterPro:IPR025723"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028600"
                     /db_xref="UniProtKB/TrEMBL:G0WDV2"
                     /translation="MSDSAFGEEQEEIEGPAPSLSQIKHIILILSGKGGVGKSSVTTQ
                     AALTLCNMGYKVGVLDIDLTGPSLPRMFGLENRSIYQDVDGWLPVPVETNGIGELKVI
                     SLGFLLGDRGNSVVWRGPKKTAMIKQFIKDVAWGQLDYLLIDTPPGTSDEHISIAEQL
                     RFSEPDGAIVVTTPQGVATADVRKELNFCKKVALHILGVVENMSGFICPHCEECTNIF
                     SSGGGAKLATEFDVPYLGNIPIDPKFVEMIENQNVSEKNLVESYGESTLCPIFKNIMD
                     KVLAQNRPPRC"
     gene            complement(<422805..>424826)
                     /gene="NDAI0G01890"
                     /locus_tag="NDAI_0G01890"
                     /db_xref="GeneID:11497360"
     mRNA            complement(<422805..>424826)
                     /gene="NDAI0G01890"
                     /locus_tag="NDAI_0G01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671159.2"
                     /db_xref="GeneID:11497360"
     CDS             complement(422805..424826)
                     /gene="NDAI0G01890"
                     /locus_tag="NDAI_0G01890"
                     /inference="similar to DNA sequence:INSDC:YEL007W"
                     /note="similar to Saccharomyces cerevisiae YEL007W;
                     ancestral locus Anc_7.132"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671207.2"
                     /db_xref="GeneID:11497360"
                     /db_xref="InterPro:IPR018608"
                     /db_xref="UniProtKB/TrEMBL:G0WDV3"
                     /translation="MTMNIEPTFRGYISDEKDAMKIIQATLDGKLKYIPRRPYEIERP
                     QLITSGNIFVFIEEISGIKRWTDGVPWSPSRIAGKFLIYRELNKDKDKEKDKDKVNES
                     DKDKEKGNEKDNDTDKEKGKEIYRERKLSKSSSKDSTEQLKDEFKTTGLLKKTISVKL
                     KRLLFDSVENVHLISYYTLQDVKDAKFPDIKLSPILANVEPSAELIRAIDGISLGNVK
                     GGYNNNNNNNNNNNNNNNNNNNNNNDNGSMAFNKQSSIQNFQGNLPTTTNGISKFNTA
                     PIILSQNGPEYYPNSTDAMMMAMKPMSYVNDKNLNNTTSQPNTAYLSAYMFQPQYPFT
                     NNSNTNVSNVNNNTGRYHLYNTSFLPNNSAYGYPDYPTSFATLQAPLPYGYNNGQLFS
                     TNHPPYYNNSFPPPSSNIINNNAANQMNQNTTSEQSSRNTLPPTYYLMNADPQPSPNN
                     NNNTSAGTTSSHPSNNSIPMPPSLTNNSYASYPMNVSYYNPAPAISPHPHPSTQYSQQ
                     QPTTRSSVSNPTPSSLRSMYNKNGAITSDYTFYSNNNTTKDNNTNRTVPVDKDNNYQQ
                     YNSNSEIQRKNSNHGSNDMDSSSSYGITKQNYNNNNVIPSTSSPSSSSAQSGQQNNNN
                     NNYYHSGYKNYNYPLGANASAAPPPSLPNLNQQQQSQSSELQPLPPQQR"
     gene            <427004..>429964
                     /gene="NDAI0G01900"
                     /locus_tag="NDAI_0G01900"
                     /db_xref="GeneID:11497361"
     mRNA            <427004..>429964
                     /gene="NDAI0G01900"
                     /locus_tag="NDAI_0G01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671160.2"
                     /db_xref="GeneID:11497361"
     CDS             427004..429964
                     /gene="NDAI0G01900"
                     /locus_tag="NDAI_0G01900"
                     /inference="similar to DNA sequence:INSDC:YER047C"
                     /note="similar to Saccharomyces cerevisiae SAP1 (YER047C);
                     ancestral locus Anc_7.215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671208.2"
                     /db_xref="GeneID:11497361"
                     /db_xref="GOA:G0WDV4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WDV4"
                     /translation="METSGNNHHILTRWTRIRKRPQQPLTDLTELYSRVANESIYYLK
                     LEDRNCLKKSLQGWKALSTETLFKLTLIENSHPNFTSYTRDESSLQIGIKELYQKSLN
                     HIERLQKLIKKEEEDIKGNRDSIDANKKHLTTSSFTRSRRKHFPSQASSTTPSGIYYS
                     KKMVTTLRNNSNDNHREHHLNTNILKQNNSSPSITHVHYPNISSQPASRPIYHSASST
                     SSNSFNLKSKVNFTSSKPLNFYDDNGTTNTNKFRKNKDIPKEQMEQEGAKTDIIFKDF
                     DDVVDTTVCTDNDNNNNNNNNNNDDQDTTISTNKSVPEFDLEDYFDSYLDSDEDKPDD
                     EDTSDMIRSKTLSSLSKCSSNTSSNSSYPSVIPPLPPSLPPLPPPSSIESSLKKPIST
                     TQITKNLKAFNSSPEIQFRSSTKDNLSHRKAVPSSSNSPSPTHSLLLARNSDLTSNKQ
                     ESKLLHPSSSYSSASKKTISSVSQQQLRPITQAATKATKATKATKKSSSTYNKKPSSS
                     SSHNNLQSNIPNKVSNIHHKKVISNSLTNKRKIKSQVSSAKYTTQQQQQQQQQQQSKT
                     KALKLQENINGKTKMKLKTNVPSTLTNRPKTKSTTNIKKMPQEKKFTSAATPSSSLSS
                     SSLSPPPHPPPIELTPTPQTTIEPPPEETKILEEKFINSLTGVDKQAAKQILSEIVVH
                     GDQVHWDDIAGLESAKNSLKEAVVYPFLRPDLFRGLREPIRGMLLFGPPGTGKTMLAR
                     AVACESHSTFFSISASSLTSKYLGESEKLVRALFVIAKKLSPSIVFVDEIDSIMGSRN
                     NENENESSRRIKNEFLVQWSSLSSAAISKDTGKNDIITSSPGREEHKEEDNRVLVLAA
                     TNLPWCIDEAARRRFVRRQYIPLPEEATRIVQFKRLLAHQKNTLTEDDFNELIKLTEG
                     FSGSDITALAKDAAMGPLRELGDKLLDTARDNIRSIDLNDFKNSLAYIKPSVSKESLI
                     EYEEWAAKFGSSGA"
     gene            complement(<430147..>430563)
                     /gene="NDAI0G01910"
                     /locus_tag="NDAI_0G01910"
                     /db_xref="GeneID:11497362"
     mRNA            complement(<430147..>430563)
                     /gene="NDAI0G01910"
                     /locus_tag="NDAI_0G01910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671161.2"
                     /db_xref="GeneID:11497362"
     CDS             complement(430147..430563)
                     /gene="NDAI0G01910"
                     /locus_tag="NDAI_0G01910"
                     /inference="similar to DNA sequence:INSDC:YER046W"
                     /note="similar to Saccharomyces cerevisiae SPO73
                     (YER046W); ancestral locus Anc_7.212"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671209.2"
                     /db_xref="GeneID:11497362"
                     /db_xref="UniProtKB/TrEMBL:G0WDV5"
                     /translation="MSKNTFIKDLEAFPKDIIIENERGLTFLGYPFYSPRLLIPRIDP
                     PQFQIFIHSTGLLQCVSDDIIQSFQYFYPLESQFDEENAIKNDEKWFVMMDFKDRYDM
                     DDQGWCYSWSFNNSRWKSKNGIVRRRVWVKLPSKKK"
     gene            <434073..>435119
                     /gene="NDAI0G01920"
                     /locus_tag="NDAI_0G01920"
                     /db_xref="GeneID:11497363"
     mRNA            <434073..>435119
                     /gene="NDAI0G01920"
                     /locus_tag="NDAI_0G01920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671162.2"
                     /db_xref="GeneID:11497363"
     CDS             434073..435119
                     /gene="NDAI0G01920"
                     /locus_tag="NDAI_0G01920"
                     /inference="similar to DNA sequence:INSDC:YER045C,YIL036W"
                     /note="similar to Saccharomyces cerevisiae ACA1 (YER045C)
                     and CST6 (YIL036W); ancestral locus Anc_7.211"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671210.2"
                     /db_xref="GeneID:11497363"
                     /db_xref="GOA:G0WDV6"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:G0WDV6"
                     /translation="MPNLPVCAQFMPSANLSSAYQPVNTPGSFIFFLSDSFDTNSGTG
                     IKNQSFDNRRPINSTLDSPSYPPINNIPNIIYEPLLTNQRQQQLSPHIIPQGQVRDEN
                     REGPEAPASFIEFFAEKPKLLSQSTFVPSTIQVNSSDKISITSPHSYLYRNRTIISFQ
                     SFKTKEKIITCTNGQITHLTEDINTVNDVYDSQPPPFPGKAKGKKGYNIHVMTMNNNN
                     MEHMQTPKEAERERLLERNRLAASKCRKRKRLQEEKFQEDYRKALQENSFLKKKIELY
                     EKWIKNLKTGDQNGKGICSSLNETKTKMEVGKIEVDGNKKRRRVPTTVEELSMIVDIE
                     DLDTLGAILSLESN"
     gene            <435402..>436630
                     /gene="NDAI0G01930"
                     /locus_tag="NDAI_0G01930"
                     /db_xref="GeneID:11497364"
     mRNA            join(<435402..435443,435527..>436630)
                     /gene="NDAI0G01930"
                     /locus_tag="NDAI_0G01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671163.2"
                     /db_xref="GeneID:11497364"
     CDS             join(435402..435443,435527..436630)
                     /gene="NDAI0G01930"
                     /locus_tag="NDAI_0G01930"
                     /inference="similar to DNA sequence:INSDC:YER044C-A"
                     /note="similar to Saccharomyces cerevisiae MEI4
                     (YER044C-A); ancestral locus Anc_7.210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671211.2"
                     /db_xref="GeneID:11497364"
                     /db_xref="UniProtKB/TrEMBL:G0WDV7"
                     /translation="MNLDLTSEDIEWIVCFALIQHRNKKIWKLVTNKLEKRKDFPVDV
                     CEVIPSKLNKVMLNKREHFDQLKPIYMFNRNAHFETLTKHLFDKPQIFSTFSDDISKV
                     NMTKWYYPRYKLLLLELFEKNSNNIKIDTKLYHLFQCFQELTISFCCFQLDSDFLFLR
                     NFLCKTLLYRTIFKDILSLYLNYLTNDQGSDDEKKKANAIRNKRANTSLIWTMKLHLK
                     TVVNIFNFQIHNASPPRKEAVVIQLIEKYLLLIGNLFHVLINLLDRSLLKYHNTKTAY
                     VKLYQRKKNILPHYYWDDFKNILQTYSQFEDIKEEGTDFLKCTLRELIELVGGINWRK
                     LKEKGKCEGTKFREIKVAIQFIQAELLLLRDSNLIALFYSNTRDIFN"
     gene            <437190..>437627
                     /gene="NDAI0G01940"
                     /locus_tag="NDAI_0G01940"
                     /db_xref="GeneID:11497365"
     mRNA            <437190..>437627
                     /gene="NDAI0G01940"
                     /locus_tag="NDAI_0G01940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671164.2"
                     /db_xref="GeneID:11497365"
     CDS             437190..437627
                     /gene="NDAI0G01940"
                     /locus_tag="NDAI_0G01940"
                     /inference="similar to DNA sequence:INSDC:YER044C"
                     /note="similar to Saccharomyces cerevisiae ERG28
                     (YER044C); ancestral locus Anc_7.207"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671212.2"
                     /db_xref="GeneID:11497365"
                     /db_xref="GOA:G0WDV8"
                     /db_xref="InterPro:IPR005352"
                     /db_xref="UniProtKB/TrEMBL:G0WDV8"
                     /translation="MSNILTQIQASLQRMPQGYLPKWLLFISIVSIFNSIQTYFSGLE
                     LTRKVYAGKPKETTFLSARTFGTWTFISCVIRLYGAFYLNEPHIYQLAFISYIVALVH
                     FGSELLIFRTCSFNSGFMGPLIVSTTSLIWMYNQKEFYTGVPW"
     gene            complement(<437843..>440377)
                     /gene="NDAI0G01950"
                     /locus_tag="NDAI_0G01950"
                     /db_xref="GeneID:11497366"
     mRNA            complement(<437843..>440377)
                     /gene="NDAI0G01950"
                     /locus_tag="NDAI_0G01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671165.2"
                     /db_xref="GeneID:11497366"
     CDS             complement(437843..440377)
                     /gene="NDAI0G01950"
                     /locus_tag="NDAI_0G01950"
                     /inference="similar to DNA sequence:INSDC:YFR038W"
                     /note="similar to Saccharomyces cerevisiae YFR038W;
                     ancestral locus Anc_7.205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671213.2"
                     /db_xref="GeneID:11497366"
                     /db_xref="GOA:G0WDV9"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WDV9"
                     /translation="MVVFKRKTRFSRRSVTPLVDYKEKEVSDLTPDVLNSDSDTAVRD
                     GNDAINEPIWLHDDLNLDSDIQLDSDADTGGNGNNDDDESLDNLLKSKNERDKEHQDD
                     DNSGADNTDESDTKAVSLKLKKLNEFVTQSQVYSGIIADTLLKRTNELEQEKNTADPI
                     TGEEDNIEEPPKKKAKTSILDFFRKKEKKEIKEEVDSKEVLDDETISKEQPHLLKNCI
                     LKPYQLEGLNWLITLYENGLNGILADDMGLGKTIQSIALLAFIYEMDTEGPFLIAAPL
                     STIDNWMNEFQKFAPDLPVLKYYHHGGQNDRTKLLRKFFKKTNGTGIIVTSYEIIIRD
                     SDFIMSKNWKFLIVDEGHRLKNINCKLIKELKKINTSNKLLLTGTPLQNNLSELWSLL
                     NFIMPNIFADFEIFSKWFDFEGLNLQSNSMKLNKMINDELQKNLISNLHTILKPFLLR
                     RLKKTVLADILPPKREYVVNCPLTSIQKKFYTRGLTGKLKKTIFKEYVKTFFTMNAEY
                     IGKVSNKSIREFIDCKLGEDETLDIDDMNDTLKSMDLLYQKHIHPYLVNKRLQNMMMQ
                     LRQIVDSTLIFYFPYLHPEDLTLEILLKSSGKLQTLQKLIIPLIKAGHKTLIFSQFTN
                     MLDLLEDWCELNSLRALRIDGSVDTESRKDLIEQFNKKSGKKQAQVFLLSTRAAGLGI
                     NLTAADTVVLFDSDWNPQVDLQAMDRCHRIGQEKPVIVYRLCCDNTLEHVILTRAANK
                     RKLERLVIQMGKFNTLKKLALNEGSFLNQAKTEHTSNKELVEELSQLLMSNQSSIGFT
                     RANDKISEELSDEEIKELTDRSLEAYKPDRQVDLPHVRLFETTSGF"
     gene            <440882..>442567
                     /gene="NDAI0G01960"
                     /locus_tag="NDAI_0G01960"
                     /db_xref="GeneID:11497367"
     mRNA            <440882..>442567
                     /gene="NDAI0G01960"
                     /locus_tag="NDAI_0G01960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671166.2"
                     /db_xref="GeneID:11497367"
     CDS             440882..442567
                     /gene="NDAI0G01960"
                     /locus_tag="NDAI_0G01960"
                     /inference="similar to DNA sequence:INSDC:YFR037C"
                     /note="similar to Saccharomyces cerevisiae RSC8 (YFR037C);
                     ancestral locus Anc_7.204"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671214.2"
                     /db_xref="GeneID:11497367"
                     /db_xref="GOA:G0WDW0"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:G0WDW0"
                     /translation="MSTEETTPLPTEEQPLQQVEVEETQEEENADVNMIQDEEATETV
                     PESAIDNNNKPHEINYEEEAQKLEERALKFLAKQTHPIIIPSFAQWFDISKIHEIERR
                     SNPDFFDDSSRFKSPKSYKDTRNFIINTYRLSPFEYLTITAVRRNIAMDVSSIVKIHS
                     FLERWGLINYQIDPKSKPSLIGPAFTGHFQMILDAPQGLKPMIPTETITTQNDDGSTV
                     ETEGGSNKVKRGPFPLNLSLRQNVYDSTNDFNALQSASSNNNKQPINKTYVCHTCGNN
                     AVTVRYHNLRSKDSNLCARCFKEGHFGANFQSTDFIKLENDSKRTKTWSDQEILLLLE
                     GLEMYEDQWEKIVDHVGGTKSLEDCVEKFLSLPIEDKYINDIIGSKKDVQKDNDEGTS
                     KPIFNTVEAVDATIKSLLGGLHKETLDEAIPESANRLAEKYIQETQAVALELVNLTMK
                     KLDLKYSKLIKLETSLEEERARYIKETERANNDRLSLSKQVAELNEELSKLNISKRVV
                     LASEQVDAGIKLVDNDEENDELNETNTALKKISDQEAEALSQLEPQVYKPWSL"
     gene            <442962..>446510
                     /gene="NDAI0G01970"
                     /locus_tag="NDAI_0G01970"
                     /db_xref="GeneID:11497368"
     mRNA            <442962..>446510
                     /gene="NDAI0G01970"
                     /locus_tag="NDAI_0G01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671167.2"
                     /db_xref="GeneID:11497368"
     CDS             442962..446510
                     /gene="NDAI0G01970"
                     /locus_tag="NDAI_0G01970"
                     /inference="similar to DNA sequence:INSDC:YIL026C"
                     /note="similar to Saccharomyces cerevisiae IRR1 (YIL026C);
                     ancestral locus Anc_7.201"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671215.2"
                     /db_xref="GeneID:11497368"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR020839"
                     /db_xref="UniProtKB/TrEMBL:G0WDW1"
                     /translation="MAERRRSARISSKSSASSSIAKEVDHSTRSIETDEHTAIDHDND
                     DSNSELESESESEEDDNEDDEDYIESSKKKGSARATTNKRKRTNNNGIRSTNKRTKTV
                     PTSRSSVLSSTSAKKDQETYLELIKDFEPTELFEILATSEDVSIVELLTSWLETYTEN
                     RDKFLKEFINLVLNCCGAVATVEDHDVHSNDSSNETIGEVQLMFQRQKIHEFHLLVSK
                     EHKKKSKYKPLYNNFVEFMSKLLDVANDLQLLFIESSPINKNDETNSENNENTEITMG
                     PLVLDLLTWLSSFSVSKVRSFRYISTLSLYLFQDYLTNYIMILDKNYLSKLSKQLAVE
                     EKKKRPNKKTLEKLNLTIMEIQGNKTVTESIIDNIVKLCFIHRFKDVDESIRSESMVH
                     LAIWTENFPEYFLKVTFLKYFGWLLSDESSSVRIEVLKVLPKLVVDDRGKPTDNSFIR
                     QFFERFKQRILEIALKDVDLEVRIQSINVLTGISSLDYLEDSEMLLILSTIFSNHDIK
                     VSSTSKNSRFLASVAKFFARITNEKCQEFMNDNNLPKTIDNMSIDSTIKIGIFIRLLS
                     NSFVSHLEMIKSGVEPREKIHILFQAAEFLFPYFGSQIENICQLLINDEISNDIAKQL
                     STKENDDQEEEANDDLDITPLFPTDSNSIVLYVTVLNGLTQGGISSKNSTKFHISDII
                     IPNYEKLMLNLPLQSIDILAPILEIFTLFTFEDWIHAGYEKTVSKVTEAIMKMFKESN
                     LVCSDADMKYQSFSKVFQHIKKFELKELDELCVNELTYLKLQLENFLKDKMEKNEIGS
                     PENFNETIVDLYEVYVNKLVLLGKGYTLEFDESLIKLFFKNYMSHMPSMLDSLDIETI
                     ELMDFKLLVLLVTWQLQKWEDIFENLDPTSSQFNNTSTLKTSMNTIILIIESLNKIMI
                     NLPASTESTMTAIYLLNRSLSNSTIDIVVAVRVFELKLPDSNPWKETLKNKLPYYLHT
                     DVSNTFMEVYLYLESCAVNVNESGIHLDRLAEEDVNLNELPKEELFGGNYERELLLFT
                     IKLKGLIKLELLRGDIVSRIALNKDHLSPLYTKVIDDTIFKTSTTEASSTKRSIATVN
                     TRERDLEYNGIERNNTEMEEQDRLDPIEDSSQPTQDDEPMVTNRRYEGLEPIEEQSQE
                     LSQEVSPQPFRSISENLSGIGGTADSRSNNIEDSDA"
     gene            complement(<446757..>447107)
                     /gene="NDAI0G01980"
                     /locus_tag="NDAI_0G01980"
                     /db_xref="GeneID:11497369"
     mRNA            complement(<446757..>447107)
                     /gene="NDAI0G01980"
                     /locus_tag="NDAI_0G01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671168.2"
                     /db_xref="GeneID:11497369"
     CDS             complement(446757..447107)
                     /gene="NDAI0G01980"
                     /locus_tag="NDAI_0G01980"
                     /inference="similar to DNA sequence:INSDC:YFR036W"
                     /note="similar to Saccharomyces cerevisiae CDC26
                     (YFR036W); ancestral locus Anc_7.199"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671216.2"
                     /db_xref="GeneID:11497369"
                     /db_xref="GOA:G0WDW2"
                     /db_xref="InterPro:IPR018860"
                     /db_xref="UniProtKB/TrEMBL:G0WDW2"
                     /translation="MLGRPPTTLQLNKDDISELVKELEERKLKLKIEANRRKLQVSVQ
                     QAPLKKSNSAMGSTSLNETITDINIMKENGIELKAMMNSSIDASHQVTVTPRVTTHPT
                     IDDGSDNPFYKREL"
     gene            447377..447448
                     /gene="NDAI0Ltrna6K"
                     /locus_tag="NDAI_0Ltrna6K"
                     /db_xref="GeneID:11498378"
     tRNA            447377..447448
                     /gene="NDAI0Ltrna6K"
                     /locus_tag="NDAI_0Ltrna6K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:11498378"
     gene            448930..449020
                     /gene="NDAI0Ltrna5P"
                     /locus_tag="NDAI_0Ltrna5P"
                     /db_xref="GeneID:11498212"
     tRNA            join(448930..448966,448984..449020)
                     /gene="NDAI0Ltrna5P"
                     /locus_tag="NDAI_0Ltrna5P"
                     /product="tRNA-Pro"
                     /note="codon recognized: CCA"
                     /db_xref="GeneID:11498212"
     gene            complement(<449171..>449476)
                     /gene="NDAI0G01990"
                     /locus_tag="NDAI_0G01990"
                     /db_xref="GeneID:11497370"
     mRNA            complement(<449171..>449476)
                     /gene="NDAI0G01990"
                     /locus_tag="NDAI_0G01990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671169.2"
                     /db_xref="GeneID:11497370"
     CDS             complement(449171..449476)
                     /gene="NDAI0G01990"
                     /locus_tag="NDAI_0G01990"
                     /inference="similar to DNA
                     sequence:INSDC:Scer_YGOB_ADL119W"
                     /note="similar to Saccharomyces cerevisiae ADL119W
                     (Scer_YGOB_ADL119W); ancestral locus Anc_7.195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671217.2"
                     /db_xref="GeneID:11497370"
                     /db_xref="UniProtKB/TrEMBL:G0WDW3"
                     /translation="MKTIVIPDTRFQQVFQNALERERNKLYPDTTKQNTGTLVTESLV
                     IFKVILRDVILLPFIQSVLWTEFLIVCKPRIYRGFKSIANFNIKNITNMLTGRTNNY"
     gene            <449842..>450777
                     /gene="NDAI0G02000"
                     /locus_tag="NDAI_0G02000"
                     /db_xref="GeneID:11497371"
     mRNA            <449842..>450777
                     /gene="NDAI0G02000"
                     /locus_tag="NDAI_0G02000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671170.2"
                     /db_xref="GeneID:11497371"
     CDS             449842..450777
                     /gene="NDAI0G02000"
                     /locus_tag="NDAI_0G02000"
                     /inference="similar to DNA sequence:INSDC:YIL021W"
                     /note="similar to Saccharomyces cerevisiae RPB3 (YIL021W);
                     ancestral locus Anc_7.194"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671218.2"
                     /db_xref="GeneID:11497371"
                     /db_xref="GOA:G0WDW4"
                     /db_xref="InterPro:IPR001514"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="InterPro:IPR011262"
                     /db_xref="InterPro:IPR011263"
                     /db_xref="UniProtKB/TrEMBL:G0WDW4"
                     /translation="MSEEGPQVKIREATKDNVDFILSNIDLALANSFRRVMIAEIPTL
                     AIDSVQIETNTTVLADEFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQ
                     AFGESESTTNVYAKDLVIVSNLLGRNIGHPIIQDKENNGVLICKLRKGQELKLTCVAK
                     KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDPQKEWPNSKNCEYEDPPNEGEP
                     FDYKAKAETFYMNVETVGSISVDQVVVRGINTLQQKVASILLALTQMDQEKMQYATVT
                     EGQQGNNMMNQDVDMDGDAYANGANNQPGAYNDAW"
     gene            <451247..>452284
                     /gene="NDAI0G02010"
                     /locus_tag="NDAI_0G02010"
                     /db_xref="GeneID:11497372"
     mRNA            <451247..>452284
                     /gene="NDAI0G02010"
                     /locus_tag="NDAI_0G02010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671171.2"
                     /db_xref="GeneID:11497372"
     CDS             451247..452284
                     /gene="NDAI0G02010"
                     /locus_tag="NDAI_0G02010"
                     /inference="similar to DNA sequence:INSDC:YIL019W"
                     /note="similar to Saccharomyces cerevisiae FAF1 (YIL019W);
                     ancestral locus Anc_7.192"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671219.2"
                     /db_xref="GeneID:11497372"
                     /db_xref="UniProtKB/TrEMBL:G0WDW5"
                     /translation="MGSNNNNSDEDTEYLKALEAQRLAFESQFGSLESMGFEDKTKDI
                     TVGSDSSSHNSDSDINDNNNDDDEEEDSENDGDSDSDSDIDVGSRDNETKVTEKSSSM
                     ITRGPKVITFNGPADDFIAPSKKDKKLLSSGKSLIHTIIKEQESEEREMNDNKNDNEN
                     LEEENLQNDIELQQFLKESHLLSAFNNNNSTSSSITSGVALTLQGMNGSKSDSIAYQD
                     DQVMGKARARTLEMRLNGLSKINGHSKNIDKLEKVPMHVRKGMIKKHVERIQRYEKDA
                     AEGGIVLSKVKKGQFRKIESTYKKDIERRIGQSIKRKDIERNTRRERGLKINTIGRST
                     RNGLVVSKSRH"
     gene            <453131..>454948
                     /gene="NDAI0G02020"
                     /locus_tag="NDAI_0G02020"
                     /db_xref="GeneID:11497373"
     mRNA            <453131..>454948
                     /gene="NDAI0G02020"
                     /locus_tag="NDAI_0G02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671172.2"
                     /db_xref="GeneID:11497373"
     CDS             453131..454948
                     /gene="NDAI0G02020"
                     /locus_tag="NDAI_0G02020"
                     /inference="similar to DNA sequence:INSDC:YFR034C"
                     /note="similar to Saccharomyces cerevisiae PHO4 (YFR034C);
                     ancestral locus Anc_7.191"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671220.2"
                     /db_xref="GeneID:11497373"
                     /db_xref="GOA:G0WDW6"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:G0WDW6"
                     /translation="MMYLDAGKSSFLDVVEKYVKEKGSSPPGNAETSGSNYKYDEHLT
                     ATMKTITIPKINQNVYEDITGNNSNTNKNQPDADFTTKQPFQNENNKIRIKEYINISE
                     TSSSSFANGDKGNVAENDDIHNDEHLPTESLFKDTRDSSTHHYHTTENMTYWNSTSLN
                     DLDKFVSSFPTKDNMTNLVNDFYLNTAKDNNTIDTNIDVTSHLQTTRNISIGEGDHMP
                     FKTEPVKKRKTSKIDKKVSFSPRPSPLVSNFTASSNFEYTPLIKTASSTSDNVTPYLG
                     LQNGHSSEPQVNGLSSSSTHNIYDESPATVDFEYLGSELQNKLFKDLFSVEELNIDLP
                     SPANLNTTTANNTRYNTRSNDGNDGVSNDNKNNNNNNDTYNGKVRKATTMRPPSKSHV
                     TRTNKRHSTGEPINFILPSTSTTPKMTNVMKKGSASALSSPVITYTKVPAEEGSDTRK
                     SNSKSNYVVASKSPVIKPLKPKNRSSSSNLDSTTPKMMLLPTSAIQPTTTTTDAPLNL
                     GVPAISTVSKKSKTTPADISTKSSSPSLTPNGKKVEKKTTHREAEAERRNRLNNALTD
                     LNSLLPEGLKKSVSIQSKAVIVELASKYIRQLLQELERK"
     gene            <455529..>455927
                     /gene="NDAI0G02030"
                     /locus_tag="NDAI_0G02030"
                     /db_xref="GeneID:11497374"
     mRNA            <455529..>455927
                     /gene="NDAI0G02030"
                     /locus_tag="NDAI_0G02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671173.2"
                     /db_xref="GeneID:11497374"
     CDS             455529..455927
                     /gene="NDAI0G02030"
                     /locus_tag="NDAI_0G02030"
                     /inference="similar to DNA sequence:INSDC:YFR033C"
                     /note="similar to Saccharomyces cerevisiae QCR6 (YFR033C);
                     ancestral locus Anc_7.190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671221.2"
                     /db_xref="GeneID:11497374"
                     /db_xref="GOA:G0WDW7"
                     /db_xref="InterPro:IPR003422"
                     /db_xref="InterPro:IPR023184"
                     /db_xref="UniProtKB/TrEMBL:G0WDW7"
                     /translation="MLETVTEYLELLKETIIPVVAKADDEDPVDEQEAEEEEEDEGEE
                     EEEEEEEEEEDEDELHDQFDELRNELKETEKGQRLLKAYSDCSERVRIEQQRPDYDDL
                     DHKEDCIEEFFHLQHYLDSTAAPRLFDKLK"
     gene            <457318..>457509
                     /gene="NDAI0G02040"
                     /locus_tag="NDAI_0G02040"
                     /db_xref="GeneID:11497375"
     mRNA            <457318..>457509
                     /gene="NDAI0G02040"
                     /locus_tag="NDAI_0G02040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671174.2"
                     /db_xref="GeneID:11497375"
     CDS             457318..457509
                     /gene="NDAI0G02040"
                     /locus_tag="NDAI_0G02040"
                     /inference="similar to DNA sequence:INSDC:YFR032C-A"
                     /note="similar to Saccharomyces cerevisiae RPL29
                     (YFR032C-A); ancestral locus Anc_7.189"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671222.2"
                     /db_xref="GeneID:11497375"
                     /db_xref="GOA:G0WDW8"
                     /db_xref="InterPro:IPR002673"
                     /db_xref="UniProtKB/TrEMBL:G0WDW8"
                     /translation="MAKSKNHTAHNQTKKAHRNGIKKPKTYKYPSLKGVDPKFRRNHK
                     HALHGTAKALAAKRAAAKA"
     gene            <457954..>459120
                     /gene="NDAI0G02050"
                     /locus_tag="NDAI_0G02050"
                     /db_xref="GeneID:11497376"
     mRNA            <457954..>459120
                     /gene="NDAI0G02050"
                     /locus_tag="NDAI_0G02050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671175.2"
                     /db_xref="GeneID:11497376"
     CDS             457954..459120
                     /gene="NDAI0G02050"
                     /locus_tag="NDAI_0G02050"
                     /inference="similar to DNA sequence:INSDC:YFR032C"
                     /note="similar to Saccharomyces cerevisiae YFR032C;
                     ancestral locus Anc_7.188"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671223.2"
                     /db_xref="GeneID:11497376"
                     /db_xref="GOA:G0WDW9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G0WDW9"
                     /translation="MFNFGPKSASLSIRNLSYYTGEQELRNYLKDYEIVSLFIVTETV
                     RGIKERLARPLGIAYVELSSIENAEKVIKDLNKKQFQGKTLFIKYHVPYEPRFVPRYR
                     NEEKNQKANTENGLIKKGSEDTKLTDKKEVKETNPIVEANTDSIITHAVVPETSSKNA
                     KQKGTKSLNGRHYRQNRRNQEKSKDTLYCSSLPKNVTDEELREFFKGYNPQEIWIYRQ
                     KTSKVCLPVHSKVTAALVTIGSEDKLIDIIKVLRERKILGKKILLYPAYISKIEEIKE
                     IARKTREEQGIVEEVVVEDDTTVRTEDQQPIEATAENEDAGAGNVPSNKKAVARQKEE
                     VRVTLRKDDNEVSNKQNVPVPPIITEATSVKDSDTSKLNRIKQEPASEQETLTA"
     gene            <459917..>461084
                     /gene="NDAI0G02060"
                     /locus_tag="NDAI_0G02060"
                     /db_xref="GeneID:11497377"
     mRNA            join(<459917..459920,460324..>461084)
                     /gene="NDAI0G02060"
                     /locus_tag="NDAI_0G02060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671176.2"
                     /db_xref="GeneID:11497377"
     CDS             join(459917..459920,460324..461084)
                     /gene="NDAI0G02060"
                     /locus_tag="NDAI_0G02060"
                     /inference="similar to DNA
                     sequence:INSDC:YFR031C-A,YIL018W"
                     /note="similar to Saccharomyces cerevisiae RPL2A
                     (YFR031C-A) and RPL2B (YIL018W); ancestral locus
                     Anc_7.187"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671224.2"
                     /db_xref="GeneID:11497377"
                     /db_xref="GOA:G0WDX0"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR014726"
                     /db_xref="InterPro:IPR022666"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="InterPro:IPR022671"
                     /db_xref="UniProtKB/TrEMBL:G0WDX0"
                     /translation="MGRVIRNQRKGAGSIFTSHTRLRQGAAKLRTLDYAERHGYIRGI
                     VKQIVHDAGRGAPLAKVVFRDPYKYKLREEIFIANEGVHTGQFIYAGKKASLNVGNVL
                     PLGSVPEGTIVSNVEERPGDRGAIARASGNYVIIIGHNPDENKTRVRLPSGAKKIISS
                     DARGVIGVVAGGGRVDKPLLKAGRAFHKYRLKRNSWPKTRGVAMNPVDHPHGGGNHQH
                     IGKASTISRGAVSGQKAGLIAARRTGLLRGSQKTQD"
     gene            <461697..>465212
                     /gene="NDAI0G02070"
                     /locus_tag="NDAI_0G02070"
                     /db_xref="GeneID:11497378"
     mRNA            <461697..>465212
                     /gene="NDAI0G02070"
                     /locus_tag="NDAI_0G02070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671177.2"
                     /db_xref="GeneID:11497378"
     CDS             461697..465212
                     /gene="NDAI0G02070"
                     /locus_tag="NDAI_0G02070"
                     /inference="similar to DNA sequence:INSDC:YFR031C"
                     /note="similar to Saccharomyces cerevisiae SMC2 (YFR031C);
                     ancestral locus Anc_7.186"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671225.2"
                     /db_xref="GeneID:11497378"
                     /db_xref="GOA:G0WDX1"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR027120"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WDX1"
                     /translation="MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDA
                     ICFVLGITSMTTVRASNLQDLIYKRGQAGITKASVTIVFDNTDKTNSPIGFNNSAKIS
                     VTRQVVLGGTSKYLINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE
                     ILSLIEEAAGTKMFEDRREKAERTMAKKETKLQENRTLLQEEIEPKLEKLRNEKRIFL
                     EFQVTQADYEKISKVIFAFDYKNLTRRYDSFQNSLNSNKARAEELNTLIPKLSNELES
                     LNDDLGQIRSAKQEEVEKNGKISILEEKESKILNEISRTKTSLSICIQDYEENIKELD
                     KIKRNIEENKTSSLQKMESFKLIEQEYQSINTNLLKEKEACKKKEELLSTLLTGISST
                     GATDGGYDTQLASTNEKLNDVDVVIKKLTMKMELLERELASNEPKLIQAKKDKEKDQQ
                     YIIECEKLCSELEEQLTKDGFDPALTKKLREKEHFLRQELHRLNNEAENLRRRVANLD
                     FNYTKPSPDFDTRSVKGIAAQLFSLKSESMNSATALQVCAGGRLYNVVVDNEKTASSL
                     LERGRLRKRVTIIPLNKISARTLNERSCTTKRKKLAPGKVELALNLIGYDDEVSNAME
                     FIFGGSLICQDADTAKKVTFHPQIRTRSITLEGDVYDPEGTLSGGSRNNSSSLLLDIQ
                     RYNESSQKLQSTEKELNEVINSLKQQELNSQRTKVIQNDLNLARHKLSLAQRSIGANN
                     ASQIAKKNEELHHEISECQQGIIDNQRLMKTLQEDVERIKRDMDEFSHDRGSKLNELK
                     LEINDLTESINKQEKISEHEYEKYQNLQVEIEQLNSEIKSDEESLKVTEMNLDKLLKD
                     KSEIEKNFSSLDKSLVDIRGELDEERNRLLGLDEELKELENLIKLKIEAKNGYELEYQ
                     KLAHDLSKSKANTDSIQKKIEELIKEHDWLQDKDLVEGIIGQNSGINLEEHRERSRQL
                     EDKYQEMRRKVNINIMSMIENVEKKEVALRTMIRTIEKDKIKIQETISKLNEYKREAL
                     IKTWEKVTTDFGAIFSDLLPNSFAKLVPSEGKDVTEGLEVKVKLGTIWKESLVELSGG
                     QRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLK
                     EGMFSNANRVFRTRFQNGTSVVSIM"
     gene            complement(<465410..>468592)
                     /gene="NDAI0G02080"
                     /locus_tag="NDAI_0G02080"
                     /db_xref="GeneID:11497379"
     mRNA            complement(<465410..>468592)
                     /gene="NDAI0G02080"
                     /locus_tag="NDAI_0G02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671178.2"
                     /db_xref="GeneID:11497379"
     CDS             complement(465410..468592)
                     /gene="NDAI0G02080"
                     /locus_tag="NDAI_0G02080"
                     /inference="similar to DNA sequence:INSDC:YFR030W"
                     /note="similar to Saccharomyces cerevisiae MET10
                     (YFR030W); ancestral locus Anc_7.185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671226.2"
                     /db_xref="GeneID:11497379"
                     /db_xref="GOA:G0WDX2"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR002869"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR019752"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="UniProtKB/TrEMBL:G0WDX2"
                     /translation="MSAATALATNPFGSPKSSKELPAYSTPLSIINSAIYENVNNIFA
                     YNSFSNPELLHSYIKSWLQNANNTDDKFFKEFDIRSGAGLGPLGFIKSQQNSVIANPH
                     TVSTIITPSYGLPFFYDALSSAKANILLNVGALNYNQESGSIINDYSTSLNFASSLNY
                     NVLTPISNNEVSNLTSLSVVLSKFGLKTMNLFDSINYSNTIIKTPSSCSASPINVQDV
                     TLKLSKLVSTPNPSFNEVLEKFNELTGAKLHNFHYSGNFENPKTVFVTYGSLESQLFN
                     SFMEENSNGDVGIISIRIPLPFDLEKFIALIPNSTKNLIFINQKANNSNLIKSNISAA
                     LFYFNRHSINFTEYLYDSNFIWSPNAVSKIISSFTSTSIAASNSSQGFIYYSNDKSEN
                     IDLFSKLAISLSEDNNEINLRTKFDNILNAGTFQAQLSINNNNNNRNGNIISNIDTAE
                     ISIVEDVSILKNLNVLNTLKQNGTLIINTKENFEFVQDSIDTFVKGLNLSLNLLNQLI
                     ENIKLIIVKYSDGENFSIVNQAVFYKILGAQDIVSKIVINDPEFDRDDLPSILEKAFA
                     EDLIEIENDSLSNLVKQTELDIENEKKEQEQEQEQEKEKTEQEEEEQQEEEIILPSFV
                     NETSFVPNTSTLPKETTTNISNSTEISKILSFKESYGVNHLLRPDLPIKNFIVKVKSN
                     KRVTPEDYDRYIFEINFDISNTPDLKYDIGEALGIHAENNSQDVQEFLQFYNLSGNEI
                     IMVPNKDNNKILEARTSFQAFKENLDLFGKPPKRFYESLIDYAEDEEDKTKLQELISP
                     AGAVDLKRYQDVEFYTYVDILKLYPSCKPSLSDLTTLIAPLKRREYSIASSQRVHPTE
                     IHLLIVVVDWVDNQGRKRFGQASKFISDLKVGQELVVSVKPSVMKLPPSPLQPVIMSG
                     LGTGLAPFKAIVEEKLWQKQHGMEIGEVYLYMGSRHRREEYLFGELWEAYKDAGIITH
                     IGAAFSRDQPEKIYIQDRIRENLSDLKTAMIDKNGSFYLCGPTWPVPDITKALQDIIE
                     ADAKEKGIKVDLNAAIEELKESSRYILEVY"
     gene            complement(<470955..>471569)
                     /gene="NDAI0G02090"
                     /locus_tag="NDAI_0G02090"
                     /db_xref="GeneID:11497380"
     mRNA            complement(<470955..>471569)
                     /gene="NDAI0G02090"
                     /locus_tag="NDAI_0G02090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671179.2"
                     /db_xref="GeneID:11497380"
     CDS             complement(470955..471569)
                     /gene="NDAI0G02090"
                     /locus_tag="NDAI_0G02090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671227.2"
                     /db_xref="GeneID:11497380"
                     /db_xref="UniProtKB/TrEMBL:G0WDX3"
                     /translation="MSNSVDIKRKEKTCVCFLNKIALKCLPFFNYDLFLKQRLDTTFI
                     YAISLNFFTALVLLFKVGQADAIAASGPLPRDGTTKTDTYNVLRCMQLLGVSNTTIIA
                     TSEVNDLVVFHNRTIVNMTCVVKVTSRCYLRYGYEIAMENFFYAEFPSELTRLGTLGD
                     VLDGNVDLPEFKRFDRMKDPRNSTEAALATCGRTVGGYYATVFK"
     gene            complement(<474519..>476705)
                     /gene="NDAI0G02100"
                     /locus_tag="NDAI_0G02100"
                     /db_xref="GeneID:11497381"
     mRNA            complement(<474519..>476705)
                     /gene="NDAI0G02100"
                     /locus_tag="NDAI_0G02100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671180.2"
                     /db_xref="GeneID:11497381"
     CDS             complement(474519..476705)
                     /gene="NDAI0G02100"
                     /locus_tag="NDAI_0G02100"
                     /inference="similar to DNA sequence:INSDC:YDR206W,YLR233C"
                     /note="similar to Saccharomyces cerevisiae EBS1 (YDR206W)
                     and EST1 (YLR233C); ancestral locus Anc_8.415"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671228.2"
                     /db_xref="GeneID:11497381"
                     /db_xref="InterPro:IPR018834"
                     /db_xref="InterPro:IPR019458"
                     /db_xref="UniProtKB/TrEMBL:G0WDX4"
                     /translation="MENGKFISHFTTILSSVLERNHVSDQNTALTRLLVVLRNKLTIH
                     VEGVLLERQTSVILDGSDDLVGFLDQLWRDIIIPVFDWFQNWKDALIINSNQKCNSFW
                     KMKRVLIKTFKLIHKIYYGLLELFIKKYDTAFVIPNGIITRLNLTSYNDDKENKYQLH
                     PSSSFTVLIMKTFHCCLNYLGLVHFQTSMIEKVPGSTYEITDFKKSIRYLELASLVLP
                     AIGNTYYFKAKIHIQCEDFANAIFEIMRGSLVRLPEYDESFELLRRIMCPNKDNDIHL
                     ILNQKLKELHKQDVEINPDMDSKIIESYFITLFGTYFTTIMWGSTIQNTDTQIEMAQA
                     LKVIFYERLKTNFVDNMDIVFKQVVIVIGGMHLMANEKGNSSALVKELNKIKLSNYII
                     YLEFVFDWITNITHNIIIPFWLINIENNHQYLAIIRVVLCWVKSNRGILHYSHRHDGF
                     CQVIANLINGMIKSDSFALEAVSSRRPRRDHFFHEDIILKEFSCVNFSLTDFNDSPIF
                     DSSNKLDRLIGSTSTDARRTCVEENKLRLQSIFVSGKKFLEKNGAGILWNDKLNAYEL
                     PNEIIDSTSTNTTLEPPGSFSSVENKTLRLNKELLDKFLKEESEISINHTNSNAFDGH
                     IDNRHDQSISILGSHDVEVSGNNISIQAFESSSQYEMTDEVLSSQCKNNIVQSVPGNT
                     DIVKSSSSLISSAEVHYMNEMKILSSSIETSTQQTTSVPFVQLESD"
     gene            <476957..>478927
                     /gene="NDAI0G02110"
                     /locus_tag="NDAI_0G02110"
                     /db_xref="GeneID:11497382"
     mRNA            <476957..>478927
                     /gene="NDAI0G02110"
                     /locus_tag="NDAI_0G02110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671181.2"
                     /db_xref="GeneID:11497382"
     CDS             476957..478927
                     /gene="NDAI0G02110"
                     /locus_tag="NDAI_0G02110"
                     /inference="similar to DNA sequence:INSDC:YLR234W"
                     /note="similar to Saccharomyces cerevisiae TOP3 (YLR234W);
                     ancestral locus Anc_8.414"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671229.2"
                     /db_xref="GeneID:11497382"
                     /db_xref="GOA:G0WDX5"
                     /db_xref="InterPro:IPR000380"
                     /db_xref="InterPro:IPR003601"
                     /db_xref="InterPro:IPR003602"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR013497"
                     /db_xref="InterPro:IPR013824"
                     /db_xref="InterPro:IPR013826"
                     /db_xref="InterPro:IPR023405"
                     /db_xref="InterPro:IPR023406"
                     /db_xref="UniProtKB/TrEMBL:G0WDX5"
                     /translation="MKVLCVAEKNSIAKAVSQILGGGSCNSRDSGYTYVKNYDFKFDG
                     FPFVSTNDCDVTMTSVAGHLTSVDFRPDIYGWNKCRIDELFTAPLSTEMDNNQKKIAA
                     NIKREARYADFLMIWTDCDREGEYIGWEIFQEALKGNSRLTNSQVYRANFSHLERRHV
                     LNAARRPQRLDLKSVDAVGARIELDLRTGVTFTRLLTNTMKAKVETWNRSQTSISSNG
                     NMSSRAKEPPTIISYGACQFPTLGFVVDRYERIKHFVSEEFWYIQLVIKDPESGASTT
                     FQWDRGHLFDRLSVLAFYETCLETAGDKAKVVDLISKPTSKYRPLPLTTVELQRNCAR
                     FLRLNAKKSLAAAEKLYQKGFVSYPRTETDIFPQAMDLQSLVRNRAQLDQSNNRTAWA
                     SYAEGLLSDDASNTNKFRFPRSGTHDDKAHPPIHPVVSVGPNANLTPDEKRVYEYIVR
                     HFLACCSEDAKGQSTTLTLDWADERFVASGLIVLERNFLDVYPWAKWETTKRLPRLEI
                     NQECEIGKAEMNFGHTSPPKPMTESELIMLMDANGIGTDATIADHIEKIQTRKYIKSE
                     KVGKDTFFQPTVLGIALVHGFEAIGLEDSFAKPFQRREMEEDLKKICQGQLTKNEVVN
                     DIVGKYQSYWQRTNESKRTLLEVYDRIRQTMS"
     gene            complement(<479231..>481048)
                     /gene="NDAI0G02120"
                     /locus_tag="NDAI_0G02120"
                     /db_xref="GeneID:11497383"
     mRNA            complement(<479231..>481048)
                     /gene="NDAI0G02120"
                     /locus_tag="NDAI_0G02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671182.2"
                     /db_xref="GeneID:11497383"
     CDS             complement(479231..481048)
                     /gene="NDAI0G02120"
                     /locus_tag="NDAI_0G02120"
                     /inference="similar to DNA sequence:INSDC:YLR237W"
                     /note="similar to Saccharomyces cerevisiae THI7 (YLR237W);
                     ancestral locus Anc_8.412"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671230.2"
                     /db_xref="GeneID:11497383"
                     /db_xref="GOA:G0WDX6"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="UniProtKB/TrEMBL:G0WDX6"
                     /translation="MKSQSRFSKFLKHLEIPVHERETVNFLRNPDLQPIISRNQTWGF
                     WSNFAYWGVMSWSVGTWMSASSALSVGLSYGETIGTFIIGDVLTIIFTLANSYPGYDW
                     KVGFTLSQRFVFGIYGSGFGILIRILMSIVNYASNAWLGGLCVNMILDSWSHHYLHLP
                     NTLTQKVAMTTKELIGFIIFHIITMFCYLMKPYQANYLMISSCVATCFAMMGMVIYLT
                     KENGGVGDLFVSTKSTAKGSDKAWAWVYMVSYWFGSVSPGSTNQSDFSRFGSSQTAIW
                     LGTIMALLIPTTLTPVFGVIGASTTEQLYGTQLWQPMDICDYWLRQNYHPGARAASFF
                     CGLAFVSSQISYTISNAGFASGMDLAGVLPKYIDIKRGAIFTALVSVALQPWNFYNSS
                     STFLTVMSSFGIVMTPIISVMICDNLVIRKRQYSVSQAFVIHGEYYFNKGFNWRAFVA
                     WVVGMTPGLPGIAWQVNNNYFHNKGIVNFFYGDSFFSFAISFLLYWFLCVVFPFQINI
                     LHDDKDYCGAFTDEVARSKGMVPFSEITEEEIEAFKLGSLDITYVTKDSAQNDHHTET
                     KEIAISKTTSANTDEYELVADTTENSELESSGIHERGQK"
     gene            <482264..>483406
                     /gene="NDAI0G02130"
                     /locus_tag="NDAI_0G02130"
                     /db_xref="GeneID:11497384"
     mRNA            <482264..>483406
                     /gene="NDAI0G02130"
                     /locus_tag="NDAI_0G02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671183.2"
                     /db_xref="GeneID:11497384"
     CDS             482264..483406
                     /gene="NDAI0G02130"
                     /locus_tag="NDAI_0G02130"
                     /inference="similar to DNA sequence:INSDC:YDR202C"
                     /note="similar to Saccharomyces cerevisiae RAV2 (YDR202C);
                     ancestral locus Anc_8.410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671231.2"
                     /db_xref="GeneID:11497384"
                     /db_xref="InterPro:IPR028241"
                     /db_xref="UniProtKB/TrEMBL:G0WDX7"
                     /translation="MTTQLYPNDYFGGVENFNSKSDHAKERHWLINEIIKPELPNIID
                     NVEKCLAMLNSDQIFKMPISNTSANATATTNKNMSTITRTVQNDSSTSSSSSSAASTS
                     NNCPSIRGIITRRGGYILDFQAMVKFNEFKKGKQILFRMNTGKNYPLLQIKRIHENME
                     HILQLLEDLQLIDDILEFIKKFGTVLNLLNDSTDLLTNPPEQLIFPYNNNEMMKEMFQ
                     DSHLISQSTHHEISLELVLFKNEISIDFRNLEKVTKKPWCEIDPQTGKSLTDKVKDEL
                     KSNRSKNLTDILKSNGVQLEQPSLLNNLMMSTFNTETTTLQQAQKYLSRCVTFDNKVV
                     MELEKIAITTSDPTLISISAKLTALEGSISNHYTNLTIEECPITNE"
     gene            <484059..>485720
                     /gene="NDAI0G02140"
                     /locus_tag="NDAI_0G02140"
                     /db_xref="GeneID:11497385"
     mRNA            <484059..>485720
                     /gene="NDAI0G02140"
                     /locus_tag="NDAI_0G02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671184.2"
                     /db_xref="GeneID:11497385"
     CDS             484059..485720
                     /gene="NDAI0G02140"
                     /locus_tag="NDAI_0G02140"
                     /inference="similar to DNA sequence:INSDC:YDR200C,YLR238W"
                     /note="similar to Saccharomyces cerevisiae VPS64 (YDR200C)
                     and FAR10 (YLR238W); ancestral locus Anc_8.408"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671232.2"
                     /db_xref="GeneID:11497385"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:G0WDX8"
                     /translation="MNNTDNANIMSTVLDTHHQSHNYQQQQKDYNSHDHSHSHSHHHS
                     QQRQRQQNNKSMMKDGSLPSHSIRKHLKQQERQSYNVTLKPREKYTKIMVLKSLNSTF
                     DTKYLIVPFKPNGLKFGRPVANPTAASNAPPQPPPPSSSSCSSSSNNNNNNNNNASID
                     LSATSCSSIIQVRQDNGYFDSRVLSRNHALLSCNPTNGSIYIKDLKSSNGTFVNGERL
                     TDSQDKELNIGDVLDLGTDIDTKFDHRKISAFIEDIFILPLVDNDDTTTRTASSDATT
                     IAGDDLLKAGFETTLFGDVVDEITLEETLFGSDDNNEILSGIFINNSIGTNKKLIDVI
                     KSFGVTVSLNNHQLLTAKSVETFLMDYSNELDKLHKLLTERNDKHLSHLQNNLRQALT
                     KQQESLMKDHQKELNDIENDQHAMEKQFKLDEIENNNRLKEIELELEDLRTRLEVERY
                     KNSQLLKDYDEMKEKTKEKQQDGDTIVVDTETESKTEKPRMDKEKHATNDNRETINKG
                     SVRQPCYIDKGNKREKTYSHNFLPLFTLGAISMGIFAFTLKHFFL"
     gene            complement(<485893..>486903)
                     /gene="NDAI0G02150"
                     /locus_tag="NDAI_0G02150"
                     /db_xref="GeneID:11497386"
     mRNA            complement(<485893..>486903)
                     /gene="NDAI0G02150"
                     /locus_tag="NDAI_0G02150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671185.2"
                     /db_xref="GeneID:11497386"
     CDS             complement(485893..486903)
                     /gene="NDAI0G02150"
                     /locus_tag="NDAI_0G02150"
                     /inference="similar to DNA sequence:INSDC:YLR239C"
                     /note="similar to Saccharomyces cerevisiae LIP2 (YLR239C);
                     ancestral locus Anc_8.407"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671233.2"
                     /db_xref="GeneID:11497386"
                     /db_xref="GOA:G0WDX9"
                     /db_xref="InterPro:IPR000544"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR020605"
                     /db_xref="UniProtKB/TrEMBL:G0WDX9"
                     /translation="MMNSSVIIPSGLFIRPLTSLVKRDISIFSTVQAENQDRNGNGDI
                     ATTYPIDSSARTIRHLQFIKKIPFTKGILIQEKIVRAQLDMKELQSKIKKRLNELHEE
                     HGDSARINDNEKSIIDNILLMKPNPVVLTFEFEPTYTGGKRIKKTITQEQVDRFENFQ
                     PTTTTEDVVQPLKPKFVQVERGGQITYHGPGQMVAYIILDLKTFHKFPAKCLVSTIEK
                     ATMQTLYNVKDLHLRSQLTQNTGVWVDEDDKIASIGIHVRRSITSHGVAINVNPELLY
                     MNSFEMCGLPNKRATSIEEQRVSSDSKIDVQDVAVEFVKSLAKLLGINKVERMQADDM
                     PV"
     gene            <487168..>489909
                     /gene="NDAI0G02160"
                     /locus_tag="NDAI_0G02160"
                     /db_xref="GeneID:11497387"
     mRNA            <487168..>489909
                     /gene="NDAI0G02160"
                     /locus_tag="NDAI_0G02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671186.2"
                     /db_xref="GeneID:11497387"
     CDS             487168..489909
                     /gene="NDAI0G02160"
                     /locus_tag="NDAI_0G02160"
                     /inference="similar to DNA sequence:INSDC:YLR240W"
                     /note="similar to Saccharomyces cerevisiae VPS34
                     (YLR240W); ancestral locus Anc_8.401"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671234.2"
                     /db_xref="GeneID:11497387"
                     /db_xref="GOA:G0WDY0"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR001263"
                     /db_xref="InterPro:IPR002420"
                     /db_xref="InterPro:IPR008290"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015433"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="UniProtKB/TrEMBL:G0WDY0"
                     /translation="MPANNTTFCISQDLEIPLRIKIGSLQGQKPLLKASQRFLNPTLT
                     QKGSNMFPNSDFIVSIQVIDQERDRNLTIPIFTPYIPFKHARKWDHWLTLPIQIKQLH
                     VSNKLKITIWEYDGFKRIPFFQLETYIYDSNDFQLKRGKESLMFKYVNKDDDYDLDEV
                     HIIENDPIQCNLNKYYQGEIKKVDWLDKITIPKLESLQESKKLPLGTFVLNIEFPIFE
                     MPVIFVEKSLNDTQNQIPTLHNFELTNNMLPLNNTASIVRNNNNNISNGGIDSNHNKT
                     DARLKISLGDKYNSTLKIYDPDQFSLDPIEEKFRRLERAAKHSNLDRQVKPNAKKRDY
                     LNKIINYPPGTKLTAHEKGSIWKYRYYLMNNKKALTKLLQSTNLAEESERGEVLELMD
                     SWAEIDIDDAIELLGSKFKNLSVRSYAVNRLKKAADSELELYLLQLVQAVCFENVTIF
                     TDKTNSEFTIVDMNATGSLDATTNSIKNIHPNQRTMQQQQHNIKKSLMKPIKENGTSL
                     EETPIVISPLAEFLIRRALKNRRLGNFFYWYLKAESQDNPYLNQILDSYWGRLSKEHK
                     KILKDEILFDNCLHSICEEIKNLRDTITKKVELLNHLLITKLRHILKSKTIYLPLDPN
                     IQIIDVIPESSKVFKSSLSPLKITFKTADNSIYALMYKVGDDLRQDQLVVQIISLMNE
                     LLKNENVDLKLTPYKILATGPQEGAIQFIPNDTMADILSKYHGILPFLKGHYPDSSQE
                     SGVQDWVMDNFVKSCAGYCVITYILGVGDRHLDNLLITPEGYFFHADFGYILGQDPKP
                     FPPLMKLPPQIVEAFGGAESSNYNKFRSYCFVAYSILRRNAGLILNLFELMKMSNIPD
                     IRIDPNGAILKVQERFNLDMSEEDATIHFQTLINGSLNALLPIVIDHLHNLAQYWRA"
     gene            <490315..>492723
                     /gene="NDAI0G02170"
                     /locus_tag="NDAI_0G02170"
                     /db_xref="GeneID:11497388"
     mRNA            <490315..>492723
                     /gene="NDAI0G02170"
                     /locus_tag="NDAI_0G02170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671187.2"
                     /db_xref="GeneID:11497388"
     CDS             490315..492723
                     /gene="NDAI0G02170"
                     /locus_tag="NDAI_0G02170"
                     /inference="similar to DNA sequence:INSDC:YLR241W"
                     /note="similar to Saccharomyces cerevisiae YLR241W;
                     ancestral locus Anc_8.400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671235.2"
                     /db_xref="GeneID:11497388"
                     /db_xref="GOA:G0WDY1"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="InterPro:IPR027815"
                     /db_xref="UniProtKB/TrEMBL:G0WDY1"
                     /translation="MISSIISDTIQGSLKISDDDDPHDFRKPSAMVVTTQTAIATILG
                     LFALLSFSMLLKKLPRLYASRKYKDDGSLNLPSWDETKLFGWLINLFQITDKHVLEYA
                     GLDAFVFLCFFKMCIKLLATYCVFAILIISPIRYHFTGQYDDGSDNNNSYLGMTNSFV
                     KRHLTISQDIPIEAPERANLYLWMYVIFTYLFTFLAIYMLISQTKLIVNTRQIYLGRQ
                     NTLTDRTIRLSGIPIELRDKQALKNRIEQLKIGTVSSITICREWGPLNRLFHYRKNVL
                     KELELKYAECPSSLRNRNYESNVEYYPLGRNTTDPSNMAPDSGTTNTNTAVTDRVIAN
                     VPQGGRERPEEDNVLYSEVRLGERPTIRTGLFGLFGEKIDAIDHLEKQLKFIDEEIIE
                     ARKKHFSATPTAFVTMDSVANAQMAAQAVLDPRVHYFITRLAPAPHDIKWDNVCLSRK
                     ERLTKIYSVTVFIGISSIFLIIPVSYLATLLNLRSISKFWPSLGKILKEHRWAENIVT
                     GLLPTYLFTLMNVGIPYFYEYLTSRQGLVSYSEEEISLVSKNFFYIFVNLFLVFTLAG
                     TASNYWGYLSDTTKIAYQLATSVKEMSLFYVDLIILQGIGMFPFKLLLAGSLIGFPLV
                     KIQAKTPRQRNELYNPPIFNFGLQLPQPILILIITLLYSVMSTKLLVSSLVYFIIGFY
                     VYKYQLIYATDHLPHSTGKVWPLIFRRVIVGILLFQLTMTGTLAGFDGGWILSSWLFP
                     LPFITLSYLYDFEKNYLPLSQYIALSSIREHERDNSMVCSSVETESYEYPYLIDGLEG
                     PILS"
     gene            complement(<492849..>493733)
                     /gene="NDAI0G02180"
                     /locus_tag="NDAI_0G02180"
                     /db_xref="GeneID:11497389"
     mRNA            complement(<492849..>493733)
                     /gene="NDAI0G02180"
                     /locus_tag="NDAI_0G02180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671188.2"
                     /db_xref="GeneID:11497389"
     CDS             complement(492849..493733)
                     /gene="NDAI0G02180"
                     /locus_tag="NDAI_0G02180"
                     /inference="similar to DNA sequence:INSDC:YLR242C"
                     /note="similar to Saccharomyces cerevisiae ARV1 (YLR242C);
                     ancestral locus Anc_8.399"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671236.2"
                     /db_xref="GeneID:11497389"
                     /db_xref="InterPro:IPR007290"
                     /db_xref="UniProtKB/TrEMBL:G0WDY2"
                     /translation="MICIECGAAVDSLYTVYSNKHIQLTECSQCHNIVDKYVEFDNVL
                     MFIDLLLLKPGAYRHLVFNSLEERLSKYKESKPLQGPLRSRLLILRNNIRNWLLKFDD
                     LNRLWLLLLTFEIYLTWFTEDETPPHKRSLLMSRILTENALIQYAYFTLYCLIDISMF
                     HYLIQYFIISWCKWGTNVKNAKHVISYTILLSYGAKIFPILMLIWPYDTILSMSIIKW
                     VANFYIVESLRIVTNLSYFTILRIFTFVSFARYTCTKPILILFVSKCNIHLMKTYLKS
                     EIDVELLRLESLKYFITG"
     gene            <494063..>494884
                     /gene="NDAI0G02190"
                     /locus_tag="NDAI_0G02190"
                     /db_xref="GeneID:11495705"
     mRNA            <494063..>494884
                     /gene="NDAI0G02190"
                     /locus_tag="NDAI_0G02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671189.2"
                     /db_xref="GeneID:11495705"
     CDS             494063..494884
                     /gene="NDAI0G02190"
                     /locus_tag="NDAI_0G02190"
                     /inference="similar to DNA sequence:INSDC:YLR243W"
                     /note="similar to Saccharomyces cerevisiae YLR243W;
                     ancestral locus Anc_8.397"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671237.2"
                     /db_xref="GeneID:11495705"
                     /db_xref="GOA:G0WDY3"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WDY3"
                     /translation="MSRVGVLVLGPAGAGKSTFCNSIISHMQTIGRRAHIVNLDPAAE
                     PNQYEFTIDIRDLISLDDVMEELDLGPNGGLIYCFEYLLKNLDWLDEEIGDYNDEFLI
                     FDCPGQIELYTHIPVLPNIVRHLQGQLNFNLCATYLLEAPFVVDTSKFFSGALSAMSA
                     MILLELPHINVLSKLDLIKDDYNKKRLKRFLNPDAMLLSTETIDKEMNPRFHHLNECI
                     ANLVDDFGMVQFLPLESKNPDSIMTILSYIDDVTQWAETQEPKEPDDQIDIEDME"
     gene            <495164..>496558
                     /gene="NDAI0G02200"
                     /locus_tag="NDAI_0G02200"
                     /db_xref="GeneID:11497391"
     mRNA            <495164..>496558
                     /gene="NDAI0G02200"
                     /locus_tag="NDAI_0G02200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671190.2"
                     /db_xref="GeneID:11497391"
     CDS             495164..496558
                     /gene="NDAI0G02200"
                     /locus_tag="NDAI_0G02200"
                     /inference="similar to DNA sequence:INSDC:YDR190C"
                     /note="similar to Saccharomyces cerevisiae RVB1 (YDR190C);
                     ancestral locus Anc_8.395"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671238.2"
                     /db_xref="GeneID:11497391"
                     /db_xref="GOA:G0WDY4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010339"
                     /db_xref="InterPro:IPR027238"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WDY4"
                     /translation="MVTISEVKNDNSSNKFAGNAAATRTAAHTHIKGLGLDETGVAKR
                     VEGGFVGQMEAREACGVIVDLIKAKKMSGRAILLAGGPSTGKTALALAISQELGPKVP
                     FCPLVGSELYSVEVKKTETLMENFRRAIGLRIKETKEVYEGEVTELTPEDAENPLGGY
                     GKTISHVIVGLKSAKGTKTLRLDPSIYESIQREKVNIGDVIYIEANTGAVKRVGRSDA
                     YATEFDLETEEYVPLPKGEVHKKKEIVQDVTLHDLDIANARPQGGQDVVSVMGQILKP
                     KKTEITEKLRTEVNKVVAKYIDQGVAELIPGVLFIDEVNMLDIEIFTYLNRALESNIA
                     PVVVLASNRGMTTVRGTTDIVSPHGVPPDLIDRLLIVRTLPYTKDEIRSIIERRSKVE
                     NLELATDALDLLANMGAETSLRYSLQLLSPSGILAETSGRNEILVEDINEASLLFLDA
                     KRSTKILETTANYL"
     gene            complement(<496774..>498663)
                     /gene="NDAI0G02210"
                     /locus_tag="NDAI_0G02210"
                     /db_xref="GeneID:11497392"
     mRNA            complement(<496774..>498663)
                     /gene="NDAI0G02210"
                     /locus_tag="NDAI_0G02210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671191.2"
                     /db_xref="GeneID:11497392"
     CDS             complement(496774..498663)
                     /gene="NDAI0G02210"
                     /locus_tag="NDAI_0G02210"
                     /inference="similar to DNA sequence:INSDC:YDR189W"
                     /note="similar to Saccharomyces cerevisiae SLY1 (YDR189W);
                     ancestral locus Anc_8.394"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671239.2"
                     /db_xref="GeneID:11497392"
                     /db_xref="GOA:G0WDY5"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:G0WDY5"
                     /translation="MLFLNKDIADTNLEDTFNDQELIWKVLILDRKSTAIISSILRVN
                     DLLKAGVTVHSLIKQDRASLPDVPVVYFVTPNQENIDIIVDDLKNDKYSDFYINFTST
                     LNRDLLENLAEKVSMTGKSXEKIKQVFDQYLDFIVTEPELFSLELPNTYALLNTPSAT
                     EESINQLCDKVADGLFNTVMTTDSIPIIRAPKGGPAEMIAEKLGMKLRDYVINSKSTS
                     NVVTSTSTSNPDSLERSVLVILDRKIDFACMFQHSWIYQCMVFDIFKLSRNTITVPIK
                     NEQGHVTEKQFDIEPNDFFWIENSHLPFPEAAENVETALSTYKEEAAEITKKTGVTNL
                     TDLDPNSNNDTVQIQEAVKKLPELTARKNTIDTHMNIFGSLLNELENKNLDKFFEIEQ
                     DPNSSKLRQGFLSILKDGKTNNFEDKMRSFIVLYLTSTNGLPRDFVDEVEKYFSDNEY
                     DISALKYVYKLREFMQLSNMSLQNKSLEDGRSNKKTSTAGNLSLSGLYGLTEGGLQGG
                     VGSLISGIKKLLPEKKTIPITNVVEAIMDPLNSSQKNLETTDEYLYIDPRITRGSHTK
                     KPKRQSYNKSLVFVVGGGNYFEYQNLQEWAHSQLHNPKTVMYGSTMIISPNEFMKEVS
                     ELGSA"
     gene            complement(<499255..>500919)
                     /gene="NDAI0G02220"
                     /locus_tag="NDAI_0G02220"
                     /db_xref="GeneID:11497393"
     mRNA            complement(<499255..>500919)
                     /gene="NDAI0G02220"
                     /locus_tag="NDAI_0G02220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671192.2"
                     /db_xref="GeneID:11497393"
     CDS             complement(499255..500919)
                     /gene="NDAI0G02220"
                     /locus_tag="NDAI_0G02220"
                     /inference="similar to DNA sequence:INSDC:YDR188W"
                     /note="similar to Saccharomyces cerevisiae CCT6 (YDR188W);
                     ancestral locus Anc_8.393"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671240.2"
                     /db_xref="GeneID:11497393"
                     /db_xref="GOA:G0WDY6"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012722"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:G0WDY6"
                     /translation="MSLQLLNPKAESLRRDAALKVNITSAEGLQSVLETNLGPKGTLK
                     MLVDGAGNIKLTKDGKVLLTEMQIQSPTAVLIARAAAAQDEITGDGTTTVVCLVGELL
                     RQAYRFIQEGVHPRIITDGFEIARKEALKFLDEFKIDKKGEDGAIDREFLLQVARSSL
                     STKVNNELTEVLGPIVTDAVLNVSHSNDNNSNAMDLHMVEIMQMQHLSPKDTLFIKGL
                     VLDHGGRHPDMPIRVENAHVLILNVSLEYEKTEVNSGFYYSSADQRDKLAASERKFVD
                     EKLKKIIDLKNEVCGLDSNKGFVIINQKGIDPMSLDVLAKHNILALRRAKRRNMERLQ
                     LVTGGEAQNSVEDLSPSILGYSGLIYTETIGEEKFTYVTENKDPKSCTILIKGSTHYA
                     LNQTKDAIRDGLRAVANVIKDNTVVPGAGAYFIAAANHLKKSNMTKLGAKGKTKTGIE
                     AFAEALLVVPKTLVKNSGYDALDVLALCEDELEDAQDGGDNERRYVGVDLNIGDSCDP
                     TIEGIWDSYRVLRNAISGATGIASNLLLCDELLRAGRSTLKEGAPQ"
     gene            complement(<501330..>502469)
                     /gene="NDAI0G02230"
                     /locus_tag="NDAI_0G02230"
                     /db_xref="GeneID:11497394"
     mRNA            complement(<501330..>502469)
                     /gene="NDAI0G02230"
                     /locus_tag="NDAI_0G02230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671193.2"
                     /db_xref="GeneID:11497394"
     CDS             complement(501330..502469)
                     /gene="NDAI0G02230"
                     /locus_tag="NDAI_0G02230"
                     /inference="similar to DNA sequence:INSDC:YLR244C"
                     /note="similar to Saccharomyces cerevisiae MAP1 (YLR244C);
                     ancestral locus Anc_8.392"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671241.2"
                     /db_xref="GeneID:11497394"
                     /db_xref="GOA:G0WDY7"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001714"
                     /db_xref="InterPro:IPR002467"
                     /db_xref="UniProtKB/TrEMBL:G0WDY7"
                     /translation="MTASIETTKTYCAGLQCGKETTSQLKCPICLKSGIISIFCDDDC
                     FKDNYKAHKALHYKEGDEETKSESYDPFPKFKYTGSLRPHYPLTPKRFVPEHIEKPDW
                     AANGLPVSEQKNDRLNVIPIYKKSEIKIIRKACMFGREILDIAAAAVRPGITTDEIDA
                     IVHEETIKRDCYPSPLNYYNFPKSVCTSINEVICHGIPDKTVLKEGDIVNLDVLVYQG
                     FHADLNETYYVGENIRKEVINTVETARECLKNAIKLCKPGMTFQELGDHIEKHALENK
                     CSVVRTYCGHGVGKYFHCAPSIPHYANNRAAGVMKPGMVFTIEPMINEGVWQDISWPD
                     DWTSTTKDGKVSAQFEHSLLITENGVEILSARNKKSPGGPRTRIK"
     gene            complement(<502684..>503214)
                     /gene="NDAI0G02240"
                     /locus_tag="NDAI_0G02240"
                     /db_xref="GeneID:11497395"
     mRNA            complement(<502684..>503214)
                     /gene="NDAI0G02240"
                     /locus_tag="NDAI_0G02240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671194.2"
                     /db_xref="GeneID:11497395"
     CDS             complement(502684..503214)
                     /gene="NDAI0G02240"
                     /locus_tag="NDAI_0G02240"
                     /inference="similar to DNA sequence:INSDC:YLR245C"
                     /note="similar to Saccharomyces cerevisiae CDD1 (YLR245C);
                     ancestral locus Anc_8.391"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671242.2"
                     /db_xref="GeneID:11497395"
                     /db_xref="GOA:G0WDY8"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR006262"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:G0WDY8"
                     /translation="MQQGAQDEDLSKKLHIPIEIGHKLISKLIESKSLSYSPYSHFKV
                     GCCLLIKNNETTSDGESFYSYVLGANIENASYGASICAERTTIVKALTSTTTTTTTCK
                     DATNWVCIAIIGGCDNDDGGKIISPCGICRQVIREFVPLDFPIVMFNADASQWECKTM
                     EQLLPDSFGPDHLTHS"
     gene            <503564..>504733
                     /gene="NDAI0G02250"
                     /locus_tag="NDAI_0G02250"
                     /db_xref="GeneID:11497396"
     mRNA            <503564..>504733
                     /gene="NDAI0G02250"
                     /locus_tag="NDAI_0G02250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671195.2"
                     /db_xref="GeneID:11497396"
     CDS             503564..504733
                     /gene="NDAI0G02250"
                     /locus_tag="NDAI_0G02250"
                     /inference="similar to DNA sequence:INSDC:YLR246W"
                     /note="similar to Saccharomyces cerevisiae ERF2 (YLR246W);
                     ancestral locus Anc_8.389"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671243.2"
                     /db_xref="GeneID:11497396"
                     /db_xref="GOA:G0WDY9"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:G0WDY9"
                     /translation="MSNSSIIEYSKPFRIRKSSRQKHSHDHDHDNDNGLETSQSNLKS
                     LIDNENDSNIEDLEKNTNIITNHSRWKLFLRWLITIDGDEEINNSRDYISLPNTTNYM
                     FFLGGRFRQVKKDTKYLSIIVLIILIIPIVLFSIFETNKLWHTNKGYKVLVIFFYYTW
                     GTCFTSFIKTATSDPGVLPRNIHLSQISNNFKIPQEYYNEVTLPTGNPESTINIKYCT
                     TCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLTFLLSGTFTSIFLII
                     NASIDIARTPKVRDTPVAVLLIIYGGLTIWYPLILFCYHIFMTGTQQTTREYLKSIGS
                     KNPVFHRIKRQENNPFEQGSFLKNLIYLMCQPRGLSMVSARERQKQGDWRFTRIP"
     gene            <505912..>506676
                     /gene="NDAI0G02260"
                     /locus_tag="NDAI_0G02260"
                     /db_xref="GeneID:11497397"
     mRNA            <505912..>506676
                     /gene="NDAI0G02260"
                     /locus_tag="NDAI_0G02260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671196.2"
                     /db_xref="GeneID:11497397"
     CDS             505912..506676
                     /gene="NDAI0G02260"
                     /locus_tag="NDAI_0G02260"
                     /inference="similar to DNA sequence:INSDC:YDR185C,YLR168C"
                     /note="similar to Saccharomyces cerevisiae YDR185C and
                     YLR168C; ancestral locus Anc_8.388"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671244.2"
                     /db_xref="GeneID:11497397"
                     /db_xref="InterPro:IPR006797"
                     /db_xref="UniProtKB/TrEMBL:G0WDZ0"
                     /translation="MKLFQNTSNFEYPWEQVSTANWNKYPNEVSTHVIAVDVLRRELS
                     KTDPNVLITERLITVKQGVPKWIMYLIGAGDNTSYVREVSTVNKKDKTLVLKSCNLTM
                     CNILKVFETVKYSPHPMDPINKTLFEQEAQITAYGGSLGRICSKMEDWSINRFCENAK
                     KGKIGFESVLKEFHEKLKSKVDDLDLDLDLDLDLDFDLSSTSNLIVNKMNDAMEDVKS
                     TATSMFKETEKKCSILSDYYDLFIDTFEKDLHQQKN"
     gene            complement(<508794..>509516)
                     /gene="NDAI0G02270"
                     /locus_tag="NDAI_0G02270"
                     /db_xref="GeneID:11497398"
     mRNA            complement(<508794..>509516)
                     /gene="NDAI0G02270"
                     /locus_tag="NDAI_0G02270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671197.2"
                     /db_xref="GeneID:11497398"
     CDS             complement(508794..509516)
                     /gene="NDAI0G02270"
                     /locus_tag="NDAI_0G02270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671245.2"
                     /db_xref="GeneID:11497398"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:G0WDZ1"
                     /translation="MKMKMDKSDQVQSFLSNDAAETSVVPRDKFPFWLSYFFNEYIHQ
                     RFGQITGGVFIFICIFASISTYFKSGAAIFIACVYFLVLLMAVVIGYVYELRPNFKLR
                     ELNSQSQMKLLLEVIECKPTPSSSTWDVIACHVNEYLYTERYHTTPNYFYDGNEAYCW
                     FRESVFEPLERQFRGQNHIEDDGTELGKFKVAAFREFRDSVNRYWQEEYPVAFTKVGN
                     SRGSNPIVNPNERTERSVENMV"
     gene            complement(<511522..>511980)
                     /gene="NDAI0G02280"
                     /locus_tag="NDAI_0G02280"
                     /db_xref="GeneID:11497399"
     mRNA            complement(<511522..>511980)
                     /gene="NDAI0G02280"
                     /locus_tag="NDAI_0G02280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671198.2"
                     /db_xref="GeneID:11497399"
     CDS             complement(511522..511980)
                     /gene="NDAI0G02280"
                     /locus_tag="NDAI_0G02280"
                     /inference="similar to DNA sequence:INSDC:YLR167W"
                     /note="similar to Saccharomyces cerevisiae RPS31
                     (YLR167W); ancestral locus Anc_8.386"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671246.2"
                     /db_xref="GeneID:11497399"
                     /db_xref="GOA:G0WDZ2"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR002906"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G0WDZ2"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGGKKRKKKVYTTPKKIKHKHKKVKLAV
                     LSYYKVDAEGKVTKLRRECSNPTCGAGVFLANHQDRYYCGKCHSVYKTSA"
     gene            <512609..>515185
                     /gene="NDAI0G02290"
                     /locus_tag="NDAI_0G02290"
                     /db_xref="GeneID:11497400"
     mRNA            <512609..>515185
                     /gene="NDAI0G02290"
                     /locus_tag="NDAI_0G02290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671199.2"
                     /db_xref="GeneID:11497400"
     CDS             512609..515185
                     /gene="NDAI0G02290"
                     /locus_tag="NDAI_0G02290"
                     /inference="similar to DNA sequence:INSDC:YLR166C"
                     /note="similar to Saccharomyces cerevisiae SEC10
                     (YLR166C); ancestral locus Anc_8.384"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671247.2"
                     /db_xref="GeneID:11497400"
                     /db_xref="GOA:G0WDZ3"
                     /db_xref="InterPro:IPR009976"
                     /db_xref="UniProtKB/TrEMBL:G0WDZ3"
                     /translation="MNSLYELDPKWRKLLNANNFLGGLTVNEFVEELSKDHSLRSPLN
                     GKSSSARNSKHFVSDSVDGNDNAKWVKLDPKPYIRTFESTLKELKNLNEDSEKRKNQL
                     ADQVASQELLHSHNILGLSSTLKNMVSQYDYLDNQLTTVTQVVSPLGDKLENAIRKKK
                     TYINSVELIIQYNEFYSNGESEYIETLRNDPNWLQKLKACNIVKNLLVLSLKIETSSI
                     PKTLEVTKLIEKYSELMENDLLAHFNSAYRENNFNQLNEIALILNHFNGGVNVIQSFI
                     NQHSYFIDTAQIDFDETTETFLDEKLKNRLLDQDSHGVIYDEAIIKILDEIETVIKNE
                     SKIVKRVFEDRAPHVIQLFIQRIFAQKIEPRFELSLNASLSFSNLAYVRTLHGLYSIL
                     GQFVKDLSEFFQLLEIDKDNVLTNTVEQCYSDFFSRYLYDRSKYFEIEKQSLESILLE
                     KTAKFNSNHEKEIRSRSLLNKFNKNIENNTYEFNDLTGTTNNSRSRLSQLNSFLKNHL
                     DRDHLSLSRANTLNFNNYDDNDINNSNINMTPSNITSKDNIFQDAYDEEFSLTNVDSM
                     LKCIVESVARVMELIPNKDVFTFELVDIMFMGIIGTYVEISLELAYSHICQIDISKES
                     DINLKFLKYISTSTSILSLISTSIKAIFLPLLNNSPETKKQIIELTNKQIKRSELLIN
                     TILEEIIQVYDSKFSHSLSKQKKKDFVPKSQDLLDQDTLPAIEIVSLLNSLYSQSSQY
                     LKKKNLEGFLNAIGEDLYNLLLAHYAKFQVSSIGGIIVTKDIIGYQNTIEEWRIPNLL
                     EKFATLRELANLFTVQPVLLDSLTREGHLADISKEVISNYIANREDFNHENFITSMKL
                     KF"
     gene            <515502..>516227
                     /gene="NDAI0G02300"
                     /locus_tag="NDAI_0G02300"
                     /db_xref="GeneID:11497401"
     mRNA            <515502..>516227
                     /gene="NDAI0G02300"
                     /locus_tag="NDAI_0G02300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671200.2"
                     /db_xref="GeneID:11497401"
     CDS             515502..516227
                     /gene="NDAI0G02300"
                     /locus_tag="NDAI_0G02300"
                     /inference="similar to DNA sequence:INSDC:YLR165C"
                     /note="similar to Saccharomyces cerevisiae PUS5 (YLR165C);
                     ancestral locus Anc_8.380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671248.2"
                     /db_xref="GeneID:11497401"
                     /db_xref="GOA:G0WDZ4"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:G0WDZ4"
                     /translation="MIKIIFDCNNYIIVNKPFGVFSQPGDLGAWFLKNPNSKAGPRVL
                     LDEVPNTFSRNVQSFDKLRTVNRLDACVTGGMLLAKNKNAAEMFSRNLRKGGNSGFQI
                     SRRYVALLDTNQIDDFQALRESGTMISDDMVSKYKRLDEQCILLELVTGKKHQLRKQL
                     ASILKQPILNDCKNGGLRIPEVDENQIALHSAFIKTKVGLQERKHLIPMTFDNNGNLW
                     LRKYCDAKGHFSPEIIRLLDEGW"
     gene            complement(<517385..>518269)
                     /gene="NDAI0G02310"
                     /locus_tag="NDAI_0G02310"
                     /db_xref="GeneID:11497402"
     mRNA            complement(<517385..>518269)
                     /gene="NDAI0G02310"
                     /locus_tag="NDAI_0G02310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671201.2"
                     /db_xref="GeneID:11497402"
     CDS             complement(517385..518269)
                     /gene="NDAI0G02310"
                     /locus_tag="NDAI_0G02310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671249.2"
                     /db_xref="GeneID:11497402"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:G0WDZ5"
                     /translation="MYKYFSNLTRFTQKKNMKLDSLKQEQPFLADDSVGTLLLPKDKF
                     SFWITYAFSEHMHQLASKIWGGLAILLAVLTITFGILGNDISIAFFIFSLFSLLFFLI
                     LFAVNCERDHKLYKLNSHNKMKLLMDIIENKPNASVQSWDIIARHMNKYLYLEGYYNT
                     PNFFYDGNEVYYWFRRFVLEARMAPQQNIATTTQNSSSVADSKDGVKELDPNIASGTS
                     PELAVLQASRIAASNLADRTELGKYEIVALQVYEESVAEYWANEYPVAFERVENFVDT
                     TNTGTSKQDTTAEYADMV"
     gene            <518661..>520052
                     /gene="NDAI0G02320"
                     /locus_tag="NDAI_0G02320"
                     /db_xref="GeneID:11497403"
     mRNA            <518661..>520052
                     /gene="NDAI0G02320"
                     /locus_tag="NDAI_0G02320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671202.2"
                     /db_xref="GeneID:11497403"
     CDS             518661..520052
                     /gene="NDAI0G02320"
                     /locus_tag="NDAI_0G02320"
                     /inference="similar to DNA sequence:INSDC:YLR163C"
                     /note="similar to Saccharomyces cerevisiae MAS1 (YLR163C);
                     ancestral locus Anc_8.376"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671250.2"
                     /db_xref="GeneID:11497403"
                     /db_xref="GOA:G0WDZ6"
                     /db_xref="InterPro:IPR001431"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:G0WDZ6"
                     /translation="MFSQTLKNVRSSTIIKRFLKQAATPSTRTSVLPNGLTVATEWMP
                     NTSSATVGIFVDAGSRAENEKNNGTAHFLEHLAFKGTKNRSQKGIELEIENIGSHLNA
                     YTSRENTVYYAKSLKEDIPKAVDILSDILTRSVLDPEAIERERDVIIRESEEVDKMYD
                     EVVFDHLHEVTYKDQPLGRTILGPIKNIQSITRDDLSKYITDNYKGDRMVLAGAGAVD
                     HEKLVEYAQRCFGHLGKSTSPVPLGSPRGPLPVFNRGERLIEEKTLPTTHIAISLEGV
                     SWSAPDYFIGLATQAIIGNWDRALGAGTNSPSPLAVAASNKGILANSYMSFSTSYADS
                     GLWGMYLVLDSKEHDAKKIIDEIIKEWRRIKSGNISDVEVNRAKAQLKAALLLSLDGT
                     TAIVEDMGRQFVTTGKRLSPEEVFEKVNQITKDDIVKWANYRLQDKPVSMVALGNIKT
                     VPGISYIEEKLNK"
     gene            <520917..>522380
                     /gene="NDAI0G02330"
                     /locus_tag="NDAI_0G02330"
                     /db_xref="GeneID:11497404"
     mRNA            <520917..>522380
                     /gene="NDAI0G02330"
                     /locus_tag="NDAI_0G02330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671203.2"
                     /db_xref="GeneID:11497404"
     CDS             520917..522380
                     /gene="NDAI0G02330"
                     /locus_tag="NDAI_0G02330"
                     /inference="similar to DNA sequence:INSDC:YDR314C"
                     /note="similar to Saccharomyces cerevisiae RAD34
                     (YDR314C); ancestral locus Anc_5.340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671251.2"
                     /db_xref="GeneID:11497404"
                     /db_xref="GOA:G0WDZ7"
                     /db_xref="InterPro:IPR004583"
                     /db_xref="InterPro:IPR018325"
                     /db_xref="InterPro:IPR018326"
                     /db_xref="InterPro:IPR018327"
                     /db_xref="InterPro:IPR018328"
                     /db_xref="UniProtKB/TrEMBL:G0WDZ7"
                     /translation="MGERPKIINGIDDIRIMAKNKKTNRDILVIFFMIILKNILPKEC
                     KLSLCFALPTPDYGIMGSKLHWQMRTGTGQVPNRFDTDLLKPNFWIELVLPYATDEIY
                     IMDPVVLIGEKEMVKKYKRSEPVLNLYPTWSFKTTVNQVFKYVVSIDSVTGLLQDVSA
                     RYVPNLCYAYFDNSVWSPYLQSKNYCAFIFFRKVIDTINRNNKVLPTERDKTFQHNVM
                     HKIAMNNYTLPKTLADVKRSNNFIIPSLLKSTEAIQDRASPVGTFHYGQQMKLKEHIY
                     WRKDVQQLKSRQHWAILGRSVKSDVKPLKQKKYIPMKNRKRPKLEMYEIKELYSFEQT
                     INTPKYPSHYRDQDGKFSKITDPRYYKNKFNHIEIYSEDIKPDGFKLISLNEPTDIKG
                     SIHRFNRVQRKNSKDIIYYLDVVSGFDFKQKKGSAVPVVESILVNENDYEKIQVFLEK
                     RQELTSLQLWDTLIRKAQLKETLNIRYGHISQKPYDE"
     gene            complement(524025..524145)
                     /gene="Ndai_RDN5-1"
                     /locus_tag="NDAI_RDN5-1"
                     /db_xref="GeneID:11495683"
     rRNA            complement(524025..524145)
                     /gene="Ndai_RDN5-1"
                     /locus_tag="NDAI_RDN5-1"
                     /product="5S ribosomal RNA"
                     /transcript_id="XR_002431981.1"
                     /db_xref="GeneID:11495683"
     STS             524033..524145
                     /standard_name="PMC99952P2"
                     /db_xref="UniSTS:273711"
     gene            525760..527558
                     /gene="Ndai_RDN18-1"
                     /locus_tag="NDAI_RDN18-1"
                     /db_xref="GeneID:11495714"
     rRNA            525760..527558
                     /gene="Ndai_RDN18-1"
                     /locus_tag="NDAI_RDN18-1"
                     /product="18S ribosomal RNA"
                     /transcript_id="XR_002431979.1"
                     /db_xref="GeneID:11495714"
     STS             525779..526332
                     /gene="Ndai_RDN18-1"
                     /locus_tag="NDAI_RDN18-1"
                     /standard_name="PMC106412P1"
                     /db_xref="UniSTS:270119"
     STS             526035..527004
                     /gene="Ndai_RDN18-1"
                     /locus_tag="NDAI_RDN18-1"
                     /standard_name="PMC140342P1"
                     /db_xref="UniSTS:270933"
     STS             526075..526759
                     /gene="Ndai_RDN18-1"
                     /locus_tag="NDAI_RDN18-1"
                     /standard_name="PMC95223P1"
                     /db_xref="UniSTS:273623"
     STS             526163..526958
                     /gene="Ndai_RDN18-1"
                     /locus_tag="NDAI_RDN18-1"
                     /standard_name="PMC343294P1"
                     /db_xref="UniSTS:273189"
     STS             526190..526708
                     /gene="Ndai_RDN18-1"
                     /locus_tag="NDAI_RDN18-1"
                     /standard_name="PMC125238P1"
                     /db_xref="UniSTS:270483"
     STS             526216..526629
                     /gene="Ndai_RDN18-1"
                     /locus_tag="NDAI_RDN18-1"
                     /standard_name="PMC87142P1"
                     /db_xref="UniSTS:273581"
     STS             526304..526805
                     /gene="Ndai_RDN18-1"
                     /locus_tag="NDAI_RDN18-1"
                     /standard_name="PMC104890P1"
                     /db_xref="UniSTS:270115"
     STS             526517..526867
                     /gene="Ndai_RDN18-1"
                     /locus_tag="NDAI_RDN18-1"
                     /standard_name="PMC133845P3"
                     /db_xref="UniSTS:270670"
     STS             526694..526770
                     /gene="Ndai_RDN18-1"
                     /locus_tag="NDAI_RDN18-1"
                     /standard_name="PMC152246P1"
                     /db_xref="UniSTS:271203"
     STS             526771..527065
                     /gene="Ndai_RDN18-1"
                     /locus_tag="NDAI_RDN18-1"
                     /standard_name="PMC84574P1"
                     /db_xref="UniSTS:273448"
     STS             527515..528297
                     /standard_name="PMC86038P1"
                     /db_xref="UniSTS:273512"
     STS             527517..527912
                     /standard_name="ITS"
                     /db_xref="UniSTS:275294"
     gene            527863..528020
                     /gene="Ndai_RDN58-1"
                     /locus_tag="NDAI_RDN58-1"
                     /db_xref="GeneID:11495712"
     rRNA            527863..528020
                     /gene="Ndai_RDN58-1"
                     /locus_tag="NDAI_RDN58-1"
                     /product="5.8S ribosomal RNA"
                     /transcript_id="XR_002431982.1"
                     /db_xref="GeneID:11495712"
     gene            528252..531646
                     /gene="Ndai_RDN25-1"
                     /locus_tag="NDAI_RDN25-1"
                     /db_xref="GeneID:11495715"
     rRNA            528252..531646
                     /gene="Ndai_RDN25-1"
                     /locus_tag="NDAI_RDN25-1"
                     /product="25S ribosomal RNA"
                     /transcript_id="XR_002431980.1"
                     /db_xref="GeneID:11495715"
     STS             528299..528484
                     /gene="Ndai_RDN25-1"
                     /locus_tag="NDAI_RDN25-1"
                     /standard_name="G28482"
                     /db_xref="UniSTS:48320"
     STS             528320..528957
                     /gene="Ndai_RDN25-1"
                     /locus_tag="NDAI_RDN25-1"
                     /standard_name="PMC139893P1"
                     /db_xref="UniSTS:270904"
     STS             530362..530737
                     /gene="Ndai_RDN25-1"
                     /locus_tag="NDAI_RDN25-1"
                     /standard_name="PMC133845P2"
                     /db_xref="UniSTS:270669"
     STS             530372..530619
                     /gene="Ndai_RDN25-1"
                     /locus_tag="NDAI_RDN25-1"
                     /standard_name="PMC120649P1"
                     /db_xref="UniSTS:270380"
     STS             530431..530725
                     /gene="Ndai_RDN25-1"
                     /locus_tag="NDAI_RDN25-1"
                     /standard_name="PMC89798P1"
                     /db_xref="UniSTS:273611"
     STS             530431..530687
                     /gene="Ndai_RDN25-1"
                     /locus_tag="NDAI_RDN25-1"
                     /standard_name="PMC89798P2"
                     /db_xref="UniSTS:273612"
     STS             530435..530887
                     /gene="Ndai_RDN25-1"
                     /locus_tag="NDAI_RDN25-1"
                     /standard_name="PMC156610P1"
                     /db_xref="UniSTS:271418"
     STS             530472..530889
                     /gene="Ndai_RDN25-1"
                     /locus_tag="NDAI_RDN25-1"
                     /standard_name="Pp_Pp7"
                     /db_xref="UniSTS:259708"
     gene            complement(532683..532756)
                     /gene="NDAI0Gtrna5N"
                     /locus_tag="NDAI_0Gtrna5N"
                     /db_xref="GeneID:11495713"
     tRNA            complement(532683..532756)
                     /gene="NDAI0Gtrna5N"
                     /locus_tag="NDAI_0Gtrna5N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:11495713"
     gene            <535293..>536060
                     /gene="NDAI0G02340"
                     /locus_tag="NDAI_0G02340"
                     /db_xref="GeneID:11497405"
     mRNA            <535293..>536060
                     /gene="NDAI0G02340"
                     /locus_tag="NDAI_0G02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671204.2"
                     /db_xref="GeneID:11497405"
     CDS             535293..536060
                     /gene="NDAI0G02340"
                     /locus_tag="NDAI_0G02340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671252.2"
                     /db_xref="GeneID:11497405"
                     /db_xref="UniProtKB/TrEMBL:G0WDZ8"
                     /translation="MEMSKYILDTDIVLSLQFKSTIKMKFQELKAAGSIFIGMESDDW
                     LSNSKNEYSSVTFNMVGKGVKNIALTVDLFSVKNKSKARHSVLLQSTIEKYKAHGLLS
                     SVTTDNCSQVLGAGNVLKKDHMCVNFRESIGCLAHQLALFTNDFINAITCAFSGVLDD
                     EINRYLKEENDNEEVSPELESETDGEDLAIDEQEDIIEDVEESVTTIRNQEISKEEQE
                     KMKNYEHLGDTIMKSDEYRSPSPFHKFKISDLMMVPY"
     gene            <539058..>541079
                     /gene="NDAI0G02350"
                     /locus_tag="NDAI_0G02350"
                     /db_xref="GeneID:11497406"
     mRNA            <539058..>541079
                     /gene="NDAI0G02350"
                     /locus_tag="NDAI_0G02350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671205.2"
                     /db_xref="GeneID:11497406"
     CDS             539058..541079
                     /gene="NDAI0G02350"
                     /locus_tag="NDAI_0G02350"
                     /inference="similar to DNA sequence:INSDC:YLR153C"
                     /note="similar to Saccharomyces cerevisiae ACS2 (YLR153C);
                     ancestral locus Anc_8.367"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671253.2"
                     /db_xref="GeneID:11497406"
                     /db_xref="GOA:G0WDZ9"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR011904"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:G0WDZ9"
                     /translation="MARRTHECVHEAENAQLHYAPAHFYETQPGKGYIDDVDQYSQMY
                     RESIDNPELFFDKMAKEFLHWDTPYKAVKSGSLADGDVAWFLNGELNASYNCVDRHAF
                     ANSNKPAIIYEADDEVENRIITFGQLLRKVSKVASLLKSWGVKKGDVVTIYLPMIPEV
                     IITMLAVVRIGAIHSVIFSGFSASSLRERIIDSKSKVIITCDEAKRGGKTIHTKDIVN
                     ESLQGINSVTYVLVYERTHNKTIAMSPTRDYWWTEEVNKQPNYCPPVPCNAEDPLFLL
                     YTSGSTGSPKGIVHTTAGYLLGAAITTRYVFDIHPDDILFTAGDVGWITGHTYALYGP
                     LSLGTATIIFESTPAYPDYGRYWRIIERYKATHFYVAPTALRLIKKIGEAEISKYDIS
                     SLRVLGSVGEPISPELWKWYHEKIGNKNCVVCDTMWQTESGSHLLAPLSGVTPTKPGS
                     ATVPFFGIDACLIDPVSGHILEGNDVVGVLAVKCSWPSMARSVWNNHDRYIETYLKPY
                     PGYYFTGDAAGRDHDGYYWIRGRVDDVVNVSGHRLSTTEIETCLVNDKYVSAAAVVGI
                     PDDLTGQSVVAFVSLQNDNEIDGPVSFHRELILQVRKEIGPFAAPKAVIIINDLPKTR
                     SGKIMRRVLRKIASNEAEQLGDLSTLANPEIVSEIMEAVKTQFFNRNVK"
     gene            <541421..>542395
                     /gene="NDAI0G02360"
                     /locus_tag="NDAI_0G02360"
                     /db_xref="GeneID:11497407"
     mRNA            <541421..>542395
                     /gene="NDAI0G02360"
                     /locus_tag="NDAI_0G02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671206.2"
                     /db_xref="GeneID:11497407"
     CDS             541421..542395
                     /gene="NDAI0G02360"
                     /locus_tag="NDAI_0G02360"
                     /inference="similar to DNA sequence:INSDC:YLR151C"
                     /note="similar to Saccharomyces cerevisiae PCD1 (YLR151C);
                     ancestral locus Anc_8.365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671254.2"
                     /db_xref="GeneID:11497407"
                     /db_xref="GOA:G0WE00"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:G0WE00"
                     /translation="MALLNPFRILENLRKFKYNRPFPISSIWPVNRRAAVLILLFVGN
                     SGELRVLLTKRSRSLRSFSGHVALPGGKADSSTETFEQIARREAEEEIGLPQDKNVLE
                     NRYGMKLETISTEIPCYISQTFLSVKPVVCFLYNSEFDQKNEKYTKTLDASKFFGKLN
                     PGETSSLFSVPLNDMVKHLFTDSSDIKPEYERRVHMSKNWGGLKWFIEHYYYPVLNTN
                     EVSWLNTIEDLSSEDELEDGQQYRDLWGLTAKILSDVARIGNNIDSAKRRGHEGLIYG
                     LYEFSDQFKDPKRSIWEQAMIAGKKGYYYSDVLPEHYIKKLQRDDVTF"
     gene            <543140..>544645
                     /gene="NDAI0G02370"
                     /locus_tag="NDAI_0G02370"
                     /db_xref="GeneID:11497408"
     mRNA            <543140..>544645
                     /gene="NDAI0G02370"
                     /locus_tag="NDAI_0G02370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671207.2"
                     /db_xref="GeneID:11497408"
     CDS             543140..544645
                     /gene="NDAI0G02370"
                     /locus_tag="NDAI_0G02370"
                     /inference="similar to DNA sequence:INSDC:YDR169C"
                     /note="similar to Saccharomyces cerevisiae STB3 (YDR169C);
                     ancestral locus Anc_8.363"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671255.2"
                     /db_xref="GeneID:11497408"
                     /db_xref="InterPro:IPR018818"
                     /db_xref="UniProtKB/TrEMBL:G0WE01"
                     /translation="MMEIKKDINDINTKPDDTNANKNITLDPSIAHQRSVSNNKNSNN
                     IVSGSVTPRKLSELLMRRGPLAIRHITQALNEDITNFKDLSSSKQRRLIMGAMDDGDK
                     DNRIVFEKVGWGQWSARQLDDNEDFNTVLDITKKNNLKVRDAASTAKDDNNNIGINTN
                     ANVNTNTSSSSRRRSSNSAMVKKPETKTKNKNHPISSPAMTTNSPQAESLSQPSVLYI
                     DEEVLASDEEDDIDIENRDKDMFAFNGRRKSTVVYASNVAGDNVASTADVTEHELMAR
                     HIRPKLRNNSRTRRSSSKSKSRPSINKMVPSTVNQQTDIQTFQHQQHFISGQSNKIDL
                     DLLSRSTLSEPPSERPSRVSFSKESGIRSTLFASNGMYKGEEKRNTVGSTTFNNTSSD
                     MSNRFAIPQIAFKNPHIGHNTVESFIPPSAEDTSHNNHEEKQTPSDTTEDEDWAAMGA
                     EVLRNVKNSGTQNVLQRNQHANNVDDRKESQHRRGTDDENDGAILLMNLMK"
     gene            <544818..>547058
                     /gene="NDAI0G02380"
                     /locus_tag="NDAI_0G02380"
                     /db_xref="GeneID:11497409"
     mRNA            <544818..>547058
                     /gene="NDAI0G02380"
                     /locus_tag="NDAI_0G02380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671208.2"
                     /db_xref="GeneID:11497409"
     CDS             544818..547058
                     /gene="NDAI0G02380"
                     /locus_tag="NDAI_0G02380"
                     /inference="similar to DNA sequence:INSDC:YLR149C"
                     /note="similar to Saccharomyces cerevisiae YLR149C;
                     ancestral locus Anc_8.362"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671256.2"
                     /db_xref="GeneID:11497409"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019417"
                     /db_xref="UniProtKB/TrEMBL:G0WE02"
                     /translation="MPGLELYDAKVTINHWQLRDCVKPCSTNPNKLYYIFDHSIRSLD
                     TAMSNDVLLKKQHYNYHYPSSSRKYDKKTSSLLRKNNGSVAPSKKLVEFNFKPRCFTE
                     LNGLTVCGGLIGSDDRGFPTNWNRLSAHNGDNDSVDPTTTTRPYLSSPADPIKLASHG
                     ALADSTNYSNPNIWKGIINVYNEHTGKAKSLILGQFINNCVTLFNTSNNNYDLYTCNN
                     DGHLYQCTINNRGVELIRRYSDLKFPLNNASMSHDGQTMVVSGDSNKFALYQKDQLNN
                     KFSLNGKAALSSGNALSNWGNQEIVNRMPRYENVNDTTLDNMNDTTTVNNNNTTNNIF
                     DAPSGDHGFYNCFSENDMKFATLFQNGICLIYDARYTNSPLATIKSTRPNSHTGAFRV
                     CRFSYGLDDLLFISEHQGRVHVVDTRNFENHQVIVIPDKLNMDDDLNTNTTPTLSSNF
                     LNGDPVSLNQYLQIPSGSVNRHDLLSNNVSSISNASRHCYDRSTRNSTSENEPWITPA
                     GSVPLECLEPQIFPFPKIIDKFSNHELNQIDYNTISSRLVDSNNNNFIGGGTSQMNHD
                     NEMDFQPRARRRSSFRIRRVSTSSNRSEESEDIDPVISQHRRRHFNRQQYLNALNSQV
                     VVDEDEDQDGEDNSMNTTRHTRHNVTGLLDDDDEETNNYAVFDNDDLYDAYNDINSTN
                     IPRTRNNVILNYSNNDYTEENNISGIDWVQDNSGSSLVIGTDYGIMKWNINSWARRSF
                     SSYEFC"
     gene            complement(<547355..>550252)
                     /gene="NDAI0G02390"
                     /locus_tag="NDAI_0G02390"
                     /db_xref="GeneID:11497410"
     mRNA            complement(<547355..>550252)
                     /gene="NDAI0G02390"
                     /locus_tag="NDAI_0G02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671209.2"
                     /db_xref="GeneID:11497410"
     CDS             complement(547355..550252)
                     /gene="NDAI0G02390"
                     /locus_tag="NDAI_0G02390"
                     /inference="similar to DNA sequence:INSDC:YLR148W"
                     /note="similar to Saccharomyces cerevisiae PEP3 (YLR148W);
                     ancestral locus Anc_8.359"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671257.2"
                     /db_xref="GeneID:11497410"
                     /db_xref="GOA:G0WE03"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007810"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019453"
                     /db_xref="UniProtKB/TrEMBL:G0WE03"
                     /translation="MNVDIENVQLDFIKELSKNITALQVKSNNLCFALKSGKIYLINL
                     ETPSNVVHFQIPLLITNNDNNLNVNEKLLTISLSPNADKLFIKTNFANYYILQLNHQQ
                     EPNTNINKINSIIPIKKLSKKKNYDIRAIEWINNDTIICGSTDGTILRIDSSQTLLLT
                     GSKQPKVTQLIQDSSSSIDGILYHNEKLLIASGNQGTIKIWKNVKFMNQHDMETFFKE
                     KFKSPDEMENFDDNLIADDDHHDNKIMHFTPKFSSYGSLFAWVTSTGIVFGDLEPSTK
                     AKVNQPIEDTKPTILKDAKILLNIELSDSKYKIKDVIMTKFHIIIIRGFTITIINQLD
                     NSIVFEESIWDNKDTSSGKLLGLAADYSQSLPTFWCFSNTNIYEIILNKESNAIWKLL
                     CDQKKFDVALSLKDSLNQFQIDSILLYKGEHLLLTAHDGMDENLYAEAARCFGLTSSS
                     SITSLALKFFQLKDNFTNNDDSNGNEISSTKNLQIFLTTKLNHINNKVQGILISSWII
                     WLFMKELNHIEEKISQSKIQDDITNLNETKFKTSKELQTFLSKNLHHLDKETIYQIIS
                     NQNRKNELLYFANLIEDYHDVLDYWITQENWYESLKILVKFNDPNLVYKYSNVLLINS
                     PESTINSWMKIDNIDATELIPSILNYYTNFQKQSISTAEELQNYGLFYLKWYIEQTYN
                     LNVPIIYNTVLYMLIVKDGSIPLVSSERSEQMETYEQSIINFLTKYHDKYDQDFILRL
                     SLKFKRIKVSIFLYSQLHLYEDSINLALQNNLINLAKIIANDPSLDENLKLRKKLWLE
                     IAKNLLFTSTTDNNDNERAIDLKSTIRSIINDSNNLLEIKDLLPFFNEFTTIANLKDE
                     LIKSLEVHSQSMIQTSSAIKKSLILKKNIKEEIKNFEKRYQILEPGKSCNSCHKFLQS
                     RKFLVFPCDHCFHTDCLIKEILNSNDYYLKDKIGKFQKNYQRIENQLILRN"
     gene            <550523..>550726
                     /gene="NDAI0G02400"
                     /locus_tag="NDAI_0G02400"
                     /db_xref="GeneID:11497411"
     mRNA            <550523..>550726
                     /gene="NDAI0G02400"
                     /locus_tag="NDAI_0G02400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671210.2"
                     /db_xref="GeneID:11497411"
     CDS             550523..550726
                     /gene="NDAI0G02400"
                     /locus_tag="NDAI_0G02400"
                     /inference="similar to DNA sequence:INSDC:YLR147C"
                     /note="similar to Saccharomyces cerevisiae SMD3 (YLR147C);
                     ancestral locus Anc_8.358"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671258.2"
                     /db_xref="GeneID:11497411"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:G0WE04"
                     /translation="MSSIPVKLLNEAQGHIVSVELATGETYRGKLIESEDNMNIQLRD
                     VIVTGTDSKMTRMDHVFVRGVSY"
     gene            complement(<550929..>551264)
                     /gene="NDAI0G02410"
                     /locus_tag="NDAI_0G02410"
                     /db_xref="GeneID:11497412"
     mRNA            complement(<550929..>551264)
                     /gene="NDAI0G02410"
                     /locus_tag="NDAI_0G02410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671211.2"
                     /db_xref="GeneID:11497412"
     CDS             complement(550929..551264)
                     /gene="NDAI0G02410"
                     /locus_tag="NDAI_0G02410"
                     /inference="similar to DNA sequence:INSDC:YLR146W-A"
                     /note="similar to Saccharomyces cerevisiae YLR146W-A;
                     ancestral locus Anc_8.356"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671259.2"
                     /db_xref="GeneID:11497412"
                     /db_xref="UniProtKB/TrEMBL:G0WE05"
                     /translation="MDPYKDEDTSSSTTDGYTEPRRNNDRETQKQVTSSALLNDLLSQ
                     ALEQQSQINDLFAKLTDVNKEVRTDIDEFCDLYEKSIMFNTNNNITNDDMDNERTHAS
                     MNSSREEIN"
     gene            <551702..>552625
                     /gene="NDAI0G02420"
                     /locus_tag="NDAI_0G02420"
                     /db_xref="GeneID:11497413"
     mRNA            <551702..>552625
                     /gene="NDAI0G02420"
                     /locus_tag="NDAI_0G02420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671212.2"
                     /db_xref="GeneID:11497413"
     CDS             551702..552625
                     /gene="NDAI0G02420"
                     /locus_tag="NDAI_0G02420"
                     /inference="similar to DNA sequence:INSDC:YLR146C"
                     /note="similar to Saccharomyces cerevisiae SPE4 (YLR146C);
                     ancestral locus Anc_8.354"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671260.2"
                     /db_xref="GeneID:11497413"
                     /db_xref="GOA:G0WE06"
                     /db_xref="InterPro:IPR001045"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0WE06"
                     /translation="MTTATTEPPAKTTLPRHPLIKDGWFREINDKCFPGQAFAIKVSE
                     ILHTSQSDFQDILVFQSESYGVVLVLDGIVQCTERDEFAYQEMISHIPMYLHKNPKKV
                     LVIGGGDGGVLREVVKHDCIKSATLVEIDKTVIELSKKYLLEMSTAFDHPKVNVELCD
                     GFKYLKQVRDWEYNDKFDVIITDSSDPEGPAEAFFQREYFQLLQGALKDDGILIAQAS
                     ENVWLDLKYLTKLIKTAKSVFPNTNYCYTMVPSYTSGQLGLIVCSKQYDLNLTIPTRL
                     PTENEQGLLRYYNPEIHSSFVCSSNLGKFND"
     gene            complement(<552814..>553617)
                     /gene="NDAI0G02430"
                     /locus_tag="NDAI_0G02430"
                     /db_xref="GeneID:11497414"
     mRNA            complement(<552814..>553617)
                     /gene="NDAI0G02430"
                     /locus_tag="NDAI_0G02430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671213.2"
                     /db_xref="GeneID:11497414"
     CDS             complement(552814..553617)
                     /gene="NDAI0G02430"
                     /locus_tag="NDAI_0G02430"
                     /inference="similar to DNA sequence:INSDC:YLR145W"
                     /note="similar to Saccharomyces cerevisiae RMP1 (YLR145W);
                     ancestral locus Anc_8.353"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671261.2"
                     /db_xref="GeneID:11497414"
                     /db_xref="UniProtKB/TrEMBL:G0WE07"
                     /translation="MQQSLDSDYTYNQRYKDLYLKLHQEFRILHLLYHRNKNQHRLSI
                     WWKRFNMLKRNCAQVIELIEYHYKQPEYNGKMTSSSSSKSKRQKQKIVIIRLYRLIHS
                     MFSKRYLSKMYYDFNGIIALGQFVTLGVVLVGLLGRIYSIYLELFELNRNNFKHVGCI
                     IKDIPINKILVNETNQAIMKSINQEELGEELGEEISIDDTMHNVRNTIIEQQLDDNVI
                     EMKISTGIRIQENITTEHTIEKKKDNKIKKKKNKKSKSKSKSAIDSIFG"
     gene            <554213..>556846
                     /gene="NDAI0G02440"
                     /locus_tag="NDAI_0G02440"
                     /db_xref="GeneID:11497415"
     mRNA            <554213..>556846
                     /gene="NDAI0G02440"
                     /locus_tag="NDAI_0G02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671214.2"
                     /db_xref="GeneID:11497415"
     CDS             554213..556846
                     /gene="NDAI0G02440"
                     /locus_tag="NDAI_0G02440"
                     /inference="similar to DNA sequence:INSDC:YLR144C"
                     /note="similar to Saccharomyces cerevisiae ACF2 (YLR144C);
                     ancestral locus Anc_8.352"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671262.2"
                     /db_xref="GeneID:11497415"
                     /db_xref="GOA:G0WE08"
                     /db_xref="InterPro:IPR005200"
                     /db_xref="UniProtKB/TrEMBL:G0WE08"
                     /translation="MYDAPPPYSEIDLNANAPPDLPNRVRRQPETPAPGNAGQQNDYL
                     YAAPPVHHARYNRRPMIPPVRPPAIPPVRIENEDEDEYAPPLPRRPPSSSPSSPSLAV
                     PPPQLPPRSRSVSRHSSLNNSQIEILRSSTSRPNDAEESIISDLQSNLNSMNIVDSSK
                     NLLDFKLSNSEPLSIFARKSHEIPLPMNLNKNGSALHTNKFYANLFLGNQTCPIWTHP
                     YSLWFSKEQDSLGIAINHIKASQRVFSDEIPSKFFFCPTNIKAFIFSSIEFNITEMPK
                     LGFAGCNHMSIQLQLKKNDSQFIWFPLVQGMGFVTAIYYNLTPKFQSMIGFKSITLIT
                     NNQSLPINVSKYRILLQDDRIWTLYITLPVGSETTFRMSLTQIDGNTIVADKSISGTI
                     VQIIPESHDQIDRLAGSYVMDCTVESYAINDNTDELNYKLKYKTSSQTKPSPNTLIFA
                     LPHHIDVMTQQTLNTRTGIKLDSTVMGEMEAFITTEFNMNLSIPTNLNFNPFTTIPGK
                     NNNNNNNIHYTPEILQSIHKAAINESQNDILTESNLDSMYFSGKILAKYAWILYVSHF
                     ILHDSNITNRLLINLKKAIQRFISNTQILPLMYDTIWGGIISSGTSSQDFGNSFYNDH
                     HFHYSYHVITASIIALVDNDINADGNGSSWLIQNKDWVECLIRDYCNPSIDDQYFPQF
                     RSFDWFNGHSWAKGLFESGDGKDEESSSEDVNASYALKLWGLVTKNNKLEQLGNLQLG
                     ILRGSLNHYFLYSNDNITEPKNFIGNKVSGILFENKIDHTTYFGNELQYIQMIHAIPI
                     TPASSFIRSPKFVEEEWEQKLIGIVGDINDGWKGIIMLNVALFDPIMSFSFFNDPEFK
                     SDFLDNGQSLTWSLAYSGAFY"
     gene            complement(<557055..>559937)
                     /gene="NDAI0G02450"
                     /locus_tag="NDAI_0G02450"
                     /db_xref="GeneID:11497416"
     mRNA            complement(<557055..>559937)
                     /gene="NDAI0G02450"
                     /locus_tag="NDAI_0G02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671215.2"
                     /db_xref="GeneID:11497416"
     CDS             complement(557055..559937)
                     /gene="NDAI0G02450"
                     /locus_tag="NDAI_0G02450"
                     /note="ancestral locus Anc_8.350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671263.2"
                     /db_xref="GeneID:11497416"
                     /db_xref="UniProtKB/TrEMBL:G0WE09"
                     /translation="MQFEKNVEQGRYDLIPVKSLPSYIDDYSSMAHLQAVSAHDSFKG
                     KPGQISPLLLPANTDKTFLEPIPISILEKLSQVYQSGTLHQSLPTRAENLSNTLASSN
                     IPSFRTDMGLTNTQELDANSQVVSSVTQAALASSSLRHRPTLVINVKKEPEPVHLTDI
                     RVKPEPQDALLHTLPAPIGNESSTTSTTVMPSLPVQASNPNTTNKADEIVQVKTEPPE
                     NYSQVPNNVIPSDQSQHQQETADKSSSIVKNSLQTAQIQTHNDKVPDSTTPLAPTLEV
                     NETVSVSRNQDTTQLNKPSNAVRPEQVDDHSVSQNLGVSNNPENVVDNAVISSAIQKE
                     PTLEKTTNENIVDTLTEGPIYIKPTMQQSNPEKEKMVNDNKNTTETRKTLLGDNSKQM
                     TGALVQTPPTRLPEDTPTRGAQDQTTQSDKLKENLIPLGSTDTQQNHVAQTKFKPATT
                     TEPSPQTTSPAIPKHSLEIENGDGMEVKKRKILDSDNRTQPTKTVVAGSNLENYTSNK
                     ATKDKEMGTDECCSTDPTGDGAEPSTTLSTAVQTNQSVSTPTTTDHETNIKANTGEDT
                     SGQHTSPERQKISPVSVHTDPSNAIVPLSQNLQDRDSALTPLVPTTTTKTNKLRSLNL
                     PVGPANQLLSTGKDSANKKVLMGPEPDTTTEIIRNPNTDQLPKVTSQKSITSKDSIPL
                     SPKKHTKVSPTLISQSNQKQVLQISHPATHPIHTKFNSSSNTTENHSPSFPSENRLSR
                     YDSGSNMTSEIYQIRSLESXXXXXXXPPPFIEINNKYSSNTWNERNLNNVVSEQVRRP
                     TMSSEQREQSHIPDNFLSATKPTSLPPTPIQRQRERPNNYPPSAFNPIFSTNGSARIN
                     RSKSPDIPIHPRSRELLPTMRHFESNSRRTFNVDSMSNNNSSRQSEMAQPQPKLVLSF
                     LNPEANPESFYSINSRKLNNNHDRKQKPPKSLKRMGDLAKKYNLDR"
     gene            complement(<560518..>562671)
                     /gene="NDAI0G02460"
                     /locus_tag="NDAI_0G02460"
                     /db_xref="GeneID:11497417"
     mRNA            complement(<560518..>562671)
                     /gene="NDAI0G02460"
                     /locus_tag="NDAI_0G02460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671216.2"
                     /db_xref="GeneID:11497417"
     CDS             complement(560518..562671)
                     /gene="NDAI0G02460"
                     /locus_tag="NDAI_0G02460"
                     /inference="similar to DNA sequence:INSDC:YLR143W"
                     /note="similar to Saccharomyces cerevisiae YLR143W;
                     ancestral locus Anc_8.349"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671264.2"
                     /db_xref="GeneID:11497417"
                     /db_xref="InterPro:IPR002761"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR013813"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G0WE10"
                     /translation="MKFVALISGGKDSFYNIFHCLKNNHELIALANLHPTDVQEQELD
                     SFMFQTVGHDIIPLYSKCLGVPLLRTTIDKSSSKNVDLNYLPTKFDEIEKLYELLLSI
                     KNEFPDLEAVSVGAILSSYQRIRVESVCQRLGLTVLSYLWQRDQLELMKEMCSMSKDI
                     HTDVTSCCKFDARIIKVAAIGLDKSHLGKSLPVNLPTFTKLNKMYQVHICGEGGEFET
                     MVLDAPFFKNGFIKLIQLIHEDPSVSDDGVYSAKFKVEFQERTVPAEELSKQLSLLPV
                     PKVIDEKWDALLETYMKKNEEWNVVRTNGGDLAYSNNNTITMPLSIRKLDSLIFISNL
                     TCNNGSVSVIKQAENVFEQLAKILNDENLFPSQTLYSSLILRDMSQFSKVNGIYNKFF
                     NTFKVGPLPPSRACVGSELLANDCQLQLSIVLDRTKESQLIEIKGNEEINDFKTLMLN
                     KNKDGLHVQGRSYWAPCNIGPYSQAIWTRYDFNKVTYISGQIGLIPASMNILDSSKEA
                     QCVLALRHFDTLKETIDSKRQLFMTCFISTMDVLHTVCSIWSLYSNKMANESDSELWW
                     DKENDPMESIIIVKVSQLPRNAVCEWGGVTCKEIEFIDDEYDSNDESDIKEAVELYDL
                     QFLDTLQWAESTVNSNNSKRHFITAFSDDDTILRKALTSLERTAHIVLYYNATKMPHD
                     VQTGLYAYQNIEFFPVEGIFDYIGNEHRYGMQIRY"
     gene            complement(562854..562925)
                     /gene="NDAI0Gtrna9D"
                     /locus_tag="NDAI_0Gtrna9D"
                     /db_xref="GeneID:11497195"
     tRNA            complement(562854..562925)
                     /gene="NDAI0Gtrna9D"
                     /locus_tag="NDAI_0Gtrna9D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:11497195"
     gene            complement(<563847..>565484)
                     /gene="NDAI0G02470"
                     /locus_tag="NDAI_0G02470"
                     /db_xref="GeneID:11497418"
     mRNA            complement(<563847..>565484)
                     /gene="NDAI0G02470"
                     /locus_tag="NDAI_0G02470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671217.2"
                     /db_xref="GeneID:11497418"
     CDS             complement(563847..565484)
                     /gene="NDAI0G02470"
                     /locus_tag="NDAI_0G02470"
                     /inference="similar to DNA sequence:INSDC:YLR141W"
                     /note="similar to Saccharomyces cerevisiae RRN5 (YLR141W);
                     ancestral locus Anc_8.347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671265.2"
                     /db_xref="GeneID:11497418"
                     /db_xref="UniProtKB/TrEMBL:G0WE11"
                     /translation="MGRPRRDLVKLYYDHFNGEVRQFLDPTMGIKYELRGSRIHVDSR
                     VKYLEDKNVETTDRGGDDSDLEGEEEEVLTKRQAQLGTDWTSKEKHLFFFYLARYSIH
                     RLDEWYLKIGGKMTKYEVLVYYDVLKRNLNELKYGEGKTNGNDMDLRRRTTSRFGRLL
                     TLVDFPIAYEMDDSFIRLENKLSRMVSEELNKNDKSTTMEEISEEGNENEKGCQDLDQ
                     GENEDSNEERDGEEPHNKDRDIEISVAETMDYFNLQSKSWRERWKLLSSATHQTDKLA
                     LPSVTKDCHEYLTELVIDHVEGIFAELLLLPMADQRGFSRNEENISWSENPVVVVKAT
                     DIKKSLRNMRVHKHRPTDSGLGILETFDKFNVRPRLGSITKKSSRSKIKSLLKNPAEA
                     SLVEAVLSNKDDESVNVPSSRIPTRTRKRNKRESSSAKDSKHRRLERILTNWENKLME
                     IHDKRASQIYARTLLQYFLYQIPEEDDSKEDDSNVLERVQDNEDESHNNSGHDDNDDY
                     DDERFQPIILEDEEDPGADPEIAKIPHTVKNRFLHYY"
     gene            <565766..>568207
                     /gene="NDAI0G02480"
                     /locus_tag="NDAI_0G02480"
                     /db_xref="GeneID:11495703"
     mRNA            <565766..>568207
                     /gene="NDAI0G02480"
                     /locus_tag="NDAI_0G02480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671219.2"
                     /db_xref="GeneID:11495703"
     CDS             565766..568207
                     /gene="NDAI0G02480"
                     /locus_tag="NDAI_0G02480"
                     /inference="similar to DNA sequence:INSDC:YLR139C"
                     /note="similar to Saccharomyces cerevisiae SLS1 (YLR139C);
                     ancestral locus Anc_8.346"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671267.2"
                     /db_xref="GeneID:11495703"
                     /db_xref="UniProtKB/TrEMBL:G0WE13"
                     /translation="MSSFFPKLRSSQGILPINWKRNFITRTRCITIGKSTRTIVLIHP
                     YSIPNISSSIRNNQFRTYSTSEPGLFTSSEIDSDNNKKNETGAIEPSLSSSVHTSSIE
                     ESQPLISLDNVIDNKRGRKIKPEKQKIVVLDYKQAGLLNDKNDTVHNNRYHNSTRLDE
                     TYQNIFLLKDLPDLEPFIQTTSRKHISKQSALTQKNAEDHTKKGSDKKTAKTTTNSKL
                     STFDLQEIESQTNDLLRFESSVTLSQVMKSIDSQKPLTKVISHYDFSDLYNKLALSYT
                     LPQLRAYTKLNYNYSLTHLTKKKIINRIILKFWDCRIITTNEDSTEQKEDISLINRHK
                     QKKITKTYEVSTIDLKHTELALLIFTERGKLLKNLTKMNDVTIAFPLDENKLIIKAVS
                     RKIINYLEISIRKILSNVTNEFIDCHSLFQKLSIPQINNLINLIEINSGTVFEQIDKN
                     NNNNNNNNSNNSNNSNNNINEMIFKVSAFGQKRIEFAKRLLYWGTYEDNNLIEKTVLC
                     VPHSIRETEPTFKKYSYNDMESFNWIDKNKDWYRLQTPYSLHNNNKPTVLIPSNPIRI
                     DEVNDFKDFYFNFDKKKNELPHTANDHTSISMTLGVILNSKDSTKPCFQPYIPQLKQK
                     LLHLPLFNPTETQDELYSIDKHDYYLQLKFIPISHSITAAYPIELWFELDELENIQTE
                     TLQVITPRLTWSFQLQTPTLSHDFAINFEHYETMTKEMENRIHDTDLNLNSRDNKLNV
                     PNVISLNGTQYRFINSQYHRVLRLKYLNKYLVQMSDIDSGTMGGKFTRVDFIYGDNDN
                     NIGNVNGFINDVLNF"
     gene            complement(<568591..>569862)
                     /gene="NDAI0G02490"
                     /locus_tag="NDAI_0G02490"
                     /db_xref="GeneID:11497421"
     mRNA            complement(<568591..>569862)
                     /gene="NDAI0G02490"
                     /locus_tag="NDAI_0G02490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671220.2"
                     /db_xref="GeneID:11497421"
     CDS             complement(568591..569862)
                     /gene="NDAI0G02490"
                     /locus_tag="NDAI_0G02490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671268.2"
                     /db_xref="GeneID:11497421"
                     /db_xref="UniProtKB/TrEMBL:G0WE14"
                     /translation="MKIHSILSYIILLPLSQALEITHDVLQTGSITYNEPITIDTDKS
                     LKVTSGTNVNFMGSLNVDGNLCVSSNYINVTGSITNSHNIYLYNPGRYSHTSGTNIAV
                     KSILNEKEGLLTVQSGAYLVNELFGASDSFINEGIINIPSFFPNLSIYGPESGIENTG
                     TIVLGNTNATFSNSVTGGGCISNLNDAVYLDSTKEIDQTFWNSGGMEIHVIRGSYAKP
                     LVFRGFSKGASIGYAVSSQTKTLSWNYDPTNGSMVINTSSSGASSDIINIDLGPGYNS
                     SLFTITIDSVGIPGVSGVTQRYLTVRYKGVSPETTPPSECRLPSSLDYGQCSVLHLSS
                     SSSHLPSSSSSSIRATQISSSLKSTQASLNGHETSSRCIITNTRTKFQNTISTTHREY
                     VTGTDLTPITLSSKVVTYFIAGNQTQKMSSS"
     gene            complement(<571132..>574260)
                     /gene="NDAI0G02500"
                     /locus_tag="NDAI_0G02500"
                     /db_xref="GeneID:11497422"
     mRNA            complement(<571132..>574260)
                     /gene="NDAI0G02500"
                     /locus_tag="NDAI_0G02500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671221.2"
                     /db_xref="GeneID:11497422"
     CDS             complement(571132..574260)
                     /gene="NDAI0G02500"
                     /locus_tag="NDAI_0G02500"
                     /inference="similar to DNA sequence:INSDC:YLR138W"
                     /note="similar to Saccharomyces cerevisiae NHA1 (YLR138W);
                     ancestral locus Anc_8.341"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671269.2"
                     /db_xref="GeneID:11497422"
                     /db_xref="GOA:G0WE15"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="InterPro:IPR013928"
                     /db_xref="UniProtKB/TrEMBL:G0WE15"
                     /translation="MAVWEHLSVSKAHVAYACVGVFSSIFSLVSLFVKEKLYIGESTV
                     AGIFGLIVGPVCLNWFNPLKWGNSDSITLEITRIVLCLQIFAVAVELPRKYMLKHWLS
                     VVMLLFPVMTTGWLIIGLFVWIVIPGLNFSESLLISACITATDPILAQSVVSGKFAQK
                     VPGHLRNLLSAESGCNDGMAFPFIFLSLNLIIHPGNGREIVKDWICVTLLYECIFGCI
                     LGVFIGYIGRRAIRFAEEKNIIDRESFLAFYVVLAFCCAGFGSILGVDDLLVSFAAGA
                     AFAWDGWFSQRTEESKVSTVIDLLLNYAYFIYFGAIIPWSQFNNGSIGLNVWRLIILS
                     IVVIFLRRIPAVMLLKPIIPDIKSWREALFVGHFGPIGVGAVFAAILARAELEDTISE
                     EPTPLARIPPEGTKHYQLIACIWPTTCFFIVTSIIVHGSSVAVVTLGRHLNTITLTKT
                     FTTHTTNGGTGKSTWMTRLPSLDKSGRSFSLQRVDTHVSAAPSTNENIGTTETVVETS
                     GIPTRAVGGMTRKDVKKRKRQGRKRKRDKIFHRRTLSNKYNNTYDDELNDLGRERLQR
                     EREAQAATFALSSANINNYDNYDNISSIHSESESERERVRAEKEKGTLINQDLQSFNS
                     FNNNNIRIEVPDVVSMGSNIPSNYSTTEMHSISTGKEDTGQTNKEDESMYTGSSISGS
                     HSSVATSERERRQQIKKDEDQAHIAYQSGDQIIIENKHGEILNEADLKKRKLNDEEAN
                     NLSPRTSRSSSLGSGKLSKILTGPFTKDFNLSPTQSYESDTSLRTLKKILTPPEGIRK
                     SFPIPQRGSVGSTSKYHAYKMDNLLIIENNEGDVLRRYKITPRERSNSNSSSNATTNS
                     KDIKPTGVVNKALTAVGLRSRNSSLSGSKKSNTNPQPTTLQRGRNDPQTRMNNVDNVA
                     AGAKTGKPRPLTPIPTQEYSSEEEDDDDDDEQDPHSNDDGGNETEDDYDYDTEDESNS
                     FESDEDIDSEREGNETARGVGPLDTNHQANIIDQEPQSPAVESRESPISPTSSTSATQ
                     KMKSTLRHFKRK"
     gene            complement(<574886..>576193)
                     /gene="NDAI0G02510"
                     /locus_tag="NDAI_0G02510"
                     /db_xref="GeneID:11497424"
     mRNA            complement(<574886..>576193)
                     /gene="NDAI0G02510"
                     /locus_tag="NDAI_0G02510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671223.2"
                     /db_xref="GeneID:11497424"
     CDS             complement(574886..576193)
                     /gene="NDAI0G02510"
                     /locus_tag="NDAI_0G02510"
                     /inference="similar to DNA sequence:INSDC:YLR137W"
                     /note="similar to Saccharomyces cerevisiae YLR137W;
                     ancestral locus Anc_8.339"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671271.2"
                     /db_xref="GeneID:11497424"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0WE17"
                     /translation="MSETDSEGPHESVDSSFMLVSIQHDTIHEEMSRRFSDLNNYNHL
                     DRMPQDLGMQDPKACRLEIDLNPPLYHDFEMEKRNKKKKSRRRRRRKGRNKKNNTSED
                     DEDSDGADTSSYYLDIEQSITSLCSNTDNNNSTTGYVLWKTTIMFIAWVLYEEASKPL
                     RNGMEVTLLRNDSWSDNSDLETSDYDFSRMFVPRLFNTKTAGYYGNTDNNKNNNKAIA
                     SIIELGSGISGILPVVLGNHVDNYICTDQKGILSKLQSNIKNNLKQLNKREIISKSLN
                     INYDNGEATSKDKKQQEINEAADIADDKTNKRNTQKRDKQTINLEVLPLDWETFKNAA
                     DYPEFVRINNSNTNPNSVVYMLAMDVIYNDYLITPFLETVDKLRTFFLKKTRHVRIIV
                     GVHLRNYNVIVAFLEKALVHFGLSVYLIDDPMLKASIYNFFII"
     gene            <576912..>578072
                     /gene="NDAI0G02520"
                     /locus_tag="NDAI_0G02520"
                     /db_xref="GeneID:11497425"
     mRNA            <576912..>578072
                     /gene="NDAI0G02520"
                     /locus_tag="NDAI_0G02520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671224.2"
                     /db_xref="GeneID:11497425"
     CDS             576912..578072
                     /gene="NDAI0G02520"
                     /locus_tag="NDAI_0G02520"
                     /inference="similar to DNA sequence:INSDC:YDR151C,YLR136C"
                     /note="similar to Saccharomyces cerevisiae CTH1 (YDR151C)
                     and TIS11 (YLR136C); ancestral locus Anc_8.333"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671272.2"
                     /db_xref="GeneID:11497425"
                     /db_xref="GOA:G0WE18"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:G0WE18"
                     /translation="MYYSNYNEYIQNQNYTQQSTLPLAPPSYHVDGYPLSNHGQLYSQ
                     VQLSNTDNSSRTTDSISASSATESVFSANNHSHTPTQARPINHEDNNTFYDARVKELE
                     EYYLKTLLNDNNDNNNYEVNGNISDVSLSPEPSYAKPMDYFYNGNTKNNNIYLTTPQV
                     LLSSSSSSSSSSSSSMPKVLSNNNTSNINPIINPFLTQPNDSSKRPFNNNNLQPIVEN
                     KKLQVAINPNYAPSANKGVLPLTTENLQKLSISSNNQQKQVKQPKKTIKSKTKSQSQS
                     QTKQLYKTELCESFTLKGVCKYENKCQFAHGLHELQLKERSTNFRTKNCSNWLKLGYC
                     PYGKRCCFRHGDDSDIKIYLNAGTYTSVSKDTTTARKKNTHANVKVLKRMTW"
     gene            complement(<578235..>580643)
                     /gene="NDAI0G02530"
                     /locus_tag="NDAI_0G02530"
                     /db_xref="GeneID:11497426"
     mRNA            complement(<578235..>580643)
                     /gene="NDAI0G02530"
                     /locus_tag="NDAI_0G02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671225.2"
                     /db_xref="GeneID:11497426"
     CDS             complement(578235..580643)
                     /gene="NDAI0G02530"
                     /locus_tag="NDAI_0G02530"
                     /inference="similar to DNA sequence:INSDC:YLR135W"
                     /note="similar to Saccharomyces cerevisiae SLX4 (YLR135W);
                     ancestral locus Anc_8.330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671273.2"
                     /db_xref="GeneID:11497426"
                     /db_xref="GOA:G0WE19"
                     /db_xref="InterPro:IPR018574"
                     /db_xref="UniProtKB/TrEMBL:G0WE19"
                     /translation="MDLRRAQRNLELISHVEAKQDHNDIDEDGDNNETRFGTGLPSTQ
                     VPHDLMAFTSSGSEMENENENKEEGNLPKENSDIKSLLFEPEQGRMTSENHEAKQGHF
                     DEAMHEEPLMFMNTQIQSRLDDAEEESRLKLQLNHFKYSAEENEDEYIDELSSRSPTF
                     LLHEKVTNLIPLKTSTMKKSSVSPKKVVKQKKKTTTTTRRTSKRSTNTLKNTIKNITQ
                     FSIENFEKTRSQNLLKQLSGKHKKVQDIIKLQDNEDSESSSSRPRKDKSNKKRKSKEL
                     EFDTYNCKEWEYISNSIIKKFPHCEKSEMKQVFTYLYGGDVGGTGEQIDFHEDNAKSY
                     ESNYVESQGLWVSSQLAPREVSQPGTKDVTGVQDSIKPRTQSVVNVLSLSQVMEDKTE
                     ASIDNIPMDDHVDNVPMREIRNDRLENISIQEVMADPIDEIPIEVEVSSISSQNVAPI
                     NINKEYNGGGEDDDISIVSDSMEESANIIPIRDTTFLEEEENDEYISNKKQEVEGKEQ
                     RRKRITIPELKGPFLIRDDEIAAAGGEEEKEIIDLTQEPFKVVDRLISPLRSFASNNG
                     NDDNKENGNGNENENENEHDVVIGSVQVPASRTTSVLPATTTQGVTSLDANGNEYGID
                     NEWENIRCLVPLYMIENDDLILADTYTYSRDETVVSCSDEEAGANTGTIIIRNKEEKK
                     PNIIESQSVQKLRDSIRSLGLKPVRSKSEMIESLQLASSQLGEKNSNQDEMMVNKKQL
                     FEHITKIVRDDEMMMDKIICFEPILIQELLERLIKLDPFIEIVDTSTIREWADSQGVC
                     LKNR"
     gene            complement(<581052..>582866)
                     /gene="NDAI0G02540"
                     /locus_tag="NDAI_0G02540"
                     /db_xref="GeneID:11497427"
     mRNA            complement(<581052..>582866)
                     /gene="NDAI0G02540"
                     /locus_tag="NDAI_0G02540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671226.2"
                     /db_xref="GeneID:11497427"
     CDS             complement(581052..582866)
                     /gene="NDAI0G02540"
                     /locus_tag="NDAI_0G02540"
                     /inference="similar to DNA sequence:INSDC:YDR147W,YLR133W"
                     /note="similar to Saccharomyces cerevisiae EKI1 (YDR147W)
                     and CKI1 (YLR133W); ancestral locus Anc_8.328"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671274.2"
                     /db_xref="GeneID:11497427"
                     /db_xref="GOA:G0WE20"
                     /db_xref="InterPro:IPR007521"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR026712"
                     /db_xref="UniProtKB/TrEMBL:G0WE20"
                     /translation="MPTSSYRHSRSHSRSSSSSRRPSLSRQRSSHRLIRTISVESLEL
                     HKDQNNTSALTTGTTTTTTTTSIETTTTTTTTTTKHDIDGEELNLDSKLDTLNLNNNE
                     CIEVPFIKATIDNTLPQDYLKDDILNMIQSLKIPKWHQRGHFVSSPLKRDSLILTKIT
                     GAMTNAIYKVEYPSLPSLLLRVYGSNNDTIIDRDYELQVLARLSIRNIGPSLFGCFSN
                     GRFEQFLENATTLNKDDIRDWKTSQRIARRMKELHIGVPLLSSEREKGPVCWQKINQW
                     VKFLDTNPKAQIWIKNDTNIQTHLLCKNWKDFKTAISKYQNWLSSFHSDAKGKNLGFC
                     HNDAQYGNLLFSAPIKPTTNDINIDSNTPTATTSTSEPPTLSTATSSSSLFPSNSRIQ
                     IDEIIKPTKQEQSQDSKLVVIDFEYSGANPVAYDLANHFSEWMYDYNNASAPHVAHVE
                     SYPNREQILNFIYSYVSHLRGGAREPIDEEVKVLYNSILRWRGVCQLFWSIWAVLQSK
                     DLKLMLETENETFEGPNGEQYIVKVEKDNNNDNEMIERIDSIDDESVGVDIDSFDYMA
                     YCQDKISIFWGDLIKFNVVNEFECYSLDSARYLDSEEL"
     gene            <583298..>584200
                     /gene="NDAI0G02550"
                     /locus_tag="NDAI_0G02550"
                     /db_xref="GeneID:11497428"
     mRNA            <583298..>584200
                     /gene="NDAI0G02550"
                     /locus_tag="NDAI_0G02550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671227.2"
                     /db_xref="GeneID:11497428"
     CDS             583298..584200
                     /gene="NDAI0G02550"
                     /locus_tag="NDAI_0G02550"
                     /inference="similar to DNA sequence:INSDC:YLR132C"
                     /note="similar to Saccharomyces cerevisiae YLR132C;
                     ancestral locus Anc_8.327"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671275.2"
                     /db_xref="GeneID:11497428"
                     /db_xref="GOA:G0WE21"
                     /db_xref="InterPro:IPR027521"
                     /db_xref="UniProtKB/TrEMBL:G0WE21"
                     /translation="MIEERQDNENTNDDQLPPIPDSILNKYHIEPNLAKYDIEQTSPS
                     QNKSTKVMYLRSSQRKLDQFWQAFIYLECKPTRGDRQFLSQIISTTNNNAKLHTSMTN
                     NGTALKFSPLYRSKLGSPQNLHVTLTPNIPFASEALRDSMLQVLSDKINKCKIRPFVL
                     EFESARACKLLRSVVNDKLFLALDVKEEIKRNQLMEIHEIIDETLKKVIPEYYSQSWK
                     NRAKDFYLNNAHMSLAESNTVPSRMVKDFKKLQDLLSYNNNPKNCNDGDKETIQEENN
                     LSFQIRTLKVDIDRQTLTIPFIPL"
     gene            <585170..>587554
                     /gene="NDAI0G02560"
                     /locus_tag="NDAI_0G02560"
                     /db_xref="GeneID:11497429"
     mRNA            <585170..>587554
                     /gene="NDAI0G02560"
                     /locus_tag="NDAI_0G02560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671228.2"
                     /db_xref="GeneID:11497429"
     CDS             585170..587554
                     /gene="NDAI0G02560"
                     /locus_tag="NDAI_0G02560"
                     /inference="similar to DNA sequence:INSDC:YDR146C,YLR131C"
                     /note="similar to Saccharomyces cerevisiae SWI5 (YDR146C)
                     and ACE2 (YLR131C); ancestral locus Anc_8.326"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671276.2"
                     /db_xref="GeneID:11497429"
                     /db_xref="GOA:G0WE22"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0WE22"
                     /translation="MESVPNSSWLMDPSDVLKNANIIPATESTSNTQNTHNMNGSYAR
                     DMDNIIGPNNIYYQQPYLIKSSTNSCNNNNNNNDNTNAPLFEDQDNFDSLFDLNYTDI
                     DSLLTQELKDLDIPLIPTDNNNSSNDSNQWNNHQYGKKSMSHKRGPSGTAIFGFLNHN
                     KNLSISSVNRHILELSKDPTSFDINFLQNNSNNTIQEVPNENPATNHLSQSLLKQQEK
                     LRLALEQQKEVNKKLELQLKENQLQQEKLQRVLLEQEAVAQQLVSKNTNNDPYETNND
                     DAFIITTPPPKINLNPSSNNNNSNNKYSNNNNNIRNDELIITTNSTNGKYQFPPPIMI
                     SPANSNSNSNSSMNASPTRRGRGHNRRFILSEVSDNGNIEDESFRATKDGGNNDNFST
                     NTPDLLATTNYFQELSKQRDCYPPVSSTKLAPSAVIAPPLNSPFYIQSPGKESNDTLQ
                     EKSSFLNPFTANTQYSSSSPSEPATSRTILSLHSKKDSCLSTVSTIPQTLDEALINSQ
                     GIEHDNQKRLLGLGLNMALESTTTEQQQQQQRRDSIRKPPPLNILPTIPGSSNNTPIK
                     KNKNQFPQKHTFQHTPIKTLTPMRTHNNAISPTASNLEAPLPPPPTLPLSLLSTPTPP
                     RSQTIRTTSPTRITKKPTTLPPGTIDQYVEELPNKQFGCLYPNCDKIFKRRYNVRTHI
                     QTHLEDRPYRCEFRGCEKAFVRNHDLVRHKKLHAEKHMKTQSPIKKKNAIEEERSPVK
                     ETIERDKDKGIVVMKIQEQLREEQEGHESSSTLAQEPTITRVCSDDSMTSMWVD"
     gene            <588135..>589424
                     /gene="NDAI0G02570"
                     /locus_tag="NDAI_0G02570"
                     /db_xref="GeneID:11497430"
     mRNA            <588135..>589424
                     /gene="NDAI0G02570"
                     /locus_tag="NDAI_0G02570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671229.2"
                     /db_xref="GeneID:11497430"
     CDS             588135..589424
                     /gene="NDAI0G02570"
                     /locus_tag="NDAI_0G02570"
                     /inference="similar to DNA sequence:INSDC:YLR130C"
                     /note="similar to Saccharomyces cerevisiae ZRT2 (YLR130C);
                     ancestral locus Anc_8.325"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671277.2"
                     /db_xref="GeneID:11497430"
                     /db_xref="GOA:G0WE23"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="InterPro:IPR004698"
                     /db_xref="UniProtKB/TrEMBL:G0WE23"
                     /translation="MLELLARDDAVVCEISNDYNGHSGLRILAVFIILISSGLGVYFP
                     ILSSRYSFIRLPSWCFFLAKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWA
                     FGICLMSLFLLFFVEIVTHYFVAKSFGDEHHDHGNNINSVHDDDADSSDESITSYTED
                     HPVILPRRSHNDIENQFQKSNCKLAQSAQNPDDDDDDEEEEDDKLKEEKEREALQDRQ
                     NISGNNKNNDNMTRFNSIPGKDHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFIL
                     EFGIIFHSVFVGLSLSVSGEEFETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPW
                     LMGLAFTITSPIAVAIGIGVRHSWIPGSRKALIANGVFDSISSGILIYTGLVELMAHE
                     FLYSNQFKGPDGFKKMLAAYFIMCLGAGLMALLGKWA"
     gene            complement(<590030..>592906)
                     /gene="NDAI0G02580"
                     /locus_tag="NDAI_0G02580"
                     /db_xref="GeneID:11497431"
     mRNA            complement(<590030..>592906)
                     /gene="NDAI0G02580"
                     /locus_tag="NDAI_0G02580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671230.2"
                     /db_xref="GeneID:11497431"
     CDS             complement(590030..592906)
                     /gene="NDAI0G02580"
                     /locus_tag="NDAI_0G02580"
                     /inference="similar to DNA sequence:INSDC:YLR129W"
                     /note="similar to Saccharomyces cerevisiae DIP2 (YLR129W);
                     ancestral locus Anc_8.324"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671278.2"
                     /db_xref="GeneID:11497431"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G0WE24"
                     /translation="MVKSYQRFEQESVFGVINSNSNCIWLPSDSNPSTSPGQIITSAL
                     ENINIWDIKTGELSSHLIDSLIPPPGSIDAKSTKPAETTYLQHHKDTNLLAVGYNDGV
                     IKVWDLYSKTVLCNLNGHSSAITVLKFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLR
                     SHKDAITGIWCNEMQNNGEDDENELDWLISTSKDGLIKIWDLKIQQCIETHIAHTGEC
                     WSVAVRNDLLITTSSDSQIKIWELNLDNDDDGKNKKLIEKGIYEKQSKQRGLSIEFID
                     TADETGFFYIQNADKTVEIFRLRKQDEINKAIKKRTKRLTEKGMTPEDIEQNIKDSYI
                     SLIMHPFQIVRSIYKIKAVTWTIATPSKLELCLTTSNNTIEYYSTPYEKREPTQPTPN
                     KLHTIELQGQRTDIRSIDISDDNKLLATASNGLLKIWNIKTKSCIRTFECGYSLTCKF
                     LPGGTLVIVGTRGGELQLFDLASSTLLETIEDAHDAAIWSLDLTSDGKRLVTGSADKS
                     VKFWDFQLEQELVAGTVDKYLPKLKLFHDTTLELNDDILSVKISPEDKFLAVSLLDNT
                     VKVFFMDTMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLF
                     AHQDSIMNVKFVPESHNFFSCSKDGLIKYWDGDKFECIQKLAGHQSEVWSIAIANDAS
                     FIVSSSHDHSIRIWEETEDEVFLEEEREKELEELYEDTLLTSLEEDNGDDAFKKDGGE
                     DKDEATDVHKQTMESLKASERLMEAFDLGMKEIEAMEEYERELKNWQRKDSNNKATQT
                     VPIKPQGNAILLAIKKTPEEYIMDTLVRIKPSQLEDALLVLPFSYIIKFLKFIDIVIN
                     SKKILNNHLPLICRILFFIVKSNHKELVSQKNEELKSQITRVKDNLRNALKNNEDDLG
                     FNIQGLKFIKQQWKLKHNYEYVDDQDQKAQEAKFAKKRTFGTII"
     gene            complement(<594115..>594975)
                     /gene="NDAI0G02590"
                     /locus_tag="NDAI_0G02590"
                     /db_xref="GeneID:11497432"
     mRNA            complement(<594115..>594975)
                     /gene="NDAI0G02590"
                     /locus_tag="NDAI_0G02590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671231.2"
                     /db_xref="GeneID:11497432"
     CDS             complement(594115..594975)
                     /gene="NDAI0G02590"
                     /locus_tag="NDAI_0G02590"
                     /inference="similar to DNA sequence:INSDC:YLR128W"
                     /note="similar to Saccharomyces cerevisiae DCN1 (YLR128W);
                     ancestral locus Anc_8.322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671279.2"
                     /db_xref="GeneID:11497432"
                     /db_xref="InterPro:IPR005176"
                     /db_xref="InterPro:IPR014764"
                     /db_xref="UniProtKB/TrEMBL:G0WE25"
                     /translation="MAKKYLSRNNWRLNYALNEYYDKEIGSFIGDDDDDDGCKTILPD
                     LNKYPQELIALFKKYSSKNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCE
                     NLKDGINKQQFLSNWYLQGCSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDV
                     DDGDSTRNNTNIGDDTTNSNDTSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKV
                     NKELLSLWFQFLNEERKKEITKDQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEF
                     YEYLQDTGRI"
     gene            <595394..>598129
                     /gene="NDAI0G02600"
                     /locus_tag="NDAI_0G02600"
                     /db_xref="GeneID:11497433"
     mRNA            <595394..>598129
                     /gene="NDAI0G02600"
                     /locus_tag="NDAI_0G02600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671232.2"
                     /db_xref="GeneID:11497433"
     CDS             595394..598129
                     /gene="NDAI0G02600"
                     /locus_tag="NDAI_0G02600"
                     /inference="similar to DNA sequence:INSDC:YLR127C"
                     /note="similar to Saccharomyces cerevisiae APC2 (YLR127C);
                     ancestral locus Anc_8.321"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671280.2"
                     /db_xref="GeneID:11497433"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014786"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="UniProtKB/TrEMBL:G0WE26"
                     /translation="MTPLLDTDVDLSRITESIFVSIDPQYHPQLQTMLLWLNPNETTT
                     QSATTMTIDLKNCINIIVSTYGKDDQIRLLFKKYYSFVIKLHFMKDNRPKNMTSIREF
                     HKLENLYLTPLRFTYDLIDTNEMQSLINIFKRYLINNNFTFRKNVLHSMETLFLTEDQ
                     FEFQYNMNSLNEIVIWLNDANGNVSPIDLLLDLLLRKIEKFCQREMAGLWNGRFIIME
                     KFNLFINQYWKLISKLFHHQQFDYGDVENDHALTNLIYYFFTQQFIKIRINESLKIMV
                     SNFPISTPTIIELKNVLITSSMPRENVSTTATTTFRDTNLSEEYLKLFVKKFLKDFQR
                     KFLNPCIPTIPLIRALVKMTNSFLILDPRGQLLTTIILTLKPLIQRRTTDIVNILLYA
                     MLNLNEMELHKLGCNIDFDIESFNILVSELYPTIIKSMNQNQNNPSVVPYTTAGTGTT
                     CSNERITNDDIPYQNVKDMANANTMEYLARRKPETKPFFDLFKQYLEWVPPMNKIYDS
                     TSKNTVVDDEETSRIRSRHAIDYLFRFFDSIDLLLSEYLKLLTEKFIHSKNYYTLDNN
                     WLWCLNLLKEKSNSSNVPDENVKSTINTIDIMLNDMKRSASYGKDKKHTKENNMVQGD
                     IGFYPKEVSKLYWKINSTNIAKWRMNMKGDFFHLLKYSKTAEPNHTMDIKLNRFFNEL
                     GRKGKKMELYKDKSLMEMKISFDDGRELFFDNITIEQYDVLSLFTVEKGAAFTLEKAY
                     DFFSGLKRGKQKLEECIQFWVDKKVLYLDDDDGCYKVLERLTFLDEIKQRKKMQEETV
                     IKSDARMGIDHDYVQEAAEDDDIAGFETHKDVISRANDEIKNILDRIFPFINGMLENL
                     GSMKLEKIHSFLKMTVPRDFEYNRIAIHQLENYLNGLVEDEKLETTTDGAFKKPK"
     gene            <598499..>599281
                     /gene="NDAI0G02610"
                     /locus_tag="NDAI_0G02610"
                     /db_xref="GeneID:11497434"
     mRNA            <598499..>599281
                     /gene="NDAI0G02610"
                     /locus_tag="NDAI_0G02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671233.2"
                     /db_xref="GeneID:11497434"
     CDS             598499..599281
                     /gene="NDAI0G02610"
                     /locus_tag="NDAI_0G02610"
                     /inference="similar to DNA sequence:INSDC:YLR126C"
                     /note="similar to Saccharomyces cerevisiae YLR126C;
                     ancestral locus Anc_8.320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671281.2"
                     /db_xref="GeneID:11497434"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:G0WE27"
                     /translation="MAQNKMNNKIAIFYTDEDAEWTHPHGNFVTMAQNLLENSKIDST
                     LETIEYQVFNIVQNEFPSFDSLHEFIGIFITGSKYDSFDSEIEWIINLRSFLKRLLSL
                     ENSKMMPPVVGICFGHQVIAAALGNKVDRNPKGLEAGVVEVKLNDMGQEIFGTDRPSL
                     NLSMLHNDIAYEIPDGLSNWGGSDICDIQGFYLKNRILTFQGHPEFINDVAKKGVKRS
                     YNTPGSKMREDQYIAMVNKCDTLTNDGYFVGQSIWKLFHGYI"
     gene            <599890..>601662
                     /gene="NDAI0G02620"
                     /locus_tag="NDAI_0G02620"
                     /db_xref="GeneID:11497435"
     mRNA            <599890..>601662
                     /gene="NDAI0G02620"
                     /locus_tag="NDAI_0G02620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671234.2"
                     /db_xref="GeneID:11497435"
     CDS             599890..601662
                     /gene="NDAI0G02620"
                     /locus_tag="NDAI_0G02620"
                     /inference="similar to DNA sequence:INSDC:YDR144C,YLR120C"
                     /note="similar to Saccharomyces cerevisiae MKC7 (YDR144C)
                     and YPS1 (YLR120C); ancestral locus Anc_8.318"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671282.2"
                     /db_xref="GeneID:11497435"
                     /db_xref="GOA:G0WE28"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:G0WE28"
                     /translation="MTSRIISHILLSLPYFISQASASSKDNTSPPKYLALNFEKRYGD
                     SFLNSSSSNGPSAQLIKRDDGYEQVTLTNQQSFYSVEVEMGTPSQKLTVLLDTGSSDF
                     WVTSSDNPYCGTTSTEGSLYGGETQDTIDCSTYGTFDSSKSSTFQSNDTDFLISYGDG
                     SFAEGTWGTDVIKLDDSLSLNDVSVAVASSTNSSMGVLGIGLRPLETTYSSTKSVNEK
                     TSYMYDNFPISLKKSGLIESTAYSLYLNDPSSKSGNILFGGVDHSKYTGQLYTVPMLS
                     STTSYKTPVEFDVTLNGIGIIDSSGNKKTLTATQFYGLLDSGTTFSYLPSALVAMIGE
                     ELGASYDSNIGYYTIDCSAEDSDDTKIVFDMGGFHINTTLSDFVIQISTSTCILSIVP
                     QDGKVVLGDSFLNNAYIVYDLDNYEIAMAQAAWDSTREANIDVISTTIPSAIRAPGYS
                     STWSTSRSISSGGDIFTTTEVTLSTSATSSPESSASSVTSASTLSSDSSAASSYSRST
                     STLRSSSRSSSFVSSNNRATASTSSSIRSSSSSSSSSSSSSSSSSSSTGITSSTNRTN
                     SGIQLAISPLLLAAVSMLSIFLFV"
     gene            <602238..>604223
                     /gene="NDAI0G02630"
                     /locus_tag="NDAI_0G02630"
                     /db_xref="GeneID:11497436"
     mRNA            <602238..>604223
                     /gene="NDAI0G02630"
                     /locus_tag="NDAI_0G02630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671235.2"
                     /db_xref="GeneID:11497436"
     CDS             602238..604223
                     /gene="NDAI0G02630"
                     /locus_tag="NDAI_0G02630"
                     /inference="similar to DNA sequence:INSDC:YDR143C"
                     /note="similar to Saccharomyces cerevisiae SAN1 (YDR143C);
                     ancestral locus Anc_8.317"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671283.2"
                     /db_xref="GeneID:11497436"
                     /db_xref="GOA:G0WE29"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G0WE29"
                     /translation="MSEDNNPTPPPNRSINEPSSNDSTANTNSSNNAAAGGIGTRDIT
                     VSINYEFPGFNNNNNNNNTAATTTTPGTNGINNAGSEVPTTAPTERPMGAFILSFRDV
                     PIATSQERLSTVISLATELAMRRYNQLIRPKGISRENFEKLPILKTKDITGTTECSIC
                     YEPYVDEPDPIDNKRKRAAGDGTEEDSNDDNKKKRKLATAGAANDTAPLASTSTTENT
                     DTGNNSSSTNIEEAEEPVYLHSPVKLPCDHIFGRECLYKWSKLENSCPLCRHKIIESD
                     SERASEISTADRAGNDAMFEQIRNMLYAPENNSNNTTSPAVNTATSTTIETAATAQTR
                     NNTDNAVSNSSEGGNNTTQTQAPAGSDNLRRGTGPIAQYPLNTTAFIFLRVPPGTITN
                     TGANTAANTAAPEANAAASPSIPATVPSTSTGTATNSSPGTTAPPVAQSNETGSRGTY
                     NQLTDFFTNFFAQFPVIRRTENTNATTVNENPSGTAATTTTTAPTAPTQPPLPADFPQ
                     PNENVSEHVQRIMDMLRNRREQTMSNSLPIASNNTATNTNTNTNTNVNGSSSNPPTTG
                     SNVLFHSGVASYRRPDGQVTTYPINNNASSDDWGLPHPPPNTTNSQSSANQPSSTTST
                     SASASNNIEERSNEDENTSNGNNNNSNNNNESNGNNN"
     gene            complement(<604606..>605268)
                     /gene="NDAI0G02640"
                     /locus_tag="NDAI_0G02640"
                     /db_xref="GeneID:11497437"
     mRNA            complement(<604606..>605268)
                     /gene="NDAI0G02640"
                     /locus_tag="NDAI_0G02640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671236.2"
                     /db_xref="GeneID:11497437"
     CDS             complement(604606..605268)
                     /gene="NDAI0G02640"
                     /locus_tag="NDAI_0G02640"
                     /inference="similar to DNA sequence:INSDC:YLR119W"
                     /note="similar to Saccharomyces cerevisiae SRN2 (YLR119W);
                     ancestral locus Anc_8.315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671284.2"
                     /db_xref="GeneID:11497437"
                     /db_xref="InterPro:IPR009851"
                     /db_xref="UniProtKB/TrEMBL:G0WE30"
                     /translation="MVCMRKGKEIKVRATETRHREKGNDEYQMTMETTIIADGNTTTT
                     SLEDVPLPENIQLLTNRELLGLLTEHADKLSEYVTKFHPLNDTISDIQTLKQRLRDLH
                     ERFDELQLKRDDIKKELEDYKVVESMYVKKWQDFHHLIQEKYSDDALRRNVEMYLKRL
                     DNECTNLEVSMYDTQGQDGMKNIDMNQLNLFVKEYLEKRQKFHLNQEKLNTWNEQGSL
                     RL"
     gene            <605378..>606058
                     /gene="NDAI0G02650"
                     /locus_tag="NDAI_0G02650"
                     /db_xref="GeneID:11497438"
     mRNA            <605378..>606058
                     /gene="NDAI0G02650"
                     /locus_tag="NDAI_0G02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671237.2"
                     /db_xref="GeneID:11497438"
     CDS             605378..606058
                     /gene="NDAI0G02650"
                     /locus_tag="NDAI_0G02650"
                     /inference="similar to DNA sequence:INSDC:YLR118C"
                     /note="similar to Saccharomyces cerevisiae YLR118C;
                     ancestral locus Anc_8.314"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671285.2"
                     /db_xref="GeneID:11497438"
                     /db_xref="GOA:G0WE31"
                     /db_xref="InterPro:IPR003140"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0WE31"
                     /translation="MNNILRIAPKLQPVKQSIIVLHGLGDTADGWRFLAQELTSDKRF
                     HHTQFILPNAPNIPVYANGNATMPAWFNIHEWNLTSKNVDVDGIMQSVDLVTRIVKEE
                     IDNGVKPEDIAIGGFSQGAAISLASVALLPYKIGAFFVFSGFCQIEQKLIHDGRELNL
                     ETPVFHGHGGLDNVVPEYCGELARGLFKDKLKYKNYNYHTYRSMEHSVCPEELVDFRE
                     FIVKALKL"
     gene            <606878..>609001
                     /gene="NDAI0G02660"
                     /locus_tag="NDAI_0G02660"
                     /db_xref="GeneID:11497439"
     mRNA            <606878..>609001
                     /gene="NDAI0G02660"
                     /locus_tag="NDAI_0G02660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671238.2"
                     /db_xref="GeneID:11497439"
     CDS             606878..609001
                     /gene="NDAI0G02660"
                     /locus_tag="NDAI_0G02660"
                     /inference="similar to DNA sequence:INSDC:YLR117C"
                     /note="similar to Saccharomyces cerevisiae CLF1 (YLR117C);
                     ancestral locus Anc_8.310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671286.2"
                     /db_xref="GeneID:11497439"
                     /db_xref="GOA:G0WE32"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G0WE32"
                     /translation="MSTLPSSEPPDQISAESILKDIYAKRTQLKIKSTTTPKVDILDL
                     EELKEFQRRKRTEFETYLKRNRLDMGQWIRYGQFEIEQHDWKRARSVYERALLVDSSY
                     IPLWIRYIDNELKNKFINHARNLLNRAITILPRVDKLWYKYLFVEESLQNWDIVRALF
                     RKWCLLEPKSNAWDSFIQFEIRQENWENVRDVFSQYVLVHPQIDTWLQWVKFETVHGD
                     IDTIRSVYSLALDTLISFEDRNTSSPVLHDDIIDLIISFANWEATQLELERVRALYNI
                     SLDKWPEEKKLQDGLVDFEKKHGNTSTMEESIIGKRKREYETYLLKNPQDYDTWWLYF
                     DLLQDNFPHDILIHAYDKFLVGFTQFKPKDGTKTIKWQRYIYLWIRYLIFLELETDDI
                     EKCRTYYKMLINEVIPNKNFTFGKIWILYSEFEIRHNGLTEARKILGRSIGMVPKDKL
                     FMKYIEIEMNLKEFDRVRKLYEKYLQFNPGNLNTWISYIELEASLGDDERVRALYNII
                     LEEDNKNFISNFLPNESRLQMMKKFIDFETEEQEYDNARELYEKYLKLSDYSPEIWIS
                     FAMYQNSTPTKEQLQDIRERLENEEENGSDEEQEIEFEISEVNKENARSVFEKAIEFY
                     KTQHDTKRRILMLEAFQGYEETYGTEETKERLLKRMPQVVKKRIIEDDTEKEVIDYIF
                     PDDVKLNKNASKFLELAKKWSETQK"
     gene            complement(<609197..>610771)
                     /gene="NDAI0G02670"
                     /locus_tag="NDAI_0G02670"
                     /db_xref="GeneID:11497440"
     mRNA            complement(<609197..>610771)
                     /gene="NDAI0G02670"
                     /locus_tag="NDAI_0G02670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671239.2"
                     /db_xref="GeneID:11497440"
     CDS             complement(609197..610771)
                     /gene="NDAI0G02670"
                     /locus_tag="NDAI_0G02670"
                     /inference="similar to DNA sequence:INSDC:YLR116W"
                     /note="similar to Saccharomyces cerevisiae MSL5 (YLR116W);
                     ancestral locus Anc_8.309"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671287.2"
                     /db_xref="GeneID:11497440"
                     /db_xref="GOA:G0WE33"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:G0WE33"
                     /translation="MSTAQGEQQYRGRSSSEKVNEALWGDPTEKKKFIPLLPTKITGA
                     LTKEQMSIYQVMFRIQEITLKLRSGAALEPPKRKNRSPSPPPSYDAQGKRINTSEQRY
                     RRKLEEERHRLVEIANRTIPFFVPPSDYVKITRFQDKYYIPVEQYPNVNFVGLLLGPR
                     GNTLKKLQEDSGCKISIRGRGSVKEGKSSTDLPKGANDMSDPLHCVIIADTEEKIQKG
                     IKCCQNVVIKAVTSPEGQNDLKRGQLRELAELNGTLREDNRPCPICGLQGHKRYDCPN
                     KETFAQMVTCRRCGQTGHTTRDCKISLPPRPSPSQTELSYASNTTGRFRTSNEGRNDG
                     RNDFEPFKRRHIESRYQAGATTTGQPRSRYSGDNNNNQEDNFQRGPGSYQQRPMSQSR
                     YHNNNNPTQNIGRFSTPSQQYAPQRTPEPALPPGIDYSNNGSNSLPIKNFPSETPSIP
                     LPSNSLIASNILPPGVHTAGPLPSQPPPSGLPSVPGLSPGLYGPPPGLPDYSQSNSDS
                     PFPSEAPPGIGGPPGL"
     gene            complement(<611144..>613684)
                     /gene="NDAI0G02680"
                     /locus_tag="NDAI_0G02680"
                     /db_xref="GeneID:11497441"
     mRNA            complement(<611144..>613684)
                     /gene="NDAI0G02680"
                     /locus_tag="NDAI_0G02680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671240.2"
                     /db_xref="GeneID:11497441"
     CDS             complement(611144..613684)
                     /gene="NDAI0G02680"
                     /locus_tag="NDAI_0G02680"
                     /inference="similar to DNA sequence:INSDC:YLR115W"
                     /note="similar to Saccharomyces cerevisiae CFT2 (YLR115W);
                     ancestral locus Anc_8.308"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671288.2"
                     /db_xref="GeneID:11497441"
                     /db_xref="GOA:G0WE34"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR022712"
                     /db_xref="InterPro:IPR025069"
                     /db_xref="InterPro:IPR027075"
                     /db_xref="UniProtKB/TrEMBL:G0WE34"
                     /translation="MTYKVSCCDDGSGQTVGTLLKFDNVVTILIDPGWASSAVSYEDS
                     VRYWTNVIPEVDIILLSQPTGECLGAYTLLYTNFLSHFKSRIEVYSTLPIANLGRVSM
                     IESYASKGIIGPYNTNRLDLEDIEKSFDHISILKYSQTVDLRSKFDGLSLIAYNSGSN
                     PGGTIWSISTYSEKLIYVHRWNHTRDSILNPASLLDQTTGKPLASLLKPSGVITTLDK
                     FGSIDPFKRRVKLFKGTVWNSLNNNGSVLIPVEMGSGKFLDILVIIHEFLFENGKNPF
                     YKHLPVLLVSYSKGRALTYTKSMLEWLSSSLLKTWESRSSNPSPFDLGNRFKVVTSDE
                     LSKYPNSKICLVSNVDILLDETVAHLCDSKSQHQNKTTILLTSNMNNGILQNMKECWE
                     EQKVKEGDLIKFNKTISVHNIQLDPLNDEELSEYKSVLEERKNKEKLIIESIKRGKHK
                     DKILTLDLHGKDSILDASRKSSIIDLTNADEEEEDEEEDEDEDDALSSKALYAKRIHT
                     PVDIIIQPNLPPKSKMFQFYPTKLKTDDYGTVIDFTMLIPKDDEDDKDFESELTKKRR
                     IDRLQNKGQDTEDMNMPVAQFTKKEKLNQNNNNTITDSSFIQPNFDNIDFLKTDNTPQ
                     KRTLTKKNHIINCSISYINLESLVDQRSASVIWPSLKPRKLILFGPDKIQDRTLMKIL
                     VKKGVDVTALPLNKPTEFTTSIKAFDISIDPELDQILNWQRISDGYTIAHVTGHLVKE
                     IPNATATQATKIQQNTKNKLILKPLNSMTKVHASGALSVGDVRLVELKRNLTAKNHVA
                     EFKGEGTLVVDNKVTVRKISDGETVIDGPPSELFQLVKKSVTEMLAKI"
     gene            <614278..>616746
                     /gene="NDAI0G02690"
                     /locus_tag="NDAI_0G02690"
                     /db_xref="GeneID:11495704"
     mRNA            <614278..>616746
                     /gene="NDAI0G02690"
                     /locus_tag="NDAI_0G02690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671241.2"
                     /db_xref="GeneID:11495704"
     CDS             614278..616746
                     /gene="NDAI0G02690"
                     /locus_tag="NDAI_0G02690"
                     /inference="similar to DNA sequence:INSDC:YLR114C"
                     /note="similar to Saccharomyces cerevisiae AVL9 (YLR114C);
                     ancestral locus Anc_8.305"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671289.2"
                     /db_xref="GeneID:11495704"
                     /db_xref="InterPro:IPR018307"
                     /db_xref="UniProtKB/TrEMBL:G0WE35"
                     /translation="MGNIDNRSTILAACLVDFHHKRGPEVEYWYGLPKDTNTSQLWPN
                     LPFQALPDGSHSFKETFAYFTLLYNEKKKCGPKSNSGATDIPEEELQDYTTFFAVSCS
                     RQIDSDKLIHKSKDITRSTVQKAIVIISRQPIFGQIKDKLSIVTNAFFLQYDFNDKSI
                     IVSLYESLKSMYSNQSPSLSPTSVIQERNNSENRLYIGLCLRKIIYDFKKDVLLILKA
                     LLLERKIIFYGSDVETLCNLQFGLISLIPNLLSNLQNCGSPQLFKDFSHMEVVTSFKS
                     SDRQSIIRFLGLPLQIFEKGGMFSPYTPLQQLNDIKSKVTEFFVIGTSNSLLSEQRNE
                     LCDVFINVDDKTVEVINKSLQPILQLTSYDKKWIESISSIVINTWNENDEETPKTSEY
                     EGSEDFIRWQFEDYFTCLLSSAKLYDYLNKYKDNAEILQSIPEQMIESNPAYLFNIHW
                     INEWGKTQNYHIFNNITDDRLFDLFPPKHVYNGVDTFKILQKKFITTFQNLKINNNTN
                     VSESKRSNGDLSLSKVSTHDSSNDVASFASSNKEMSSSSTSNVWSTWKDYFKNKSKAN
                     KLDREEEKEKDNGMSRTLSTNSSQHSTGKKSIRSARSERQENPAKKVFENALIGLGIH
                     QDNRQKKENGTDTTASTNDTEDIDDDSDAESVPASEPVIVDMAEVKMDYSSELDAKQK
                     KRVHGKKQDDEEDNNNEILDIYGTEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDED
                     EDEDEDEDEDEDEDENKDEDEDENKESEVDEDIDSNDNEPNDSTGSEDDIAEDDIAGD
                     ESGEESDREDQENDEESLKATEQD"
     gene            complement(617159..617231)
                     /gene="NDAI0Gtrna8R"
                     /locus_tag="NDAI_0Gtrna8R"
                     /db_xref="GeneID:11497218"
     tRNA            complement(617159..617231)
                     /gene="NDAI0Gtrna8R"
                     /locus_tag="NDAI_0Gtrna8R"
                     /product="tRNA-Arg"
                     /note="codon recognized: CGU"
                     /db_xref="GeneID:11497218"
     gene            complement(<618268..>619611)
                     /gene="NDAI0G02700"
                     /locus_tag="NDAI_0G02700"
                     /db_xref="GeneID:11497443"
     mRNA            complement(<618268..>619611)
                     /gene="NDAI0G02700"
                     /locus_tag="NDAI_0G02700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671242.2"
                     /db_xref="GeneID:11497443"
     CDS             complement(618268..619611)
                     /gene="NDAI0G02700"
                     /locus_tag="NDAI_0G02700"
                     /inference="similar to DNA sequence:INSDC:YLR113W"
                     /note="similar to Saccharomyces cerevisiae HOG1 (YLR113W);
                     ancestral locus Anc_8.302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671290.2"
                     /db_xref="GeneID:11497443"
                     /db_xref="GOA:G0WE36"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008352"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0WE36"
                     /translation="MATNEEFIRTQIFGTVFEITNRYADLNPVGMGAFGLVCSATDNL
                     TNQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLTHENLICLQDIFLSPLEDIYFVTEL
                     QGTDLHRLLQTRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKI
                     CDFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFP
                     GKDHVHQFSIITDLLGSPPADVINTIGSENTLKFVTSLPHRDPIPFSQRFKTVEPDAV
                     DLLEKMLVFEPKKRVTAAQALTHPYLAPYHDPNDEPVADAKFDWHFNDADLPVDTWRV
                     MMYSEILDFHKIGGTDGQIDTTATFDDQVAAATAAAAQAQAQAMAQAQAQAQAETQSK
                     SPDQLNNNNISSTVSPSQISSTEHQNNNNNSNNTENNDAISRYGDQAVHYANEFQ"
     gene            complement(<620961..>621413)
                     /gene="NDAI0G02710"
                     /locus_tag="NDAI_0G02710"
                     /db_xref="GeneID:11497444"
     mRNA            complement(<620961..>621413)
                     /gene="NDAI0G02710"
                     /locus_tag="NDAI_0G02710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671243.2"
                     /db_xref="GeneID:11497444"
     CDS             complement(620961..621413)
                     /gene="NDAI0G02710"
                     /locus_tag="NDAI_0G02710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671291.2"
                     /db_xref="GeneID:11497444"
                     /db_xref="UniProtKB/TrEMBL:G0WE37"
                     /translation="MRKINTAKKKGFKCFVRGILSSSTRRKSFLLRRLSSNKSALYFI
                     FFIWKRTGVCLEEMAFGIYPPHRVRWCVGGVSQRGNIGTVASTHTPHLGRVFWPLDSR
                     FGLILSTTVRREQNIIERYAIFSATFPYMHKQNPQKVRKKEMTSGISV"
     gene            <621940..>622272
                     /gene="NDAI0G02720"
                     /locus_tag="NDAI_0G02720"
                     /db_xref="GeneID:11497445"
     mRNA            <621940..>622272
                     /gene="NDAI0G02720"
                     /locus_tag="NDAI_0G02720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671244.2"
                     /db_xref="GeneID:11497445"
     CDS             621940..622272
                     /gene="NDAI0G02720"
                     /locus_tag="NDAI_0G02720"
                     /inference="similar to DNA
                     sequence:INSDC:Scer_YGOB_YDR134C,YLR110C"
                     /note="similar to Saccharomyces cerevisiae YDR134C
                     (Scer_YGOB_YDR134C) and CCW12 (YLR110C); ancestral locus
                     Anc_8.301"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671292.2"
                     /db_xref="GeneID:11497445"
                     /db_xref="InterPro:IPR025928"
                     /db_xref="UniProtKB/TrEMBL:G0WE38"
                     /translation="MSPLPPPTRTSTTYVTITDCEEHVCKETVSPALVSTATVTVNNQ
                     VTEYTTYCPISTEHHNSTTKASPTSTKAQTKNATSSHTIHSSYTGAAVKALPAAGALM
                     AGVAALLL"
     gene            complement(<623414..>623947)
                     /gene="NDAI0G02730"
                     /locus_tag="NDAI_0G02730"
                     /db_xref="GeneID:11495690"
     mRNA            complement(<623414..>623947)
                     /gene="NDAI0G02730"
                     /locus_tag="NDAI_0G02730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671245.2"
                     /db_xref="GeneID:11495690"
     CDS             complement(623414..623947)
                     /gene="NDAI0G02730"
                     /locus_tag="NDAI_0G02730"
                     /inference="similar to DNA sequence:INSDC:YLR109W"
                     /note="similar to Saccharomyces cerevisiae AHP1 (YLR109W);
                     ancestral locus Anc_8.300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671293.2"
                     /db_xref="GeneID:11495690"
                     /db_xref="GOA:G0WE39"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013740"
                     /db_xref="UniProtKB/TrEMBL:G0WE39"
                     /translation="MAAVTVNQPFPAKDYKFQYIAISKSDADQEACKMPQTVKWGDFI
                     KENKTVVITGAPAAFSPTCSVSHIPGYITYLNELVQDKHVDQVVVVTVDNPFANQAWA
                     KNLGVTDTTHIKFASDAGCNFIKSLGYEMPVGDDVFWSGRWVVIVKDGKVTYAAAEEH
                     PVTDVTVTSVETVLSKL"
     gene            <625312..>626946
                     /gene="NDAI0G02740"
                     /locus_tag="NDAI_0G02740"
                     /db_xref="GeneID:11497447"
     mRNA            <625312..>626946
                     /gene="NDAI0G02740"
                     /locus_tag="NDAI_0G02740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671246.2"
                     /db_xref="GeneID:11497447"
     CDS             625312..626946
                     /gene="NDAI0G02740"
                     /locus_tag="NDAI_0G02740"
                     /inference="similar to DNA sequence:INSDC:YDR132C,YLR108C"
                     /note="similar to Saccharomyces cerevisiae YDR132C and
                     YLR108C; ancestral locus Anc_8.299"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671294.2"
                     /db_xref="GeneID:11497447"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="UniProtKB/TrEMBL:G0WE40"
                     /translation="MSTAKKEQTTTPTTEDFLPWDQIYTIQIGQQSFKLNGSSLNSDG
                     PNFFTRYFQTHTMVENNSLFIDRDPEIFHTITKHLQGYFIDIKDEYEYTMLFTDSIYY
                     GFPRLRQLFKDSEYYFANVGGKSFKIPKSLFRREGDSLNYFQIILNSFYKEVEQRIVE
                     KNLVKTPLPPSYVPRSAEFFQDLLTLLSGTSLELSDEKRESLAEECRYYRFLNLEQKL
                     TKSSIIYNPLSTLEEIVIPLKDLKRRGLRFHSNSNSSNQHTSSSSLNRCLDTVGNRAN
                     CNGGIKSKPSSTDVSSNSSASSSSSSSSCSNNSSDNEREEPASKKLKKENMGGVQENC
                     TTKKHSNKNKAWSIVTYKKPYVDKYSRDLIFQIDSTECMLMFNKKNKMIHVDLIGRNF
                     ETFESIFTSPLFQNSNEEIDLSKFKIQLPSSDTTTSKSSKENPSVRQTQSNNGTLNSA
                     ASHLILPACISICDLYVNGVKCPNICSLINDTKYNENIIHREKDDSITYAPGINLYLT
                     KSLWKLGVKDGKIMLIAIKAEAFSGIKEYNKLIQFI"
     gene            complement(<627690..>628901)
                     /gene="NDAI0G02750"
                     /locus_tag="NDAI_0G02750"
                     /db_xref="GeneID:11495707"
     mRNA            complement(<627690..>628901)
                     /gene="NDAI0G02750"
                     /locus_tag="NDAI_0G02750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671247.2"
                     /db_xref="GeneID:11495707"
     CDS             complement(627690..628901)
                     /gene="NDAI0G02750"
                     /locus_tag="NDAI_0G02750"
                     /inference="similar to DNA sequence:INSDC:YLR107W"
                     /note="similar to Saccharomyces cerevisiae REX3 (YLR107W);
                     ancestral locus Anc_8.296"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671295.2"
                     /db_xref="GeneID:11495707"
                     /db_xref="GOA:G0WE41"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:G0WE41"
                     /translation="MTSKGTLRPIDLPTQPIGFQDRYKILHKLHTHLMKCKPRVPGEK
                     LEKLAMQLEVKVAKLTNTSQNYRFTISVLLRDLTKAKGDLSKVAINGQPLIGPKRSKR
                     IGADDITLITTKANAMEKLKGLLLETSVLEKHGYIVDTYSKSTKEQEVKTYTNCSRCE
                     MKFEKSDILKKTVCRYHPSKKQFNRGTKVYDYPCCGETSASSSISRLGCKTYDYHVFR
                     SESYFELKQISEFKDTANIEGESNVLALDCEMAFTSLGYEMVRLTIVNFFSKKVLFDE
                     IIEPFGEIIDLNTQFSGVYESSMEHAISFKKFIDLVLSKSLINKHSILIGHGLENDLN
                     VMRIIHNKIIDTAVLYSNGRLKTSLKNLAFEILSRKIQSGEHDSSEDAIATMDIVKKK
                     LGISLTQEEWS"
     gene            <629341..>644226
                     /gene="NDAI0G02760"
                     /locus_tag="NDAI_0G02760"
                     /db_xref="GeneID:11497449"
     mRNA            <629341..>644226
                     /gene="NDAI0G02760"
                     /locus_tag="NDAI_0G02760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671248.2"
                     /db_xref="GeneID:11497449"
     CDS             629341..644226
                     /gene="NDAI0G02760"
                     /locus_tag="NDAI_0G02760"
                     /inference="similar to DNA sequence:INSDC:YLR106C"
                     /note="similar to Saccharomyces cerevisiae MDN1 (YLR106C);
                     ancestral locus Anc_8.295"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671296.2"
                     /db_xref="GeneID:11497449"
                     /db_xref="GOA:G0WE42"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR012099"
                     /db_xref="InterPro:IPR025662"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WE42"
                     /translation="MSHDHVLLDLLAIKERYDLFNTTFPSEALNKLPVFDSKLTPKEN
                     LLNVSHFALNEPNTSGVLFIYKSIFLEIISNWTTVLYKTDRIQVFDSVSKIITIYPLA
                     TSLIEEFLDRENDYFLSVLQNPSTQGESNLQKVLLSYYRLLFENKEAFVKYVKPDILY
                     SLISEIQAQSTFSTEIVKFLAIKILSIYLDMGEKALLNMIKTHISSDENLIGSYETSS
                     NINYKFLEINEAKRFSNFSKLPESPECFIDSATENANIQNKYYTIKPQDLNPNIVSIC
                     GVLVSKINSFKDANVYPESFVPTLKTITALRKLAKQLQYNEPVMLVGQAGAGKTFLIN
                     EASKYIQCHDSIVKIHLGEQTDAKLLIGTYTSGEKPGTFEWRSGVLTTAVKEGRWVLI
                     EDIDKAPTEVLSILLSLLEKRELTIPSRGETVKAANGFQLISTVRVDENNIKKNIRHE
                     HNQESNEEDAIEQDPELNLNLIGMRIWNTIYLHEPSETDLHSILCQKYPVLARLIPKL
                     IHSYKAVKKIYHSPKFISLNRGAHARVISVRDLMKLCNRLGALFENNNITKPDQLIEL
                     SIYDSIFAEASDCFAGAISEYKALEPLIHCIGETLEITPSRISLFLSKHVPTFENLDD
                     SIKIGRSILPKSRLSIQKKSANSTAFAITNHSLRLMEQIAVTIQMTEPVLLVGETGTG
                     KTTVVQQMAKFMNKTLTVINVSQQTETGDLLGGYKPVNSKTIAVPIQELFETLFIATF
                     SLKKNERFSKMLHKCFNKGQWKNVVRLWQEAYKMAQNILKTDEDETEDTTEKKKQKKR
                     KLDSHEKKLLLEKWVEFYAMIGKFELQSSSIENAFVFNFVEGSLVKAVRNGEWLLLDE
                     VNLASADTLESISDLLSESSSRSILLSEKGDAEPIRAHPDFRIFACMNPATDVGKRDL
                     PSGIRSRFTEIYVHSPDRDITDLLSIIDKYIGKYNVSDEWVGNDIAELYLEAKKLADS
                     NQIVDGSNQKPHFSIRTLTRTLLYVGDIVHIYGLRRSLYDGFCMSFLTLLDQKSESLL
                     EPIIMKYTLGRLKNVKSVMGQIIPSPGPDYVQFNHYWMKKGQDEIKEQAHYIITPFVK
                     KNMMNLVRASSGRRFPVLVQGPTSAGKTSMIKYLADITGHKFVRINNHEHTDLQEYLG
                     TYITDETGKLSFREGILVEALRKGYWIVLDELNLAPTDVLEALNRLLDDNRELFIPET
                     QEVVHPHPDFMLFATQNPPGLYGGRKVLSRAFRNRFLELHFDDIPQDELETILRERCQ
                     IAPTYAKKIVEVYRQLSIERSASRLFEQKNSFATLRDLFRWALREAVGYEELAANGYM
                     LLAERCRNPQEKVVIKNILEKVMKVKLDMQQYYTNLENKSLQLQDSVVWTNGLRRLSV
                     LVSKCLQNNEPVLLVGETGCGKTTICQILSAFMKKDLITLNAHQNTETGDILGAQRPI
                     RNRSELQNQLANTIIKALDMPSTNQCYDLETLLKLYKETNKENVSDEDHLKIKKLQDN
                     LNILFEWSDGPLITALKTGNFFLLDEISLADDSVLERLNSVLEPERNLLLAEKGTSDS
                     LIVAKDGFQFLSTMNPGGDYGKKELSPALRNRFTEIWVPSMENFEDVHMIVESRLLES
                     VKQLTNPVVKFSKWFGEEFGGGNTTNGIISLRDILAWVQFINSTSEKMGDANAAFAHG
                     ASMVFIDALGTNNTAYLAEDEASLNSLKKQCLAKLSTFIDSDVSKYFGKDIDIEISMK
                     QLRIGLFSLNRGECAVDSPSFNLNAPTTATNLMRVVRAMQVHKPILLEGSPGVGKTSL
                     ITALADLTGNNLTRINLSEQTDLVDLFGSDAPGEKSGEFVWKDAPFLRAMQQGSWILL
                     DEMNLASQSVLEGLNACLDHRGEAYIPELDRSFSCHPNFLVFAAQNPQYQGGGRKGLP
                     KSFVNRFSVVYVDMLTSDDLLLIAHHLYPNIDPEVCSKLITLMSTLERQVVKKKQWGS
                     VGAPWEFNLRDTLRWLKLLDKQSICEETDVVDFVNIIIKQRFRSISDKEHADHLIKDI
                     FGDFTTKDKFFKQDADYIQVNNVIAPRNGLYRYPLSENLIPLECNIEIYESALMCINN
                     NWPLILVGPSNSGKSAIIRTLANILGTEVGFFSMNSDVDSMDILGGYEQVDITRKISY
                     IVNDLKDILRSLLSINMGIYGQETAAVSAGLDLFYFLLEEIVTPENFQIFKDKFISLL
                     SHLHSNEALIDINERITKISKINNVSNGVTFEWFDGMLVKAVEKGHWLVLDNANLCSP
                     SVLDRLNSLLETDGTLLINECSEANGEPRVIKPHPNFRLFLTVDPKYGELSRAMRNRG
                     VELFVQHLETRATVFDSLCLGYPKLSTDVTRSSLVDMLQATSLNTRNPTKPTKCFIPS
                     HLSYFGGFMRMLDMMELYPASLGSESLVTVLPLIQLRDIQQWTNNALSNAGFTQKDSY
                     LGINNLVKFLAEMNIIERMDKVYSKSQSRTRSLLANQNCSLMGESVFPLLNVYLLPTH
                     SKAAKTIETTESIYMLTVSRILNIFTEFLNQVNMKSIHGKIDDLSYMELSAASANGRH
                     IKNVPRIPIFNIICRLCDLIIKHIKNSPLFEQQEVFSQFYQLVILISTIIDATAKKDE
                     ARLRVYKELLVNWVALASDAGLLTTEFSVVAEEFDNTMHLNQGQSITILWDTFRKKYP
                     YNEECWSLLDDLVSLCNRFDEVETLQFSESYESLNNLRTIFGTLYECLLNNDTSNFKN
                     ISLQLEEGLETMETLSSKFLVKRKHFFRDEYDTLLRLLYSTHNELPDLKLNIVSFTSL
                     STYKFLQSSLNNCPYPSILGLLWTNSDGKFQSEVDSLTTSKYFENIITKSNSFGKYPG
                     SQIKQILSDAKSLLSFTAKSASCILESQMDNLAHVLTSWIKNVITAHVPDAFKGTTLA
                     IKDLDAMPLYFKNALQQYLLPAMELCEAHRSGQEVGRAWILFSIGLITLYVPDIPYDP
                     AVRDYVLHDVYLKHKEFSQQISSGLEAIRITTSGDEQILAERLFNNSAPVEPPQKPRI
                     FRPTTTVDNLFDEWKAFLTSTISADQVNSLMDSIGMHATNHENRHEMFQQNTSNFLQR
                     LESGFKYYSDLNEIFAGYILSMKLGFDILKQSSIESKKMIDISTLWPVDPLVIANTNR
                     VNAAFTALGGLIRRSTTNMLATEKILIFFLQLFKFHESDVDMLPTLNSTLHTLYYRWS
                     LRRLREEQNAEQKASLFKYEDTSEDFEADFKKMFPDYEDTLTLGGDDKATAVEQLHEV
                     YYAIAENYMGIFGSKQNESMKTMIDNGSDIVDLLLSETRNMKSHNLEGAHLTAVISRL
                     SNAIDSFKSATIPSDVDFYRDSSISESQKAIDIIDNLWKYTHELLKQWPEHATLNELF
                     RICGEFLDFPIQMALARQLQKIEQIYTFMAEWEKYASSQVSLASHIKKITDLIVSWRK
                     LELHTWNSLFNTEDEKAIKSIGKWWFYLFETIIVTNFSKDTNLLDERNTDTQLLESLN
                     VFFSKSTLGEFETRLKLVESFIKHIELMGQASSHVSSALSNVITFYRQFLPTIQEQIS
                     RSRKTLEKDISEVILLASWKDVNVDALKQSSRRSHNSLYKYVRKYRDLISGSVLSLIE
                     NGLPYVANPVVKLNKIRDVSYKALDLEVAIVEVKKVNDWSSRPAVLQNINMVNKNMNS
                     YSNKISEQAFPNFVELAVDFNKEADRLRQETPSVFTKDNKKKIAALKAQKGKLLSDAL
                     KELRRIGLKSGLRKDIHAVQGTSTAILANSCSFSSTELEGSDTCYYRVLDILPRLRGA
                     VGNPADDIPFVTLEKGMAISENLVFSLITIRKPMATLALRFKKVTELRRDLEDACSTV
                     AEIRHRSLETDIHQMLYMCTWLPRLIDYVVSTMEIISGTASCENNSTFLLNFKEKLGS
                     LKSKLESVRIIDSSTSKVVAAFTTLNAQFISELEAHKTSTTFYVYDVIISWINQQSST
                     HIKNEELNETKISEVDQTFRKIFTSIILVFQKLMENGVTSVTEEMDNWLSLTATKIMF
                     NVKTISSNNVIRNIEKAVSLLKTSDFTAENSSLVRAIVTFTMPVINHYYTTMQTILDK
                     SRNYYSQTSHGTYILTTILYNLAKNGFCSPEPPSEEVDDKNLHEGTGLGDGEGAQNNT
                     KDIEQDEDLTEDAQTENKDQENKDDNDDNGQSDEDEAVEMEGDMAGDLENISDQEEKD
                     EDIDSEEEDNELDEEIDDINEDDPNAIDDKMWDEEPEEDSKEKNTDQNMNNKSEDQDI
                     QAADEENNEGDNADNGENEGSQDDDNKPEAEQDEDKTSNENDNDEAEEDEDAENEEDV
                     GEQEDEVKNEEGQELDAHVPEVETMDLPEDMNLDSGDEDQDEGGDGGEEEKEEEEFGD
                     NLDNDENEEDENINSIEENEKANDEDALDVEENEESQDGMPDEDDAAMDVDEANEEEQ
                     QQENTENPENVDENMSEDEQLAEDQKQESKEQGGEENADGLDGVDDMLDEEDIDAEAA
                     VQQNSGSKGVGSDAKDDDEQEDIGNSGATQIAHQEEQQNENEVNEPSREEAKEALKQL
                     GDSLRQYHKRHQEIKEASNDENQEDVENVNQRPDEFEHVEGTNTENDTQALGAAAQDQ
                     LQSIDQDNAIEDDLSEKEDEDIEMKDEVVDESNEPVEQQEENNEQADSDEKNGGVFTA
                     GQEDKFDVDALNTDPLLQRRDEEDELDELMDEIDNETHEEAITELPPRSIEESRELWH
                     KSELATADLVSRLGEQLRLILEPTLATKLKGDYKTGKRLNMKRIIPYIASQFRKDKIW
                     LRRTKPSKREYQIMIAIDDSKSMSESKCVKLAFDSLCLVSKTLTQLESGGLSIVKFGQ
                     HTREVHPFQQQFSNEAGAKAFQWFNFQDTKTDVKRLVAESIKIFERARAFNNSDQWQL
                     EIVISDGICEDHETVQRLVRRARENKIMLVFVIIDGINNSNESIMDMSQVNYIPDEFG
                     NMKLQINKYLDSFPFEFYVILHDISELPEMLSLILRQYFSDLASG"
     gene            <645551..>646693
                     /gene="NDAI0G02770"
                     /locus_tag="NDAI_0G02770"
                     /db_xref="GeneID:11497450"
     mRNA            <645551..>646693
                     /gene="NDAI0G02770"
                     /locus_tag="NDAI_0G02770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671249.2"
                     /db_xref="GeneID:11497450"
     CDS             645551..646693
                     /gene="NDAI0G02770"
                     /locus_tag="NDAI_0G02770"
                     /inference="similar to DNA sequence:INSDC:YLR105C"
                     /note="similar to Saccharomyces cerevisiae SEN2 (YLR105C);
                     ancestral locus Anc_8.294"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671297.2"
                     /db_xref="GeneID:11497450"
                     /db_xref="GOA:G0WE43"
                     /db_xref="InterPro:IPR006676"
                     /db_xref="InterPro:IPR006677"
                     /db_xref="InterPro:IPR011856"
                     /db_xref="UniProtKB/TrEMBL:G0WE43"
                     /translation="MAKGSRQYSLRYKYPLPIHPIDDLPPLILHNPISWAYWIYKYIR
                     SSNNVKDKIHVDIIGNRYPRILVKDDVQMLYLWDNGFFGTGQLSRSEPTWKSRTEARL
                     DADDSIAADKSQLTLEKVTQRRRLQRLEFKKMREQLENQLLQLRRSGGSKEQEYALLE
                     REREALRDFKAQQSFHDELDNVATDEGQINGGENEISVREEDSELIDGNGNIKQLEAL
                     ELMPVEAIFLTFALPVLDIDMSSLFTRLHAYSSGDIEYKNIHNLMIQYVSYHHYRSHG
                     WCVRSGIKFGCDYLLYKRGPPFQHAEFCIVTMDAHTTKDYTWYSSIARVCGGARKTLV
                     LCYVERLISEEKVMALLNKRDYAGIFSSYKINEVTYKRWVPGKNRD"
     gene            complement(<646836..>647234)
                     /gene="NDAI0G02780"
                     /locus_tag="NDAI_0G02780"
                     /db_xref="GeneID:11497451"
     mRNA            complement(<646836..>647234)
                     /gene="NDAI0G02780"
                     /locus_tag="NDAI_0G02780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671250.2"
                     /db_xref="GeneID:11497451"
     CDS             complement(646836..647234)
                     /gene="NDAI0G02780"
                     /locus_tag="NDAI_0G02780"
                     /inference="similar to DNA sequence:INSDC:YLR104W"
                     /note="similar to Saccharomyces cerevisiae YLR104W;
                     ancestral locus Anc_8.293"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671298.2"
                     /db_xref="GeneID:11497451"
                     /db_xref="UniProtKB/TrEMBL:G0WE44"
                     /translation="MLSKRFKSSFFLPFFLIVSISPVVGFFQFQQQQQQQPIELSYEE
                     RILNNDCDKYLCPDTLACVASKKDCPCPFPKSQLKCLISNERYVCISKPATHDEEMNA
                     VYDDPVKGPKAAFDGMRDCGWVKNAYNLKL"
     gene            <649288..>650244
                     /gene="NDAI0G02790"
                     /locus_tag="NDAI_0G02790"
                     /db_xref="GeneID:11495556"
     mRNA            <649288..>650244
                     /gene="NDAI0G02790"
                     /locus_tag="NDAI_0G02790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671251.2"
                     /db_xref="GeneID:11495556"
     CDS             649288..650244
                     /gene="NDAI0G02790"
                     /locus_tag="NDAI_0G02790"
                     /inference="similar to DNA sequence:INSDC:YHR144C"
                     /note="similar to Saccharomyces cerevisiae DCD1 (YHR144C);
                     ancestral locus Anc_2.84"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671299.2"
                     /db_xref="GeneID:11495556"
                     /db_xref="GOA:G0WE45"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR015517"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WE45"
                     /translation="MLVAITGNGKFGAEHVRDIFIKNHEFKSLEEDDFETNDEILEYA
                     TKHYKENLIMLTNDLYLITVLEKRPFFVHLTVNSSLALKRAIISKTSKDLSPEDALAA
                     IMNEMSLEESNHEYLELYEKAHIKFKLVGKDWATVEKRLIKVVKEQIEQLQVKKNPFE
                     NVPPLRPSWDTYFMKLATLAATRSNCMKRKVGCVIVRDHRVIATGYNGTPRHLTNCFN
                     GGCDRCNDGGSKNLNTCLCLHAEENALLEAGRDRVGFNATLYCDTCPCLTCSVKIVQS
                     GITEVVYSQTYRMDEQSYKVLTAAGINVRQYSFIEEPRLVIV"
     gene            complement(650467..650522)
                     /gene="NDAI0Gtrna5F"
                     /locus_tag="NDAI_0Gtrna5F"
                     /db_xref="GeneID:11497182"
     tRNA            complement(join(650467..650503,650467..650522))
                     /gene="NDAI0Gtrna5F"
                     /locus_tag="NDAI_0Gtrna5F"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /db_xref="GeneID:11497182"
     gene            complement(<652383..>653522)
                     /gene="NDAI0G02800"
                     /locus_tag="NDAI_0G02800"
                     /db_xref="GeneID:11495711"
     mRNA            complement(<652383..>653522)
                     /gene="NDAI0G02800"
                     /locus_tag="NDAI_0G02800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671252.2"
                     /db_xref="GeneID:11495711"
     CDS             complement(652383..653522)
                     /gene="NDAI0G02800"
                     /locus_tag="NDAI_0G02800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671300.2"
                     /db_xref="GeneID:11495711"
                     /db_xref="UniProtKB/TrEMBL:G0WE46"
                     /translation="MKPVVIKPLLGLLVQSATSSALLQISSVTLLDDIRTVSGDITVN
                     AGSSFMITHDFELTIESGTIANNGTLCVSTTDTVSEMSLNIVAKNINNKGNLIIDNED
                     SGDKSTMVTIGSLNNGGYLRMNLKDNTEYLSVQASLIDNGYISLCHINNYYDKLTFKK
                     YSRVDDMQNTGTTDVSGTNVTSMVQSQVVIVFGGQVLEFNSTVTYPSYDPVTGIVTTT
                     NRYGTFRIDIGLGYDASNFSDAQIRTCEYLGTCYAPYLRYLGVKPAAATERPTECAVK
                     PDLSMAICSAAVSSSVASSSHSTSSSISVPATSIEPTSSAVTQHTVSKGASSTTNDNG
                     QCVVTEISTEYFSTLHTTTYFYTSDSTVTTPVTSTFITTAYSKVK"
     gene            complement(<653669..>655438)
                     /gene="NDAI0G02810"
                     /locus_tag="NDAI_0G02810"
                     /db_xref="GeneID:11495558"
     mRNA            complement(<653669..>655438)
                     /gene="NDAI0G02810"
                     /locus_tag="NDAI_0G02810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671253.2"
                     /db_xref="GeneID:11495558"
     CDS             complement(653669..655438)
                     /gene="NDAI0G02810"
                     /locus_tag="NDAI_0G02810"
                     /inference="similar to DNA sequence:INSDC:YOL070C"
                     /note="similar to Saccharomyces cerevisiae YOL070C;
                     ancestral locus Anc_3.148"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671301.2"
                     /db_xref="GeneID:11495558"
                     /db_xref="UniProtKB/TrEMBL:G0WE47"
                     /translation="MSLEAYESPSKVSVNTQRLSDMIDSLHNEQSEADLFKFIKTVIP
                     IARTTSPADTHTPPPTASSQLEAQKEPTLISPSKPPSGGLLRSPAGNVSIASMDNRSS
                     MISNYSGVLQEGVEISYVVQNQSPTKVRRHEPRIPELPTLPSEEDMSSVIQQEQQPPI
                     NRSTTDITISAVSNAKPVRRFDSKSSMKTISREPSVKRNDTLKLLGSPKRGFPSIDSG
                     NLASESGTSSYYPTTAKQQGSPTVQQKEHVIIIDDDEEQEEEENDNEDSRTASTNDHV
                     SMVSSIIPPLSTTITTNDEGMLPLRSEINEYNPAVPPRSKDRPRSRLFVRDEMDDSEE
                     EDILDEENLAKERQSISNPPNLLHTTNNIHEEDSIIGTTTPSRYSESFYSAASFPDTD
                     KVNEYKVDDSNNDQEDDVIHYDETYLSRPLPNVPQPQRDETIKVNYTPHTPGPQNVNT
                     NVNTAVEDAATADDDDDDDDQYEDIDETVKQGIRQEQRIPKVIPRTKPPKKNKNKKKK
                     QHKNDLSGFDIDTLNQLLNVTKGTLIGSEFNNLGMKIEEKRALERLVDSLSRLTADMV
                     LDPDRFEEGLKRLEKATKALDGF"
     gene            <655932..>657287
                     /gene="NDAI0G02820"
                     /locus_tag="NDAI_0G02820"
                     /db_xref="GeneID:11495559"
     mRNA            <655932..>657287
                     /gene="NDAI0G02820"
                     /locus_tag="NDAI_0G02820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671254.2"
                     /db_xref="GeneID:11495559"
     CDS             655932..657287
                     /gene="NDAI0G02820"
                     /locus_tag="NDAI_0G02820"
                     /inference="similar to DNA sequence:INSDC:YOL069W"
                     /note="similar to Saccharomyces cerevisiae NUF2 (YOL069W);
                     ancestral locus Anc_3.149"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671302.2"
                     /db_xref="GeneID:11495559"
                     /db_xref="GOA:G0WE48"
                     /db_xref="InterPro:IPR005549"
                     /db_xref="UniProtKB/TrEMBL:G0WE48"
                     /translation="MNHDIFPILDITELVICLQSCDFSIATEDQISRPTAEFVMTIYK
                     QIIENFMGISVDSALRTDGVLPKDAPNEDFNNDGLLPTLIMTKICYKFFQNVGVADFT
                     LLDLTKPDHQRTVRLLSAVINYARFREERMFDCNKFITQMETLLSELRSKFDDYNLLQ
                     QQMKEYEEEINILDAGDDNGTKELNKLEENNKNLENQLKKLTQVQETLSINYSNYKSE
                     KQKILKELESLGFQIVELESQRDKLENYTNIDIEELNTTVEDLSKILENKEKVLQNLR
                     IKQKNLETKITTFEKISTELYDILRLISTEVQNSHGTQVNLIDIQNQLLENRDKLQDI
                     LSNAVLLKSNVLKEQLKDQREQFNKFTEDYDEKSNENKLRLEELQQQFSKEIIPKLRE
                     TENHIQRDLIDGEVKLLEKEIRDIQLKFNEELDSIELEYSLLVGHINRYMEMILDKIN
                     P"
     gene            complement(<657414..>659138)
                     /gene="NDAI0G02830"
                     /locus_tag="NDAI_0G02830"
                     /db_xref="GeneID:11495560"
     mRNA            complement(<657414..>659138)
                     /gene="NDAI0G02830"
                     /locus_tag="NDAI_0G02830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671255.2"
                     /db_xref="GeneID:11495560"
     CDS             complement(657414..659138)
                     /gene="NDAI0G02830"
                     /locus_tag="NDAI_0G02830"
                     /inference="similar to DNA sequence:INSDC:YDL042C,YOL068C"
                     /note="similar to Saccharomyces cerevisiae SIR2 (YDL042C)
                     and HST1 (YOL068C); ancestral locus Anc_3.151"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671303.2"
                     /db_xref="GeneID:11495560"
                     /db_xref="GOA:G0WE49"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR007654"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:G0WE49"
                     /translation="MTSISSTPTGPLINGNKRAFIDPNDSNLNNINISSKKPKLQDDY
                     TLKLENPNNNNNNGNIPDEDEQVLSKFSRKAPNILTDEGKLIPLIPPQPIVLGKDPKA
                     NKYILPKITKEDSLNARMVLKYYGLKKFLDTYLPEELNSLYVYFLIKLLGFEIKDREL
                     LNTIYEFINQDMNMTIDNMSLAIQKFDDPLEKKQAVRLIKDLQKAINKVLCTRLRLSN
                     FYTVDHFVNALKTSKRILVLTGAGVSTSLGIPDFRSSEGFYSRIRHLGLDDPQDVFNY
                     DIFMQDPSVFYNIAHMVLPPDNLYSPLHSFIKLLQDKNKLLRNYTQNIDNLESNAGIQ
                     EENLVQCHGSFATASCVTCHWKVPGEKIYDNIRKLELPLCPYCYKKRREYFPNNNTKF
                     SSNSMTDLTNNHFAGQVLKSYGVLKPDITIFXVVKSLPSKFHRTIKEDILKCDLLICI
                     GTSLKVAPVSEIVNMVPAHVPQILINRDPVRHAEFDVNMLGFCDDVAALVAQKCQWDI
                     PHEKWDTLKNTKFDCIEKEKGSYNIKIHQDNIQKEGEGQGQEHKTTETKEQEEDEDKS
                     LTTISTSE"
     gene            complement(<659587..>660870)
                     /gene="NDAI0G02840"
                     /locus_tag="NDAI_0G02840"
                     /db_xref="GeneID:11495561"
     mRNA            complement(<659587..>660870)
                     /gene="NDAI0G02840"
                     /locus_tag="NDAI_0G02840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671256.2"
                     /db_xref="GeneID:11495561"
     CDS             complement(659587..660870)
                     /gene="NDAI0G02840"
                     /locus_tag="NDAI_0G02840"
                     /inference="similar to DNA sequence:INSDC:YDL036C,YOL066C"
                     /note="similar to Saccharomyces cerevisiae PUS9 (YDL036C)
                     and RIB2 (YOL066C); ancestral locus Anc_3.154"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671304.2"
                     /db_xref="GeneID:11495561"
                     /db_xref="GOA:G0WE50"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR006225"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:G0WE50"
                     /translation="MSAIKKKQNLMCDDFGFKLKVNGSQQVQHKKDKTKEQIDPPYEV
                     IIAGPLRKIKPYYFTYKTFCKERWRDHNVLDIFVNEFRDREYTYYEKAIRTGLIEINN
                     KPATLDSIVKNGAMLTHKIHRHEPVVTSEPIRIVFENEGLLVIDKPSGIPVHPTGRFR
                     FNTVTKILEEKYNYVVHPCNRLDRSTSGLMFLAKTPKGADDMAIQLREREVTKEYVAR
                     VVGNFPSGEIIVDKPIRSVNRKVSLNAVCDITDEDAKNAKTIFEKISYDGQTSVVKCK
                     PLTGRTHQIRVHLQYLGHPIANDVIYSDPTIWGPTLGRNGIEEAKGFDKYISKLDEIG
                     KTKNAASWYSAREREGTREQEDNRKHLEHDICSVCDFNSDRDCLLGLSDCELWLHAYR
                     YESTQLDSTTGMKKWSYRTPLPTWAKIIPEAIIIT"
     gene            complement(<661183..>662373)
                     /gene="NDAI0G02850"
                     /locus_tag="NDAI_0G02850"
                     /db_xref="GeneID:11495562"
     mRNA            complement(<661183..>662373)
                     /gene="NDAI0G02850"
                     /locus_tag="NDAI_0G02850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671257.2"
                     /db_xref="GeneID:11495562"
     CDS             complement(661183..662373)
                     /gene="NDAI0G02850"
                     /locus_tag="NDAI_0G02850"
                     /inference="similar to DNA sequence:INSDC:YOL065C"
                     /note="similar to Saccharomyces cerevisiae INP54
                     (YOL065C); ancestral locus Anc_3.155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671305.2"
                     /db_xref="GeneID:11495562"
                     /db_xref="GOA:G0WE51"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:G0WE51"
                     /translation="MSQMKKDWKVSISTLNCGKISPLENSINVERIIQHLIPALKKNK
                     DGSHLIAADIYAFGFQELSMIWEGSLPTVMQSYNDILSKTIIKVLNERFRKDSIEYSL
                     VGSDYVGATSLVVVCRNSLHIEKVWRSRTKCGMFGSNLKGGVGLGLALSRDEDEGDND
                     TFIFVCSHLNANEGYENMQKRCADFTTIINNCDRDFKEILEYNKDGHYFFFGDMNFRV
                     NGWEHINTNYNDLNTIETLATKYDELQEVLKSVDSFKRFDEAEITFPPTYKYEIIGDK
                     NKFNKKRSPSWCDRVLFKKYNGKPRIISYHSIERTQDLQFTDHQGVNLTIEVGQSSTI
                     SSPLQQLLQSLEATERGSISVLAEQTIDTIDWIVGYVAWFMHYKAHYWIGGAIILLII
                     YYLL"
     gene            complement(<662669..>663751)
                     /gene="NDAI0G02860"
                     /locus_tag="NDAI_0G02860"
                     /db_xref="GeneID:11495709"
     mRNA            complement(<662669..>663751)
                     /gene="NDAI0G02860"
                     /locus_tag="NDAI_0G02860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671258.2"
                     /db_xref="GeneID:11495709"
     CDS             complement(662669..663751)
                     /gene="NDAI0G02860"
                     /locus_tag="NDAI_0G02860"
                     /inference="similar to DNA sequence:INSDC:YOL064C"
                     /note="similar to Saccharomyces cerevisiae MET22
                     (YOL064C); ancestral locus Anc_3.157"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671306.2"
                     /db_xref="GeneID:11495709"
                     /db_xref="GOA:G0WE52"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="InterPro:IPR006239"
                     /db_xref="InterPro:IPR020583"
                     /db_xref="UniProtKB/TrEMBL:G0WE52"
                     /translation="MPFEKELLVATQAVRKASLLTKRIQSQVIAHRSSTTITKSDSSP
                     VTIGDFAAQTIIINAIKANFPQDNVVGEESSDGLDDAFVGEILKEIHLNDQIYKDQGY
                     DDTEGMSFTNEQFPLQSISDVKTVLNLGNYEGGDKGRFWCLDPIDGTKGFLRGEQFAV
                     CLALIVDGVVQVGCIGCPNLKLNDYDTNVKDLPGFESFGYLYRAVRGHGAFYSVASNP
                     VDWIKIHVRQLPETKDMISLEGVEKSHSSHDEQSQIKSKLGVTKSLHLDSQVKYCLLA
                     QGLADLYLRLPIKLSYEEKIWDHGAGNVIVHEAGGFHTDSLDNVPLDFGNGRTLKTKG
                     VIASSGPKELHDLVVSISNEVINSRN"
     gene            <664526..>667501
                     /gene="NDAI0G02870"
                     /locus_tag="NDAI_0G02870"
                     /db_xref="GeneID:11495564"
     mRNA            <664526..>667501
                     /gene="NDAI0G02870"
                     /locus_tag="NDAI_0G02870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671259.2"
                     /db_xref="GeneID:11495564"
     CDS             664526..667501
                     /gene="NDAI0G02870"
                     /locus_tag="NDAI_0G02870"
                     /inference="similar to DNA sequence:INSDC:YDL031W"
                     /note="similar to Saccharomyces cerevisiae DBP10
                     (YDL031W); ancestral locus Anc_3.159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671307.2"
                     /db_xref="GeneID:11495564"
                     /db_xref="GOA:G0WE53"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012541"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WE53"
                     /translation="MALKEKRTRDTAVDSSDSENDAADFDIATDIALNASDSDDASSD
                     SDNEDVQDVIDYSDSEHQQEDNKIARKEKQKKQDIDKSFPILELSDDEDTKKKSNSKN
                     NGSDNDDDDDINAYFSTTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKT
                     IPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHN
                     VFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIE
                     YAVFDEADRLFEMGFQDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVR
                     LDAESKISENLEMLFLSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQNKKDNES
                     DSDADDNNNNNKNKKKRKFKKERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGY
                     LISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKI
                     FIHRVGRTARAGNRGWAYSIVSESELPYLLDLELFLGKKIMLTPMYDSLCEIMKNKWI
                     AEGNDESSFVNPKIAYTDRLILGSAPRLEVEGLGDLYKNMMQNNFELKLIKDVAMKAE
                     KLYFRTRTSASPESLKRSKEIIASGWDEQNVLFGKNQEKEKLDFLAKLQNRRNKETVF
                     EFSRNPDDEMSVFMKRRRRQLAPIQRKARERKELLQMEKMAGLTHSVEDEILKGDDNE
                     AGYSVSEDTLKQQFQDADELLADQENKSKKDKKSKKSFKDPNFFLSHYAPAGDIQDKQ
                     LELTTGFVNDAAKVAYDLNNDDKVQVHKQTAMVKWDKKRKKYVNTQGLDNKKYIIGEG
                     GQKIAASFRSGKFDEWAKKRKMKPLKVGARETTIPSNILANPTNGSHGSQGNTIRGKF
                     KHKQMKAPKMPDKHRDDYHIQKKKVEKALANGIQVRGYGNAPGMSNELKSTEQIMKDR
                     NVKENKRAKNARPSKRRKF"
     gene            complement(<667570..>667905)
                     /gene="NDAI0G02880"
                     /locus_tag="NDAI_0G02880"
                     /db_xref="GeneID:11495565"
     mRNA            complement(<667570..>667905)
                     /gene="NDAI0G02880"
                     /locus_tag="NDAI_0G02880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671260.2"
                     /db_xref="GeneID:11495565"
     CDS             complement(667570..667905)
                     /gene="NDAI0G02880"
                     /locus_tag="NDAI_0G02880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671308.2"
                     /db_xref="GeneID:11495565"
                     /db_xref="UniProtKB/TrEMBL:G0WE54"
                     /translation="MGVFVMRMVYFSAFGPYRFPGLLVVLKYAGNRRNLFVHPISRCI
                     GIITQYSKSRDGKRRYTVFDKMTSDYLFYYVVVLRLILRSQQSTDFDDMSRHHLIGSL
                     LFFYIVQYI"
     gene            <669498..>671108
                     /gene="NDAI0G02890"
                     /locus_tag="NDAI_0G02890"
                     /db_xref="GeneID:11495566"
     mRNA            <669498..>671108
                     /gene="NDAI0G02890"
                     /locus_tag="NDAI_0G02890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671261.2"
                     /db_xref="GeneID:11495566"
     CDS             669498..671108
                     /gene="NDAI0G02890"
                     /locus_tag="NDAI_0G02890"
                     /inference="similar to DNA sequence:INSDC:YDL030W"
                     /note="similar to Saccharomyces cerevisiae PRP9 (YDL030W);
                     ancestral locus Anc_3.160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671309.2"
                     /db_xref="GeneID:11495566"
                     /db_xref="GOA:G0WE55"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR024598"
                     /db_xref="UniProtKB/TrEMBL:G0WE55"
                     /translation="MSHLDLEKRRSLLEDLEIIENAISTRFQRNPELYYSNLKKVSEL
                     FPSKQVEELPTHSIMTNNKIYKTKKLKRNRKQIALQQHEISLFIKDFFSKQKELETLT
                     REANFKAKKNKEEILLPVEEFKDILSEINEADGNENGNRRELEINDKINKYSMFSNSL
                     NKSHPSTILSSRASDLDINSIFSLEEQYGEYLALNPYYTEWLNVVKKEDLTFLQFLNM
                     LKIFQDDKRYIVQPPMDRKNEPYMKYLQRYCSYLESFFERKYPLIDSRYTSRELKKEF
                     NKSIIKPLENEKKGFFCKTCCKWFKTLTVFESHLNGQKHIKSYNKRVQGLYAEYKTHR
                     YSMLLKEEHQSTCEFVERKMAFTVEERITEMKRLAEICKAPAYDVNEKEGDENNTELN
                     VKDNLKNDGASAMLSGSINMPLGPDGLPMPFWLYKLQGLDVSYPCEICSNQIFKGRRT
                     FDKHFTEATHIYHLRCLGIEPTPAFKGVTKIEEAQRLWNNMKNDTIMGDKKFIETIPD
                     KMAIEVEDKEGNIMTQKVYDELKKQGLA"
     gene            <671423..>672847
                     /gene="NDAI0G02900"
                     /locus_tag="NDAI_0G02900"
                     /db_xref="GeneID:11495567"
     mRNA            join(<671423..671444,671694..>672847)
                     /gene="NDAI0G02900"
                     /locus_tag="NDAI_0G02900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671262.2"
                     /db_xref="GeneID:11495567"
     CDS             join(671423..671444,671694..672847)
                     /gene="NDAI0G02900"
                     /locus_tag="NDAI_0G02900"
                     /inference="similar to DNA sequence:INSDC:YDL029W"
                     /note="similar to Saccharomyces cerevisiae ARP2 (YDL029W);
                     ancestral locus Anc_3.161"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671310.2"
                     /db_xref="GeneID:11495567"
                     /db_xref="GOA:G0WE56"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="InterPro:IPR027306"
                     /db_xref="UniProtKB/TrEMBL:G0WE56"
                     /translation="MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER
                     ANITTPLRDIMIGDEASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLNNTS
                     GGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGD
                     GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEK
                     LCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPG
                     VGELLFNTIQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQLWYTRVLHNDPS
                     RLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWYEGGAAAMAKFGPR"
     gene            complement(<673122..>676025)
                     /gene="NDAI0G02910"
                     /locus_tag="NDAI_0G02910"
                     /db_xref="GeneID:11495568"
     mRNA            complement(<673122..>676025)
                     /gene="NDAI0G02910"
                     /locus_tag="NDAI_0G02910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671263.2"
                     /db_xref="GeneID:11495568"
     CDS             complement(673122..676025)
                     /gene="NDAI0G02910"
                     /locus_tag="NDAI_0G02910"
                     /inference="similar to DNA sequence:INSDC:YOL063C"
                     /note="similar to Saccharomyces cerevisiae CRT10
                     (YOL063C); ancestral locus Anc_3.163"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671311.2"
                     /db_xref="GeneID:11495568"
                     /db_xref="InterPro:IPR014839"
                     /db_xref="UniProtKB/TrEMBL:G0WE57"
                     /translation="MPIDIDDAFNNWLLHRKIARRTERPNFCFDTSIFASSHGESHLR
                     SSIPIKRYILCSNGGKLPSDKISHDFPPQFIDAIDQYLSKSDQYAITKPVLTEMGDHL
                     VSEIKKAKDTLEPSWSSTGIQNPAELLLSNEHRLIIEEILPTIDSFNASNRINSNNEA
                     TFKNNLTVTYKEYIFIAKDDDVYIHKIVDIEGDEKWQGITIIFSCTDSTTPDDTPASV
                     PELNRMPTINFMKIVKFGDVDMLCLCIEESKALFYPIEDLLEKSRTDICRIQHDDEGN
                     DLNEEFRMKILPLTVLVVPASCWSVDTYSTEECVYVAIGHNGPGISLFVFPMDELPNK
                     WYLDPSKIITTEIISKHNVPCISFVPNSLDEKGYVTLGFCSIYGNITTIKVKFNKITG
                     KLETNFLDTQFFGTFCWTITSLSKKDFLTIPEFEYLNLNFQTSFKKSILTSICDDDTT
                     LGFHPPSIYYSNNLGIGTLTTQIPVPVSEVSLGCQKGHLKDFVQLRFTSFEENISSGK
                     LKNVREEEEEEEEEEGEVVHTVQPLSQRQDTEHTTIDYIEDDIRRYYVFWEKYWEQEN
                     LNDEEIKRYSKWWNTKFDLANNRNTTVSRNSSGNILKNSYKFTALNERRDFYLQNIPL
                     RNRHLIEPNKLNHFSRHFLRLPTSPFYGISISYDKNSYQSITASWNQQCGISTEDTGT
                     HTDDRTSTESLNEQLNERIDRGSIELLGVESEEDIEDGNSISSEIRNTLGSAHENNWA
                     KRLGYPETVSPSSQRKWSIHNHATKVHELLANIEDGSERSLTGFKLKDLNDDFFLVTT
                     ADCIYLLKAHPLLITSFTAEKVFPLEEANFCSCHDFIFALNRINTVCHIKELNCIVVA
                     SQVGLISLLRLTEYKGIYSFRQEYILGWKSQDPQNPNEENRCILTSISSIRFGTERWY
                     CGIDDVYLPYYNITGMDYVYIPADEVNGLAAYVILYVISGNCIRRFRVSSNQS"
     gene            complement(<676413..>677873)
                     /gene="NDAI0G02920"
                     /locus_tag="NDAI_0G02920"
                     /db_xref="GeneID:11495569"
     mRNA            complement(<676413..>677873)
                     /gene="NDAI0G02920"
                     /locus_tag="NDAI_0G02920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671264.2"
                     /db_xref="GeneID:11495569"
     CDS             complement(676413..677873)
                     /gene="NDAI0G02920"
                     /locus_tag="NDAI_0G02920"
                     /inference="similar to DNA sequence:INSDC:YOL062C"
                     /note="similar to Saccharomyces cerevisiae APM4 (YOL062C);
                     ancestral locus Anc_3.165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671312.2"
                     /db_xref="GeneID:11495569"
                     /db_xref="GOA:G0WE58"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:G0WE58"
                     /translation="MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRS
                     PILTLGSTTFHHIRSSKDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEY
                     LKEEFMIVHELLDVMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKG
                     NNEISMPKFLKRNDSSQSHDSNFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKDG
                     SILKAYVDGSIDLQTRLSGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSN
                     LSNKVLSKASVGNVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNL
                     PFKITPIVTNSVTGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTC
                     KFVPAENAMVWKFNKYNGLTENTLSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSN
                     SGLVVRYFTISEGHQNYKAVKWIKYVSKSGSYEVRF"
     gene            <678220..>679782
                     /gene="NDAI0G02930"
                     /locus_tag="NDAI_0G02930"
                     /db_xref="GeneID:11495570"
     mRNA            <678220..>679782
                     /gene="NDAI0G02930"
                     /locus_tag="NDAI_0G02930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671265.2"
                     /db_xref="GeneID:11495570"
     CDS             678220..679782
                     /gene="NDAI0G02930"
                     /locus_tag="NDAI_0G02930"
                     /inference="similar to DNA sequence:INSDC:YOL061W"
                     /note="similar to Saccharomyces cerevisiae PRS5 (YOL061W);
                     ancestral locus Anc_3.166"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671313.2"
                     /db_xref="GeneID:11495570"
                     /db_xref="GOA:G0WE59"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:G0WE59"
                     /translation="MSFKVDLEYPFKRYHCKTQPTKSIVMSSIVIFGGESHPELVKKI
                     CENVNIHPSQVTLGKFSNGETSISVGDSVREKDVYVIQSGCGQVNDTFMQLLILISAC
                     KSASASRVTAVMPYFCYSRQPDTPYTVKGAPLISKPRETYTFESNPGTPINGGSSTKS
                     NSSSSMTTQRPGADSSFKSLNTTIRNTIDLQQPQPSRVQPGVRPVLPTLNNTMSLSRI
                     PIIPGGKVQTPRTSNADAGELFNSQNAGYKLWVVQAGTLIANLLTASGADHVITMDLH
                     DPQFPGFFNIPVDNLYCQPIQMNYIQHHIPDYQDAVIISPDAGGAKRATAIADALELS
                     FALIHKERRSQLLKGPPDATLTSGGALPVSPKPLVATLNFPRNINASSPPKPQISHRH
                     GGDDVNQSKYIQTTMVVGDVRNKVCIIVDDLVDTSYTITRAAKLLKDQGATKVYALIT
                     HGIFSGDALNRINQSSIDKLIISNTIPQDKTVQFLGKDRVDVIDVSRVFGEAIRRIHN
                     GESISMLFEHGW"
     gene            complement(<680031..>682148)
                     /gene="NDAI0G02940"
                     /locus_tag="NDAI_0G02940"
                     /db_xref="GeneID:11495571"
     mRNA            complement(<680031..>682148)
                     /gene="NDAI0G02940"
                     /locus_tag="NDAI_0G02940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671266.2"
                     /db_xref="GeneID:11495571"
     CDS             complement(680031..682148)
                     /gene="NDAI0G02940"
                     /locus_tag="NDAI_0G02940"
                     /inference="similar to DNA sequence:INSDC:YOL060C"
                     /note="similar to Saccharomyces cerevisiae MAM3 (YOL060C);
                     ancestral locus Anc_3.168"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671314.2"
                     /db_xref="GeneID:11495571"
                     /db_xref="GOA:G0WE60"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR002550"
                     /db_xref="UniProtKB/TrEMBL:G0WE60"
                     /translation="MSSPRTTPLQSTRLILIGYLLMLIPKIYSLPLTWSRMSSMATPS
                     SSPAASPPPYEDTTDITTYGIISAILVVLGGVFAGLTLGLMGQDEVYLKVISTSGTPT
                     EKKLAARVLSLISRGKHWVLVTLLLSNVITNETLPIVLDRCLGGGWQAVLSSTVLIVI
                     FGEIIPQSICVKYGLQVGAFFSPFVLLLMYVMYPVAYPIATLLDYLLGEDHGTIYKKS
                     GLKTLVTLHRTMGVERLTQDEVTIISAVLDLKEKSVKEIMTPIENVFTMSAATILDDK
                     TVELIFNSGFSRIPIYLPNEPNNFIGMLLVRVLISYDPDDALPVSHFPLATLPETSPN
                     TSCLNILNYFQEGKSHMCIVSKDPGSSQGAIGVLTLEDVIEELIGEEIVDESDVFVDI
                     HQHIMRSQPGPLSKRHITSYLHHLYTDSHRKHQQDEANSLLEGPQEQQGSDNEEGSKK
                     RSESQPLLHTPNNSHDVLKEGYSSTLKPSISIASPTGNGHTNHYRSRIFSTPSTSEFQ
                     QHNHSNLVLPSNLASNPLDIKKPFVTIKKPVENIQKLTDDENALLKKHAKLAHGAMEY
                     ASQSGEAVQVTTSMTTNTPTKDITTPANSSSRSWQSSDPKTDNKSINSPRRSPINKNV
                     TTISSSYQSTKNGIVESVITVKGVPKTIIEPAHNWDDSSHLETTGSDRDNISQRLILQ
                     KSPSSQIDEISVSPNTSIHNESE"
     gene            complement(<682731..>683156)
                     /gene="NDAI0G02950"
                     /locus_tag="NDAI_0G02950"
                     /db_xref="GeneID:11495572"
     mRNA            complement(<682731..>683156)
                     /gene="NDAI0G02950"
                     /locus_tag="NDAI_0G02950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671267.2"
                     /db_xref="GeneID:11495572"
     CDS             complement(682731..683156)
                     /gene="NDAI0G02950"
                     /locus_tag="NDAI_0G02950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671315.2"
                     /db_xref="GeneID:11495572"
                     /db_xref="UniProtKB/TrEMBL:G0WE61"
                     /translation="MSINTVPKNINNKGNLIIDNGDSGDKSTKVTTCSLINGGILKDT
                     SGSLSVNKTFINSGYIWLGYVSRFDSLLTFEASKTGIQNSDTIDVSGTNVTVNVPNTG
                     GGCICGDSISTDLSIDTDYSLYQTFWMESSGSCLIYHEY"
     gene            complement(<684196..>685527)
                     /gene="NDAI0G02960"
                     /locus_tag="NDAI_0G02960"
                     /db_xref="GeneID:11495686"
     mRNA            complement(<684196..>685527)
                     /gene="NDAI0G02960"
                     /locus_tag="NDAI_0G02960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671268.2"
                     /db_xref="GeneID:11495686"
     CDS             complement(684196..685527)
                     /gene="NDAI0G02960"
                     /locus_tag="NDAI_0G02960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671316.2"
                     /db_xref="GeneID:11495686"
                     /db_xref="InterPro:IPR021031"
                     /db_xref="UniProtKB/TrEMBL:G0WE62"
                     /translation="MLMKSIVIRYIIGVLFQIITSIAALEISENTVIDNLATVTDDLT
                     IDRGSYLLVTYDPSVSINSNNIVNNGNLCIGTASTTDSISINIAGSSLNNKGKLIIDN
                     GPIGTASTLIKLATLTNSGYLRGRLNDGSDGLTVTDSFINTGYIWLGYSGNVFGSFTI
                     NPPNTGIQNSGTISFTDSNVTINFPVTGGGCMVGSTSRDTFAVNTDYSIDQTIYLTST
                     TTKSITILGSGKYIPVIRGVDAKTTFQFGRQVRKSNNTKSVISYNTTSGILTTWNVYG
                     IMKLDIGTGYDATGFISGQVISGSCSTCYAPIISYSGIVPTAGTSRPSICDIEPDRTM
                     ALCPLIISSSSSALSSSYAQSSSSLVPSSSYLLSSLETSSTVLIPTSSSLSQQHTASK
                     TIVMSSSQCVITETAMEYFSTLYNTTYSYITVATINEETTDTYITTSFSSK"
     gene            <688651..>690135
                     /gene="NDAI0G02970"
                     /locus_tag="NDAI_0G02970"
                     /db_xref="GeneID:11495574"
     mRNA            <688651..>690135
                     /gene="NDAI0G02970"
                     /locus_tag="NDAI_0G02970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671269.2"
                     /db_xref="GeneID:11495574"
     CDS             688651..690135
                     /gene="NDAI0G02970"
                     /locus_tag="NDAI_0G02970"
                     /inference="similar to DNA sequence:INSDC:YDL022W,YOL059W"
                     /note="similar to Saccharomyces cerevisiae GPD1 (YDL022W)
                     and GPD2 (YOL059W); ancestral locus Anc_3.169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671317.2"
                     /db_xref="GeneID:11495574"
                     /db_xref="GOA:G0WE63"
                     /db_xref="InterPro:IPR006109"
                     /db_xref="InterPro:IPR006168"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR011128"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR017751"
                     /db_xref="UniProtKB/TrEMBL:G0WE63"
                     /translation="MGLHFLFPVLLNILLLSSSYLVVVLQMSLSYKTFNLLSNSGKKA
                     SPLVVALAYSSSFSSSHFSFLEKLPLYKENSNNILRRSLHPSSIIRQTISNINKNNNN
                     NITRKMTSPTRLKTMRSPMKKVESQVNLHPLLCDPFRVTVIGSGNWGTTIAKVVSENT
                     AIHSHVFEKEVQMWVFEEKIDGQNLTEIINTKHENVKYLPGIELPENLRANPDLLDAV
                     KEADILVFNIPHQFLSRIVKQLEGHVKKGARAISCLKGFEVGVKGVQLLSSYITDELG
                     IACGALSGANLAPEVAKEHWSETTVAYQLPKDFRGEGKDVDHKILKVLFHRPYFHVNV
                     IDDVAGISIAGALKNVVALGCGFVEGLGWGNNAGAAIQRVGLGEIIKFGQMFFPESRV
                     ETYYQESAGVADLITTCSGGRNVRVAKYMAETGKGAIESEKDLLNGQSAQGVITCKEV
                     HEWLDKCELTQEFPLFEAVYQIVYNNVPMENLPDMIEELDDFGF"
     gene            <691428..>692690
                     /gene="NDAI0G02980"
                     /locus_tag="NDAI_0G02980"
                     /db_xref="GeneID:11495575"
     mRNA            <691428..>692690
                     /gene="NDAI0G02980"
                     /locus_tag="NDAI_0G02980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671270.2"
                     /db_xref="GeneID:11495575"
     CDS             691428..692690
                     /gene="NDAI0G02980"
                     /locus_tag="NDAI_0G02980"
                     /inference="similar to DNA sequence:INSDC:YOL058W"
                     /note="similar to Saccharomyces cerevisiae ARG1 (YOL058W);
                     ancestral locus Anc_3.170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671318.2"
                     /db_xref="GeneID:11495575"
                     /db_xref="GOA:G0WE64"
                     /db_xref="InterPro:IPR001518"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR018223"
                     /db_xref="InterPro:IPR023434"
                     /db_xref="InterPro:IPR024074"
                     /db_xref="UniProtKB/TrEMBL:G0WE64"
                     /translation="MSKGKVCLAYSGGLDTSIILAWLLDEGYEVVAFMANVGQEEDFD
                     AAKEKALKIGATKFVCVDCRNDFVTDILFPAVQCNAVYEDVYLLGTSLARPVIAKAQI
                     DVAEQEGCFAVAHGCTGKGNDQIRFELGFYALKPDVKVIAPWRLPEFFERFAGRKDLL
                     DFAAEKGIPVAQTKSKPWSTDENQAHISYEAGILEDPDTTPPKDMWKLTVDPMDAPNE
                     PQDLSINFERGLPVKVSYNDHATKKDVSVTAPQDIFETVSNLARANGVGRIDIVEDRY
                     INLKSRGCYEQAPLTVLRRAHVDLEGLTLDKEVRQLRDQFVTPTYSKLLYNGSYFSPE
                     CEYVRSMIQPSQETVNGTVRVRLYKGNVIILGRSSATENLYDPTESSMDELTGFLPTD
                     TTGFIAIQAIRIKKYGDAKRAKGTKLTL"
     gene            <694187..>695146
                     /gene="NDAI0G02990"
                     /locus_tag="NDAI_0G02990"
                     /db_xref="GeneID:11495576"
     mRNA            <694187..>695146
                     /gene="NDAI0G02990"
                     /locus_tag="NDAI_0G02990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671271.2"
                     /db_xref="GeneID:11495576"
     CDS             694187..695146
                     /gene="NDAI0G02990"
                     /locus_tag="NDAI_0G02990"
                     /inference="similar to DNA sequence:INSDC:YDL021W,YOL056W"
                     /note="similar to Saccharomyces cerevisiae GPM2 (YDL021W)
                     and GPM3 (YOL056W); ancestral locus Anc_3.172"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671319.2"
                     /db_xref="GeneID:11495576"
                     /db_xref="GOA:G0WE65"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR005952"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G0WE65"
                     /translation="MTSSSETFKLFLLRHGQSNLNHENIFCGWIDAKLTEKGENQARN
                     TAKLIQDYCQTNNVTLPQIGYSSRLIRTQQTMDVILEQFNLKGDKHIICGGEKTSSRE
                     LAQIPLKLLPSNTITNDKSDINEVSILQTWRLNERHYGSWQGQRKPQILQQYGDEQYM
                     YIRRDFNGRPPKVDLNLEMVQEIDDKGSSTGYEFKEPNRHLKYGLEESNNEPLPCGES
                     LCDVGKRLGPFLDNVVLKIAKDHHLDSSLIVGHGSTVRSALKMLEGISDEEIKGIDIP
                     NGIPLVIELDRASLKFVRRFYLDPESAKINAEKVRKEGFENNP"
     gene            complement(<695595..>697139)
                     /gene="NDAI0G03000"
                     /locus_tag="NDAI_0G03000"
                     /db_xref="GeneID:11495577"
     mRNA            complement(<695595..>697139)
                     /gene="NDAI0G03000"
                     /locus_tag="NDAI_0G03000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671272.2"
                     /db_xref="GeneID:11495577"
     CDS             complement(695595..697139)
                     /gene="NDAI0G03000"
                     /locus_tag="NDAI_0G03000"
                     /inference="similar to DNA sequence:INSDC:YDL020C"
                     /note="similar to Saccharomyces cerevisiae RPN4 (YDL020C);
                     ancestral locus Anc_3.173"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671320.2"
                     /db_xref="GeneID:11495577"
                     /db_xref="GOA:G0WE66"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0WE66"
                     /translation="MKMISTDLTMRVFAESIEDELNYVQSARSNYYNNGFPFGFNPQQ
                     FLKFGSQSSPVASSSSSFQPLKQINSNEYIVPYRRHNTHDIGQDPKYPRICTNNKSYS
                     APRTSSLSSSSNKLPNGYSTYGRCRSSSSSSTSSSISSYGQTSKAKNYGLFNKYADPS
                     VMATSASEKMKPSTTSNNNSILDDSTYDDTYNVDLLASNSRFELTSLVEESSAISTNH
                     NQSCTNLNLNSAPPFFDITIANEDNDDLNFGYDMEFLYSSQTDEDILSLEENEKLLMD
                     LPLQNSNMAALNSHDTKLLFKGEFPNDDYDFVEEDDNKEVNRKDYEYDESFSDDYIDY
                     QKSASSASSIFASPFDDSSIVTKPAIKKNNNLSSKKVATNKLSKSKSSNKENKEHLSK
                     TTDNNKSLSNKKKSEVSIPNCQYSNEIYMCSIINSKTKELCGAKFSRTYDLTRHQNTI
                     HAKERTVFRCLQCIKLFGGVGQEKTFSRLDALSRHLKTKHIDLTDFQRKEVTKYAKEH
                     ITYITA"
     gene            complement(<697636..>699306)
                     /gene="NDAI0G03010"
                     /locus_tag="NDAI_0G03010"
                     /db_xref="GeneID:11495578"
     mRNA            complement(<697636..>699306)
                     /gene="NDAI0G03010"
                     /locus_tag="NDAI_0G03010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671273.2"
                     /db_xref="GeneID:11495578"
     CDS             complement(697636..699306)
                     /gene="NDAI0G03010"
                     /locus_tag="NDAI_0G03010"
                     /inference="similar to DNA sequence:INSDC:YOL055C"
                     /note="similar to Saccharomyces cerevisiae THI20
                     (YOL055C); ancestral locus Anc_3.174"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671321.2"
                     /db_xref="GeneID:11495578"
                     /db_xref="GOA:G0WE67"
                     /db_xref="InterPro:IPR004305"
                     /db_xref="InterPro:IPR004399"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="InterPro:IPR027574"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:G0WE67"
                     /translation="MTAFQTIQINTPPPYLSLSKDEHLPTILTIAGSDSSGGAGIEAD
                     LKTISAHRCYGMTCMTALTIQTPVKVFGIHLTPKDVLKQIIDVNLRDMRCNVIKTGML
                     TLDAIDVLAEKLNSMDPKEKPLLVVDPVLVATSGSTLAGDELVQLIKEKITPLANVLT
                     PNIPECFKLIGENVKIESLDDVRQLAERVSDVTKCSNVLVKGGHIPWDKNGSEKYITD
                     VLLMRDEQKFVVFKGHFVDTTNTHGTGCTLASAIASNLARGYSLCQSVYGGIEYVQNA
                     VTIGCQVTKSHVKENGPINHVYAVEIPMEKMITDDCFTAHDIVPTISNDTELLSKKIG
                     NDFFTYLINHPFVKPHWQSYINHEFVKKIADGSLDRRKFQFFVEQDYSYLIDYARVHC
                     VAGSKAPTLEDMEKELEIVGGVKQEMDHHEKRLREDFGVKDDEYFANITRGPALKAYS
                     RYFNDISRRGNWQELVAALTPCLMGYGYALYTFEKQITVTNESMPLYHGWLEVYSSAW
                     YREAMAKGKVLLNNISMTYPQEQLDTLVTIFGEVCELETKFWDAALEY"
     gene            complement(<699746..>704233)
                     /gene="NDAI0G03020"
                     /locus_tag="NDAI_0G03020"
                     /db_xref="GeneID:11495579"
     mRNA            complement(<699746..>704233)
                     /gene="NDAI0G03020"
                     /locus_tag="NDAI_0G03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671274.2"
                     /db_xref="GeneID:11495579"
     CDS             complement(699746..704233)
                     /gene="NDAI0G03020"
                     /locus_tag="NDAI_0G03020"
                     /inference="similar to DNA sequence:INSDC:YDL019C,YAR042W"
                     /note="similar to Saccharomyces cerevisiae OSH2 (YDL019C)
                     and SWH1 (YAR042W); ancestral locus Anc_3.175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671322.2"
                     /db_xref="GeneID:11495579"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR018494"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G0WE68"
                     /translation="MMVTGNTETFRRGNTNGQQRGNHPRRRLRVKSSAIYKVIDLQTS
                     YTYIHTYIHRRAYSYIYIYIYSVISLSQQQQYVTNIILLLYPDTVDYQYTINILSSVS
                     AVCPNSLPNNNRNTQTSNDDGIGNGASALVDPPVQNDNVSTISSSTSSSSSSSSSTTT
                     SHSAAAAAAVNQDVTLKSHSITRSKPLLKLKLLNILRQGDLQLLTTLLTSSQFTPLND
                     PNVHEVTKLILNYAVQLAPTQLVKDIINNFINPQPSENPLIILDINQRDKNGNTPLHL
                     AAYQSRNEIVTILMDHPKINDCLLNNMHLQPIEMCKNLNTAQLIQFKRSNYVAEIAQE
                     FRLAFNNRDFNHLETILNNDRNAQLLDINGMDPETGDTVLHEFVKKRDVIMCRWLLEH
                     GADPFKRDVKGKLPINLIPKINENEQASNTKMAIDIELKKLLEKAIREQSVIDITNGI
                     APSPLNTATTTSRDDNLGTTTTTTTTTTTNKNDANNNINARLHEPPTFKGYLKKWTNF
                     AQGYKLRWFILSEDGRLSYYIDQSDTKNACRGSLNLSSCNLHLDSSEKLKFEIIGGTN
                     GSIRWHLKGNHPIETSRWVWTIQGAIRFAKDREIIMNKKLNNNPNMITNSTIHSLQQN
                     SQIIRQSSATVANHNNTTGDPMKTRKRKSTMTSSSTTTTTNSATKPSLLNENTNDNEP
                     TVENSTNLQENLNDNESHHNEQEEEDEQEEDEEDDDDEDEDDDDDDDDDDFHANHTNN
                     NDEEDVTINYGPYSTKVHMLQRSITIELNSLTDLLNDDENPTTTTTTTTTTTITDHDN
                     DMWDTMNHSIDTITKCFNKLNDITSKRDKKLLNMLDKQKDVNNVWIQSMKDLEMELID
                     KDKRLVSLDKERKHLKKMLQKKLLEIDTTTNDLTTTTGTTTRSSSNFNQQLSETQTTD
                     NKYTKMMNSTESNAQGNMESPTDTLEEIAKFINATKDSDEDSDIDEFFDAEDVVESDS
                     EQEQEQVQEQDSTNTTPQPKIEQSIEEQETIVAEKTNEPIKIFNTTVTTTTTTTTTAL
                     TPTIETVQSYVGPNIKIVTEIQELNKKKLIEEGTFLGYEDGLRKKLSLDKDERPKVSL
                     WSVLKSMVGKDMTKMTLPVTFNEPTSLLQRVSEDLEYSQLLDQAASFNDSTLRLLYVA
                     AFSASIYSSTTNRIAKPFNPLLGETFEYTNPNASYRFFTEQVSHHPPISATWTESPKW
                     DFYGESRVEMKFNGRSFGVKHLGLWYIKMRPDNNMNEEEEEEEIYTFKKPDNSVIGIL
                     VGNPQLDNHGEVKIKNHKTGDYCILNFKARGWTSAGAYEVKGDIYNKNNEKIWVLGGH
                     WNDAIYAKKITNKNTSDLKLDNNNNINNLHPNTNLSTNNNSSSRDNGPRYDGTKFMIW
                     KTNERIESPFNLTPFAITLNAPQPHLIPYLAPTDSRLRPDQRAMEDGKYDIAAEERNR
                     LEEKQRAVRKEREKTGKKYQPQWFVKDVHPVTNEPYWRYNGEYWKLRKQHNFESCPDI
                     F"
     gene            <704910..>708269
                     /gene="NDAI0G03030"
                     /locus_tag="NDAI_0G03030"
                     /db_xref="GeneID:11495580"
     mRNA            <704910..>708269
                     /gene="NDAI0G03030"
                     /locus_tag="NDAI_0G03030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671275.2"
                     /db_xref="GeneID:11495580"
     CDS             704910..708269
                     /gene="NDAI0G03030"
                     /locus_tag="NDAI_0G03030"
                     /inference="similar to DNA sequence:INSDC:YAR019C"
                     /note="similar to Saccharomyces cerevisiae CDC15
                     (YAR019C); ancestral locus Anc_3.177"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671323.2"
                     /db_xref="GeneID:11495580"
                     /db_xref="GOA:G0WE69"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0WE69"
                     /translation="MYDRINLTPAQQQQQQQQQQLQRRQNRDNNTPATAQYIPTSSTT
                     SSSSLSQRKNKSVQYQLKKVIGQGSYGVVYKAINKKTSQLVAIKEINYHNNDDLNEIM
                     SEIDLLKNLNHTNIVKYHGFIQKSSSLYIILEFCSLGSLKNMISSGHGIPEFNAKTYI
                     KQTLNGLNYLHNQGVIHRDIKAANLLLNAERIVKLADFGVSTRVTNTAMTLAGSLNWM
                     SPEILGNRGASTLSDIWSLGSTVVELLTGDPPFSKLTNTTISYAIENDNYIPPDSMSY
                     EVKDFLSKCFQKNMYKRPTALVLLNHPWITNENENKNKNKSENKNKNKNEHTAPPVIK
                     SNLNKKLSKFKETNFATDEFWDNDFENDENLILSITNNNDNSPLKKQSSSPSNVMETP
                     IAQRNINGNENEMKNNLCPSPIKNTPAFMKISHNNNNILTPKNSRSSLNNNTNTNDND
                     NDNKDVSKSEDYYLNKIQKGKSIKNYLPIIFQKCDPYNLIEIIMQIMISINKDSDKKN
                     TKLFLKNLQYLLEYDYQSNNSKLKQIFISIGGIPILLNNPILYESIVFNFFANNSSSN
                     SISTSNDSKEILIQCGIMNPEIINKLKNTKLYWQLIYNFMEHLNSSLSSASSLKIWSN
                     WCQNNLSVSSLINNLNDKNCKTILLRLSTVSPVWFAKNFLPHIVNSNCITNNTDPQIL
                     YVVLKSITCMFQATFSTAHSNLNPSFPRSGSNVNSSPTKSPYLSPIRMSPSSSPSRGA
                     VSLVMMTASPGTSSPSSSSSCSSSSSSSSQSCMINASKFKLPENFTNWLLDFLTDNKL
                     IMTGNVHLWKYFIKLLSYLTHLNNPLLIQLKYNIDFINFSNNLLKFYESIKTSDSHTK
                     KSTNMLAKKNSIKSIIQQLLTILSEISSNENTNQNPKENIHKFHHPSQEISSLNESFI
                     NLALNYLHNDDFIVEGLDLILQNFSIIQNDQLKKLSNHLTNAFYQFGNSTNDDDIDFN
                     KFIKIFIKFCSMTSSSSSSSLSLLDLNYKLISNGLFFQRIEMFFQNYFNSLLIQIDLL
                     KFVKIIFMNSLQFATEKEEDIDEDMLLIVNKKLYEINTFLQNNWKTGNKIEDGKVGSD
                     SILIHQLCNNIQKLLVKSNKKIMIEKGNIVS"
     gene            complement(<708715..>710599)
                     /gene="NDAI0G03040"
                     /locus_tag="NDAI_0G03040"
                     /db_xref="GeneID:11495581"
     mRNA            complement(join(<708715..709832,710590..>710599))
                     /gene="NDAI0G03040"
                     /locus_tag="NDAI_0G03040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671276.2"
                     /db_xref="GeneID:11495581"
     CDS             complement(join(708715..709832,710590..710599))
                     /gene="NDAI0G03040"
                     /locus_tag="NDAI_0G03040"
                     /inference="similar to DNA sequence:INSDC:YFL039C"
                     /note="similar to Saccharomyces cerevisiae ACT1 (YFL039C);
                     ancestral locus Anc_8.23"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671324.2"
                     /db_xref="GeneID:11495581"
                     /db_xref="GOA:G0WE70"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR004001"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="UniProtKB/TrEMBL:G0WE70"
                     /translation="MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIM
                     VGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP
                     VLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVT
                     HVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCY
                     VALDFEQEMQTASQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQ
                     TTYNSIMKCDVDVRKELYGNIVMSGGSTMFPGIAERMQKEITALAPSSMKVKIIAPPE
                     RKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF"
     gene            complement(<711396..>712028)
                     /gene="NDAI0G03050"
                     /locus_tag="NDAI_0G03050"
                     /db_xref="GeneID:11495582"
     mRNA            complement(<711396..>712028)
                     /gene="NDAI0G03050"
                     /locus_tag="NDAI_0G03050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671277.2"
                     /db_xref="GeneID:11495582"
     CDS             complement(711396..712028)
                     /gene="NDAI0G03050"
                     /locus_tag="NDAI_0G03050"
                     /inference="similar to DNA sequence:INSDC:YFL038C"
                     /note="similar to Saccharomyces cerevisiae YPT1 (YFL038C);
                     ancestral locus Anc_8.25"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671325.2"
                     /db_xref="GeneID:11495582"
                     /db_xref="GOA:G0WE71"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WE71"
                     /translation="MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVD
                     FKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQDSFDGVKMW
                     LQEIDRYATSTVLKLLVGNKCDLEDKRVVEYDVAKEFADSNKMPFLETSALNSTNVEE
                     AFLTMARQIKESMNQQKMEDSNAASKGGDKNSNVNLTGGQSLTNSSSGCC"
     gene            <712935..>716999
                     /gene="NDAI0G03060"
                     /locus_tag="NDAI_0G03060"
                     /db_xref="GeneID:11495583"
     mRNA            <712935..>716999
                     /gene="NDAI0G03060"
                     /locus_tag="NDAI_0G03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671278.2"
                     /db_xref="GeneID:11495583"
     CDS             712935..716999
                     /gene="NDAI0G03060"
                     /locus_tag="NDAI_0G03060"
                     /inference="similar to DNA sequence:INSDC:YFL036W"
                     /note="similar to Saccharomyces cerevisiae RPO41
                     (YFL036W); ancestral locus Anc_8.28"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671326.2"
                     /db_xref="GeneID:11495583"
                     /db_xref="GOA:G0WE72"
                     /db_xref="InterPro:IPR002092"
                     /db_xref="InterPro:IPR024075"
                     /db_xref="InterPro:IPR029262"
                     /db_xref="UniProtKB/TrEMBL:G0WE72"
                     /translation="MLRPITSRSTNVRSSILQNVHTSSNTSILLSTRSISSKSLTFQN
                     LSSYSNLNNDSNHDPSQLFPSPSPSSSSSSSCSSTSSKPHNASTTVPGISLNPPDMNN
                     IKNNNKSKYLVTDVLNSRLMKRKIDKPNKNPYLPNFDTFNRSHASSISSTTEKRDVMQ
                     LWSLLEACLQSNYFDRAKSILNSLYMINSHRKYFIDDYNLYLKKLSDSNRNNINLDQI
                     LMDDLKTKFKSIHYNDRTLSILIHHSLSSTSNKHVNIKTYLNMNRNGIKEILKNIDIL
                     NINDFQKLYNDLKFIQQTDIPPSIRSILHQESMKTTTSNTPNPTQSSEQQHEIVRLDN
                     SVESIKKQNTEELVAVDTIGMKVIRHTLLGLSLNETQRNLISNYNFEPNENIMNNNNH
                     TTASRNDLDFFEIYKSLTNESERETFESILEQFNIDRQRALESRAADAAKERWKHDFE
                     EAKERGDLSIRKSLNVKLWNWYELMLPILKKEIEKAQLKLEKQSKIFKSQDFDPYLLL
                     VNPEKMCVITILELLKLNSTGGVIEGMRTARAVISVGKAIEMEFRSEQLLKNESSIFK
                     DINKKSAEFKKIVQRAKSNFRSTQLEKSKIFWPQAVRAQIGSILISTLIHVAKIDVEG
                     FDPITKTKVYGEAPAFAHSYQYCNGMKLGVIKIHKALINQLNGERLVASVQPQLLPML
                     VEPREWKNWRSGGYFYTQSTLIRSKESPEQLAYLKAVSDKEAIDDVYNGLNALGKTAW
                     TVNKRLFEIISKVWNEGIEFLDIPQIQYDMQLIPPPPRNSDPSILREWKLQNKEIANK
                     ISKNRSIRCDTNYKLEIARAFLGEKFYFPHNLDFRGRAYPLSPHFNHLGNDLSRGLLI
                     FWKGKKLGPDGLSWLKIHCANLYGMDKIPFTERIQFIEDHIEDVKDTAENPLDGKGWW
                     KKADKPWQLLATCIELNEALKLDNPEDFISHQPVHQDGTCNGLQHYAALGGDVEGATQ
                     VNLIPNERPQDVYRHVANLVKKRLEKAVLAGDKKAELLVDKITRKVVKQPVMTNVYGV
                     TYVGATFQIEKQLSEYFPDRKQCFDLSKYLTFHVFATIRELFHSAHLIQDWLGECAKR
                     ITKSIRLDVDGKSFKNGNKPDFMSSVIWTTPLGLPIVQPYREATKKQVMTNLQTIFIS
                     DPFAINGVNARRQKAGFPPNFIHSLDASHMLLSAIKCKENGLEFASVHDSYWTHACDV
                     NKMSVYLRDEFIELHKVDLIERLKDEFDERYKDYVQIVKIGKTTELANKILKWRKEQS
                     EKLGRPLTLADEIHMEKKRQDMLNSESATVRAKGSKLVTSISLVEDVKEIDELKPVTE
                     SMSVLVIVPLKLPEIPSKGDFDVQNVRESKYFFS"
     gene            complement(<717242..>718254)
                     /gene="NDAI0G03070"
                     /locus_tag="NDAI_0G03070"
                     /db_xref="GeneID:11495584"
     mRNA            complement(join(<717242..718115,718235..>718254))
                     /gene="NDAI0G03070"
                     /locus_tag="NDAI_0G03070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671279.2"
                     /db_xref="GeneID:11495584"
     CDS             complement(join(717242..718115,718235..718254))
                     /gene="NDAI0G03070"
                     /locus_tag="NDAI_0G03070"
                     /inference="similar to DNA sequence:INSDC:YFL034C-B"
                     /note="similar to Saccharomyces cerevisiae MOB2
                     (YFL034C-B); ancestral locus Anc_8.29"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671327.2"
                     /db_xref="GeneID:11495584"
                     /db_xref="InterPro:IPR005301"
                     /db_xref="UniProtKB/TrEMBL:G0WE73"
                     /translation="MSFFNFKGFGRNSKKTKNQTHNLGTPTPPPQMSTIYSSPHSSNS
                     KLSLRKLPSPKRKSQNNLPPQQQQQPQSSSNSSSHKINANASQNTLTSHQSDKPETQQ
                     VMFLSEPFVRTALVKGSFKTIVQLPKYVDIGEWIALNVFEFFTNLNQFYGVIAEYVTP
                     DAYPTMNADPHTDYLWLDANNRQVSLPASQYIDLALTWINNKVNDKNLFPTRNDATFP
                     QVFLRDVQRIMVQMFRIFAHIYHHHFDKIVHLSLEAHWNSFFAHFISFSKEFKIIDRK
                     EMAPLLPLIESFEKQGKIIYT"
     gene            complement(<718820..>719236)
                     /gene="NDAI0G03080"
                     /locus_tag="NDAI_0G03080"
                     /db_xref="GeneID:11495585"
     mRNA            complement(<718820..>719236)
                     /gene="NDAI0G03080"
                     /locus_tag="NDAI_0G03080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671280.2"
                     /db_xref="GeneID:11495585"
     CDS             complement(718820..719236)
                     /gene="NDAI0G03080"
                     /locus_tag="NDAI_0G03080"
                     /inference="similar to DNA
                     sequence:INSDC:YFL034C-A,YLR061W"
                     /note="similar to Saccharomyces cerevisiae RPL22B
                     (YFL034C-A) and RPL22A (YLR061W); ancestral locus
                     Anc_8.31"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671328.2"
                     /db_xref="GeneID:11495585"
                     /db_xref="GOA:G0WE74"
                     /db_xref="InterPro:IPR002671"
                     /db_xref="UniProtKB/TrEMBL:G0WE74"
                     /translation="MANYGLKLLTKERIYYIKTSRRQQKTIKTLTVDVSSPTENGVFD
                     PASYAKFLIDHIKVDGTIGNLGNAITVEEDGSIVTIVSTTKFSGKYLKYLTKKYLKKN
                     QLRDWIRFISIKKNNYKLSFYQVTPEEDADEEEDAE"
     gene            <720183..>723212
                     /gene="NDAI0G03090"
                     /locus_tag="NDAI_0G03090"
                     /db_xref="GeneID:11495684"
     mRNA            <720183..>723212
                     /gene="NDAI0G03090"
                     /locus_tag="NDAI_0G03090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671281.2"
                     /db_xref="GeneID:11495684"
     CDS             720183..723212
                     /gene="NDAI0G03090"
                     /locus_tag="NDAI_0G03090"
                     /inference="similar to DNA sequence:INSDC:YFL034W"
                     /note="similar to Saccharomyces cerevisiae YFL034W;
                     ancestral locus Anc_8.32"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671329.2"
                     /db_xref="GeneID:11495684"
                     /db_xref="InterPro:IPR007941"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0WE75"
                     /translation="MSDSEEDLGIELKGLKISKYLKKDTETNRSQQSNEEKHNDEGLG
                     STPLQETLIEEHSDTNEAEDHSNSESSSLSDNNGNLTIDSLPMSYRNMNLEEGQKDVI
                     ENSSLNQSLSPSFQPIRSSETPSISSRNEPHQQKQEQDISPNDAIPKAKNDHEDTHSL
                     SSDDTDDDSEWQTMPAVASYNVYNKNGELELKPYDSNEETFDIEQIQKTGKYNNKNKQ
                     TFDYTKVAEETQAQRSYLSNKKTDFLFEHKKLKKALQSKNKSTESQLTNYSSSNSKLN
                     SEITLNNPEEIEEEEEEDSEFDEFEDDVEAQDDLNPTSQLSVTKDLLSDMEKFAYLGA
                     VNVLVNQMCTDLATVCLCVDIKSHKKLASRLHFTQKDMAAWKTVILSRLYEHLAVSQK
                     EIEMIEKLSLHKIQLEDLCKCLKTTQNVENPWEKDNKKKSSLDNSQEKGEKNKSSLDN
                     SQETDANSEKMRHSNEEEGTIETKTETKESTSMVPQKVIKPENINDQNRLNIDIAWTI
                     ICDLFLVFLQNYTYDARSRTLLIKFAKALNITKLEICEFEKRITDSLDMEQSTEDQEW
                     NETDHMKSRRKRKRRKKMAYVGLAMVGGSLVLGLSGGLLAPVIGAGIAAGLSTIGIGG
                     ATGFLTGVGGTTVVALSSTAIGANIGARGMSKRMGSVRTFEFRPLHNNRRVNLILSVS
                     GWIIGNEDDVRLPFSTVDPLEGDLYSLYWEPEMLKSTGQTINIVASEVFTQTIQQVLG
                     ATILTGLMSAIQWPMALSKLGYILDNPWNVSLDRAWAAGLILADTLMSRNLGERPITL
                     VGFSLGARVIFSCLIELSKRKASGLVENVFIFGTPIVRKREHLVMARSIVSGRFVNGY
                     SDKDWVLAYLFRATGGGFKAVMGISPIEDINEIENFNCTEFVDGHMAYRKNMPKLLRE
                     MGIAVLDDTFVEIEEIMDPNEYKRKRKLVHDVDAAQKKLSERKKHNSWMPKWLKPKKS
                     KWQVMVEEAVEEGREGALEGEDDGSSTDEKNQNKEEG"
     gene            complement(<723760..>725547)
                     /gene="NDAI0G03100"
                     /locus_tag="NDAI_0G03100"
                     /db_xref="GeneID:11495587"
     mRNA            complement(<723760..>725547)
                     /gene="NDAI0G03100"
                     /locus_tag="NDAI_0G03100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671282.2"
                     /db_xref="GeneID:11495587"
     CDS             complement(723760..725547)
                     /gene="NDAI0G03100"
                     /locus_tag="NDAI_0G03100"
                     /inference="similar to DNA sequence:INSDC:YLR060W"
                     /note="similar to Saccharomyces cerevisiae FRS1 (YLR060W);
                     ancestral locus Anc_8.33"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671330.2"
                     /db_xref="GeneID:11495587"
                     /db_xref="GOA:G0WE76"
                     /db_xref="InterPro:IPR004531"
                     /db_xref="InterPro:IPR005146"
                     /db_xref="InterPro:IPR005147"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="UniProtKB/TrEMBL:G0WE76"
                     /translation="MPTVSVNKKQLFDLLGKQYGNEEFDELCFEFGIELDEDTTEEAL
                     KNNEEPELKIEIGANRYDLLCIEGIAQSLNEYLGRAETPKYKLTKPTTKLYIEQSSEQ
                     IRPYAAAAILRNITFTEKSYASFIALQDKLHSNLCRNRSLVAIGTHDYDTMEGPVYYR
                     ALPPKDIHFIPLNQTKEFNGAELIEFYKQPEQKNNLGRFVPLIENSPVFPIMMDKNDV
                     VCSLPPLINSEHTKITLDTRNVFIDITAIDKTKADIVLNQLVAMFSRYCDEPFTVEAV
                     EVVSEHNNQSRIVPDFTERKMETSVTYINSALGLEQTPEQIVACLKRMSLDAVKSNKS
                     DDILEVTIPITRTDVLHPCDIMEDAAVGYGFNNLPKGEKLSNANFIASALPINKISDI
                     FRVASSQASWVEVLPLTLCSHDENFKFLRMKDDNTKVVKLANPKTLEYQVVRTTLLPG
                     ILKTVKENRKHSLPIKVFETGDVVFKNNSLERKAYNERHWGAIYVGKNSGFEIIQGLL
                     GKIMQTFRTEWIADYGAGSTGRGYWIEQDDSLSTYFPGRGARVMFRSKEGENAKVVGN
                     LGVLHPEVMNNFDVPFAASFVELNAEVFL"
     gene            complement(<725984..>731107)
                     /gene="NDAI0G03110"
                     /locus_tag="NDAI_0G03110"
                     /db_xref="GeneID:11495588"
     mRNA            complement(<725984..>731107)
                     /gene="NDAI0G03110"
                     /locus_tag="NDAI_0G03110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671283.2"
                     /db_xref="GeneID:11495588"
     CDS             complement(725984..731107)
                     /gene="NDAI0G03110"
                     /locus_tag="NDAI_0G03110"
                     /inference="similar to DNA sequence:INSDC:YFL033C"
                     /note="similar to Saccharomyces cerevisiae RIM15
                     (YFL033C); ancestral locus Anc_8.34"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671331.2"
                     /db_xref="GeneID:11495588"
                     /db_xref="GOA:G0WE77"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G0WE77"
                     /translation="MSNLNPYSNNSNTKDDFSTLPSLGQLHISEDDNISVSKLREHLP
                     PTSDDEEEELDTDDNAEPMDQQDRDSPNSAKYDEYLELATDKNPSMILEVDLDGKIRY
                     ISPRWETLTRIPCPEYISDLILGSEQDKLVFNKVMDMMLANDNVSYTVTFNVSTQTRP
                     ENEKPNDNEDSIQSEFNPYLHDIIAFEACGILIRDSTTNQPTYSMWILKPYNAAWRND
                     NNLEHILPAALIDRLGFGATLFSDYLKDIENEMIIDEADVPVPKMELCRVCETNVPAW
                     WLETHSQSCVCEHRIQSLIQLLHDNLVEQLRLLNNDNITEYKDVPILVKSKTFLELSL
                     ESLRELSTIAININTSEMISSFDVENANFEILRQNRNDTTEENIPLQSENGSDNFFQF
                     SPRTKSNIQNIQEWHLKFPKDDEDPGLSLLVHDTIDLARRKVDAVLRLDNAMTYSSKI
                     KNEVNTYVIQLIREQIENNRIHLPQSMNYPYTASPIPSISNSAFSTASERLDTVVPVS
                     QNLKRPSTNVLLHSNLGSESSISIKDPTPRLARSHLQQSSLFSDAYLNAEGMPEPRNI
                     KSKRENNSMLNNQNDNIQNDSNEDMDTLGDGSSRSRSRSVTPRQQLHFPRTDNNNNSN
                     NTNDNNQQIHTLSNPVDVDSSVTEHLSTEPSFYSTPGLLSSSKFTSSSNNSGLPRLLT
                     SISLTPRRGSPLPETMNSTYPIQRASNSKLNNIKSPVNSPMISNKEFLTPEQHSNNNS
                     TFQTQPLSPLLLATNQTRRVPPSIKDYDILKPISKGAYGSVYLARKKITGEYFAIKVL
                     KKSDMVTKNQVTNVKSERAIMMVQSDKPYVARLFATFQNKENLFLVMEYLPGGDLAAL
                     IKMMGSLPDEWVKQYSTEIISGVDDMHQNGIIHHDLKPDNLLIDSKGHIKLTDFGLSR
                     AGLIRRHKFDFKRKHSSISTDTFNSHNSITNNNDNDNDNNNNNNSQISTPDSNTIAHK
                     RNSTSKLLKKSTIKNTDQDIHLHTNTPTPRSSRKFGQDEVATSSPDPNTMKRSESRSS
                     LSVLELSQTGTPLTNQGQNSTPMHLRTNSFVTLDSTGTSSPASDLALFHPDDSKQDKK
                     FFGTPDYLAPETIEGSGEGDHCDWWSVGCILFELIFGYPPFHTSTPEGVFKKILAGKI
                     EWPKFKSPEEERDFISPEAKDLILKLLTVDVSKRLGTNGAEEIKAHPYFKGVDWEHVY
                     DEDASFVPSVEDPEDTDYFDTRGAVLENFGDDHDEDISKLQPSNYFHYANQDVPDISS
                     TPNIEPVHVNTKRWASLPNNTINDNNRIQTPVGKMSVSSLLGTTLQEEALKNSPTMKS
                     VPMAIPPHMRDRRTSKLNDPQTEFGSFYFRNLSALDKANKDAINRLKSEHIAEFPNGH
                     RRTSSTSILNSPSELPGGKLRGNTSKHSTTGSPAIGIGLSSRPIGRSDSSSIRSFSPE
                     RGFSIDESGMSRIRKDVKPSDSSNILSFNDSEQLNQPRFKSLLSPSTPGAPTAACSTL
                     TPTTTTTTTTATTPSLVSHQRIMPNRVIFQRTNSSEVSVGETDRLQAVSRVNSVRYRR
                     RSGRQSSGTGTEKIGCNMDILLCEPIPIHRYRIIKDLESLGCTVIAASGADELVSRAD
                     AEITFDLIITTLKLPNVSSTELIRLLKFTNGTNSATPIVALTSYYEEAMNSNVFDYVL
                     EKPLQMKDIRNLISKYALRKSQRDEFSLLSDNEDIRLSR"
     gene            <735232..>736188
                     /gene="NDAI0G03120"
                     /locus_tag="NDAI_0G03120"
                     /db_xref="GeneID:11495589"
     mRNA            <735232..>736188
                     /gene="NDAI0G03120"
                     /locus_tag="NDAI_0G03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671284.2"
                     /db_xref="GeneID:11495589"
     CDS             735232..736188
                     /gene="NDAI0G03120"
                     /locus_tag="NDAI_0G03120"
                     /inference="similar to DNA sequence:INSDC:YFL031W"
                     /note="similar to Saccharomyces cerevisiae HAC1 (YFL031W);
                     ancestral locus Anc_8.36"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671332.2"
                     /db_xref="GeneID:11495589"
                     /db_xref="GOA:G0WE78"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:G0WE78"
                     /translation="MSNNIINPTAFNAPIEIPTDFKSTLPPRKRAKTKEEKEQRRIER
                     ILRNRKAAHQSREKKRLHLKFLEQKCQIMENLLSRIDADVLQNLVATDSTGTSILEEY
                     NNILNTTDESYVEDKLNPSSSSSSPSATVNNGSPSTFQTTFDAGNIEPVAIKKEQTTE
                     TDLSAAIGSSLSSFSSSNSNSSSNSDSKSSCASPSSIMSPVSNGTMEDELFFDEKENY
                     YTSSSSISSINMIKSEPQDWNLLITKSEHDNSILEDFNIEHEFEYNEHSFSDQLLTKT
                     VDVEESLMKPKTIPNMTVLMKNDDIDGSFVLDNWRNPAVITI"
     gene            <737614..>738795
                     /gene="NDAI0G03130"
                     /locus_tag="NDAI_0G03130"
                     /db_xref="GeneID:11495590"
     mRNA            <737614..>738795
                     /gene="NDAI0G03130"
                     /locus_tag="NDAI_0G03130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671285.2"
                     /db_xref="GeneID:11495590"
     CDS             737614..738795
                     /gene="NDAI0G03130"
                     /locus_tag="NDAI_0G03130"
                     /inference="similar to DNA sequence:INSDC:YFL030W"
                     /note="similar to Saccharomyces cerevisiae AGX1 (YFL030W);
                     ancestral locus Anc_8.37"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671333.2"
                     /db_xref="GeneID:11495590"
                     /db_xref="GOA:G0WE79"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR024169"
                     /db_xref="UniProtKB/TrEMBL:G0WE79"
                     /translation="MYGRIFPNLFTRRTYHKMTTGKQILLVPGPVTLSPQVQTALSQD
                     ALSHTGAEFVSIFQNVLKNTRKLFKSYDMKAQPIVIAGSGTLGFDIAGSNLIKPKDKV
                     LVLSTGFFSDSFADCLQGYGAEVTKLTAPLGDVVPLQDFEDELKKGHYTAVVATHVDT
                     STGVLNDIESISEVVQRISPESFLFVDSVCAIGCETMEFDKWKVDYCLTASQKAIGAP
                     PGLSISMISERALQFALGKRNNSGVFFTSLKRWSPILKAYEGNLGAYFATPPTQLINS
                     LDVALKQILETEGGIDGRVLKHKETSDWFKDRLCKELNLKLVSKYPSNVSAHGLTSIY
                     VPNPKETILSLKERGFIIAGGLHKEIASQYIRIGHMGVSACDDELNHIPKCFKALKDV
                     L"
     gene            <739603..>741012
                     /gene="NDAI0G03140"
                     /locus_tag="NDAI_0G03140"
                     /db_xref="GeneID:11495591"
     mRNA            <739603..>741012
                     /gene="NDAI0G03140"
                     /locus_tag="NDAI_0G03140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671286.2"
                     /db_xref="GeneID:11495591"
     CDS             739603..741012
                     /gene="NDAI0G03140"
                     /locus_tag="NDAI_0G03140"
                     /inference="similar to DNA sequence:INSDC:YLR058C"
                     /note="similar to Saccharomyces cerevisiae SHM2 (YLR058C);
                     ancestral locus Anc_8.38"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671334.2"
                     /db_xref="GeneID:11495591"
                     /db_xref="GOA:G0WE80"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019798"
                     /db_xref="UniProtKB/TrEMBL:G0WE80"
                     /translation="MPYALSEAHKKMVMSHLSETDPELEQIIKAEIDRQKHSIVLIAS
                     ENFTSTSVFDALGTPLSNKYSEGYPGARYYGGNEQIDKIELLCQARALKAFNLTADKW
                     GVNVQTLSGSPANLQVYQAIMRPHDRLMGLYLPDGGHLSHGYATENRKISAVSTYFES
                     FPYRVNQETGIIDYDTLEQNAILYRPKVLVAGTSAYCRLIDYKRMREIADKCGAYLMV
                     DMAHISGLIAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRRGLRSVNAKTGKEIY
                     YDLENPINFSVFPGHQGGPHNHTIAALATALKQVDTPEFKEYQQLVVKNAKTLELEFK
                     KLGYKLVSNGTDSHMVLVSLREQGIDGARVDYVCDKANIVLNKNSIPGDKSALVPGGI
                     RIGAPAMTTRGMGEEDFQKIAQYIDKAVQLAKEVQQSLPKDANKLKDFKAKIDEGSDV
                     ITNIKQEIYQWAGEYPLAV"
     gene            complement(<741321..>742463)
                     /gene="NDAI0G03150"
                     /locus_tag="NDAI_0G03150"
                     /db_xref="GeneID:11495592"
     mRNA            complement(<741321..>742463)
                     /gene="NDAI0G03150"
                     /locus_tag="NDAI_0G03150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671287.2"
                     /db_xref="GeneID:11495592"
     CDS             complement(741321..742463)
                     /gene="NDAI0G03150"
                     /locus_tag="NDAI_0G03150"
                     /inference="similar to DNA sequence:INSDC:YFL029C"
                     /note="similar to Saccharomyces cerevisiae CAK1 (YFL029C);
                     ancestral locus Anc_8.40"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671335.2"
                     /db_xref="GeneID:11495592"
                     /db_xref="GOA:G0WE81"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G0WE81"
                     /translation="MVKLSDLPISERKLLKSTKTARIYNVQDKYAVKSLATDYVVPPH
                     NPRYELAIMKKILRLGDFRNAHLIELLDHSKRQDELELLLLFYPSTLDEFMIKNYKPS
                     YGNDLKPTRRKFNPYYSLTKSPMEEQEIEPYNMVYENYFDINQYSYGFFLQLVEGLTY
                     LHSHGIIHRDIKPQNILLEMNGEDNIQLIITDFGISYDETDSKQVVTERPDDKITDVS
                     TSFYKAPELLFGVKNYRFEVDIWALLVLVSQWFQVSTNIENFAPAMFDDGSNVLESGS
                     DIRLIMSIFEKLGIPSIEKWEDVSRYGSRDAFTGMFGEEGDGNYILDQSEDIQRSIVL
                     EKLMPRLKQLIDRDQREKFVTCIMNIVSFASEKRWSSQRILAELRS"
     gene            complement(<744284..>745141)
                     /gene="NDAI0G03160"
                     /locus_tag="NDAI_0G03160"
                     /db_xref="GeneID:11495593"
     mRNA            complement(<744284..>745141)
                     /gene="NDAI0G03160"
                     /locus_tag="NDAI_0G03160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671288.2"
                     /db_xref="GeneID:11495593"
     CDS             complement(744284..745141)
                     /gene="NDAI0G03160"
                     /locus_tag="NDAI_0G03160"
                     /inference="similar to DNA sequence:INSDC:YFL028C"
                     /note="similar to Saccharomyces cerevisiae CAF16
                     (YFL028C); ancestral locus Anc_8.42"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671336.2"
                     /db_xref="GeneID:11495593"
                     /db_xref="GOA:G0WE82"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WE82"
                     /translation="MAEFAVEVDNLTYKFAEATKPSVIDIKLQIPWNKRTLVVGANGA
                     GKSTLLKLLSGKHLCLNGKIRVNGLDPFSPLSMHQEEVNSEEKDWQVTTYLGTEWCHM
                     SIINRDIGVLELLESIGLNHFKERGEKLIEILDIDTNWRMHRLSDGQKRRVQLAMGLL
                     KPWKVLLLDEVTVDLDVIARSRLLQFLKWETETRKCSVIYATHIFDGLAKWPDKVIHV
                     KDGRIVSQLNYTKDVEFCNEIDGNTNGHVTFHSSTNQPHISITRVNSLHPLALAWLRE
                     DTGVSNEEI"
     gene            complement(<745611..>747170)
                     /gene="NDAI0G03170"
                     /locus_tag="NDAI_0G03170"
                     /db_xref="GeneID:11495685"
     mRNA            complement(<745611..>747170)
                     /gene="NDAI0G03170"
                     /locus_tag="NDAI_0G03170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671289.2"
                     /db_xref="GeneID:11495685"
     CDS             complement(745611..747170)
                     /gene="NDAI0G03170"
                     /locus_tag="NDAI_0G03170"
                     /inference="similar to DNA sequence:INSDC:YFL027C"
                     /note="similar to Saccharomyces cerevisiae GYP8 (YFL027C);
                     ancestral locus Anc_8.44"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671337.2"
                     /db_xref="GeneID:11495685"
                     /db_xref="GOA:G0WE83"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:G0WE83"
                     /translation="MVNLTSFYLPMPIKVSNKMTADPMPMENVFDARTLVTYFNMREK
                     QDMKQKLIQRVLEANDYHTLGKLGSTVFGFINHPLRREAWRQLLYEQLTIYDDEDKDP
                     ELLSVKQHKDENQVMLDVKRSFGTLKDERLKERLRDILYSTIVKVLRKYPQLNYYQGY
                     HDLVSVFIMVFIESYPFVKTTSFLTPLDARIRGDTDPIQNTDTQTSSSGISKDNKIVD
                     EEQLFGCVERFTLLYLRDFMMNCLDFSLDQLQIIPQLMRMMDIDLFSKLHFDSINPFF
                     AISAILTIFSHDLKPWEDGSSNGTIFQIFDLVISKQSMLVPLFIYANIILEKKQLLLE
                     AYECNQDNFENTVDLVHGIIQQVLMIPSSNDNDADDNKFWRKILKISQDMSIIDDYNG
                     WQTIIHPQSVLLTTASGEGTIKQYNIEEVLCLLGKQIEINEAYKNVPINDKPSCYYGK
                     SESTCLNCAALYSGSFIKLSILIGIFAILLRFTGRNTFKNKMGFMFPDFSKYSSLNYI
                     LSMINTYKTEE"
     gene            <748083..>749516
                     /gene="NDAI0G03180"
                     /locus_tag="NDAI_0G03180"
                     /db_xref="GeneID:11495595"
     mRNA            <748083..>749516
                     /gene="NDAI0G03180"
                     /locus_tag="NDAI_0G03180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671290.2"
                     /db_xref="GeneID:11495595"
     CDS             748083..749516
                     /gene="NDAI0G03180"
                     /locus_tag="NDAI_0G03180"
                     /inference="similar to DNA sequence:INSDC:YFL026W"
                     /note="similar to Saccharomyces cerevisiae STE2 (YFL026W);
                     ancestral locus Anc_8.45"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671338.2"
                     /db_xref="GeneID:11495595"
                     /db_xref="GOA:G0WE84"
                     /db_xref="InterPro:IPR000366"
                     /db_xref="InterPro:IPR027458"
                     /db_xref="UniProtKB/TrEMBL:G0WE84"
                     /translation="MSSSTDVPQLSQYFFDSNYNPGQSLISYTSIYGNDTVVSFDEVQ
                     TIVDKKITEAIMFGVRCGAVILTIIVMWMISKKKKTPIFIINQISLFLILLHSALYFR
                     YLLSNYSSVTYALTGFPQFIHRGDVHIYGAASIIQVLLVASIETSLVFQVKVIFTGDN
                     FKRIGRVVMGISIALGLATVAMYFVAAIKGMISTYNNVGGTQPKYFNVATILLASSIN
                     FMTLILVIKLILAIRSRRFLGLKQFDSFHILLIMSCQSLLAPSILFILAYSLNPNDGT
                     DVLVTVATLLVVLSLPLSSMWATAANNASRPTSAGSDYSPSTGFYDNSRSSAMSQSLH
                     SEGKKSFKSRLYNLYPTRSSDKSSEHTFVDHQDLEKNDLYELSTPITQTNPNGIQLSN
                     YRSKMVNNEMDYLADIYTPNTAADENARKFWSEGNGDDFDSISKESSELTHELHPDIV
                     KMAAGNNEGDDEFLETKKITLKNIAPK"
     gene            complement(<749585..>752743)
                     /gene="NDAI0G03190"
                     /locus_tag="NDAI_0G03190"
                     /db_xref="GeneID:11495596"
     mRNA            complement(<749585..>752743)
                     /gene="NDAI0G03190"
                     /locus_tag="NDAI_0G03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671291.2"
                     /db_xref="GeneID:11495596"
     CDS             complement(749585..752743)
                     /gene="NDAI0G03190"
                     /locus_tag="NDAI_0G03190"
                     /inference="similar to DNA sequence:INSDC:YFL025C"
                     /note="similar to Saccharomyces cerevisiae BST1 (YFL025C);
                     ancestral locus Anc_8.46"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671339.2"
                     /db_xref="GeneID:11495596"
                     /db_xref="GOA:G0WE85"
                     /db_xref="InterPro:IPR012908"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0WE85"
                     /translation="MGVRKLLAGLSRNVLIPYGLSNSRESSTSPSDSNATLRKKEPKD
                     SKSRNANIEKILTHGSKNVKIVTLLGSFFIILITLVTLFRPFSGADLPQCQGIYMYPS
                     YARIDGFDTRYTPLAKKYHLYLYREQGKDKIPANNTHIKLDGIPVLFIPGNAGSFRQV
                     RSIASACANKYFDSPNEIMKENAKNLDFFAADFNEDYTAFHGGTMLDQAEYLNDAIRY
                     ILELYEQTNGFDGRPIPKSVLILGHSMGGMVARVMPTLRNHIHGSINSIITLSTPHGA
                     APVTFDGDILKIYKKTNDYWRAQYADKDSFFSKHVSLISITGGILDTVLPADYAMVSD
                     LIPPENGFTTFTTTIPGVWTPIDHLAIVWCKQLREVIATLLLETVDDSVPDKTVSLEE
                     RMHISKKLLLSGFEDYSMNEKAILNPSTYGKIMDTDFSMGMNLINLDDQFTITKENID
                     STEAYSKIFIPTEGDNFSFTLLTSLANPKVRFCKEHVIIKNIKDLKCASITDDISVIP
                     NSFSINSYAADSSFANEQSPFKMLSYDKDILSQYDFIIIEKPNELDDDSDFLTAILTM
                     APTSRTIPIKPRNVMFFGHTISLNTNTLAVEELELPELWDSLISYKIQASVENTKEKP
                     LLFEPLIRQSVDEPFETKWHLGLGKDDIDVSVHNVAPFIPLNETKPRPIRLSVIMPPN
                     INVHLKLKINWLLTIKLLFIRYRLAIASFPIFIIALAMAYQFHHYNETAIFLSFHSSL
                     SYIIQEWGFFLLFVLFILSPIVNNRTVQRILYLLDPLKLNRPFLLEKEHIHANFYYLG
                     IQEWFASGLGTIFGLMSFALLYVLAAGLALIEKSVHYFSKNRPEGLVEATTPNCPPMD
                     TKLFQKKHIIPGILLNIMVISYIPYQLAFIMLFLAQVVICIKIGYMKKCRDYANIRNY
                     NMSILVLFLFVSIIDAPIIIVFLHNVGIRWETSFRSHHNILSVTPIILLVCSNANLNI
                     PSRVSSNSFDGKVTIALLLYSGIFSLIYGLRNLYWVHDLLNIISAWLFYSILRNRLMQ
                     NKPKELTNDTDNSTYEMNRLSD"
     gene            complement(<753344..>755788)
                     /gene="NDAI0G03200"
                     /locus_tag="NDAI_0G03200"
                     /db_xref="GeneID:11495597"
     mRNA            complement(<753344..>755788)
                     /gene="NDAI0G03200"
                     /locus_tag="NDAI_0G03200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671292.2"
                     /db_xref="GeneID:11495597"
     CDS             complement(753344..755788)
                     /gene="NDAI0G03200"
                     /locus_tag="NDAI_0G03200"
                     /inference="similar to DNA sequence:INSDC:YFL024C"
                     /note="similar to Saccharomyces cerevisiae EPL1 (YFL024C);
                     ancestral locus Anc_8.47"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671340.2"
                     /db_xref="GeneID:11495597"
                     /db_xref="GOA:G0WE86"
                     /db_xref="InterPro:IPR019542"
                     /db_xref="InterPro:IPR024943"
                     /db_xref="UniProtKB/TrEMBL:G0WE86"
                     /translation="MPSKPPQANKTKAAKNNVNNNKNNSKSNVAGAARFRHRKISVKQ
                     QLRIYKHTDIRNLDEDELQQREVADVETGVEKSEEKEVHLHHILQLGSSQINSVKKKY
                     IPTPDASLKWKDYAQFYVGKFSEPKSYIEFSATVEDCCGASYNMDEKDENFLNDVVNN
                     KENAEKLSEDEFEILCTCFENAIHERQPFLSMDPESILDFNELKPTLLKADFGDSGLR
                     AQLATELGYSSNEKFITQFDSKSQSNTRSLPILIEKYGTQIYDYWKARKIEVEGKEIF
                     PQLKFERPGEKEEVDPYVCFRRREVRHPRKTRRIDVINSQKLRLLRQELEHAKELALL
                     VARREKISSDLLHDDMAILKERSELKKLKRSLNISGEDEDLINHKRKRPAVLTIERKR
                     MEAEAFAARNAALQAAAAKSVASDVAAKKSNKNKISKNKLEQLSKSGQKLTKQQLLLL
                     RAQKNADIKLEDEQLLTDKQDQQHQQQKQQQQNGIHVYVKLPSSKVPDLVLEDVDNLL
                     SDKENNARKFVRERMEKRRQEDANNFFNLTDDPYNPIFDISLPGEISPSSEPFSSISS
                     SRFEITRSYYTPHLADYLSGTAKDIKLFGKEGEKITQNANNLKKTELYDPFRPKKEIN
                     SQEYPVKFRSRIGRLGIQYIDRKPNIKLDDIDNMMDEVFDFQSISKQENDKRSDGEAI
                     NVYDSKLDELVRTYDKWHYDSLSNDYGLKFSDEPSRLNQIPNETQAIRFGTMLGSKAY
                     EQLREATFRCRREYIQKMRQQKLNNQNQIKSQQIPNGTAPLPPLGTPSVQPSQLSSKS
                     NTPNPSSNSTSVIYRN"
     gene            <756459..>759083
                     /gene="NDAI0G03210"
                     /locus_tag="NDAI_0G03210"
                     /db_xref="GeneID:11495598"
     mRNA            <756459..>759083
                     /gene="NDAI0G03210"
                     /locus_tag="NDAI_0G03210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671293.2"
                     /db_xref="GeneID:11495598"
     CDS             756459..759083
                     /gene="NDAI0G03210"
                     /locus_tag="NDAI_0G03210"
                     /inference="similar to DNA sequence:INSDC:YFL023W"
                     /note="similar to Saccharomyces cerevisiae BUD27
                     (YFL023W); ancestral locus Anc_8.48"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671341.2"
                     /db_xref="GeneID:11495598"
                     /db_xref="GOA:G0WE87"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR024325"
                     /db_xref="UniProtKB/TrEMBL:G0WE87"
                     /translation="MDNNVDPLLKSLNHTLESLQSKYDFLAQQRDHYLQIRERLFEVS
                     ERPTVSDEEKQNGVIFGDVIISDNKVFLNIGYEYYIEKSRDEVIEFISDKLRLMEEAM
                     TTFHAKIDEANGTLQNLTTLKKFDEQTIGDEEDEDELLPSMEVREELDEEGNVITASV
                     RPATNKNSIKDLESKLMKVVNGNANDDDYKQIHDNKEDSDEENDFVKNLKGKLSVSDK
                     PSISEPPKMTEKYNRIDADSVYTFADLVEQLDEQDEFSDGSIHENDIKYDFESYDTAN
                     GAYSTDEDEDEDDLDISLVPGAMAQSSFMKQIMELRNSRAVSSDKEDLKEEYTQIIAS
                     DNDIVATKSVKENTEQNHKADTHKKSILKSTCKEDELSKSKRNVGFAPELNVIEVENF
                     KEETRKQTHNFPRPQFTAFDNEEIDDDDDDDDNPADFDADLFAQLIGAQPPDEIHDKY
                     KEIVKKEQKIEQDEIIVQEKRKRRVSRFKMDRSSTDVKTSQDVPSQDSCAKNKLNEPE
                     PLVGDIIDKDDENEDDDEEIVVNEDIVENDLEGNDEVVKDYIIEKVIEDEIIENNNEA
                     MLDVVAKDGDKNDLKAATQTKKGNSFFSKKMNSLRKPISSLKNSANSKIKMEELLASI
                     NDDEDNINDKEVTDDEQHVCNHSHEGNKKVTSKINEISRTDLKTIDKNESSFPKDIVD
                     AIRKREEELEKNGKIANIDYMTLGENIDDMTKAYSLGLYDDDLEDDPGAILEKVEDFT
                     EYNKHVEELKDEIKEFQLSNPIVEKNVNGNKEDRLAEKEVDESAMMVDVIEHDIPDDY
                     SSDGDDSDADFGLQQEKLHESISIEYQRLKEQLLSKMESEGKVNIRWNEPQELEPIDE
                     FGNLVKTSKFKSQRSLFN"
     gene            <759645..>760682
                     /gene="NDAI0G03220"
                     /locus_tag="NDAI_0G03220"
                     /db_xref="GeneID:11495599"
     mRNA            <759645..>760682
                     /gene="NDAI0G03220"
                     /locus_tag="NDAI_0G03220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671294.2"
                     /db_xref="GeneID:11495599"
     CDS             759645..760682
                     /gene="NDAI0G03220"
                     /locus_tag="NDAI_0G03220"
                     /note="ancestral locus Anc_8.49"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671342.2"
                     /db_xref="GeneID:11495599"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:G0WE88"
                     /translation="MKAKEEDVHKMQIQQLNSINIWETDFSTVPTWQDAPNVEYFFNP
                     KSPNSNIFIEENQDYHNDFLQDSLENKRNFILENHVTEEILSPLEFPIKLSNVETSTE
                     DFNDSDAEEFPENELLNGLSAAKERIEQMIFNIDSQVLNKGAYTHIQREVFDPSILCL
                     LECIESFNRGTSLPSVEDTTRRPLNDNDVLPDEDPCANLPNYGVILIKSPSSASQLWD
                     EYVKIPSELAVNDVVACILNLKKEIAVNSNDSTMLNLELIMKRKSSIKMLEERLGSSW
                     RNKDKNFSRQINRRKKIWKSIEEGLRDGVPLHDCFDILDRYVQKSHKGLSLYYNGVPF
                     RIKDLQNEFLF"
     gene            complement(<760895..>762394)
                     /gene="NDAI0G03230"
                     /locus_tag="NDAI_0G03230"
                     /db_xref="GeneID:11495600"
     mRNA            complement(<760895..>762394)
                     /gene="NDAI0G03230"
                     /locus_tag="NDAI_0G03230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671295.2"
                     /db_xref="GeneID:11495600"
     CDS             complement(760895..762394)
                     /gene="NDAI0G03230"
                     /locus_tag="NDAI_0G03230"
                     /inference="similar to DNA sequence:INSDC:YFL022C"
                     /note="similar to Saccharomyces cerevisiae FRS2 (YFL022C);
                     ancestral locus Anc_8.52"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671343.2"
                     /db_xref="GeneID:11495600"
                     /db_xref="GOA:G0WE89"
                     /db_xref="InterPro:IPR002319"
                     /db_xref="InterPro:IPR004529"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:G0WE89"
                     /translation="MSDFQLQILKKLAELNEIKSTAQVFPEKNSQEVLAALSSLNAHS
                     KLNYVKSENIAYDLSNEGKDIIANGSHEMKLLSLVKELGKLQIKDVMSKMGADGKVGQ
                     ARAFKSGWIVKNKENELEVSDKFKSQPLDTIEDETKILLQKIVDGETLDTKTINDLKK
                     RKLITPRKLTDYSVTKGPDFSLELAKLETDITSEMVATGSYKDLKFKAYNFNSQGVNV
                     SSGALHPLNKVREEFRQIFFSMGFTEMPSNQYVETGFWNFDALYVPQQHPARDLQDTF
                     YIKDPLTADLPEDKTYISNIKAVHENGKFDSIGYRYNWKEEECQKLVLRTHTTAISAR
                     MLHDLAKDPKPTRLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEEF
                     FAKMGVTGLRFKPTYNPYTEPSMEIFSWHEGLGKWVEIGNSGMFRPEMLESMGLPKDL
                     RVLGWGLSLERPTMIKYKVQNIRELLGHKVSLDFIETNPAARLDEDLYE"
     gene            complement(<762846..>763523)
                     /gene="NDAI0G03240"
                     /locus_tag="NDAI_0G03240"
                     /db_xref="GeneID:11495601"
     mRNA            complement(<762846..>763523)
                     /gene="NDAI0G03240"
                     /locus_tag="NDAI_0G03240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671296.2"
                     /db_xref="GeneID:11495601"
     CDS             complement(762846..763523)
                     /gene="NDAI0G03240"
                     /locus_tag="NDAI_0G03240"
                     /inference="similar to DNA sequence:INSDC:YLR052W"
                     /note="similar to Saccharomyces cerevisiae IES3 (YLR052W);
                     ancestral locus Anc_8.53"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671344.2"
                     /db_xref="GeneID:11495601"
                     /db_xref="UniProtKB/TrEMBL:G0WE90"
                     /translation="MNPTELEFQRLLAEDKQVQYAYHAIKKYKNDLKPDLTSLDKDQN
                     TKRHIMNIDDVSKINYEVIKTVPGTFIATASREEQDINALKATVFKDDLFRMNDKFAA
                     SINGRVEEIPNLKVEEDEVIEGDSEVDLLFEKIGWLTKIQTNLINEYKNELNEERKWF
                     TLNEIVLDANAELDLFSVKNRNRKRTKGAIDLGAAEVATQSFSSTLAFNRPKRRKVAP
                     GKISNVV"
     gene            <766494..>767987
                     /gene="NDAI0G03250"
                     /locus_tag="NDAI_0G03250"
                     /db_xref="GeneID:11495602"
     mRNA            <766494..>767987
                     /gene="NDAI0G03250"
                     /locus_tag="NDAI_0G03250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671297.2"
                     /db_xref="GeneID:11495602"
     CDS             766494..767987
                     /gene="NDAI0G03250"
                     /locus_tag="NDAI_0G03250"
                     /inference="similar to DNA sequence:INSDC:YFL021W"
                     /note="similar to Saccharomyces cerevisiae GAT1 (YFL021W);
                     ancestral locus Anc_8.55"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671345.2"
                     /db_xref="GeneID:11495602"
                     /db_xref="GOA:G0WE91"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="UniProtKB/TrEMBL:G0WE91"
                     /translation="MPESTLTNILKLQESEKNGREELNKTVKKSRGLSEDTDEAIWKL
                     YSGAKTILPYKERILNFAWRSMNSPYKRAKVNSSLDFLQKNSMEFIQMNPNRTDIFEQ
                     NMDNMSEYDQKDQNNGNINTINGTVHFGSFSNDPVNIISNSFSSNVFDYPFQDEYIDF
                     NSKNAFTDPLVAESPALKSDISSTLLENERDNINNIPDLLNRTTSGQEQRELSDFQTS
                     NSHFSLENTANSLQGFTPSTWNHKARYIDSINNKSNLNDISSHFSLTEHYLNDPSPIQ
                     IPSRPSTSLRQPIPINPQSHSQTTFLNATFTPTSLPTLSGLNNSTRKRRDQSIRKRQP
                     SIGTSLKKNSNTSLSSLMNNYNTTTDNKTSIRCNNCGTGTTPLWRKDPNGNSLCNACG
                     LFLKLHGVMRPLSLKTDVIKKRQRGSKNGLNVSKKNSTANLRENITNTGDIDRRRKRN
                     STQYSGVDSTFARNDDNCNHPSLVGSLPINVVEGQNPVNLDWLSLDI"
     gene            <768527..>768757
                     /gene="NDAI0G03260"
                     /locus_tag="NDAI_0G03260"
                     /db_xref="GeneID:11495603"
     mRNA            <768527..>768757
                     /gene="NDAI0G03260"
                     /locus_tag="NDAI_0G03260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671298.2"
                     /db_xref="GeneID:11495603"
     CDS             768527..768757
                     /gene="NDAI0G03260"
                     /locus_tag="NDAI_0G03260"
                     /inference="similar to DNA sequence:INSDC:YFL017W-A"
                     /note="similar to Saccharomyces cerevisiae SMX2
                     (YFL017W-A); ancestral locus Anc_8.57"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671346.2"
                     /db_xref="GeneID:11495603"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:G0WE92"
                     /translation="MVSTPELKKYMDKKILIQLNGSRKIAGILRGYDIFLNVVIDDAV
                     EVSADGSKHQLGIQTVIRGNSIVALEALDTIA"
     gene            complement(<768935..>769405)
                     /gene="NDAI0G03270"
                     /locus_tag="NDAI_0G03270"
                     /db_xref="GeneID:11495604"
     mRNA            complement(<768935..>769405)
                     /gene="NDAI0G03270"
                     /locus_tag="NDAI_0G03270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671299.2"
                     /db_xref="GeneID:11495604"
     CDS             complement(768935..769405)
                     /gene="NDAI0G03270"
                     /locus_tag="NDAI_0G03270"
                     /inference="similar to DNA sequence:INSDC:YFL017C"
                     /note="similar to Saccharomyces cerevisiae GNA1 (YFL017C);
                     ancestral locus Anc_8.58"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671347.2"
                     /db_xref="GeneID:11495604"
                     /db_xref="GOA:G0WE93"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G0WE93"
                     /translation="MTLPEGYKIRRIEKKDYEGVVETLAVLTTVGNLTREQFESIVDY
                     WNSVQMYHDKSIYKYNPSVIVDVNTDEVAAVGNIILEQKLIHEGGICGHIEDIAVSKN
                     HQGKKLGKALLGYLSDLGFQSGCYKIILDCNEKNVKFYEKCGYSTTAIEMQKRK"
     gene            complement(<769822..>771480)
                     /gene="NDAI0G03280"
                     /locus_tag="NDAI_0G03280"
                     /db_xref="GeneID:11495605"
     mRNA            complement(<769822..>771480)
                     /gene="NDAI0G03280"
                     /locus_tag="NDAI_0G03280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671300.2"
                     /db_xref="GeneID:11495605"
     CDS             complement(769822..771480)
                     /gene="NDAI0G03280"
                     /locus_tag="NDAI_0G03280"
                     /inference="similar to DNA sequence:INSDC:YFL016C"
                     /note="similar to Saccharomyces cerevisiae MDJ1 (YFL016C);
                     ancestral locus Anc_8.61"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671348.2"
                     /db_xref="GeneID:11495605"
                     /db_xref="GOA:G0WE94"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:G0WE94"
                     /translation="MSYLNKMKLLSTIIGRSYSSSSSSIVPSFSLLLLNNTADRGTPS
                     TSSSSSSSSSSTRIRPYTHRKHFHSSSIRNQEIKDPYSVLGVNNSASTSEIKKAYYKL
                     AKKYHPDINKQPDAEKKFHDLQNAYEILSDENKRKQYDTFGPSAFQDAQQGGAGGPGG
                     GPGGFPGGYPFGQTSSGSGNPFADFGINFEDLFGAAFGNGPHATGGGRARRQSNIYRE
                     FKGDPIEIVHNLNFKDAVFGVQNVNLKFNSMDPCNKCSGSGLNRNAKRTTCPSCHGSG
                     QKVHIRSGFQMVSTCNHCHGEGTIIDSKDICSSCHGDGVELNHNKSIDVNLPNGLQDG
                     DVIRVPGQGNYPQTGASIDPAMMNSIKLSRGDLLVRVRVNKDPNFSIRDKYDIWFTKQ
                     IPITTAILGGVVKIPTVDGTQIRLKVSPGTKHDQIISIPNLGVPRSSINKDNRGNMKV
                     QYKIIMKTPQSQAEKCLWEALADVTNDTMAKRTIEHNPISGGGGTTSEGTTTNDNKKD
                     ETSSKSNDTYIDPTKNNPDEPSALGRLEKFISNAFKKIKGDKNA"
     gene            <773193..>773519
                     /gene="NDAI0G03290"
                     /locus_tag="NDAI_0G03290"
                     /db_xref="GeneID:11495606"
     mRNA            <773193..>773519
                     /gene="NDAI0G03290"
                     /locus_tag="NDAI_0G03290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671301.2"
                     /db_xref="GeneID:11495606"
     CDS             773193..773519
                     /gene="NDAI0G03290"
                     /locus_tag="NDAI_0G03290"
                     /inference="similar to DNA sequence:INSDC:YFL014W"
                     /note="similar to Saccharomyces cerevisiae HSP12
                     (YFL014W); ancestral locus Anc_8.62"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671349.2"
                     /db_xref="GeneID:11495606"
                     /db_xref="GOA:G0WE95"
                     /db_xref="InterPro:IPR007250"
                     /db_xref="UniProtKB/TrEMBL:G0WE95"
                     /translation="MSDPGRKDFSQKIGETVKPDSEKSTWEKGKETVTDTTDKLAGKL
                     QPEENKGLGQGINDSAESGKDKANGESVADQAKDYYEGAKQKLNDAVEYVSKSVHGGD
                     ADPANK"
     gene            complement(<773833..>776274)
                     /gene="NDAI0G03300"
                     /locus_tag="NDAI_0G03300"
                     /db_xref="GeneID:11495607"
     mRNA            complement(<773833..>776274)
                     /gene="NDAI0G03300"
                     /locus_tag="NDAI_0G03300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671302.2"
                     /db_xref="GeneID:11495607"
     CDS             complement(773833..776274)
                     /gene="NDAI0G03300"
                     /locus_tag="NDAI_0G03300"
                     /inference="similar to DNA sequence:INSDC:YFL013C"
                     /note="similar to Saccharomyces cerevisiae IES1 (YFL013C);
                     ancestral locus Anc_8.64"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671350.2"
                     /db_xref="GeneID:11495607"
                     /db_xref="UniProtKB/TrEMBL:G0WE96"
                     /translation="MGGRVYDPIHDIFQDTIEKTPSSSSNQNEKLPITIPTSTSNVKT
                     TSNISQPSSSTITSSHSQMLALSNKNKTSNVGNILNNTHNDNDSETTQSDEDGISSVM
                     SAAPSHLLNFKPSIIKPWVKTTEKKLKNSTKYTRHLKKLDGEFFTRKDIQFHFLTLLL
                     QDERLLFTNIFKQFFKNSIVPIPNTTNKKVLNVTDKLYDARKFIFNDKLTFSQLYLLT
                     IATSSKCSKILRDKLLIDPQIAFSTCILSLLVNIGKLNTTINFYVEMTSQLRTFHSVP
                     SLQCHSTDPKSLQDTPRLKSILKNLPLGNQPIFLQDLYRFKHPGGGYPTEHFNIINLL
                     FCLCDNVELIKMKLLTEKYIDCENYDNATFFNLLDCSYFNPMDRCNVILWLIYLHLET
                     SLTKEEIWESTKYFTGNGKPGRISLQSSKFEYDTDPIDEYQFGVDQQLKRSQFLSKLN
                     DQKKQEQGEKEGGESQPEAENNILLKKKTTKSVHNQDNEDGDEDEDVHEDEDDATNDE
                     SMLKQPEQEKAQPLSSSSFERVIPTDFQNATMPMVTIPETVTRKRKLKQKNIDDKDDS
                     EKLSSAMQKKNAKDSTSIHFLTNNNDEDDDTMNDTSIKTNTADDSHEKIPQETQGKKP
                     TRKYKKNRKKRRVVSTATNDVKKTIVDTGGVELTPEDEEEIMAIIRKRQNEKNNLQLN
                     KINKLIEFDRNKLINLGIAGAGDGDDKFKKQDEFIHDLLESHKLVRFKRKEIGLIKIF
                     NEFEDVPMASGIGIRGKRRRKFKDSLLGFETDYLRDLQIGKRKLLEKYCSLKENDDKN
                     IPRTVNDTNDTMFKL"
     gene            complement(<777538..>780195)
                     /gene="NDAI0G03310"
                     /locus_tag="NDAI_0G03310"
                     /db_xref="GeneID:11495608"
     mRNA            complement(<777538..>780195)
                     /gene="NDAI0G03310"
                     /locus_tag="NDAI_0G03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671303.2"
                     /db_xref="GeneID:11495608"
     CDS             complement(777538..780195)
                     /gene="NDAI0G03310"
                     /locus_tag="NDAI_0G03310"
                     /inference="similar to DNA sequence:INSDC:YFL009W"
                     /note="similar to Saccharomyces cerevisiae CDC4 (YFL009W);
                     ancestral locus Anc_8.67"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671351.2"
                     /db_xref="GeneID:11495608"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G0WE97"
                     /translation="MNRNTPEYPLRDIPVPYLYRLRRRPRKTDILSTNNHPILQDHSI
                     SSNSSNLAESQNSNGTTKTTNHFQNNNNNNNDSTTNSSEIMGLSFKRSRDSDIRTILP
                     SNSQEQQSNNIINYRTNQNITKKIKNNNNNNNDDDDDDEDDIDDMMSNKRVKLQDLTP
                     SQMMIPIIPTSLNVDTDTVINNNTLPNVSLDTSRTHLTHILVNTANRVAVATTPTTRT
                     NTDGGASLTTVTIMTGTTASNTTTSTTNTVNGYTSLSEDALPLSPTATSGMNTPRTQH
                     HESTESDDCDMIVDTNGNRNNNNNTTTNNNNALDLNMLVTNTNNNDEYLLTENLYNNL
                     KNQLTPIQYKNLIFKIISNLNRTELSDMNSLLNNNLKRDIISSLPIELSIKILKNLPY
                     QDIFKCLQVCPHWNKIINNTPMLWKNLLLNESFLNNHDNNNTNENNSSQIYKKLFYSN
                     LKVLKNWYNPNFKPQRTTLLGHSTSVVTCLQFEDDYVITGADDRQLRIYDSKKKIFLK
                     ELSGHEGGVWALKYDEDGIIVSGSTDRTVRVWDIKRGCCTHVFKGHTSTVRCLEIVTY
                     KNIKYIVTGSRDNTLHVWKLVREDNRSIDELPLIFNTPEENPYFVGVLRGHMASVRTI
                     SGHGNIIISGSYDNNLMVWDIAQMKCIYLLIGHTDRIYSTIYDHQRKRCISASMDSTI
                     KIWDLENIWNNGVCSVVTISATPCTRINGPMMTLQGHTALVGLLRLSDKYLVSAAADG
                     SLRGWDSNDYSRKFSYHHNNLSAITTFFMNDNILVSGSEGQFNIYNLRTGSLVHSDLL
                     KDSDQIWSVNFKGSLLVAAVEKDGESYIEMLDFNIPERSASPLQRQQLFQEQEDGEIN
                     HHSSNNQSNTNIDSMSIIMDSNSNSNSNI"
     gene            <781468..>785163
                     /gene="NDAI0G03320"
                     /locus_tag="NDAI_0G03320"
                     /db_xref="GeneID:11495609"
     mRNA            <781468..>785163
                     /gene="NDAI0G03320"
                     /locus_tag="NDAI_0G03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671304.2"
                     /db_xref="GeneID:11495609"
     CDS             781468..785163
                     /gene="NDAI0G03320"
                     /locus_tag="NDAI_0G03320"
                     /inference="similar to DNA sequence:INSDC:YFL008W"
                     /note="similar to Saccharomyces cerevisiae SMC1 (YFL008W);
                     ancestral locus Anc_8.68"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671352.2"
                     /db_xref="GeneID:11495609"
                     /db_xref="GOA:G0WE98"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR024704"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028468"
                     /db_xref="UniProtKB/TrEMBL:G0WE98"
                     /translation="MGRLSGLELNNFKSYKGITKVGFGDSNFTSIIGPNGSGKSNMMD
                     AISFVLGVRSSHLRSNIVKDLIYRGVINDNGDTNEHGKVTSAYVKAFYEKNTADDGDN
                     DDDDDERPVELMRAISTNGDTTYKINGKTVTYKEYSEFLERENILIKAKNFLVFQGDV
                     EQIASQSPMDLSKLFEEVSGSIQYKKEYDELKEQIEKLNQSAAESIRNRRRIHGELKT
                     YKEGITKDEEYKNNIEKRKKYYMYLVLWQLYHLENEKKKSLDNLKNAKSEISQLKNKI
                     TNEEKNLQRSKSSFLKENLKVNKKREQLNYQLKEKDKLLEDLNSIKIPQRAASKRINN
                     IEKRIESIQKDIERQQGYINTFENQLKVVTKAKESFEREIKESAQNSNKYSLSDDDLK
                     LYESLNEKYLMENGSAIEQQISLLNNDKQEVLEEMDRLNRKIDASKKRITEELLISQE
                     RIQNENIELVSSLNEKNSIFSEKTHELKTLQAEIESSNNQEYDTNYKLRETLLKLDDL
                     NANQRESIKEKKLRENVTMLKRFFPGVRGLVHDLCRPKKDKYGLAVSTILGKNFDSII
                     VDNLNVAQECIAFFKKQRSGTASFIPLDTISSEQPTLNLPSSQDYILTINAIEYDPEY
                     ERAMQYVCSDSIICNSLDIARDLKWNKGVRSKLVTIEGALIHKAGLMTGGISKDSNNR
                     WDKEEYQSLMTLKDKLLLQVEEISTKSRLSSTRARDVEIELSTLNAEISSLRMQLSQV
                     QRSLDENKTEINHQNTLLDQQYNPKLKSLKEKVDEFDKSWNELKSNKEKLQNEIFKEL
                     TDKVGFTIEEYERHSGELLRKQSKELQQLQKEILNIENKLQFEIERLENTQKRLTSAE
                     SNLEKAHETLKSLQKDENELAEQVKQIESEINSARNELDSVNKVFTAQQLDINRMEES
                     LGELNDNSQTLKRNRDEIKEDIAKNDLERIGILKNAKVTNIDIPVISETNLSDLPIDR
                     IDEDTISVSNEIDVDYTALPAKYKEEMGSATKNELDTKIKNVEDLLDVLQPNARAADR
                     FTEAQERFEIIDGETEKIKTTERKALQQFLKIKKKRKELFENAFDFVSEHLDNIYREL
                     TRNPNSSADLAGGNASLTLEDEDEPFNAGVRYHATPPLKRFKDMEYLSGGEKTVAALA
                     LLFAINAYQPSPFFVLDEVDAALDITNVERIAAYIRRHGNPNLQFIVISLKNTMFEKS
                     DALVGVFRQQQENSSKIVTLDLRNYAD"
     gene            <785731..>792108
                     /gene="NDAI0G03330"
                     /locus_tag="NDAI_0G03330"
                     /db_xref="GeneID:11495610"
     mRNA            <785731..>792108
                     /gene="NDAI0G03330"
                     /locus_tag="NDAI_0G03330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671305.2"
                     /db_xref="GeneID:11495610"
     CDS             785731..792108
                     /gene="NDAI0G03330"
                     /locus_tag="NDAI_0G03330"
                     /inference="similar to DNA sequence:INSDC:YFL007W"
                     /note="similar to Saccharomyces cerevisiae BLM10
                     (YFL007W); ancestral locus Anc_8.69"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671353.2"
                     /db_xref="GeneID:11495610"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021843"
                     /db_xref="UniProtKB/TrEMBL:G0WE99"
                     /translation="MSADDIKSPIPLRNKAVAQLISQATPGKRPSSSTDELKSKRALL
                     TSPQQNAADQLRARSITPTLLAEKLFNGLSSEDILKRRLKHYNINYPDDEATYLRSIY
                     DKSSQWFSRDVKPKFEAEKYLPYKTESHKDKARYLCHVLVNLHIAISSLDIQGLLSIT
                     SKDLADLQNEIDDLALNTDLFRLANEIDTNVVDFKEHEDHLDLEVPDSGSTGKITAKS
                     SSIVSVNHWTNELNNCLNFDFPLTLRKSLASVYYYLSLIQGQKIVRSMYVDMFESLVA
                     YDDDGTNFTHLVLEQGLVLDFKIIFDFICQFLPYPDSDYARYDLSSKDDLQLFRLLLK
                     LAHVAKPFFDANDESILKDTMDYLLSNLSPSTTVTLLPILNSFVPYHYHKKNKVTDYL
                     PFCFSLWSSVTAIIAVDTHLYDFVGEVAEDLHKKLMDNVENDNMVKFGKYGLFSEDQM
                     AFMFNRVQGHLRTDGQIHSYSRTVKPFVYSINGSDNTDFFTKFVNLIQSIETFVHPSN
                     NGFWTKPIAKFVHAFIKLYHGRVKDEETAVKKGRSIEIFLSAECHFKFVDILFNILMI
                     GAQNKSNEVANYYISCYAYLLEICPKNSFRIFDRVLVEIYDTLTGEYINSRHRVISSL
                     KQFTRILRFMVVHPLYRIHITNILSLLIDKIDMNDPQLTSNVTNSIVSIATFVPFQNL
                     VREGEYLTFESTTIPFIQEHIMHLKMGQSSDNFETEDSVLDSAFRASTTIFENVIKVY
                     VEKIFSVVDIETDDPLITKLNQTTVLMQEAMDDKVFDYYIDIFQRRFWDNDYFKVKDP
                     NYELTTIPLSAIVRRKNSTSVSLVNTLIYNIKQQVERGAGSIRSSSEIQQRDVKLVLY
                     LTTLNDVLRQSHESLLSYSAKILDFMKFLYEEVSNPPIDVLTSILTHSVLATLNTTEI
                     IDYRLFGNNSTIPDTERWGGLQFDKRKYDKENLDFIWHTPSDQEVKLSIDLLENLTDH
                     CITSLERQMNEPRTDTSYTDKIQKYSLVLTHCLSGISLLIDPDFNKNKTSPPSDISYK
                     DRLTLLKNIRESNCDNQEFDIDIEQIRSTTDEETVHLEDDKKDSAFEHDYNVADLKHS
                     VTDNFIIDDTAPSGLPTGVGTPVAGVNDISSSMNSGIIFRDLDIYTSNYYFGNTVEEK
                     LKNPDYLKVHQIRAIIGSFFFKLHNFVSKHFQHNTTMFQIVLHGLKVWFTDIGQETIF
                     NEDPDAFIDIEFLDNLQSLAHVRDSFTRTYLAVKTNDLHQSRVLLHSTNRYPSKLEIK
                     LLEVMIEMATSIYPDIHKPAQSILAHCMKQLIGSYSIIIREILAALRRAIEDTDHQKI
                     SAILRVFMIKKIDKKLMSDYKNIGEAVLLLIDCCKYDELDIAFYAENLLNDIVNSLRI
                     PSSVCIYDEKLLKFLEIPDASMDLQVKAVRLAKSKKREQYFSIILRLQDDLLEIINKS
                     GDSLAWKVQIFITRFICKIQASLEFPVDKRVIDVVYNQTKSKHPQMVHLAVRSYLSIF
                     NKIFSLSDYDYDIRKAYENGFDPYFIKEINTTNSNFPDEFLKEMNNFDAPKYFIDSRA
                     SVGWLCWGKRMKVVESGAIEINLQEHELEILGEMGKLVSKDWIDDMCSSLVHDNETRS
                     VFSSGDVSLIVLILVLVLKGFTSVTLEDIFTLCKKYYDRYDKASMIMSIEIFAALICS
                     SKYMNIDFLKQRDAFVDDFLNDCLNNELNHDCYEIWNTLSWWLPTVVDIRRCKPFYMH
                     LTKTTNLLDVTADNATHQSFRLLMMRSLLMSLEFRSPDVSKIIESLVFDHPYDQVRSS
                     IGKLLNTLTQNSSSLSLPSTDKIVNVGSQEYDGLGYPVKHISDVFDQIIKEKFQEAID
                     YIPKLKEMTPQEIIKTKFYYTVSTLFYWMKEMTKGPNKVLLTPYIIDYLLPFLMTLST
                     QRDMCKLAGLDPSKLLLGLAYLPMRKSEVSKVVQLVCHTKVDTSHQLKLQLLFVQHIL
                     STELLQLTKQEKTEIFEYVVKSLFNGQFVEVRVHAADVLSGIIHNSGEDETLFQSLLD
                     RFSKSLSNYTWEQKKKLSKTDIKIHGSVLGLGAIISAFPYVFPLPKWIPSQLSILSSW
                     ARTNGMAGLAAKNTINTFKKVRSDTWKFDRESFSAEELEDLEGVLWKSYYA"
     gene            <792718..>793341
                     /gene="NDAI0G03340"
                     /locus_tag="NDAI_0G03340"
                     /db_xref="GeneID:11495611"
     mRNA            <792718..>793341
                     /gene="NDAI0G03340"
                     /locus_tag="NDAI_0G03340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671306.2"
                     /db_xref="GeneID:11495611"
     CDS             792718..793341
                     /gene="NDAI0G03340"
                     /locus_tag="NDAI_0G03340"
                     /inference="similar to DNA sequence:INSDC:YFL005W"
                     /note="similar to Saccharomyces cerevisiae SEC4 (YFL005W);
                     ancestral locus Anc_8.70"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671354.2"
                     /db_xref="GeneID:11495611"
                     /db_xref="GOA:G0WEA0"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR025662"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WEA0"
                     /translation="MSASANGKGYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFIT
                     TIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFS
                     NIKQWFKTVNEHANDEAQLLLVGNKSDMDTRVVTYEQGESLAKELGLPFVESSAKNDD
                     NVNEIFFTLAKLIQEKIDANKLSAAGSGKDGSVSINGSNSGSKSSCC"
     gene            <793961..>796513
                     /gene="NDAI0G03350"
                     /locus_tag="NDAI_0G03350"
                     /db_xref="GeneID:11495612"
     mRNA            <793961..>796513
                     /gene="NDAI0G03350"
                     /locus_tag="NDAI_0G03350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671307.2"
                     /db_xref="GeneID:11495612"
     CDS             793961..796513
                     /gene="NDAI0G03350"
                     /locus_tag="NDAI_0G03350"
                     /inference="similar to DNA sequence:INSDC:YFL004W,YPL019C"
                     /note="similar to Saccharomyces cerevisiae VTC2 (YFL004W)
                     and VTC3 (YPL019C); ancestral locus Anc_8.71"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671355.2"
                     /db_xref="GeneID:11495612"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR018966"
                     /db_xref="UniProtKB/TrEMBL:G0WEA1"
                     /translation="MLFGVKLANDIYPAWKDSYIDYERLKKLLKENDIIKDPPSCNNN
                     KNDSDLWNDKDEANFVEALDHELEKVYTFQMNKYDTLMEKLNHLEKQTSNEDALKTLD
                     FQAFQHVLEDILSESQELDSFNRLNYTGFMKIIKKHDKLHSGYPSVRSLLEVRLKELP
                     FHSEEYSPLLYRISFLYNILRSNFGTVSQSLASTSKLSSATGDHEMSFKRFKFWIHPD
                     NLMEVKTRILRHLPVLVYASALTENNDILNRFDTDLIDTDGNNNIPSSNSSVTNSDTE
                     NELARKSYDPIITNLYFDNEFFELYNNKLLKTSTAPTLRLRWTGKLIDKPDIFLEKRM
                     SIENPKTGNIDLDETRLKLKQKFINGFIFNGDKHYKANVLRKLKDSGIDETDLNKMSS
                     DFDAIQTFIMQEELQPVLRTTYTRTAFQIPGDDRLRMTIDSDILYIREDSFDKSRPIR
                     DPHNWHRTDLDSAAPIQTKHLRTGEYSKFPFSVMEIKIKNAAPSKDSDKGSSMSTAKL
                     PIKHGQWIYDLTNSHLVKEVPKFSSYVQGVASLFGEDDKLDILPFWLPELENDIRIDP
                     KQAYEEEQLKLRKQKETQARIDGLRRLSKVDNSSQPSEVSIQRRSASPAQAEEEDTRP
                     EADLEDHESSDEEDNNNVQRQRRKKDKRKTKTGQTFFKILAGRDSKLTGVDSEDEEIH
                     LPPGVKKPTSFLKNAGPLKIEAKVWLANERTFNRWLKVTTLLSILTFSIYNSVKKSSF
                     PQLADMMAYIYFALTLFCGIWAYSTYINRLKIIKERSGKHLDAPLGPLVLAVILAFTL
                     IVNFGVAFREEAKNQILRNQQLSVQSDPPVQLSETLTKIQNFIFYLVGATTN"
     gene            complement(<797188..>799755)
                     /gene="NDAI0G03360"
                     /locus_tag="NDAI_0G03360"
                     /db_xref="GeneID:11495613"
     mRNA            complement(<797188..>799755)
                     /gene="NDAI0G03360"
                     /locus_tag="NDAI_0G03360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671308.2"
                     /db_xref="GeneID:11495613"
     CDS             complement(797188..799755)
                     /gene="NDAI0G03360"
                     /locus_tag="NDAI_0G03360"
                     /inference="similar to DNA sequence:INSDC:YFL003C"
                     /note="similar to Saccharomyces cerevisiae MSH4 (YFL003C);
                     ancestral locus Anc_8.73"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671356.2"
                     /db_xref="GeneID:11495613"
                     /db_xref="GOA:G0WEA2"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WEA2"
                     /translation="MDSSDLSTFVSAHYFSTSKESRSTKSSGIATSAHLQQFSIQRQQ
                     QSRLSPKRSLPWIDRSFVKSKKPSTCNRQPYFSIVQSHPNSLLPTCYSSNAQSYSTGT
                     TTRTVTRTSGPERILCCLYEIPKEVETRVGLCFLNYSTGKMILSDFMDSQIFIRTVHK
                     IQIHQPTELLLPSSSLSPNVSKLATILKFNISETVKISEASSKFFDPHEGLAAISKYA
                     IKDKDDTEEHVRIVEELIDKTFALSATAASIKYTDELVNKSSNTLSKFKNLRISYEGT
                     ENTMLIDPKTSTGLELVENKIDKNGLSFWKFLNTTSTKMGARSLRNNILQPLTDKSSI
                     LMRLDVIKELQKDKDFLISIRREMKLYQDLDKLFSKLLSVNHAAIKPEQKINYILLLK
                     DSISITLTLKKLLEEVNLESQLLQEAKKIFNNTSILEIENDINEYINEDSVWASSCLE
                     LKNQQSYAVKGGANGLLGVSRQLYRSSVDSITDEIEELSKKYDLPIDYNFDSFRGFYL
                     KIKKQAFPELNEVPNIFINVVSKKNFIECTTMDILKENAKLKEIISEISMLSEQAIHE
                     LLDKIAKNISVLFMISEAVSILDLLCCFAHNSLKHNYCIPKFSSNLILKEARHPILET
                     QTKNFVPNDITNTKNTSSVQIITGCNGSGKSVYLRQIALLSIMAQMGSPVPATGACFP
                     IFSKLHARVCNDPMEMSSSTFSFEMKEMAYFLDDMDDTTLLILDELGRGSSIGDGFSI
                     SLAITEYLIQKKSNVFLSTHFKDIPAILTSKPNVVHLHMQSQLQWDNSMKMLYHVGNE
                     VDDIENIGIKLVSKYFDPDIVTKAYAFSSVLKAAEEKATNGSLLGEEKEKEKSGLTS"
     gene            complement(<802196..>804754)
                     /gene="NDAI0G03370"
                     /locus_tag="NDAI_0G03370"
                     /db_xref="GeneID:11495614"
     mRNA            complement(<802196..>804754)
                     /gene="NDAI0G03370"
                     /locus_tag="NDAI_0G03370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671309.2"
                     /db_xref="GeneID:11495614"
     CDS             complement(802196..804754)
                     /gene="NDAI0G03370"
                     /locus_tag="NDAI_0G03370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671357.2"
                     /db_xref="GeneID:11495614"
                     /db_xref="GOA:G0WEA3"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:G0WEA3"
                     /translation="MANTSKEQMQVMVDQGVVEEVNGYCNYVSPGFFIRKRDTEELRL
                     VINYRTANQYVIGMESQLPSIYDSIVTLPDSVFTVLDITSAFYTVKLDKLSQDFLCFK
                     VGNQTYRPLRAPMGYKNSAQLFAAFINHILPSSLKPHLTIYVDDLLIIGKPNTIVSLT
                     REVIQHLGGYGIRFSAKKIQFNQRSIEYLGYKIVPGGIKPLERHIEAIVNLPPPQTVR
                     DVRSLIGMANVIRNWIPNISESLKHMYQTIKDYGDKGKKGRISISEELILEYQNFKET
                     LQRLPTIGRFIPGYPILIFTDASRYSTGAVVIQLSDKADSRKPIQIIIDEIKERNGKV
                     QGKILGFSSHKLTPAEQNYSVYDLELLAIDKVLEQYEQWLIGSPVTVITDHANLSRLT
                     TKVRLTPRISRTMEFLMQFDVRIGFMEGDSNTMADGLSRYPIHKSSEPSKIEVELFRR
                     SKLRPEILEPSIPYEDTEIPNQVKRLFITTAKINESDNVFLRVPEMTLEIVEKYQEDQ
                     IHDITGLPITLHDKLKEAVSNIKVNSKLHFLTIQGDKLLTKEHKWWIPQEQYEIILWI
                     IWNTHINNDMHRGIQETLRCIRKRYNFDDLYKLTQVVVNSCKICQSNKPTNFSISNYR
                     YIPTPSRPHMIMSADHITDLDTSKDGYNEILVIVDLFTRYTYLIAAKKQDTAEETFQR
                     LEEKLCLHGGLPITMLTDNGTKFKGEFNKNLSWRGINHWNTSIYRAKSNGANERMNGI
                     IKQCLRTHGALMRPHWPQHLSATEFFINSRTHSATRRSPNELKFGYEPEWIDTNKRLE
                     MLNTDTRIQVMSDEEWYNYIQEKVKPIQALLVKSKDRNKQKITKTGKPVVLQSR"
     gene            complement(<804824..>805531)
                     /gene="NDAI0G03380"
                     /locus_tag="NDAI_0G03380"
                     /db_xref="GeneID:11495615"
     mRNA            complement(<804824..>805531)
                     /gene="NDAI0G03380"
                     /locus_tag="NDAI_0G03380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671310.2"
                     /db_xref="GeneID:11495615"
     CDS             complement(804824..805531)
                     /gene="NDAI0G03380"
                     /locus_tag="NDAI_0G03380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671358.2"
                     /db_xref="GeneID:11495615"
                     /db_xref="GOA:G0WEA4"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR018061"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:G0WEA4"
                     /translation="MYTVSNKRNYNLNNTTVYSQDLSTTNQTIYHIRARHQWKTLPMA
                     TIWIDKRQVQALLDSGSEINLIQEDVAKMLEHQKNVSRINNNNPVKIECGGKISMSEY
                     LLLGSCFKLKERSYTASFHVVNISTNVPKMILGIPWLREHGIILNFEQNAYSIMDQGG
                     KIIDQVNNDTGYKSNFQQVTDNSSYLTQEHANSNLEDEGHDKVDNSEITLPPELSDLA
                     IYFAKPDYKRKIKGIRL"
     gene            complement(<806388..>806909)
                     /gene="NDAI0G03390"
                     /locus_tag="NDAI_0G03390"
                     /db_xref="GeneID:11495693"
     mRNA            complement(<806388..>806909)
                     /gene="NDAI0G03390"
                     /locus_tag="NDAI_0G03390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671311.2"
                     /db_xref="GeneID:11495693"
     CDS             complement(806388..806909)
                     /gene="NDAI0G03390"
                     /locus_tag="NDAI_0G03390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671359.2"
                     /db_xref="GeneID:11495693"
                     /db_xref="UniProtKB/TrEMBL:G0WEA5"
                     /translation="MSSVTTDQRELEEPNTLLPEVITTGFVLDEEEEDEIKNVENPYL
                     KMFGQTPAIDALRNSERTKNFNTYEYAEFYCPELFGFKSLKPFRNYKGLVKETKDDDN
                     RNDSYKESGKSFSRSTGMEKYVYGEDPIKFVQQFLREYQKRNILESKSTIYTTFRSLL
                     PVKINCYVCCFRW"
     gene            complement(807839..807912)
                     /gene="NDAI0Gtrna6N"
                     /locus_tag="NDAI_0Gtrna6N"
                     /db_xref="GeneID:11497288"
     tRNA            complement(807839..807912)
                     /gene="NDAI0Gtrna6N"
                     /locus_tag="NDAI_0Gtrna6N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:11497288"
     gene            <809068..>812181
                     /gene="NDAI0G03400"
                     /locus_tag="NDAI_0G03400"
                     /db_xref="GeneID:11495617"
     mRNA            <809068..>812181
                     /gene="NDAI0G03400"
                     /locus_tag="NDAI_0G03400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671312.2"
                     /db_xref="GeneID:11495617"
     CDS             809068..812181
                     /gene="NDAI0G03400"
                     /locus_tag="NDAI_0G03400"
                     /inference="similar to DNA sequence:INSDC:YPL009C"
                     /note="similar to Saccharomyces cerevisiae YPL009C;
                     ancestral locus Anc_8.75"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671360.2"
                     /db_xref="GeneID:11495617"
                     /db_xref="InterPro:IPR008532"
                     /db_xref="InterPro:IPR021846"
                     /db_xref="UniProtKB/TrEMBL:G0WEA6"
                     /translation="MKQRISALDLQILAAELKTSLEGYRLNNIYNASDSNRQFLLRFN
                     KPDSKLNVIVDCGLRIHLTEFTRPIPSAPSGFVMKLRKHLKSKRLTALRQVKNDRILV
                     LQFADGLFFLVLEFFSAGNVILLDENRKIMSLQRIVHEHENIIGETYTMFDESLFHTA
                     DDTNATNITNKDFSEGLVKNWLDEVKQKYAVAASTILETSKNDKSHQKKKIKVMSIHK
                     LLLSKEPHLSSDLLSKNLKMSKIDPSTSALDFENRVDDIIKLLNTTESEYHQLLNDNE
                     HRVGYILDHENKNFNPKIDSNPDLEFIYETFHPFEPYVEEKDKASSHISEIPGYYNKT
                     LDKFFSTIESSKYALRIQNQELQAKKKLDEAKLDNQKKLQALIDVQSSNEEKGHLIVA
                     NADLVEEAKSAIQGLVDQQMDWNTIEKLIKSEQKKHVKIAELIVLPLNLKENKFKMKL
                     PLKTFDDDEQNDTSDEDDNSSSSFSESDSENASSSSDASDSDISDFETEESVQKEVPP
                     KKRKTKRSSATSQPNEKMITVTIDLGFSAYANASEYFNAKKTSAEKQKRVEKNIEKAM
                     KNIEEKVNTQLKKKLKESHEVLKKIRTPYFFEKYHWFISSEGYLVMMGKNDAETDQIY
                     SKYIEDDDVFMSNNFGTKVWIKNPMKHEVPPNTLMQAGILCMSSSEAWSKKIASSAWW
                     CNAKNVTKFDKFDKSVLPPGVFVLKDEKDQNTLPASQLVMGLGFLWKVKTSDNGDEDV
                     KEFEGEQEELSLIDEEEENEEFRGNDSVVIPTDDDHTDSYDNNDSINIVAEIGNDLKD
                     LDLNKDEVRIPEEEEEEFDNRTIATGLVENMNKNVRGKKGKLKKMQKKYADQDESERL
                     LRLQALGTLRGLEKQQLREKEEIAKQQKREYKKAKREKQKEMQALKFTRNEKVKVNYQ
                     KPFTELKAVLTKDDKVVDIVPVFAPWPALLKYKYKVKIQPGSAKKTKTLSEILHFFMN
                     RKVDTTLADKEIDWPNEHELIKTLKEQDLVLLLCVDKLKVTLPGKNDTSKKGNQKNGS
                     KGKSKRK"
     gene            complement(<812526..>813668)
                     /gene="NDAI0G03410"
                     /locus_tag="NDAI_0G03410"
                     /db_xref="GeneID:11495618"
     mRNA            complement(<812526..>813668)
                     /gene="NDAI0G03410"
                     /locus_tag="NDAI_0G03410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671313.2"
                     /db_xref="GeneID:11495618"
     CDS             complement(812526..813668)
                     /gene="NDAI0G03410"
                     /locus_tag="NDAI_0G03410"
                     /inference="similar to DNA sequence:INSDC:YGL185C"
                     /note="similar to Saccharomyces cerevisiae YGL185C;
                     ancestral locus Anc_8.146"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671361.2"
                     /db_xref="GeneID:11495618"
                     /db_xref="GOA:G0WEA7"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G0WEA7"
                     /translation="MSEEKKPFCLSTKPNEDSPLLNSDKFLEDFNLLNVELTTKEAFL
                     SFLHDHKNDNIVAIYGGFPQFTSIGGLTKEIIEHEDFPQCTLKCIVLCSRGYNMIDIK
                     TLKKFGIQLYNYQDEVDESIAIETFKVGQVGNDVADCAMWHVLEGFRKFSYQQSIIRK
                     LGNTNETRANIANKTGYVFGHEYLRGQSIRSPRGKKCLVLGLGSIGKHVALKLQDGLG
                     MDIHYCKRTEDLQVKEKYGWKFHPLDDSLYSQLFQFKAIVVALPGTAETKHLINEKFL
                     AHCDGPELVLVNLGRGQILDIDAVTTAFEEGQLRHFGGDVFYEEPKVNSDVLKMEDTT
                     SVTPHVASATVEVFEQACELALTNIIRSITEEDNESPDTECFSRVV"
     gene            <817362..>818816
                     /gene="NDAI0G03420"
                     /locus_tag="NDAI_0G03420"
                     /db_xref="GeneID:11495619"
     mRNA            <817362..>818816
                     /gene="NDAI0G03420"
                     /locus_tag="NDAI_0G03420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671314.2"
                     /db_xref="GeneID:11495619"
     CDS             817362..818816
                     /gene="NDAI0G03420"
                     /locus_tag="NDAI_0G03420"
                     /inference="similar to DNA sequence:INSDC:YER130C"
                     /note="similar to Saccharomyces cerevisiae YER130C;
                     ancestral locus Anc_8.144"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671362.2"
                     /db_xref="GeneID:11495619"
                     /db_xref="GOA:G0WEA8"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0WEA8"
                     /translation="MIIKEESKSPDLSKPFANLFQQNLIQLGQESHHVSQNDGTRSTN
                     NDRSDSTYEDRIDKFCTQSDEAFRTFFESFCVSLDGSDNDTTTTAASKNNFNNLNLHT
                     RDYISNYDAGSIDQKLNLDMDFVPKSLDMDLGLGGFDFDFNLVNDSNNTKSSSNSNNN
                     SNETPLTTNVSTTCNSIKNYSTNNKQDVPLVSESIDNFQRLISMEEKKLNSATVLTPS
                     IVTSTRNSNNMFNRNNNSNLPNLLEGPSPTSKENNNDDAGTNTKIELPLSIAASVNDI
                     SSNNNRKVANNNNNNNNNSISGILPKEEGSLVDFTLPNWSDFATKLEEGNGKNTPVKK
                     ENSDNITNNFPIKNNNKNHNSNNKKITVKELRSISLSPKSTFRERFSGPISIPIQPIN
                     SNRPKPRGRKPSIVPDGSKQFLCTICSRRFRRQEHMKRHIRTIHFQERPYTCYVCEKT
                     FSRSDNLNQHLRTHTRNYEVKHPPLFNYDHRSSI"
     gene            complement(<819024..>819752)
                     /gene="NDAI0G03430"
                     /locus_tag="NDAI_0G03430"
                     /db_xref="GeneID:11495620"
     mRNA            complement(<819024..>819752)
                     /gene="NDAI0G03430"
                     /locus_tag="NDAI_0G03430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671315.2"
                     /db_xref="GeneID:11495620"
     CDS             complement(819024..819752)
                     /gene="NDAI0G03430"
                     /locus_tag="NDAI_0G03430"
                     /inference="similar to DNA sequence:INSDC:YGL183C"
                     /note="similar to Saccharomyces cerevisiae MND1 (YGL183C);
                     ancestral locus Anc_8.143"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671363.2"
                     /db_xref="GeneID:11495620"
                     /db_xref="InterPro:IPR005647"
                     /db_xref="UniProtKB/TrEMBL:G0WEA9"
                     /translation="MPPKRNSSTAVASNTNSNPTQQSKRPKPPSQQLKKQEILTFLQS
                     TYSYYTLKELEKLIPKNCKSISNGILVKDLIKSLLDDDLIHMEKCGNINIIWCFKRQV
                     MKEQFIIGEKLESSLQVCKEEYSKLENDIEDCLQGEYNEYIIDDGNNGGKLKRDDCLR
                     ELKELDDKLKVSKNNVMELEKFKWDDERISLEKEEKLKDINRLEKLTDNIEILVSYLS
                     NKFLIDSKQIRKEFGIPEDFKEFS"
     gene            <820735..>822012
                     /gene="NDAI0G03440"
                     /locus_tag="NDAI_0G03440"
                     /db_xref="GeneID:11495621"
     mRNA            <820735..>822012
                     /gene="NDAI0G03440"
                     /locus_tag="NDAI_0G03440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671316.2"
                     /db_xref="GeneID:11495621"
     CDS             820735..822012
                     /gene="NDAI0G03440"
                     /locus_tag="NDAI_0G03440"
                     /inference="similar to DNA sequence:INSDC:YGL181W"
                     /note="similar to Saccharomyces cerevisiae GTS1 (YGL181W);
                     ancestral locus Anc_8.142"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671364.2"
                     /db_xref="GeneID:11495621"
                     /db_xref="GOA:G0WEB0"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="UniProtKB/TrEMBL:G0WEB0"
                     /translation="MARFTSGRTNNNHHHGHGHGHGHGNNNLKKIRSPNIESELKDLL
                     NAPENSNKCGECGSAYPTWCSLNLGIFLCGRCASVHRKILNNREDDVFSKIKSLSLDR
                     WYDDDIDSFSKLGGNKGNNQFWNPKREPFPFDGDDDKSIVEHFIRDKYIVGKFRYDDV
                     KPEDFGNKDDFDTDHRSYSRRSSYDDTDDYGYSRSTDSSNRGFKYSRQLEELRDMGYN
                     SNISRIKDTLERTHGNINKTIDILERYDSTSSFSRETSHHTTAHSTAPSSSGSGAINN
                     PPLPKRRSTLSGPQPAVFDGSTDIASLVAQQTAAVGAGAAGLVPGSVQQYYDPATGMI
                     YVDQQQYMLAMQLQQQQQQQQQQQHVLQAQLQQQQQAVPQMGMQFQQVPTGLPIIYNG
                     VQIFPNNPQYQQLLMLQQQQQQQQKQQNMGYFQ"
     gene            <822716..>825562
                     /gene="NDAI0G03450"
                     /locus_tag="NDAI_0G03450"
                     /db_xref="GeneID:11495622"
     mRNA            <822716..>825562
                     /gene="NDAI0G03450"
                     /locus_tag="NDAI_0G03450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671317.2"
                     /db_xref="GeneID:11495622"
     CDS             822716..825562
                     /gene="NDAI0G03450"
                     /locus_tag="NDAI_0G03450"
                     /inference="similar to DNA sequence:INSDC:YGL180W"
                     /note="similar to Saccharomyces cerevisiae ATG1 (YGL180W);
                     ancestral locus Anc_8.141"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671365.2"
                     /db_xref="GeneID:11495622"
                     /db_xref="GOA:G0WEB1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR022708"
                     /db_xref="UniProtKB/TrEMBL:G0WEB1"
                     /translation="MSNTSTSSSNNANNINSLPKKSRKGIERSITIGPDTYMIDKEIG
                     KGSFATVHRAHLLRKQIKDDLTSPPLNFAIKIVSRSKLKNKKLLENLEIEIAILKKIN
                     HPHIVKLIDCERTTTDFYLIMEYCALGDLTFLIKKRHELIKNHPLLEKIFEKYPSPNE
                     NYNGLHRAFILNYLQQLASALKFLRSKNLVHRDIKPQNLLLLTPLINYNDSKAFKKLG
                     FIGIYELPILKIADFGFARFLPNTSMAETLCGSPLYMAPEILNYQKYNAKADLWSVGT
                     VLYEMCYGTPPFKASNHLELYKKIKRSNNKINFPNYIQIQNDMKILISKLLTFDPQRR
                     IEFDEFFNNNLVNEDLSHYESSLNDDDIQELESKSKNILENNMFISEYLSNDTSQNRN
                     NKYEYNNIQDEQNSTLTPKVTSNNKEAYSTSTPTNVVTENENENKNETVKTIRKDQNN
                     HNNTFPSYLNERTNSDIILEKDYVVIEKKSVEINALADELAKVGPIPTNNLKKTVNPD
                     TKPIQSRDQQLSSIPQKKWSTATNSTSSNNDMPINRSSTTSISNSSSPGNVITTVRRP
                     SLVDRRLSMSSLNPSNALSRAIGVASTKLFGTTTNFNTTKNQTQQQQEQQQLQATPYL
                     SNSFALSPRIFQDLTENIILRVNNIENENERIAKVENENSSSNLDTNKITHILESLSA
                     RAFVVYSFAEVKFLQVIPMKKSQQRSSNGSSAIQEEEEGEEADLRDANGNNNNDTDNK
                     FSIKELKHLCTEAIVLYMKTLEILAKSMKITSKWWYESNEKICSLRLNLLVQWIRERF
                     NECLEKADYLRLKLDDVTTNKQDQEKGNDDSEDEDENDNDNVSEKETTDTDEDVVLEK
                     LLYDRALEISKDAATMELNGENLYNCELSYATALWMLETTLEPNNAVIENARDHADDQ
                     TYEVLDEQDRIIIKKYMDSIATRLKALRSRLNQF"
     gene            complement(825836..825907)
                     /gene="NDAI0Gtrna9R"
                     /locus_tag="NDAI_0Gtrna9R"
                     /db_xref="GeneID:11497294"
     tRNA            complement(825836..825907)
                     /gene="NDAI0Gtrna9R"
                     /locus_tag="NDAI_0Gtrna9R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGA"
                     /db_xref="GeneID:11497294"
     gene            complement(<827471..>827833)
                     /gene="NDAI0G03460"
                     /locus_tag="NDAI_0G03460"
                     /db_xref="GeneID:11495695"
     mRNA            complement(<827471..>827833)
                     /gene="NDAI0G03460"
                     /locus_tag="NDAI_0G03460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671318.2"
                     /db_xref="GeneID:11495695"
     CDS             complement(827471..827833)
                     /gene="NDAI0G03460"
                     /locus_tag="NDAI_0G03460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671366.2"
                     /db_xref="GeneID:11495695"
                     /db_xref="GOA:G0WEB2"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:G0WEB2"
                     /translation="MNTKLAFLLTALFSAYCVASFPVHNDYTHPHIVELTVIFEDIKT
                     HLNDYIPLCFLPGTGFSLFNIQKGILDITIALSILTESAISAVCRDIDYALIHACIIK
                     LPWYAHRLEPAINAALQG"
     gene            complement(<829975..>832455)
                     /gene="NDAI0G03470"
                     /locus_tag="NDAI_0G03470"
                     /db_xref="GeneID:11495624"
     mRNA            complement(<829975..>832455)
                     /gene="NDAI0G03470"
                     /locus_tag="NDAI_0G03470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671319.2"
                     /db_xref="GeneID:11495624"
     CDS             complement(829975..832455)
                     /gene="NDAI0G03470"
                     /locus_tag="NDAI_0G03470"
                     /inference="similar to DNA sequence:INSDC:YER129W,YGL179C"
                     /note="similar to Saccharomyces cerevisiae SAK1 (YER129W)
                     and TOS3 (YGL179C); ancestral locus Anc_8.140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671367.2"
                     /db_xref="GeneID:11495624"
                     /db_xref="GOA:G0WEB3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:G0WEB3"
                     /translation="MAPSPNKNMHFSPLKESVSLQRSLSETPSMQIRQRRKLISPSSV
                     TSLNSLKYNSPSPTSFGNNVKETNKVLLGYDPISKKQILNNYEIIKDLGTGQHGKVKL
                     AKDTRTGELVAIKIVNRYEKRRHSLTPNAQSSLDRIKKEIAIMKKCNHEHIVKLIEIL
                     DDLKSRKIYLVLEYCKKGEIKWCPREQLEIDSAGPPQMSFQRAREILRDVILGLECLH
                     HQGIIHRDIKPANLLIDHDDVVKISDFGVSLAATGSIDNNDDELELTKTVGTPVFFSP
                     EICLGTEAIEKFNLERSSFSNVSCISFKIDIWALGITLYCLLFGKLPFVSEFELKLFD
                     KIVNDPVTFPDFEVLQNNNISNIASFEEYELAKDLLERLLDKNPTSRISIQDIKKHPF
                     VCFDFDHITNKVGEIIQYKQQEKSIFQMSQNDKSDQISISSKEIRNAISALKRDSKGS
                     ILEDDKPLDGSSINSPTISINTSNNSLYSPKYLNNSKNSSDNIYNLEFNNVAKESVIV
                     PYPIVEEAPSKTALQEELEQFDQQFEKKTIVDLPVDSSFASLDSFYAETHASSKSDFN
                     KHISNISQRNASRLRFTQSPSFAMNPFRSPFERSESRFGSTSFSQRNTNVRSVDPQRN
                     QSDTYSSNGKSLATSPIGVSPKFGSNENADKSKEIFPNSNTNPRYDSENSGNENNIFN
                     GFVALDERSVGQSSTRTSSSYSTYSPGYEIHPPYEQFGIDSDNVSVLSLGDLNRKFSP
                     NKFSTNAKSSSESENSEDDSEELVLRVGNSRHSRRQNLAPSNSISTKPFGASSILIHG
                     SSDNKKEKLTILDSESSDHFKLTVKKIL"
     gene            <836154..>838640
                     /gene="NDAI0G03480"
                     /locus_tag="NDAI_0G03480"
                     /db_xref="GeneID:11495625"
     mRNA            <836154..>838640
                     /gene="NDAI0G03480"
                     /locus_tag="NDAI_0G03480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671320.2"
                     /db_xref="GeneID:11495625"
     CDS             836154..838640
                     /gene="NDAI0G03480"
                     /locus_tag="NDAI_0G03480"
                     /inference="similar to DNA sequence:INSDC:YGL178W"
                     /note="similar to Saccharomyces cerevisiae MPT5 (YGL178W);
                     ancestral locus Anc_8.136"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671368.2"
                     /db_xref="GeneID:11495625"
                     /db_xref="GOA:G0WEB4"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0WEB4"
                     /translation="MTHNHQTQHSINSIQSLVEPVTPPPLGQMNNKRNHQKAHSLDLS
                     GFNQFISSQSPMVLMNTVSTNDTTQASSNNGLNSSYIAAGQTPTILPQITEFTSSMND
                     SNSTISTQNNPRPFHDNNITTKSSVSAISLMKNITDGVASLPVASTTPSLNAKNNSSN
                     NIGHHSNPSSSSSMAELALTPLKDLNYLKLATDQFGCRFLQKKLESPAESDIVRDLMY
                     EEIKPYFLELILDPFGNYLIQKLCDYLTVDQRTNLIKSIYPNVFQISINQYGTRSLQR
                     IIDTVDNDEQSNIIIEGFSQKYTSIEQIVTLINDLNGNHVIQKCIFKFPPSTFDFIID
                     TITEQNNIVAISTHKHGCCVLQKLLSVCTLDQIFKISVKLIQFLPALINDQFGNYIIQ
                     FLLDINEIDYYFLPEIFNTLSNELCQLSCLKFSSNVVEKFIKKLFSNVRYQLQMNNID
                     ANTLEVLGTSMNILLSIVDIFTINLNILIRDNYGNYALQTLLDVKNYSVLLEYPGNKF
                     VTNVPHFAEFSHEFTTKINNLVILTKELLSSIKTTSYAKKIKLKVKAYAELTGISFPD
                     LSPKKPNNSNKNHYMNYNNTINSVNKNKNNSYQKQHSRHFSLPANAYHRRSSSSVIPS
                     IFSQQQQQQQAPTQGQLSPGMNSIFNSHNMSPLGYQPHQSQPAQPITQPMLGQMNMSM
                     PQQLPLQQDFSSSILPRPNSSVSLQSIPSHLTYPSSSSQLSIPQTFAGSDNNISTNSS
                     SSMLYYPNNGINNFNDNMGNPLMSNLPFSSNNNFNQRQARIVSNPLPQPSFSNNGAFA
                     ANINPVSPVPNLFSSGSSNNADFINNFNFR"
     gene            complement(<839631..>841268)
                     /gene="NDAI0G03490"
                     /locus_tag="NDAI_0G03490"
                     /db_xref="GeneID:11495626"
     mRNA            complement(<839631..>841268)
                     /gene="NDAI0G03490"
                     /locus_tag="NDAI_0G03490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671321.2"
                     /db_xref="GeneID:11495626"
     CDS             complement(839631..841268)
                     /gene="NDAI0G03490"
                     /locus_tag="NDAI_0G03490"
                     /inference="similar to DNA sequence:INSDC:YGL176C"
                     /note="similar to Saccharomyces cerevisiae YGL176C;
                     ancestral locus Anc_8.135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671369.2"
                     /db_xref="GeneID:11495626"
                     /db_xref="UniProtKB/TrEMBL:G0WEB5"
                     /translation="MPLELPGFYFDEERGRYFRITELTGTTRTAISRDPNESERIYNR
                     EEIKRRKLTELNAKNYEEVKQECNAVYQEHMMKVADPYYRLIEVEKTRAILEGLRFHN
                     RRVVMNQSDLNLAGHEGCYISNSDELNPALGEFTGFFIPVNASRWGTELICATSNGSL
                     IRVLRDLSLDTESAYEFEMISESNMDSFTNIQKELVIKCRTIRLDGLLIKDVGLYYHL
                     VKEGSTDHVFMYNGGSSTLTRRVELKGEDKDHIGDSVNISLNEGFIVAVNNKLLIHKW
                     SYNQDFYKETLDKGLTSDIVTLAISPAARTKERILNIGCRNGWIYTVPIKEGKLLVSG
                     RKCFKNPLNVRSIITIKAGISPGILFVSAISKNNAQSLFMFDASLEIPTGMNRPFVIF
                     QTGQHNMAKETEFFDVSPDDHFLCYGSKNANSGKGDFEIFSIKKGDNLISESVNGSVK
                     FSPIREYCDYSSHIPQGCRLITTCFSRLETTSMPRNLKIKANSNENMIYEDGQTGSVK
                     MKSGNYRHGVPNLIICGTESESNEFFSSLYLGSVELY"
     gene            complement(<841613..>842917)
                     /gene="NDAI0G03500"
                     /locus_tag="NDAI_0G03500"
                     /db_xref="GeneID:11495627"
     mRNA            complement(<841613..>842917)
                     /gene="NDAI0G03500"
                     /locus_tag="NDAI_0G03500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671322.2"
                     /db_xref="GeneID:11495627"
     CDS             complement(841613..842917)
                     /gene="NDAI0G03500"
                     /locus_tag="NDAI_0G03500"
                     /inference="similar to DNA sequence:INSDC:YGL175C"
                     /note="similar to Saccharomyces cerevisiae SAE2 (YGL175C);
                     ancestral locus Anc_8.128"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671370.2"
                     /db_xref="GeneID:11495627"
                     /db_xref="UniProtKB/TrEMBL:G0WEB6"
                     /translation="MPDPIRLKSNLALLATLSLEELINVQLDVTLLLEAKIKEIRAHP
                     VIEEKEGPEASRASPFHEKEQSCTNFRLLNEAAKDDSFKHPNVLIEEDKNVPAGDDTE
                     NLILTQFDPETRDKLLNNHDLPVSIKLSFHLNLIRYTKNEEKNIRSVSPLSKTAIKCE
                     TDCSSPLKEPITLSQNDVQLRDDFPLDKRDLENMNYELDGEEAIADSISDLDFIQGIE
                     KFEPTFKRPLNLIGENNAQKPNPKKLKRDSTKPNTNITPTFLNLDKKSTQKIPLVDFN
                     TNPLTEKPWILEDFKPNENKAFIRRGRLKLENFYKKAGKPINLPANGKSDAFLDDSVN
                     ADNIEFQFDNLRQRAKSPPGFGRLDFPTTQERVDDKEKSQEIIQQKTRYRFLMAIQNN
                     LPPQERRYIFKKEKLNRIVDGSQFSWSPSELKIYERKPRKRS"
     gene            <843291..>844076
                     /gene="NDAI0G03510"
                     /locus_tag="NDAI_0G03510"
                     /db_xref="GeneID:11495628"
     mRNA            <843291..>844076
                     /gene="NDAI0G03510"
                     /locus_tag="NDAI_0G03510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671323.2"
                     /db_xref="GeneID:11495628"
     CDS             843291..844076
                     /gene="NDAI0G03510"
                     /locus_tag="NDAI_0G03510"
                     /inference="similar to DNA sequence:INSDC:YGL174W"
                     /note="similar to Saccharomyces cerevisiae BUD13
                     (YGL174W); ancestral locus Anc_8.127"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671371.2"
                     /db_xref="GeneID:11495628"
                     /db_xref="InterPro:IPR018609"
                     /db_xref="UniProtKB/TrEMBL:G0WEB7"
                     /translation="MSLHSYLNQAYGPSSKKKSKKSNKKSTTSSTSSQDRNVFNVTES
                     SHQILSNKKVSKAYRTSTVNGKGKLLWKNVDTNELVEIQDDKATRLIQTNDGESGNPR
                     NVTRLESQETVFRDEKGHKLTRERNERRNKETSEDLREQLRKKRLQEINMGEVQLHWL
                     KNGKSEDSTMKKKEMLKEEDPAMVFDVNEQEDNIPTSLLGRRLYDGKFPENRFHIVPG
                     PRWDGVDRSNGFEKKWLLKKQEQENVITEQKFNEGDHDSDEYI"
     gene            complement(<844269..>848915)
                     /gene="NDAI0G03520"
                     /locus_tag="NDAI_0G03520"
                     /db_xref="GeneID:11495629"
     mRNA            complement(<844269..>848915)
                     /gene="NDAI0G03520"
                     /locus_tag="NDAI_0G03520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671324.2"
                     /db_xref="GeneID:11495629"
     CDS             complement(844269..848915)
                     /gene="NDAI0G03520"
                     /locus_tag="NDAI_0G03520"
                     /inference="similar to DNA sequence:INSDC:YGL173C"
                     /note="similar to Saccharomyces cerevisiae KEM1 (YGL173C);
                     ancestral locus Anc_8.126"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671372.2"
                     /db_xref="GeneID:11495629"
                     /db_xref="GOA:G0WEB8"
                     /db_xref="InterPro:IPR004859"
                     /db_xref="InterPro:IPR016494"
                     /db_xref="InterPro:IPR027073"
                     /db_xref="UniProtKB/TrEMBL:G0WEB8"
                     /translation="MGIPKFFRYISERWPMILQLIEGTQIPEFDNLYLDMNSILHTCT
                     HGNDDDVTKRMTEEEVFAKIFTYIDHLFQTIKPKKVFYMAIDGVAPRAKMNQQRSRRF
                     RTAMDAENALQKALENGEEIPKGEPFDSNSITPGTEFMAKLTKNLKYFIHEKISNDAQ
                     WREVEIIFSGHEAPGEGEHKIMDFIRTLRAQKGFDHNTRHCIYGLDADLIILGLSTHA
                     PHFALLREEVVFGRRNPNQAKTLENQNFYLLHLSLLREYMELEFKEIADEMQFEFDFE
                     RVLDDFVLVMFVIGNDFLPNLPDLHLNKGAFVVLLQTFKEALLHSDGYINEHGKINLE
                     RLRVWLQYLSQFELMNFEKNDIDVEWFNQQLENISLEGERKRARIGKKLLIKQQKKIV
                     GMVKPWIIKEMSEKIPIGTPDEQIPTLPLTNENIVENLDFLKKFAFDLGLIVVHSKSK
                     DTYSLRIDLDGFDASESEEEHVKRLSSLRKTIKSYQQAVLVEDADELQREQDLYNTRF
                     ESWKKDYYKDKLGFKADIEENITKLTKNYVEGLQWVLYYYYRGCPSWGWYYRYHYAPR
                     ISDLEKGLDQVIEFAKDNPFKPFEQLMSVLPERSKNLIPPVLRPLMYDPKSPILDFYP
                     TEVKLDKNGKTADWEAVVLLPFVDETRLIDAMKPYLSKLSPEEKARNSFGKPLTFTFN
                     PQVDLVYKSPLSGLFSDLEHDHCVEKEYSQPSMEGLNFIYGLLPKAKTGTELLAGFPT
                     LLTLPFKYQLEYNESLVFQQPSRQQSMVLHMDDIYEENNLTLEELSKRYIGRIIYTRW
                     PYLRESKLIGLMNEETVYERKEHIDADKKRHHTRIKRSADNADKKLFNSLKKSMLRNY
                     SKQKAVILDDIRAIVKVLPVVGLTRTENGAFVKNYASQPDYYPLQLMVESISNKDERY
                     IEKPPLPIKEEFPEGSHAIFLGDYAYGGEVIIDGYNNEKRLKITVKKRSVKAEPTIGK
                     ERAQQDRNLVQYIPSFLIAKKLGMHPLLLSRLTSKFMVADGNGRHINVGIPVKFEAKH
                     EKVLGYARKGTRGWEYSNLTIQLITEYKSRFPHFFEKLAKVGNGIPIFEDLYPDLSSS
                     ETSKMLDQIKAWVKFATEKFVVVSIESDSLTKSSIIAVEEVIQHYSMLPLHPEKKQLA
                     NVPRQAILSPRSSLGLLRTQKFELGDRVMYVQDSGKVPLFSKGTVVGYTTLGLNLSIQ
                     VLFDHEIVAGNTFGGRLRTKRGLGLDASFLLNLTNKQLVYHSKASKKVAENKTTRKHV
                     KPTNIPNVQKNNKEKVDDIRKKQAHDLLSIIKKSDGHNEVNATVQEDNNSVSVPGDTE
                     TTTTVTSIGSTETKKIDGVKDIVLPPNTNVANSIFNAVLHQYDPQTNVAPVAPIAPVN
                     NNTAPMPGLPYNMPEGFATNGLPPMGHPNMGVPIGPPHIYNGSMIPQMNNMQLHPQMY
                     HGAVNMVPVAQEDSAKLTNLIKGNKNTSDKQMKSKAKEVASKRSKKPSSSKSTIVNGK
                     DNSASTKNSVSGDKKKNETNKSKPVKTSDGKIKIKGRPNSSKSITKPAVQSEGK"
     gene            <849660..>851279
                     /gene="NDAI0G03530"
                     /locus_tag="NDAI_0G03530"
                     /db_xref="GeneID:11495630"
     mRNA            <849660..>851279
                     /gene="NDAI0G03530"
                     /locus_tag="NDAI_0G03530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671325.2"
                     /db_xref="GeneID:11495630"
     CDS             849660..851279
                     /gene="NDAI0G03530"
                     /locus_tag="NDAI_0G03530"
                     /inference="similar to DNA sequence:INSDC:YGL172W"
                     /note="similar to Saccharomyces cerevisiae NUP49
                     (YGL172W); ancestral locus Anc_8.125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671373.2"
                     /db_xref="GeneID:11495630"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="UniProtKB/TrEMBL:G0WEB9"
                     /translation="MFGGFGKSNSTGGLFGQSNATNAAASGATSMFGGSQNMQNNNAT
                     GGGLFGGAAPTGNTNTAATGGGLFGNAAPSGNINTAASSGAGGSLFGNTGNAPTTNTG
                     GGLFGNAAPSGTINTAATGGGLFGTANANANTGGGNTTTGGLFGNNTNKPGGLFGGNA
                     AQNTTTGGGLFGANNQQNTTTGGGLFGANNQQNTTTGGGHFGNKPASTTTGTGGLFGS
                     TNSGTTGTTGGLFGSKPNTTNTLFGGSNTNAPSTATTTLGSGRLFGSKPLGGTAGGGL
                     FGSNNTANIGGSSLFGQGNTMNTTGGLFGSSQYGQPQPQSTLQSIHQLPITPMTRIAE
                     LPPQLRQEIEQLDQYIQKQVQISEHLKADTEEHNNLIESIPKDISYLLKTELLTNQSL
                     SQDLKQISSIKELTDNNLSDTQLFTILFQQLLTPGSKISSLDLEKFYQRKIHSFQNKL
                     DDYSRVLSDIESAISGINGDIFGASQGHLPENTYTSELGNIDLAGLYNLKTGLNAIVS
                     TVIEEFGLFMDTAERIAELRQKVREITGSHT"
     gene            complement(<851534..>851914)
                     /gene="NDAI0G03540"
                     /locus_tag="NDAI_0G03540"
                     /db_xref="GeneID:11495631"
     mRNA            complement(<851534..>851914)
                     /gene="NDAI0G03540"
                     /locus_tag="NDAI_0G03540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671326.2"
                     /db_xref="GeneID:11495631"
     CDS             complement(851534..851914)
                     /gene="NDAI0G03540"
                     /locus_tag="NDAI_0G03540"
                     /inference="similar to DNA sequence:INSDC:YPR020W"
                     /note="similar to Saccharomyces cerevisiae ATP20
                     (YPR020W); ancestral locus Anc_8.123"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671374.2"
                     /db_xref="GeneID:11495631"
                     /db_xref="GOA:G0WEC0"
                     /db_xref="InterPro:IPR006808"
                     /db_xref="UniProtKB/TrEMBL:G0WEC0"
                     /translation="MLGRIQTIGSQLLSKGEVLSTKFIGKTNALMQKSMYYGKVGAEL
                     SKTVYKQEGFQPPKIGEFKKVYCNIFEMGKHYMNKPQAFIGLVKGAGKNDLIKFGAYG
                     VQLLGFYSVGEVIGRRKIVGYRTT"
     gene            complement(<852386..>855169)
                     /gene="NDAI0G03550"
                     /locus_tag="NDAI_0G03550"
                     /db_xref="GeneID:11495632"
     mRNA            complement(<852386..>855169)
                     /gene="NDAI0G03550"
                     /locus_tag="NDAI_0G03550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671327.2"
                     /db_xref="GeneID:11495632"
     CDS             complement(852386..855169)
                     /gene="NDAI0G03550"
                     /locus_tag="NDAI_0G03550"
                     /inference="similar to DNA sequence:INSDC:YPR019W"
                     /note="similar to Saccharomyces cerevisiae CDC54
                     (YPR019W); ancestral locus Anc_8.122"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671375.2"
                     /db_xref="GeneID:11495632"
                     /db_xref="GOA:G0WEC1"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR004039"
                     /db_xref="InterPro:IPR008047"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:G0WEC1"
                     /translation="MSNPPSSSPSKLAPPSSSPASNPGSVPQQPSSPALFYNSSSSQP
                     DTLGQGNSRSQNRNGTIGIGSSPFNYPSSSQQTSDILASQNINRTQGSSSNTPLPSRF
                     SNIRSDRSNAISSSPLADGSSRSIRMRRNDIHASDLSSPRRIIDFESRSSNNNPSSSS
                     DPVSQDNNEPLRIIWGTNISIQECTNSFRNFLMTFKYKYRKILDEREEFINSTTDEEL
                     YYVKQLNEMREVGNCNLNLDARNLLAFKQSEELYYQLLNYPQEVISIMDQTIKDCMVS
                     LVEDNHLDFDLDEIETKFYKVRPYNVGTVKGMRELNPNDIDKLITLKGLVLRATPVIP
                     DMKVAFFKCNVCDHTMVVEIDRGVIQEPARCGRVDCGEPNSMSLIHNRCSFADKQVIK
                     LQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVTGAFRSIPIRANSRQRVLKSL
                     YKTYIDVVHVKKVSDTRLGVDTSTVEQELLQNQIDHNEVEEVKKVTDQDIAKIREVAQ
                     REDLYDLLSRSIAPSIFELDDVKKGILLQLFGGANKVFKKGGRYRGDINILLCGDPST
                     SKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGICC
                     IDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPV
                     TDNIDLPPPLLSRFDLVYLVLDKVDEGTDRDLARHLTSLYLEDKPDHVSQDDILPVEF
                     LTLYINYAKENIHPVLVEEAKSELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRL
                     AEAHAKMRLSTEVQLEDVQEAVRLIRSAIKDYAMDPKTGKIDMNLVQTGKSVVQRKLQ
                     EDLAREVLKVLGEYSSDSMSFNELVKQINEHSQDKVDSSDISDILSRLQQEDKVIILG
                     EGIRRSIRLNNRV"
     gene            complement(<855635..>857566)
                     /gene="NDAI0G03560"
                     /locus_tag="NDAI_0G03560"
                     /db_xref="GeneID:11495633"
     mRNA            complement(<855635..>857566)
                     /gene="NDAI0G03560"
                     /locus_tag="NDAI_0G03560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671328.2"
                     /db_xref="GeneID:11495633"
     CDS             complement(855635..857566)
                     /gene="NDAI0G03560"
                     /locus_tag="NDAI_0G03560"
                     /inference="similar to DNA sequence:INSDC:YPR018W"
                     /note="similar to Saccharomyces cerevisiae RLF2 (YPR018W);
                     ancestral locus Anc_8.121"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671376.2"
                     /db_xref="GeneID:11495633"
                     /db_xref="InterPro:IPR022043"
                     /db_xref="UniProtKB/TrEMBL:G0WEC2"
                     /translation="MAETPSATNTPVRKGILSFFQTATDSDKLSPSSNKLKEKPKEKE
                     HLSIDIGDDTVEEIETESEEDGDVFVSIIHDTSIPEIIGDSLSDMKILKGPEEAKGML
                     PAVSDTDDILYKSKVHDDNVEDGTVAKDSRVDIKAEEERKNNNTSSAKDTPTDSVENK
                     ETLPSKEQDKLTKKELAAQKRAELKKEKELKKQEREKIRADEKLKREQKLQEEKRKKE
                     ELKQKREEEKRKRDEAKLEAKKQKELEKQQREQEKLKKQEAEAKAQLRIGNFFKKVND
                     SNRTISEKSDYEKHFLPFYARDGVEVCNNYKLSPKLLEKSKSSLDSSLKNKDADFENI
                     DSWLRSKYIRRGYEVKCSAINVLQKLTTKEKTELELETLLSTVPQKYIKFYENVRPPF
                     IGTYSKNVSLPITNPFSTEGTGYNYEYDSDLEWINEEDEEGGIDNLESGEEDEDEDED
                     DDQADDSEFEGFLDTEESAEANPSGKQRFIGPLIPTVFVRNELEKLDEGDKQYFDFVK
                     VQYLIGDQPFPIDPYELPLSLQANDKSDKKRNLTETADKTSNLTTPDGSPNKKPKSLI
                     TEPKDLLKLFDNIQDSTFSLNTITEIVQKTLPQYNKQTIKNTIKEYATRGVGKTEVSR
                     KWELKALANPLELRSRIQE"
     gene            complement(<857943..>858941)
                     /gene="NDAI0G03570"
                     /locus_tag="NDAI_0G03570"
                     /db_xref="GeneID:11495634"
     mRNA            complement(<857943..>858941)
                     /gene="NDAI0G03570"
                     /locus_tag="NDAI_0G03570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671329.2"
                     /db_xref="GeneID:11495634"
     CDS             complement(857943..858941)
                     /gene="NDAI0G03570"
                     /locus_tag="NDAI_0G03570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671377.2"
                     /db_xref="GeneID:11495634"
                     /db_xref="UniProtKB/TrEMBL:G0WEC3"
                     /translation="MTKGQVKKVEFATGPDVKNSKMSKERNRKGSAPEPSISQNYNPS
                     ERNFESKLINYNISSEESEGDFSDADTESSFSTTEESILWKEQQILDLIFLPFLEDLL
                     TILNYSRLIHIDNNISHTIIERFKEGFYPPNLLVTSSICDLLGFVLKNIRKLITLSNE
                     ELENKGSLGKAKDFLGPFIQDDFKNVMSQEDYKSMKRDIGAVYSYYFKKAKRRRHTPK
                     IKHSHKLTAQVRNESDEKLGGEVSGRIPPDIENRRKEKNQRAYTADEKNCSSRPIRKN
                     MDMSNDEDYSTTVTQLESPVCLNKRTEIPRRRGVDPLDRNDLEKLSLVIDDFDFFS"
     gene            <860575..>861720
                     /gene="NDAI0G03580"
                     /locus_tag="NDAI_0G03580"
                     /db_xref="GeneID:11495635"
     mRNA            <860575..>861720
                     /gene="NDAI0G03580"
                     /locus_tag="NDAI_0G03580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671330.2"
                     /db_xref="GeneID:11495635"
     CDS             860575..861720
                     /gene="NDAI0G03580"
                     /locus_tag="NDAI_0G03580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671378.2"
                     /db_xref="GeneID:11495635"
                     /db_xref="UniProtKB/TrEMBL:G0WEC4"
                     /translation="MTYFQHGDPSEGSQKNGDIDSLKQLIKVLDESKKESRTQLTKIL
                     SNIKDTERFTKIKQVQFELQQIESMAEYHAASLIKLEKRLSRLTLSDNNNTTGEKTNN
                     KENKVNTNVLKNTPKNNVLEYNPPEPTLLLSNNDSRGKFYEVRTSNGKEVRFYYEDPS
                     AQLSEKLEELSTFPKWCDNLSSLCNIWHLDNITKGEAITEGEEVILRKVIQNSLGKKL
                     YSFGKLGSTATEIFLELENVTKKKFPGVTKDKMWKKILIDKYCSNTNEIRHVLDNIIL
                     LEIYTEDPENAKPLDNKFINMKIYKCLSNDLRTSLMNSAMGLEELLNKSPREMITVII
                     ANINLIKELAEVYEEDEKPCQTCTSLLRGYWNCPLKKVTDLRQGTGN"
     gene            <862683..>863405
                     /gene="NDAI0G03590"
                     /locus_tag="NDAI_0G03590"
                     /db_xref="GeneID:11495636"
     mRNA            <862683..>863405
                     /gene="NDAI0G03590"
                     /locus_tag="NDAI_0G03590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671331.2"
                     /db_xref="GeneID:11495636"
     CDS             862683..863405
                     /gene="NDAI0G03590"
                     /locus_tag="NDAI_0G03590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671379.2"
                     /db_xref="GeneID:11495636"
                     /db_xref="GOA:G0WEC5"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:G0WEC5"
                     /translation="MVSIIEQYTKTCPQCQRTKHARVLPSGIFQLLAVPYRPWSSIGI
                     DFVSGMREVHKFNSVLVVIDRLTKIARFIPTKKTLDASDCADLLINHIICHHGVPDEI
                     VSDRDTLFTGKIWDRLRQRLRIHLKFTTSYNPASNGQTERTNDTMRKIIASYTNQHAT
                     DWPMYCSVAAFAYNNTYQSSIKTTLFFANYGFHPRLPGFTNPILDHSQNNEEQQTPGT
                     LQSNLDYSPSSTYEIXMVIDTK"
     gene            864809..864902
                     /gene="NDAI0Gtrna15L"
                     /locus_tag="NDAI_0Gtrna15L"
                     /db_xref="GeneID:11497228"
     tRNA            join(864809..864847,864858..864902)
                     /gene="NDAI0Gtrna15L"
                     /locus_tag="NDAI_0Gtrna15L"
                     /product="tRNA-Leu"
                     /note="codon recognized: CUA"
                     /db_xref="GeneID:11497228"
     gene            complement(865626..865698)
                     /gene="NDAI0Gtrna12K"
                     /locus_tag="NDAI_0Gtrna12K"
                     /db_xref="GeneID:11495691"
     tRNA            complement(865626..865698)
                     /gene="NDAI0Gtrna12K"
                     /locus_tag="NDAI_0Gtrna12K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:11495691"
     gene            <866721..>870335
                     /gene="NDAI0G03600"
                     /locus_tag="NDAI_0G03600"
                     /db_xref="GeneID:11495637"
     mRNA            <866721..>870335
                     /gene="NDAI0G03600"
                     /locus_tag="NDAI_0G03600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671332.2"
                     /db_xref="GeneID:11495637"
     CDS             866721..870335
                     /gene="NDAI0G03600"
                     /locus_tag="NDAI_0G03600"
                     /inference="similar to DNA sequence:INSDC:YPR010C"
                     /note="similar to Saccharomyces cerevisiae RPA135
                     (YPR010C); ancestral locus Anc_8.113"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671380.2"
                     /db_xref="GeneID:11495637"
                     /db_xref="GOA:G0WEC6"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR009674"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="UniProtKB/TrEMBL:G0WEC6"
                     /translation="MSKVIKPPSKARTAHFRTLERESRFINPPKDKSAFPLLQEAVEP
                     HIGSFNALTEGPDGGLLNQGVKDIGEKVIFDGRSLDNNDIDTIKEAYLGNKLSLSVEQ
                     VSIAKPMSNDGVSSGVERKVFPSETRQRLSSYKGKLMLKLKWSVNNGEEVYSEVRDCG
                     GLPIMLQSNRCHLNKLSPYDLVQHKEESDEMGGYFIINGIEKLIRMLIVQRRNHPMAI
                     IRPSFANRGASYSQYGIQLRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVM
                     ILKALCDTSDREIFDGIIGSDLKDSFLTDRLELLLRGFKKRYPTLQNRTQVLQYLGDK
                     FRVAFQASPDKSDYEVGQELIDRIVLVHLGKGNNQDKFNMLLFMIRKLYSLVAGECSP
                     DNPDATQHQEVLLGGFLYGMIIKEKIDEYLQNIVAQIRTDSNRGLAINFKDRKYMARV
                     LMRVNDNIGSKLQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS
                     FFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFAHKCKISTQQSDVSQVPALL
                     YSLGVSPVSHIFAAGPSLCCVQIDGKIIGWVSHEQGKIIADTLRFWKVEGKVPGLPLD
                     LEIGYVPPSNSGQYPGLYIFGGHSRMMRPVKYLPLDKEDIVGPFEQVYMNIAVTPQEI
                     ENNTHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDN
                     KLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERG
                     FGYGTMYKVEKVDLSLNRSRGDPITQHFGFGNDEWPKEWLDKLDDDGLPYIGTYVEEG
                     DPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRTPQI
                     GDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKS
                     GALHGVAHDATPWIFNENDTPADYFGDQLLKAGYNYHGNEPMYSGATGEELRADIYIG
                     VVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFL
                     LQDRLLNCSDYTQTSVCRECGSILTTQQSVPRIGSLSTVCCRRCAIKFDKAKALLASQ
                     DGDANVFIDDSQIWEDGQGNKFVGGNDTTTVAIPFVLKYLDSELTAMGIRLRYNVEPK
                     "
     gene            <870998..>873829
                     /gene="NDAI0G03610"
                     /locus_tag="NDAI_0G03610"
                     /db_xref="GeneID:11495638"
     mRNA            <870998..>873829
                     /gene="NDAI0G03610"
                     /locus_tag="NDAI_0G03610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671333.2"
                     /db_xref="GeneID:11495638"
     CDS             870998..873829
                     /gene="NDAI0G03610"
                     /locus_tag="NDAI_0G03610"
                     /inference="similar to DNA sequence:INSDC:YGL167C"
                     /note="similar to Saccharomyces cerevisiae PMR1 (YGL167C);
                     ancestral locus Anc_8.112"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671381.2"
                     /db_xref="GeneID:11495638"
                     /db_xref="GOA:G0WEC7"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR006413"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:G0WEC7"
                     /translation="MSANPFDQPLNDETADQERELLDATAKILSIPTSSLEYCTLSVD
                     ETLRKLETNGTTGLPTVAEASRRKLTYGPNEIEIEEDESLWKKFLSSFVEDRLILLLI
                     GSAVVSFFMGNIDDAISITLAIFIVVSVGFIQEYRSEKSLEALNKLVPAECHLIRCGQ
                     ESHVLASNLVPGDLVHFRIGDRIPADLRIIEAVDLSIDESNLTGECEPVHKSSQAINK
                     ESFNDQPNSIIPISDRTSIAYMGTLVKEGHGKGIVVGTGKNTSFGAVFDMMSNIEKPK
                     TPLQLSMDKLGKDLSLFSFGVIGLICFVGILQGRSWLEMFQISVSLAVAAIPEGLPII
                     VTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTASKIWCLGSM
                     DNKSNVLSLDKGKNSNLKNYLTDDVRETLIIGNMCNNASFSAEHGNYLGNPTDIALLE
                     QLPKFNMKDIRHTVKKVQEIPFNSKRKFMATKVVNPDGVYTLYVKGAFEKMLGHCSHY
                     LNEKGKNEKLTATQRETIIEAANALASEGLRTLAFAKQLLPDSPTLLTEDSIDDLIFT
                     GLIGMNDPPRTTVKPAIEQLLQGGVHVIMITGDSENTAVNIARQIGIPVIDPKLSVLS
                     GDRLNEMTEDQLANVIDHVNIFARATPEHKLNIVKALRKRGDVVAMTGDGVNDAPALK
                     LADIGVSMGRMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSI
                     AALSLIALSTAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKRPPRKRSDK
                     ILTSSVLKRLVGTATCIILGTVYIFVKEMAEDGVVTARDTTMTFTCFVFFDMFNALAC
                     RHNTKSIFEVGFFVNKMFNLAVGLSLLGQMCAIYIPFFQSVFKTESLSLGDLLFLLLI
                     SSSVFIFDEIRKYWIRRNDTDDALYYSIV"
     gene            complement(<874119..>875352)
                     /gene="NDAI0G03620"
                     /locus_tag="NDAI_0G03620"
                     /db_xref="GeneID:11495639"
     mRNA            complement(<874119..>875352)
                     /gene="NDAI0G03620"
                     /locus_tag="NDAI_0G03620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671334.3"
                     /db_xref="GeneID:11495639"
     CDS             complement(<874119..875352)
                     /gene="NDAI0G03620"
                     /locus_tag="NDAI_0G03620"
                     /inference="similar to DNA sequence:INSDC:YGL169W"
                     /note="similar to Saccharomyces cerevisiae SUA5 (YGL169W);
                     ancestral locus Anc_8.111"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671382.3"
                     /db_xref="GeneID:11495639"
                     /db_xref="GOA:G0WEC8"
                     /db_xref="InterPro:IPR005145"
                     /db_xref="InterPro:IPR006070"
                     /db_xref="InterPro:IPR010923"
                     /db_xref="InterPro:IPR017945"
                     /db_xref="UniProtKB/TrEMBL:G0WEC8"
                     /translation="MNISKLIVHKLRRALYSMTSSSSIQTLQTKILKVDASSIIFSTN
                     SHIDGSLPTITDIQSKNALLEAAQIIRDTNETVAFPTETVYGLGGSALNDQSVLNIYK
                     AKNRPSDNPLITHISSINQLNRKIFNDNSPSDPLENIPKIYHPLISKLWPGPLTILLS
                     TENTHGSLSERTTNFQSTFAVRIPSNPIARALIALSDTPIAAPSANTSTKPSPTLASH
                     VFHDLKGKIPLILDGGPCNIGVESTVLDGLSNPPMLLRPGGLTMEKILKLGNGQWDNC
                     KVESKLNVKSNEVVRTPGMKYKHYSPNAKVVLLIPSSTNEYLARLIDFIKMQTFNKLA
                     ILTSYHLNGLSLDDLSQINTNSKEHTIVIKSLGQTGEEIQANLFARLREVDEDDKVDL
                     ILVEGVTENEEGLAIMNRL"
     gene            complement(<875937..>876707)
                     /gene="NDAI0G03630"
                     /locus_tag="NDAI_0G03630"
                     /db_xref="GeneID:11495640"
     mRNA            complement(<875937..>876707)
                     /gene="NDAI0G03630"
                     /locus_tag="NDAI_0G03630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671335.2"
                     /db_xref="GeneID:11495640"
     CDS             complement(875937..876707)
                     /gene="NDAI0G03630"
                     /locus_tag="NDAI_0G03630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671383.2"
                     /db_xref="GeneID:11495640"
                     /db_xref="UniProtKB/TrEMBL:G0WEC9"
                     /translation="MSTFTKITTTILTMDNTDFKISIYVSDYMGPNAVLLGQPFLLPN
                     NIGVINNIYPHLGIFNIDIHYTPPFTNDRKKFTVPLHSTALADTAPSYVTTITTGPPS
                     LSPPSFTEPEICSQQFSIHSTATAQAHAQLSNHCAKIKANFDRRSHVSVPHFKIGDIV
                     LVGAQLRRSNHNSARKSTPSWAGPYIISKVLKHVYHFTELDGTPLRHHFPASFLKLFH
                     SRPGFSPILHFPGGEDSVGTDRIPAISTRSKSNHLRSH"
     gene            <877433..>877654
                     /gene="NDAI0G03640"
                     /locus_tag="NDAI_0G03640"
                     /db_xref="GeneID:11495641"
     mRNA            <877433..>877654
                     /gene="NDAI0G03640"
                     /locus_tag="NDAI_0G03640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671336.2"
                     /db_xref="GeneID:11495641"
     CDS             877433..877654
                     /gene="NDAI0G03640"
                     /locus_tag="NDAI_0G03640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671384.2"
                     /db_xref="GeneID:11495641"
                     /db_xref="UniProtKB/TrEMBL:G0WED0"
                     /translation="MTWLYNLLEHMGYPLSDNLLMVDNEPAIRLTSHPILHSRTNHIK
                     LRYHKIIEAVEDGVVKMEYINTWIKWLVC"
     gene            <880452..>881591
                     /gene="NDAI0G03650"
                     /locus_tag="NDAI_0G03650"
                     /db_xref="GeneID:11495642"
     mRNA            <880452..>881591
                     /gene="NDAI0G03650"
                     /locus_tag="NDAI_0G03650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671337.2"
                     /db_xref="GeneID:11495642"
     CDS             880452..881591
                     /gene="NDAI0G03650"
                     /locus_tag="NDAI_0G03650"
                     /inference="similar to DNA sequence:INSDC:YGL161C"
                     /note="similar to Saccharomyces cerevisiae YIP5 (YGL161C);
                     ancestral locus Anc_8.110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671385.2"
                     /db_xref="GeneID:11495642"
                     /db_xref="UniProtKB/TrEMBL:G0WED1"
                     /translation="MSQYGTTSSNHNNSNSILDIDDDLEGVDDFLNEPNPFEDPANEI
                     NHDNSRGNAVVGATDDQISADGPINNNYNNNNNNNRDGGQEFMSSNSMKNVPLQPTTP
                     PPPLNENSNKVENDVGNQKKLGPGLLNYYSQFFQLNSKQLISRIKFTFKLSISKQMRA
                     GGDDDNVGNVEDLGYDLYSAVWIPATVIMTNFITNGLISMIVDNIIKGIIIVGTREVA
                     KDTREEHFVKLLHSIWIFFGYTFLVPIISWNLFVKNRMASLPVESSSSGLSSSLKKLE
                     SVTDLISVYGYSNVFWVPCCIILDIILECESLSHGHKTVSIILKVMEWFIFVGFGGIL
                     SLAYIIKVIINDENGAINDKKNYGTFLFSIVLHVGFCYLLKRVIF"
     gene            complement(<881936..>883471)
                     /gene="NDAI0G03660"
                     /locus_tag="NDAI_0G03660"
                     /db_xref="GeneID:11495643"
     mRNA            complement(<881936..>883471)
                     /gene="NDAI0G03660"
                     /locus_tag="NDAI_0G03660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671338.2"
                     /db_xref="GeneID:11495643"
     CDS             complement(881936..883471)
                     /gene="NDAI0G03660"
                     /locus_tag="NDAI_0G03660"
                     /inference="similar to DNA sequence:INSDC:YGL162W,YPR009W"
                     /note="similar to Saccharomyces cerevisiae SUT1 (YGL162W)
                     and SUT2 (YPR009W); ancestral locus Anc_8.109"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671386.2"
                     /db_xref="GeneID:11495643"
                     /db_xref="GOA:G0WED2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G0WED2"
                     /translation="MPTSITVNNRDQKLPPLLLPNLDFHFQNQGGSIQLPIHPQSQSQ
                     SQSQSQPPQPSTAAIGPPLSAAPASSSSNPNGFVGITDSFFTTVDSRKRSNSNEEKNG
                     LDNLAFLATKRPRLTTFHPNGIANITPPPPSAVPSFPSYNNHSHSHSHSQPQPQPQPQ
                     PQHPYPYPHPNHNDNNNNNISTFPVNTHQFQVPPPHNNANNNNNNNNNNNIQFIPLRE
                     NNGFGTSNMSNSNTTNTNTNTNTNTNTITIRPSINNENKNNGNIGTSIHGQNNKSSYI
                     PTGSKRQRIGPSCDKCRYKKIKCNAKIDILAHDERIVPLFSQYLHHVFTTNEIKSNLN
                     LLKKFIITNDIISLMKRKITTISLIKHIDKLILFEPCTSCSKRRAAAVEAAATATIII
                     PSPTTTTTTTTTTNNNSNNSNNVSPSPLTSSTSPPPSSSSSSTSPSPGITTITSNNNN
                     QTPIPPTILESNTDCTTLQHGCVFSKGFTRADINIFSKILTRIKNKTIYEMTITDFKN
                     AGF"
     gene            <887290..>887934
                     /gene="NDAI0G03670"
                     /locus_tag="NDAI_0G03670"
                     /db_xref="GeneID:11495644"
     mRNA            <887290..>887934
                     /gene="NDAI0G03670"
                     /locus_tag="NDAI_0G03670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671339.2"
                     /db_xref="GeneID:11495644"
     CDS             887290..887934
                     /gene="NDAI0G03670"
                     /locus_tag="NDAI_0G03670"
                     /inference="similar to DNA sequence:INSDC:YOL149W"
                     /note="similar to Saccharomyces cerevisiae DCP1 (YOL149W);
                     ancestral locus Anc_3.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671387.2"
                     /db_xref="GeneID:11495644"
                     /db_xref="InterPro:IPR010334"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G0WED3"
                     /translation="MNGMTMDFYRKALNYNVIGRYDPKIKQLLFHTPHASIYKWDFNK
                     DEWNKLEYQGVLAIYLRDVSNENDILPSPVNYDDTGSMLADASISTISSVPNNNINTN
                     INVSSKENGGTVLSGKDIYNYGLILLNRINPDNFSMGILPNSVVNKRKVFDATGEAQN
                     PLECMGVEVKDDLVIIKNLKHEVYGIWIHTVADRQNIYELIKYLLENEPKDSFA"
     gene            <888440..>889537
                     /gene="NDAI0G03680"
                     /locus_tag="NDAI_0G03680"
                     /db_xref="GeneID:11495645"
     mRNA            <888440..>889537
                     /gene="NDAI0G03680"
                     /locus_tag="NDAI_0G03680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671340.2"
                     /db_xref="GeneID:11495645"
     CDS             888440..889537
                     /gene="NDAI0G03680"
                     /locus_tag="NDAI_0G03680"
                     /inference="similar to DNA sequence:INSDC:YDR249C"
                     /note="similar to Saccharomyces cerevisiae YDR249C;
                     ancestral locus Anc_8.483"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671388.2"
                     /db_xref="GeneID:11495645"
                     /db_xref="UniProtKB/TrEMBL:G0WED4"
                     /translation="MLSEGPQLKMLTLQDLPVHIIQKVFVLSGNGTAMPILNKTFYNC
                     LRPTDALVNTFFWENFTYDLSRAPLLEEHEKTHMPLAHIETLFDYPMFRNYITVHYDS
                     VFDQNDIFFINERQYKMITENVDDRWLKTLEHVRNEISKGGNDNDWWYNILYGLDFYD
                     SSWLPLTVRKNMELLFVSDAYADTIFQIFNYDGESGYRFVPFIVEWFVNADHTFTMND
                     LFAMIDFAQYAALDSFMHGELDETLEYIMTGYNMRHFVKNFKESNDNEYESYDDYRVS
                     FMKSLLAHYCCIPETGPMHSYACEDECPVLYSLIYADNDTTSFLKQLYLEFAKRELWI
                     PALQVRFSRDEHHLGSDSPGCYNGKHYKMMS"
     gene            complement(<890207..>892450)
                     /gene="NDAI0G03690"
                     /locus_tag="NDAI_0G03690"
                     /db_xref="GeneID:11495646"
     mRNA            complement(<890207..>892450)
                     /gene="NDAI0G03690"
                     /locus_tag="NDAI_0G03690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671341.2"
                     /db_xref="GeneID:11495646"
     CDS             complement(890207..892450)
                     /gene="NDAI0G03690"
                     /locus_tag="NDAI_0G03690"
                     /inference="similar to DNA sequence:INSDC:YOL148C"
                     /note="similar to Saccharomyces cerevisiae SPT20
                     (YOL148C); ancestral locus Anc_3.2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671389.2"
                     /db_xref="GeneID:11495646"
                     /db_xref="GOA:G0WED5"
                     /db_xref="InterPro:IPR021950"
                     /db_xref="UniProtKB/TrEMBL:G0WED5"
                     /translation="MNANSANDGHHSFGIPVNSPGNQSPPSNISSPPSTIPSNNVAGA
                     MSIPQGNIGAPVNPETRKAMLMQQQKLQQQKQRLLLQQQQQQALHNFENQFYQLLMTI
                     NKRPKRIYNFVEDTDSILKKYEQYRPSFEFHIYENNYKICAPANTRLQQQQRSPEISN
                     GGLVLNKNNETLKEFLEYVARGRIPEAIMEVLKDSNIQFYEGNLILQVYDHTNTVDIK
                     PNETKQQQQQQQQQQQQQQQPNQPQSLNATSQNQNIKQESNVQSSPPVSNNAVNKQQS
                     PAQSSPSSTQNQQHQQQQQPTIKRPRVYRTLLRPNDLTNYYDMMSYADYTRFSDGVYQ
                     QLESEILSLTKRNLNLSVPLNPYEHKDKLEDELFTEPYWDSKESKIIHTYREECKLDG
                     TKGQVGHIEEHEESPQHSSNYEQLMLIMSERTSTTTNSTFAITLAKNSSKANAGINTA
                     NASSKGNNNTSKASSISASNSGASGGLLSASNSSNSVSANQVSISAAGTNVANENNQF
                     SRLKFIEQWKIAKEKRKLQQQQQFMNNNKNNSQNRPTSVIGSAAAGSAMATPFNAKIS
                     MTAPSSAQGQQQQKNQKQPGKGTKRGAGNKSASDTPKPKKPRKNKENTNTNTIRVQMQ
                     MVALPPPLPLQLRLQNRQLLRRKELLRRNNQLNQSYSNSNSDKQEHLLRCHHRRMARI
                     YQHKLFMRLYILLYIYVMSVAEIWEMIFTCKQEQQQQQQHNTIIIYTCSDMSHIYFYV
                     VRTCALK"
     gene            complement(<892922..>893677)
                     /gene="NDAI0G03700"
                     /locus_tag="NDAI_0G03700"
                     /db_xref="GeneID:11495647"
     mRNA            complement(<892922..>893677)
                     /gene="NDAI0G03700"
                     /locus_tag="NDAI_0G03700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671342.2"
                     /db_xref="GeneID:11495647"
     CDS             complement(892922..893677)
                     /gene="NDAI0G03700"
                     /locus_tag="NDAI_0G03700"
                     /inference="similar to DNA sequence:INSDC:YOL147C"
                     /note="similar to Saccharomyces cerevisiae PEX11
                     (YOL147C); ancestral locus Anc_3.3"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671390.2"
                     /db_xref="GeneID:11495647"
                     /db_xref="GOA:G0WED6"
                     /db_xref="InterPro:IPR008733"
                     /db_xref="UniProtKB/TrEMBL:G0WED6"
                     /translation="MPDATIVLHPTITHLVKFLDTTAGREKVLRLLQYLCRVIALNQK
                     SPLAKGLQMEFTMIRKLLRFLKPLNHLQLASKFLVMTSGKDEDFIIKYCNVLKNLFFA
                     IYLSLDQVNLFRLLKLIPVTPFTGQKVPRWANFFWLFALVSGIVMDLRKIQTTEIQLR
                     NELFAKKSEQSTTQVAGKTVPSPSFDKTKLKIITKEKYAAVRRLVWDCADSFIVLNNL
                     NYLKSRDDYVGMAGVVTSLFGLQDLWKAAVPSK"
     gene            complement(<894337..>897702)
                     /gene="NDAI0G03710"
                     /locus_tag="NDAI_0G03710"
                     /db_xref="GeneID:11495694"
     mRNA            complement(<894337..>897702)
                     /gene="NDAI0G03710"
                     /locus_tag="NDAI_0G03710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671343.2"
                     /db_xref="GeneID:11495694"
     CDS             complement(894337..897702)
                     /gene="NDAI0G03710"
                     /locus_tag="NDAI_0G03710"
                     /inference="similar to DNA sequence:INSDC:YOL145C"
                     /note="similar to Saccharomyces cerevisiae CTR9 (YOL145C);
                     ancestral locus Anc_3.5"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671391.2"
                     /db_xref="GeneID:11495694"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G0WED7"
                     /translation="MSVTPASTPAPTMAAVAAYPSMEWATTLDIPLKASEELVSIDLL
                     TDLPDDPSDLRTLLVEESASREHWLTIACSYVNQGRIDAGIELIKMALQVDHFVDSKI
                     DMGHFYTFLTWCHLKKCKLVSRTIEEKFKYLNEAENCLKEAIGINPTWVCNMLATVDL
                     YYQRGHYDKALETCDLFVKGLQQDVTNLATTNASPNCMFLLLRAKLLFRKKNFMASLK
                     LFQELLVNNPVLKPDPRIGIGACFWQLKDYKMAINAWERSLELDPTNKNSKVLCLLGK
                     FHKTLIDSGNDDEFKDNFKDAMIDLSNIYQTENGKENPVLLTLLQSYYYYKGDYKKIL
                     NIYEERIKPISSIVTDTILSESTLWCGRAYYALNDYRQAFAMFQESLKKNEDNLLSKL
                     GLGQTQIKTNLLEESVLTFENIYKTNENIQELNYILGLLYAGKCLDKKDSRNNQKNDT
                     EKKNASNKELSIMNSKAIKYLEKYIKSTNSKRNQLVIPRAYFVISQLYESTNQYKQSL
                     EYLIKALEEVKFVKNGRIDDVPIELLNNLGSFYYMNGDMIKTKEYFQLAKEKLTSGSS
                     LSSSTENESTLITVNYNIARSLESEPENITKAQELYEDILSKHPNYISAKIRNLFYKY
                     LNHVEDPKMIENEMESLNDNNESNLEIRSFYSWFLKKNTTTQKREEKQTSYNKDTLVK
                     YDSHDLYALISLGNLYCIIGRECRKNVKEQEKSKHSYLKSIQLFQKVLQIDPMNVFAA
                     QGIAIIFAESKRLGPALEILRKVRDSIDNEDVHINLANCLLEMREFNKAIENYDLILK
                     KFPKISNKSHILNLLAKTWYSRGLKEKKIEFFFKALVNTEDAIKFENVKETKNERFLS
                     ILKFNVALLNFQIAETLRRSNVKERRIKDLQKSVKGLDDAINILKELNVSKDFNIIPK
                     EELEQRIQLGETTMKNVLERCLMEQEQYERDQKNKLLEARKLLEEQELKVKEQLSKEE
                     EEKRLKLEKQTEEYKRLQDEAQKLIQERESLLVEEDNVSDKAFSGDEDEASNKKPKRK
                     RKRAATATTNGESGKKPKQKRQKKSRGVISDDESEEEEEAKLTADEDEDDAIVSRRGK
                     KSTLSNEMVDESDEESDIEDDEEDKDDGNDGLF"
     gene            <898071..>899657
                     /gene="NDAI0G03720"
                     /locus_tag="NDAI_0G03720"
                     /db_xref="GeneID:11495649"
     mRNA            <898071..>899657
                     /gene="NDAI0G03720"
                     /locus_tag="NDAI_0G03720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671344.2"
                     /db_xref="GeneID:11495649"
     CDS             898071..899657
                     /gene="NDAI0G03720"
                     /locus_tag="NDAI_0G03720"
                     /inference="similar to DNA sequence:INSDC:YOL144W"
                     /note="similar to Saccharomyces cerevisiae NOP8 (YOL144W);
                     ancestral locus Anc_3.6"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671392.2"
                     /db_xref="GeneID:11495649"
                     /db_xref="UniProtKB/TrEMBL:G0WED8"
                     /translation="MTNITTTPTPVRVFVGNIFHDFDSCLNDLYKRFGTFGSCLDPHF
                     EKHGTFAYLNMSFDPTKNDKGFEFLKRSLNNVKFKGNVLKIDMAKPNWEETWKLRHES
                     DIKENVKKEKFNAKQDWKHYKKLENISLSLKDHQELMKGRMRKTPRKKSELRKITFRI
                     NVNGSLKVYKCYKTKLWGYERNKDLRDLVVKFVGNKWKNGFDHIVDKLDYSRSNKNFQ
                     SRVIEFKTKSNTGSISLGMENDSGDEDMSEEEKEKNNEVLSKVLQDFDFDKPMKISLD
                     DDDVDDEDEEMRGQQNKNYDTNYNNREIREDRDVQQRHTQVETESITENEGEEEGEQE
                     EEEEFIPTFGATTTSVEQPASVVEGTISNTKTLRNLFAPDESQSTTSFKLIEENDEDI
                     DHERDEEMKRKQQQERDEYMATHVPVVDTPINTNELKENKNFLFFPHHDSPFLVGQTQ
                     LTKIIANSIPSEKVGEDNKDTINNGNNNNNPLYNWEDEFWGNRGVWMKEMKNRKRDAL
                     RQLRKRRNHNNDRQGNGLLI"
     gene            complement(<899887..>900396)
                     /gene="NDAI0G03730"
                     /locus_tag="NDAI_0G03730"
                     /db_xref="GeneID:11495650"
     mRNA            complement(<899887..>900396)
                     /gene="NDAI0G03730"
                     /locus_tag="NDAI_0G03730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671345.2"
                     /db_xref="GeneID:11495650"
     CDS             complement(899887..900396)
                     /gene="NDAI0G03730"
                     /locus_tag="NDAI_0G03730"
                     /inference="similar to DNA sequence:INSDC:YOL143C"
                     /note="similar to Saccharomyces cerevisiae RIB4 (YOL143C);
                     ancestral locus Anc_3.7"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671393.2"
                     /db_xref="GeneID:11495650"
                     /db_xref="GOA:G0WED9"
                     /db_xref="InterPro:IPR002180"
                     /db_xref="UniProtKB/TrEMBL:G0WED9"
                     /translation="MAVKGLGKIDQKYDGSRLRIGIIHARWNNVVIDALVKGAIERML
                     SLGVQESNIIVETVPGSFELPYGAKRLAQREEKNGTPLDAVIPIGVLIKGSTMHFEYI
                     SDSTTQAIMALQDKIDIPVIFGLLTCLTEEQALARAGIDEGKTMHNHGEDWGAAAVEM
                     ATKFGRNAF"
     gene            complement(<900866..>902167)
                     /gene="NDAI0G03740"
                     /locus_tag="NDAI_0G03740"
                     /db_xref="GeneID:11495651"
     mRNA            complement(<900866..>902167)
                     /gene="NDAI0G03740"
                     /locus_tag="NDAI_0G03740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671346.2"
                     /db_xref="GeneID:11495651"
     CDS             complement(900866..902167)
                     /gene="NDAI0G03740"
                     /locus_tag="NDAI_0G03740"
                     /inference="similar to DNA sequence:INSDC:YNL330C"
                     /note="similar to Saccharomyces cerevisiae RPD3 (YNL330C);
                     ancestral locus Anc_3.8"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671394.2"
                     /db_xref="GeneID:11495651"
                     /db_xref="GOA:G0WEE0"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR003084"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:G0WEE0"
                     /translation="MVYENKPFDEIQVKPNDKKRVAYFYDADVGNYAYGSGHPMKPHR
                     IRMTHSLIMNYGLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESV
                     KFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKCDVAINYAGGLHHAKKSEASGF
                     CYLNDIVLGIIELLRYHPRVLYIDIDVHHGDGVEEAFYSTDRVMTCSFHKYGEFFPGT
                     GELRDVGVGKGKYYAVNVPLRDGIDDATYRNVFEPVVKRIMEWYQPSAVVLQCGGDSL
                     SGDRLGCFNLSMQGHANCVNYVKSFGIPMMVVGGGGYTMRNVARTWCFETGLLNNVVL
                     DQELPYNDYYEYYGPDYKLDVRPSNMFNVNSPEYLDKIMTSIFVNLENTKYAPSVQLN
                     NVPKDPEDLGDQEEDTAEAKDTKGGSQYARDKEVERTDELY"
     gene            <902575..>903336
                     /gene="NDAI0G03750"
                     /locus_tag="NDAI_0G03750"
                     /db_xref="GeneID:11495692"
     mRNA            <902575..>903336
                     /gene="NDAI0G03750"
                     /locus_tag="NDAI_0G03750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671347.2"
                     /db_xref="GeneID:11495692"
     CDS             902575..903336
                     /gene="NDAI0G03750"
                     /locus_tag="NDAI_0G03750"
                     /inference="similar to DNA sequence:INSDC:YOL142W"
                     /note="similar to Saccharomyces cerevisiae RRP40
                     (YOL142W); ancestral locus Anc_3.13"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671395.2"
                     /db_xref="GeneID:11495692"
                     /db_xref="GOA:G0WEE1"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR026699"
                     /db_xref="UniProtKB/TrEMBL:G0WEE1"
                     /translation="MASAQQQQQMHMILPGDSLPISETDLKSHRLVLGPGLYTDPKTL
                     TIHPVNAGKLYITQNNNSNRINIHIDYESHRYIPHVNDLVIGCIVGTFADSYKVSLNS
                     FSNSVSLSYMAFPNASKKNRPTLKIGDLVYCKVATAVKELEATVECLESGFGLLEDGM
                     IIDSTGLKFVRLLLFDDQFPLLRLLASRTKFEIAIGVNGKIWIKADEIKDTLACYRSI
                     LDCSMCQSVDQFANIIKKHFQDLNTVAAATAATEN"
     gene            <903652..>905772
                     /gene="NDAI0G03760"
                     /locus_tag="NDAI_0G03760"
                     /db_xref="GeneID:11495652"
     mRNA            <903652..>905772
                     /gene="NDAI0G03760"
                     /locus_tag="NDAI_0G03760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671348.2"
                     /db_xref="GeneID:11495652"
     CDS             903652..905772
                     /gene="NDAI0G03760"
                     /locus_tag="NDAI_0G03760"
                     /inference="similar to DNA sequence:INSDC:YOL141W"
                     /note="similar to Saccharomyces cerevisiae PPM2 (YOL141W);
                     ancestral locus Anc_3.15"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671396.2"
                     /db_xref="GeneID:11495652"
                     /db_xref="GOA:G0WEE2"
                     /db_xref="InterPro:IPR007213"
                     /db_xref="InterPro:IPR011043"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0WEE2"
                     /translation="MTDNNPLVNPVLSSRSDKSLSKKQERKSKYADLAIQGTNNSSIA
                     SKRSVELLYLPKLNKDDKTTKSEYFKWFVPKNIKRSPCINRGYWLRLHAIRSRLKSIL
                     ESNNGKKLLVINLGCGFDPLPFELLDRSNKSAECFQDTISFIDVDYSDLLVNKIKIIE
                     NSQELSQIITREQSSHISEDTLITKNYRTAPCDLNDSQAFEILSQDESLNLNDTNVIK
                     IFIAEVSLAYMKPSNADGIISICSKIPNSHFVILEQLIPEGPYEPFAKQMLKHFRNND
                     SPLQSVLTYPTINSQLERFKKLGFPIINAGDMLNLWKQLPLETRSKIETIQPFDELEE
                     FHLFAHHYILLHATNDTLFRFTDDYKFPSQVHAPLLSERSLKIKLTHEELNIKRSFGS
                     SYVSKGTKNQITYHGGCNPTRLNETLIITPLHTEGSPSEEGYQIQTIKNDDPNFKKRM
                     NHTFVNGIIIGGREAPHRPIYETIKFNGNSEYSYGMELPHGIERHRHCAVNVSENEIL
                     VFGGKVHSTPDAYRKDAFLSYDISKDEYTEVPYYTAIHTTPPCLIGSSMSYDKERNIG
                     VILGGQLFKDDSFSDKLYKFSYCSRKKEITILDVFSNPLFQRYGSKCVFINDHQIMIV
                     GGTSPEIVFNDRTTIITVDILTAKINSIPIPRNIWEESQVFLVGFELLKISETKVLIF
                     AGGATCYGFGSVSNVGIEITLPST"
     gene            <906158..>907402
                     /gene="NDAI0G03770"
                     /locus_tag="NDAI_0G03770"
                     /db_xref="GeneID:11495653"
     mRNA            <906158..>907402
                     /gene="NDAI0G03770"
                     /locus_tag="NDAI_0G03770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671349.2"
                     /db_xref="GeneID:11495653"
     CDS             906158..907402
                     /gene="NDAI0G03770"
                     /locus_tag="NDAI_0G03770"
                     /inference="similar to DNA sequence:INSDC:YNL323W"
                     /note="similar to Saccharomyces cerevisiae LEM3 (YNL323W);
                     ancestral locus Anc_3.16"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671397.2"
                     /db_xref="GeneID:11495653"
                     /db_xref="GOA:G0WEE3"
                     /db_xref="InterPro:IPR005045"
                     /db_xref="UniProtKB/TrEMBL:G0WEE3"
                     /translation="MVNFDLSQVGATFRKKDKEYKDVVVPEEEEEDIDASEFEDDEIL
                     PQKVKNRRPREDDFTQQRLAALNPVLTPKTVIPIYLIIAGVFVIVGGCLLALASRVDE
                     MTLYYQDCMTAAPTDDFADMPTSHYKYYFHNLPNFDTSPQWRFIDDPNDDFQERGTCQ
                     IRFTIPRTIKKTVYINYMLEKFAANHRRYVLSFSEDQLRGAKASYDVIHDSTGINCKP
                     LARSSNGKLYYPCGLIANAMFNDTFPMELINVTDTSNNYPLTNQGINWKTDRQRFKKT
                     KYNYTEITPPPFWEKSFPDGYNETNIPNIQEWEEFQNWMRPGAFDKSTKLIRRNGNDS
                     LPAGEYEIDIGLHWPVTEFNGKKAVYITHGSSIGGRNSFLGIVYLIGGCICCAMAIVL
                     AGCWVMSGRKIADPNSLSWNKH"
     gene            <907966..>909249
                     /gene="NDAI0G03780"
                     /locus_tag="NDAI_0G03780"
                     /db_xref="GeneID:11495688"
     mRNA            <907966..>909249
                     /gene="NDAI0G03780"
                     /locus_tag="NDAI_0G03780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671350.2"
                     /db_xref="GeneID:11495688"
     CDS             907966..909249
                     /gene="NDAI0G03780"
                     /locus_tag="NDAI_0G03780"
                     /inference="similar to DNA sequence:INSDC:YOL140W"
                     /note="similar to Saccharomyces cerevisiae ARG8 (YOL140W);
                     ancestral locus Anc_3.17"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671398.2"
                     /db_xref="GeneID:11495688"
                     /db_xref="GOA:G0WEE4"
                     /db_xref="InterPro:IPR004636"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G0WEE4"
                     /translation="MFRRKLSTTTSRLTSSLKATLQKDVNYQVTTYARPNDLCVTRGL
                     NAKLYDDINNKEYIDFTAGIAVTALGHSNPQVSKILAEQSKKLIHSSNLYYTAESLEL
                     SAKIIEKTKQFGGQHDASRVFLCNSGTEANEAALKFAKKHGITINPKKQGLVAFQNSF
                     HGRTMGALSVTWNAKYRTPFGDLIPHVSFLNLNDELTVLQNFIREKKDELAGLIVEPV
                     QGEGGIFPVPEEKLIGLKQICQENDVMVIYDEIQCGLGRTGKLWAHAHLPKEAHPDIF
                     TAAKALGNGFPIAATIVNEKVNNSLKVGDHGTTYGGNPLGCAVSKYVMDTLAKEDFLQ
                     QVQRKADLFTKRLTQIQRRFPHHIKDVRGKGLMIGAEFVEPPAELVKKARELGLLVIT
                     AGKSTVRFVPALTIEDEVIEEGLNIFEKAVESVYA"
     gene            complement(<909600..>910232)
                     /gene="NDAI0G03790"
                     /locus_tag="NDAI_0G03790"
                     /db_xref="GeneID:11495655"
     mRNA            complement(<909600..>910232)
                     /gene="NDAI0G03790"
                     /locus_tag="NDAI_0G03790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671351.2"
                     /db_xref="GeneID:11495655"
     CDS             complement(909600..910232)
                     /gene="NDAI0G03790"
                     /locus_tag="NDAI_0G03790"
                     /inference="similar to DNA sequence:INSDC:YOL139C"
                     /note="similar to Saccharomyces cerevisiae CDC33
                     (YOL139C); ancestral locus Anc_3.20"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671399.2"
                     /db_xref="GeneID:11495655"
                     /db_xref="GOA:G0WEE5"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="InterPro:IPR019770"
                     /db_xref="InterPro:IPR023398"
                     /db_xref="UniProtKB/TrEMBL:G0WEE5"
                     /translation="MSVEEVSQKLETVSVSDDTPKTVLTDSNNFEVKHPLNSKWTLWY
                     TKPAVDKSESWSDLLRPVTSFETVEEFWAIIQNIPEPHELPLKSDYHVFRGDIRPEWE
                     DTANSKGGKWSFQIRSKGSEIDELWLRTLLAVIGETIDEEESEINGVVLSIRKGGNKF
                     ALWTKSENEQALRNIGAKFKQVLKLTEDGHLEFYPHSSANNRNAQPTITL"
     gene            <910625..>911506
                     /gene="NDAI0G03800"
                     /locus_tag="NDAI_0G03800"
                     /db_xref="GeneID:11495702"
     mRNA            <910625..>911506
                     /gene="NDAI0G03800"
                     /locus_tag="NDAI_0G03800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671352.2"
                     /db_xref="GeneID:11495702"
     CDS             910625..911506
                     /gene="NDAI0G03800"
                     /locus_tag="NDAI_0G03800"
                     /inference="similar to DNA sequence:INSDC:YNL320W"
                     /note="similar to Saccharomyces cerevisiae YNL320W;
                     ancestral locus Anc_3.21"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671400.2"
                     /db_xref="GeneID:11495702"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR029059"
                     /db_xref="UniProtKB/TrEMBL:G0WEE6"
                     /translation="MILEGIAITTSASLLLLYLCQNKLLYPSWINKYRNVDALLSQEY
                     DLPYTREMLTTDDNIQIEAYNLKNENGNSISTILILSPNAADIRLSLLIMDVFYNQMN
                     TSVFIYSYRGYGISQGQPTEEGLKKDADCVIEYLKNDPFYKTKKLILYGRSLGGANAI
                     YIASKYHNFVKGIILENTFLTVRKIIPYILPVSKYFSFFCKDIWNSERDIVQIDQDVP
                     FLFLSGLKDKIVPPSQMKRLYDLCPSRYRELFEFNEGGHNDTIIQDGYWEIIEEFLKK
                     YKMIDNEVKIEAMAPHL"
     gene            complement(<911595..>915776)
                     /gene="NDAI0G03810"
                     /locus_tag="NDAI_0G03810"
                     /db_xref="GeneID:11495657"
     mRNA            complement(<911595..>915776)
                     /gene="NDAI0G03810"
                     /locus_tag="NDAI_0G03810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671353.2"
                     /db_xref="GeneID:11495657"
     CDS             complement(911595..915776)
                     /gene="NDAI0G03810"
                     /locus_tag="NDAI_0G03810"
                     /inference="similar to DNA sequence:INSDC:YOL138C"
                     /note="similar to Saccharomyces cerevisiae YOL138C;
                     ancestral locus Anc_3.22"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671401.2"
                     /db_xref="GeneID:11495657"
                     /db_xref="GOA:G0WEE7"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G0WEE7"
                     /translation="MMNMPPRRDIAVSRNKMHSTHHGSLPRSYSSIGSSMKNDSSTIT
                     SINRSSLRTSLHLPSSSERSSYYIQKHFHKNNISNNGNSKNTDSVGSTDKTQGKISNN
                     NGNILRHADPAESKQSSGLLYSHRTNKELSSISKINDPNNNGLMCAGKDHLGFYRFSP
                     ENESITLVHDILDSNSGSLRHGVKATNNRIKRGKKIKLSTIADIKTGFGEQKNLIAIC
                     TNSTDISIFDIIKILILKPLINHISEHTRSINSFDFNMIQTHLIISGGQDACVKIWDL
                     RSNATRNSTPCDISFNTASDSIRDIKWMPGHDFVHSINNGAGYKFASIHDSGYLLKYD
                     IRKPGQIEKKINAHTGPGLCLNWHPHHNYIATGGRDGKCCLWYLGDKPSPNLENAMEQ
                     INEMSQHPPSSSHSMSAASVLNHTWNPGNLNSSNVSSFPEMTINTGSPITKLKFRPSF
                     DVNVFNSLLALSSMGDEAQVSIYSLARKYIPKNVLLTSASSLGLAWWDDALIFNVDKN
                     SFINGWDISKEPTVLQNLPKNVTKWRDLDGNGLLFIDQKAGSYEVANDVKPVISKKAL
                     ASNNRVNINQILSPIPSQSTADTVIPTTTKKIMQNIKMGLTGHSKRPSMHSLERPSLG
                     QSFSTRSVLQNKNNNTVLPPKNVSSLSLSNVQNNHSNIVDVTINGLIEKRTIDEPIIV
                     TLDLPCILNDIRMSQLPKDLVTEETMRIKESPVEVFKYLAKELEFSYIKGRHYDIENG
                     IDDDKIRDKDQYDNEKSKNEAHEMLGEKYGLLENTTWTNLIANRRKEEHEASNSDDAT
                     SISKSSISSHILDRSVTGAGESNEKSPSIKPPSSLRKTAKLRKEREISKLTESMHQSA
                     AIQIQDKTDTLIDLVSICNHNSEVYFRIGDSPNFKTWILIRDALLWELKRLNDPLKRE
                     VIYDKEQLTHVMGKIQEGHAKDTDDKTQKTLRNDKNRISKRIESIDSDSSKFITSDRG
                     SFIEENSLTVEQSSPEIKEVSETSEEDELRLAKQEECPQQQKSMLESITELRKLSKLG
                     DGSSQDASAVEDENELSKRNVNNVQPKSAIFQSDKESVKTSSEDKTIESSGDQGKNDD
                     VVAVATKTKPTKIIPILRRKSERPSFIDTFMTAIPPTDGAMGTKSPQLCNTPSPFSNT
                     SPRSHMSSLRSFAGSPSDLTLFRRKTTSYFQNEALDTSGLDLTSLSSGENDEIIEPER
                     KVHVIPPWNTKRIIQQVYEQAVAEGNVFLVINILLLFQDMYHITSMDIVKSSVYHFIS
                     LLHRYELFGCAASLLKYCPWNDIMGAEGDQSTIQIYCEKCGALLMNEVSKRKLTMEAQ
                     QTHDKTVLGKFGYWYCDSCRKPNSLCVICECPMKKLTLTALRCGHEAHFQCFKNWFLD
                     EGMNTCPAGCLGELI"
     gene            <916122..>917630
                     /gene="NDAI0G03820"
                     /locus_tag="NDAI_0G03820"
                     /db_xref="GeneID:11495658"
     mRNA            <916122..>917630
                     /gene="NDAI0G03820"
                     /locus_tag="NDAI_0G03820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671354.2"
                     /db_xref="GeneID:11495658"
     CDS             916122..917630
                     /gene="NDAI0G03820"
                     /locus_tag="NDAI_0G03820"
                     /inference="similar to DNA sequence:INSDC:YOL137W"
                     /note="similar to Saccharomyces cerevisiae BSC6 (YOL137W);
                     ancestral locus Anc_3.24"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671402.2"
                     /db_xref="GeneID:11495658"
                     /db_xref="GOA:G0WEE8"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G0WEE8"
                     /translation="MDDPSTLGHIEMEDLMPADGHTNEQKKESPAQDATPLMGEAKAG
                     KSSSDDINALPLEGMRDVIWKDHVIKVYPLNYQKIHIVRWQIFAGLLLFLVFGLNDQT
                     TGSLMPTLVEEYNISRVKVSTIFFLQLLGYTLASLCNEWVHRLVGTRGGVIIATSICL
                     IFFSILVSKPSNFYLYLFCYLPLGLAVGILDSLGNVLIGNLVVHKNEFMGLMHAAYGA
                     AAMVTPPLVSHFVGAKHWPLVFFIPLTISAIALIIVIPSFRFETAVKYDYICHEEDEV
                     NEMGETPLEENALDIEKVDEAKFLTMLQKPPVLLYAIFLFLYLGAEISTGSWLFTYLL
                     ETKSDNKISMSYIVASYWMGLTVGRLCLGFVSDRYFPNVYRANRVYAYLTVCWYTVFV
                     VVGLFHSNSNFYFAVLFIVIFLCGVFIGPLFPNGSIVALQVLPRRLHISGIGIAVAVG
                     GCGGAALPYSVGVITHIAGVEWIPFLCWAMVVLVTLVWSLYPRYIHGYDEFL"
     gene            <919944..>921476
                     /gene="NDAI0G03830"
                     /locus_tag="NDAI_0G03830"
                     /db_xref="GeneID:11495659"
     mRNA            <919944..>921476
                     /gene="NDAI0G03830"
                     /locus_tag="NDAI_0G03830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671355.2"
                     /db_xref="GeneID:11495659"
     CDS             919944..921476
                     /gene="NDAI0G03830"
                     /locus_tag="NDAI_0G03830"
                     /inference="similar to DNA sequence:INSDC:YNL317W"
                     /note="similar to Saccharomyces cerevisiae PFS2 (YNL317W);
                     ancestral locus Anc_3.25"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671403.2"
                     /db_xref="GeneID:11495659"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G0WEE9"
                     /translation="MDQPQKKYVIHRRTVDLSSPYARLQFNKKHGLSTIPTIEPETSY
                     ATNIMPPSAYNNDYNMQRILNVPSKFTHLSSNKVKHVIPAIKWTPEGRRLVVATYNGE
                     FSLWNGTSFNFESLMQAHDSSVTTMEYSHDGDWMISGDSDGIIKIWQANFNMVKELDD
                     AHTECIRDVAFSGNDSKFVSCSDDNILKIWNFSNGKLERVLSGHHWDVKSCDWHPEMG
                     LIISASKDNLIKLWDPRSGNCVSTILKFKHTVLKVKFQPTGGNMIAAISKDKSCRVFD
                     IRHSMKELLCVRDEVDYMTLLWNPINESMFTVGNYDGSIKHFDLLQDLTKPTHVIPYA
                     HDKCVTSLSYNPMGNILASASKDRTVRFWTRASPIDPNAYDDPTYNNDKINGWFFGIN
                     NNINAVRNKTEHGVAPPVPTNDDNNTISKINGNFMTGANNTLLMQNGNNRMQMSNHIN
                     TNGAMVPPGMPPYTMNMNMHTHINTGMDMSNTPLNTPDIDSKLPGLTPKTNNSSGLPG
                     LG"
     gene            complement(<921909..>923360)
                     /gene="NDAI0G03840"
                     /locus_tag="NDAI_0G03840"
                     /db_xref="GeneID:11495660"
     mRNA            complement(<921909..>923360)
                     /gene="NDAI0G03840"
                     /locus_tag="NDAI_0G03840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671356.2"
                     /db_xref="GeneID:11495660"
     CDS             complement(921909..923360)
                     /gene="NDAI0G03840"
                     /locus_tag="NDAI_0G03840"
                     /inference="similar to DNA sequence:INSDC:YOL136C"
                     /note="similar to Saccharomyces cerevisiae PFK27
                     (YOL136C); ancestral locus Anc_3.26"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671404.2"
                     /db_xref="GeneID:11495660"
                     /db_xref="GOA:G0WEF0"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0WEF0"
                     /translation="MDHIINNNNNTTPNNETTSNAITSTVPTNVFSTVDSNTSKTAKS
                     KQSSNSLFSLEGYNNSSYSKLDYLMNNSSYYYDNDEIEKDPCFLPKVNNTLHFETKDI
                     QKPSPLSHLTFNYPQKMETITPTNSYIVDNTTNITADIHNNNNNSNTLTHQIHVPNKF
                     VIIMIGLPAVGKSAISKQLVEYISQNFTSSDDRVPLRIEIFNAGDMRRAMSKKRFNTV
                     MNLPNNSTDDIFNPKNSNKKEEFAKLTLNKLINELNNDFCDIGIFDATNSTVLRRNFI
                     FETLFEFNNQQTSNFNLIPIVLQVTSSNPNFIKFNIHNKSFNEDYFDKPYHLAVKDFA
                     SRLKHYYSQFVPFSTDEFNHIIEKTPDCNLFYFNIIDAGLKLIPEKDHYNYLSKVPTN
                     SNSQRIHFLINLISSFVQNYNQLYGHLYVEKVDNFFQNEQEIQQPIEFPQHFIQPARV
                     DNINWDNSKKLNYLSVLSEVVNHDYLKDLFGNK"
     gene            complement(<924876..>925352)
                     /gene="NDAI0G03850"
                     /locus_tag="NDAI_0G03850"
                     /db_xref="GeneID:11495661"
     mRNA            complement(<924876..>925352)
                     /gene="NDAI0G03850"
                     /locus_tag="NDAI_0G03850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671357.2"
                     /db_xref="GeneID:11495661"
     CDS             complement(924876..925352)
                     /gene="NDAI0G03850"
                     /locus_tag="NDAI_0G03850"
                     /inference="similar to DNA sequence:INSDC:YOL135C"
                     /note="similar to Saccharomyces cerevisiae MED7 (YOL135C);
                     ancestral locus Anc_3.27"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671405.2"
                     /db_xref="GeneID:11495661"
                     /db_xref="GOA:G0WEF1"
                     /db_xref="InterPro:IPR009244"
                     /db_xref="UniProtKB/TrEMBL:G0WEF1"
                     /translation="MSGNNEDANAFGSLYPPPPPYIKFFTEENLSKLPEYQKLKKSGT
                     IEEIDANKDTNDDTETITSELDFLIPPEMPRTQQYRAFGNIWQVKDQLPDLGSMGITQ
                     LYKTSNEIGGPMNYQYKIEESRKLLKSLLLNYLELIGILSINPELYEKRWKIFELY"
     gene            <925672..>926043
                     /gene="NDAI0G03860"
                     /locus_tag="NDAI_0G03860"
                     /db_xref="GeneID:11495662"
     mRNA            <925672..>926043
                     /gene="NDAI0G03860"
                     /locus_tag="NDAI_0G03860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671358.2"
                     /db_xref="GeneID:11495662"
     CDS             925672..926043
                     /gene="NDAI0G03860"
                     /locus_tag="NDAI_0G03860"
                     /inference="similar to DNA sequence:INSDC:YOL133W"
                     /note="similar to Saccharomyces cerevisiae HRT1 (YOL133W);
                     ancestral locus Anc_3.28"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671406.2"
                     /db_xref="GeneID:11495662"
                     /db_xref="GOA:G0WEF2"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024766"
                     /db_xref="UniProtKB/TrEMBL:G0WEF2"
                     /translation="MSEPDKMEVDSENITPAPLEQQLVPEEEQKQTQRKRFEIKKWTA
                     VAFWSWDIAVDNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKW
                     IQTRDACPLDNQPWQLARCGR"
     gene            complement(<926437..>929220)
                     /gene="NDAI0G03870"
                     /locus_tag="NDAI_0G03870"
                     /db_xref="GeneID:11495663"
     mRNA            complement(<926437..>929220)
                     /gene="NDAI0G03870"
                     /locus_tag="NDAI_0G03870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671359.2"
                     /db_xref="GeneID:11495663"
     CDS             complement(926437..929220)
                     /gene="NDAI0G03870"
                     /locus_tag="NDAI_0G03870"
                     /inference="similar to DNA sequence:INSDC:YNL313C"
                     /note="similar to Saccharomyces cerevisiae YNL313C;
                     ancestral locus Anc_3.32"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671407.2"
                     /db_xref="GeneID:11495663"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G0WEF3"
                     /translation="MELFLQAHLLLSSAPNVLDDITLPQEKELEGTLAKLILNGRSYQ
                     VVDIILKELSQKVSVDENDDSKSLLQKVKTFISTHFTTDKNVSLIFAIALLQTFLQNN
                     YTGPLAPIDIFSLFFETSLSNETIDSLLVSSLTVLGQPAYELTEDPIYLILSLLLLEQ
                     ITEQPSLFDLEDDREIDIPKISTAETPASMAVAHWWRARALMAQLSLLPEATGYPSMI
                     SSSILQSIDIAHIITKSLPESTPEDVKKAIYVIYYLENVKSSLAINTEHLCLPSLTKV
                     KKLTNFQFVLTGARTKRTKFQQKAHSGLIILAKSSWNLHENKESIMESKTPETFELND
                     DLLLEKPHFESIGSEPLDEQIVKRQKLDEDEEKIIEDKLLPMAIRQEYIPQELQDLDP
                     NEQPALSNYDNIQLLLRLYTIRQTSPAKDPLVEEELASLINRIIYQTPADNANVNEKR
                     NWTIFARSLWERSMVETTRAKTIERGLLQMQSLVEELGLKIQTRLIPQGNANADNDES
                     LAVISRLKYIHQLPFLPRWELDAQLAEKYMSVGILRSAVEIYDRLHMHCESALCYAAV
                     GDEKKAESILTERVESNPSDSRAWSILGDIRQEPALWEKSWSIGKYVNAKNSLARYYY
                     NPPQHSGLTRDYNIVLKHLNDSLRQYSLNFETWYFYGCVALECGKMDVAAEAFSRCVS
                     LDQTHAMAWSNLSAAYVELNKLKEAHSCLKRAIASDAQKNWRIWENYMLVSVKLNEWD
                     DVLVACRQLVDIRRDTSGEGSIDLPIVEKLIELLVSSDYPYSGDTNETEGRLTHYQKS
                     CLEFVCNTLPSVITTNPRCWRLVAKVEIWRKRPWAALECYEKAYRAISHNPDLEIDEK
                     IWNETVDACEELVSAYESLGEMEGKYGKSSFVCKDWKYKARSTIKGLMSKGKGRWDDT
                     DGWEKLLEVRNQI"
     gene            <929611..>930544
                     /gene="NDAI0G03880"
                     /locus_tag="NDAI_0G03880"
                     /db_xref="GeneID:11495664"
     mRNA            join(<929611..929617,929697..>930544)
                     /gene="NDAI0G03880"
                     /locus_tag="NDAI_0G03880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671360.2"
                     /db_xref="GeneID:11495664"
     CDS             join(929611..929617,929697..930544)
                     /gene="NDAI0G03880"
                     /locus_tag="NDAI_0G03880"
                     /inference="similar to DNA sequence:INSDC:YNL312W"
                     /note="similar to Saccharomyces cerevisiae RFA2 (YNL312W);
                     ancestral locus Anc_3.33"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671408.2"
                     /db_xref="GeneID:11495664"
                     /db_xref="GOA:G0WEF4"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014646"
                     /db_xref="InterPro:IPR014892"
                     /db_xref="UniProtKB/TrEMBL:G0WEF4"
                     /translation="MATYQPYTEYSSVTGGGFETNDVVGQSGDVSDRSNTNTLRPVTV
                     KQILESTQEIQDGPFVSYNQELHHVCFVGVIRNITDHTSNIYLTVEDGTGQIEVRKWS
                     EDANDMASGPGDDSDPTKDSSSQVAQQYQIGTYVKIFGALKEFGGKKNIQYAVIKNIE
                     SFNEVLTHHLEVIKWHAIANGKLPDPSTGGSSSQVQEGQQQSTSGQSLFVSENDSSSS
                     RSPSDRILEFCKKQCEGKDANTFAVPIPLISQSLNIDENTTRNCCATLTEQGFIYPTF
                     DDNHFFAI"
     gene            <930898..>932310
                     /gene="NDAI0G03890"
                     /locus_tag="NDAI_0G03890"
                     /db_xref="GeneID:11495665"
     mRNA            <930898..>932310
                     /gene="NDAI0G03890"
                     /locus_tag="NDAI_0G03890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671361.2"
                     /db_xref="GeneID:11495665"
     CDS             930898..932310
                     /gene="NDAI0G03890"
                     /locus_tag="NDAI_0G03890"
                     /inference="similar to DNA sequence:INSDC:YOL132W"
                     /note="similar to Saccharomyces cerevisiae GAS4 (YOL132W);
                     ancestral locus Anc_3.34"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671409.2"
                     /db_xref="GeneID:11495665"
                     /db_xref="GOA:G0WEF5"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G0WEF5"
                     /translation="MLVPFILIFINIYITTTLASINPIIIKGKRFYDAVTNERFFIRG
                     IDYQPGGSSEVNDEKDPLSDPDLCARDILLFQDLGINTVRIYSINPDLNHDKCMTLLA
                     TAGIYLILDVNSPLENQHLNRYEPWTTYNTIYLKHVFSVIDEFLQYNNTLGFFAGNEI
                     VNDKRSAQYSPPYIKKLIGDMRRYIDVHSTRRIPVGYSAADDLKYRIPLSKYLECEDT
                     ARKDCSVDFYGVNSYQWCGQQTLESSGYDRLVEAYEKYSKPVIFSEFGCNKVLPRKFD
                     EITALYSESMNDVFSGGLVYEFTQEPNNYGLAEVVNENDIQLLDDYFTLRDHYRPEAS
                     SSQEPSSKLDLHNKNSIAPEDVVIPKCQKTYHNIKVDGEVEENLADVLIREGTQHKKG
                     KFVDLDEKDLECKFEIYRKDGKPWDGPRRIEAVNDMSPLKDTKAKSGKHGSRKKSSSF
                     KMKPKKAMTSVFLIIVCILW"
     gene            <932670..>933371
                     /gene="NDAI0G03900"
                     /locus_tag="NDAI_0G03900"
                     /db_xref="GeneID:11495666"
     mRNA            <932670..>933371
                     /gene="NDAI0G03900"
                     /locus_tag="NDAI_0G03900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671362.2"
                     /db_xref="GeneID:11495666"
     CDS             932670..933371
                     /gene="NDAI0G03900"
                     /locus_tag="NDAI_0G03900"
                     /inference="similar to DNA sequence:INSDC:YNL309W,YOL131W"
                     /note="similar to Saccharomyces cerevisiae STB1 (YNL309W)
                     and YOL131W; ancestral locus Anc_3.37"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671410.2"
                     /db_xref="GeneID:11495666"
                     /db_xref="UniProtKB/TrEMBL:G0WEF6"
                     /translation="MEQNLNYKILERAKMAQLSRKIRVRLGKIQKGTVKNRKLEDKQM
                     PAKNHPFWPLLCVVPPVQPTTSASSGITSSPGYSMWDLMSRKGVGRNKYKSQGFSKKR
                     ILQEKESYNGRYKLPLDRNYLSVPPDSREYNSDYWDHRPLSRSNNPVKAENGALEELK
                     KMKFILKAPRRLEDLEYDPIINSDDCNTSHYVSSMLMSEDTSNNKNSSPYFNDYVRDI
                     YSVSSRGNISAGSPL"
     gene            <933792..>934337
                     /gene="NDAI0G03910"
                     /locus_tag="NDAI_0G03910"
                     /db_xref="GeneID:11495667"
     mRNA            <933792..>934337
                     /gene="NDAI0G03910"
                     /locus_tag="NDAI_0G03910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671363.2"
                     /db_xref="GeneID:11495667"
     CDS             933792..934337
                     /gene="NDAI0G03910"
                     /locus_tag="NDAI_0G03910"
                     /inference="similar to DNA sequence:INSDC:YOL129W"
                     /note="similar to Saccharomyces cerevisiae VPS68
                     (YOL129W); ancestral locus Anc_3.40"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671411.2"
                     /db_xref="GeneID:11495667"
                     /db_xref="InterPro:IPR007919"
                     /db_xref="UniProtKB/TrEMBL:G0WEF7"
                     /translation="MDTDHNDRLFRLPFKLPTFHGIRTFGVYLSGIFYALGFWVFLDA
                     VLYSKYSNASDVHVTFIDWIPFLCSTFGMLIVNSIEKNRLLQGALNSEGGSSFGDVDS
                     NMAWQARSVLFCGFALLAGGLSGSIVVLIIKFLVKDYTSYPTVGMGVNNVLGNIFILL
                     SCVVLWIAQNMEDEYSYSLTL"
     gene            complement(<934765..>935889)
                     /gene="NDAI0G03920"
                     /locus_tag="NDAI_0G03920"
                     /db_xref="GeneID:11495668"
     mRNA            complement(<934765..>935889)
                     /gene="NDAI0G03920"
                     /locus_tag="NDAI_0G03920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671364.2"
                     /db_xref="GeneID:11495668"
     CDS             complement(934765..935889)
                     /gene="NDAI0G03920"
                     /locus_tag="NDAI_0G03920"
                     /inference="similar to DNA sequence:INSDC:YNL307C,YOL128C"
                     /note="similar to Saccharomyces cerevisiae MCK1 (YNL307C)
                     and YGK3 (YOL128C); ancestral locus Anc_3.41"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671412.2"
                     /db_xref="GeneID:11495668"
                     /db_xref="GOA:G0WEF8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0WEF8"
                     /translation="MSMDSGSNSVEKSNEFIADDVTSNRSNTVRRMLIQEYRKIGRGA
                     FGTVVQAYITPNKENWYGPFAIKKVPAQTEYKSRELEILRITNHPNVVKLEYFFTHVS
                     PQDHKVYQHLAMECLPETLQIEISRYAHNKLELALKHVKLYSYQIARGMLYLHALGIC
                     HRDIKPSNILVDPSTGVLKICDFGSAKRLEPNQPSISYICSRFYRAPELILGCTQYTT
                     KVDIWGLGCVIGEMLMGKAIFQGQDPLLQLREIAKLLGPPDKKFIFFSNPGYDGPLYS
                     KPLFSGTSKERFEKYFGHAGPDGIDLLTKVLVYSPEIRLSPRRILNHSFFDDLLKEQY
                     FFPRDSTQPVRLPNLFDFSEFELKILGEWGNKFTKQPEDH"
     gene            <937952..>938164
                     /gene="NDAI0G03930"
                     /locus_tag="NDAI_0G03930"
                     /db_xref="GeneID:11495669"
     mRNA            <937952..>938164
                     /gene="NDAI0G03930"
                     /locus_tag="NDAI_0G03930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671365.2"
                     /db_xref="GeneID:11495669"
     CDS             937952..938164
                     /gene="NDAI0G03930"
                     /locus_tag="NDAI_0G03930"
                     /inference="similar to DNA sequence:INSDC:YOL127W"
                     /note="similar to Saccharomyces cerevisiae RPL25
                     (YOL127W); ancestral locus Anc_3.43"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671413.2"
                     /db_xref="GeneID:11495669"
                     /db_xref="GOA:G0WEF9"
                     /db_xref="InterPro:IPR001014"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR013025"
                     /db_xref="UniProtKB/TrEMBL:G0WEF9"
                     /translation="MKKVEDGNTLVFQVSMKSNKYQIKKAVKELYEVDVLSVNTLVRP
                     NGTKKAYVRLTADYDALDIANRIGYI"
     gene            complement(<938884..>940014)
                     /gene="NDAI0G03940"
                     /locus_tag="NDAI_0G03940"
                     /db_xref="GeneID:11495670"
     mRNA            complement(<938884..>940014)
                     /gene="NDAI0G03940"
                     /locus_tag="NDAI_0G03940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671366.2"
                     /db_xref="GeneID:11495670"
     CDS             complement(938884..940014)
                     /gene="NDAI0G03940"
                     /locus_tag="NDAI_0G03940"
                     /inference="similar to DNA sequence:INSDC:YOL126C"
                     /note="similar to Saccharomyces cerevisiae MDH2 (YOL126C);
                     ancestral locus Anc_3.45"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671414.2"
                     /db_xref="GeneID:11495670"
                     /db_xref="GOA:G0WEG0"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:G0WEG0"
                     /translation="MPHPINPALQPNTLKISILGAAGGIGQSLSLLLKTQLHFPLKTN
                     STQRDKNHIHLALYDVNEDAINGVVADLSHIDTPVSISNHSPATGIKDCLMNSSLVII
                     PAGMPRKPGMNREDLFNINAKIMSNLTDDIAKYCDLSKVFVLIISNPVNSLVPVMVNR
                     LWHKHQDVSKNTHIERRIMGVTKLDIVRAKTFLHEVTIDADITPRSNDMPDVPVIGGH
                     SGETIMPLFSQSRSYKSLDKDQLAYLIHRVQYGGDEVVKAKNGLGSATLSMAHAGFKV
                     VNKFVSLLLGNVSEIHGICYVSLLDSEGHPTAMGMEKLLPLIDNCAFFSIPMTITKKG
                     VTSVDYDIVDRMDDHERNEMLPLCLPKLKKSVETGSKFAIEN"
     gene            <941809..>943185
                     /gene="NDAI0G03950"
                     /locus_tag="NDAI_0G03950"
                     /db_xref="GeneID:11495671"
     mRNA            <941809..>943185
                     /gene="NDAI0G03950"
                     /locus_tag="NDAI_0G03950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671367.2"
                     /db_xref="GeneID:11495671"
     CDS             941809..943185
                     /gene="NDAI0G03950"
                     /locus_tag="NDAI_0G03950"
                     /inference="similar to DNA sequence:INSDC:YOL125W"
                     /note="similar to Saccharomyces cerevisiae TRM13
                     (YOL125W); ancestral locus Anc_3.46"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671415.2"
                     /db_xref="GeneID:11495671"
                     /db_xref="GOA:G0WEG1"
                     /db_xref="InterPro:IPR007871"
                     /db_xref="InterPro:IPR021721"
                     /db_xref="InterPro:IPR022776"
                     /db_xref="UniProtKB/TrEMBL:G0WEG1"
                     /translation="MEKKRRRCGMTRRNGEQYCTEHLNIWKKKQGNAVHNNNNNNNES
                     KVHDNEKNNDQRIPCPLDPNHTVKKSQLEKHLKKCNKTKLKHSNDGKPYYSIDINGDH
                     HPHKEQSKLEITETSRNKWIMETISILEEISKSNLFDEMPLIEKSNKFMEENRFKLLT
                     NKKHAIQQSSLIQHMIDKKMFRNNPNFIEFGSGRAEFSRYVNQVVLCENNNDIDSTDV
                     EPQTSNFIFIDRASNRMKFDKKILDDYVEWISNKNKKSGEKMNVPDIKRVKIDIRDLK
                     LDPLLSFPNNNNYVAISKHLCGVATDLTLKCIQNSDILTGKDLSSPSNFDGICIAMCC
                     RHVCNSNDYVNPVFVNSLLEKYGHDETFTYDQFFYSLQKMCSWATCGRRDDMNDHDVV
                     RITDDKSITLKEREQFGLLARRIIDEGRKNWVKKNLNNANDFTVELVKYVHSDVSLEN
                     IVLLVSKK"
     gene            complement(<943601..>944935)
                     /gene="NDAI0G03960"
                     /locus_tag="NDAI_0G03960"
                     /db_xref="GeneID:11495672"
     mRNA            complement(<943601..>944935)
                     /gene="NDAI0G03960"
                     /locus_tag="NDAI_0G03960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671368.2"
                     /db_xref="GeneID:11495672"
     CDS             complement(943601..944935)
                     /gene="NDAI0G03960"
                     /locus_tag="NDAI_0G03960"
                     /inference="similar to DNA sequence:INSDC:YOL124C"
                     /note="similar to Saccharomyces cerevisiae TRM11
                     (YOL124C); ancestral locus Anc_3.48"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671416.2"
                     /db_xref="GeneID:11495672"
                     /db_xref="GOA:G0WEG2"
                     /db_xref="InterPro:IPR000241"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR002296"
                     /db_xref="InterPro:IPR016691"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0WEG2"
                     /translation="MASSIGSRNGTKKKYLVFMVQVHTNFRRAELESLADLYNIKDIN
                     FDKYDDNSPFFFVELDNDQQAKDWIKRSILTRAIYEYWGEGKTYDGLHESIQSQSFFP
                     EYKKLYENDSFKFEFDTYRGNSKSNRIKQIETFSYLEFKGKIDMKNPNQIFTVIEEYK
                     PISENIPAKEPINLIFGRLIQKGDRLAMEKYDLKKRPYKGTTSFEAELSLVSANIAQV
                     KPGTIMYDPFAGTGSFLTAGGHYGALVIGSDIDGRMIRGKGASQNIGANFKYYEESSR
                     FLDVLTMDFTHNSLRSNLCIDTILCDPPYGIRESIKVLGARDPERFVGKENVEIDGKK
                     AFLHRDYIPTKKPYALDALLDDILQYSAERLPIGGRLAFWMPTANDENIETIVPLHSC
                     LELKYNCTQEFNKWSRRLLVYINRGPGFDGPTNSGIKRSTTAFRDRYFSHFS"
     gene            <945738..>947561
                     /gene="NDAI0G03970"
                     /locus_tag="NDAI_0G03970"
                     /db_xref="GeneID:11495673"
     mRNA            <945738..>947561
                     /gene="NDAI0G03970"
                     /locus_tag="NDAI_0G03970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671369.2"
                     /db_xref="GeneID:11495673"
     CDS             945738..947561
                     /gene="NDAI0G03970"
                     /locus_tag="NDAI_0G03970"
                     /inference="similar to DNA sequence:INSDC:YOL123W"
                     /note="similar to Saccharomyces cerevisiae HRP1 (YOL123W);
                     ancestral locus Anc_3.49"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671417.2"
                     /db_xref="GeneID:11495673"
                     /db_xref="GOA:G0WEG3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G0WEG3"
                     /translation="MSSDEEDFNDIYGEETNSTPVITASVNGEKDVKTVKEGPEGDQK
                     AGEALEMNKDTNQVGQSNKDQPSHLDALQALSSQMNQVSTTNSNNINNINNNNNSNNN
                     NSNFANNTNLDSTNNVNNNNEVSPVNNVVVSHTNNLDDNNGDANVNGNSNNFPQPGGM
                     PWGQFQQTMPGFPNQQPAMLPPQPQQNVKADISKDSCKMFIGGLNWETTEDGLRNYFN
                     KYGNVIELKIMKDGATGRSRGFGFLTFEHPSSVDEVVKTQHILDGKVIDPKRSIPKEE
                     QDKIGKIFVGGIGTDVRPKEFEEFFAQFGTIIDAQLMLDKDTGRSRGFGFITYDSADA
                     VDKVCQNKYIDFKGKQIEVKRAQQRHSHGKPADASNSQMLTPNPMATPGMVNPMGQMY
                     QNPMMPGFNPMFNPQAMTDYYQRMQDYYKQMQAQTGIDYSQMYQQQMAMMMPGFSIPQ
                     GTDGSGSPTSDSVTPSTQPEISEANNEENSSSNVQTIGEESAPAPAPAPAPVTIEPSI
                     PTTDEEKTRAPASPPLLNLPKGPRDPTATATIHHQYQRNNDRGHYYSNGRDRKYGRDE
                     DRDRDRDRGRGGYHGGHRGGYRGNRGRGGGYNKRKNGYRPY"
     gene            complement(<947806..>949518)
                     /gene="NDAI0G03980"
                     /locus_tag="NDAI_0G03980"
                     /db_xref="GeneID:11495674"
     mRNA            complement(<947806..>949518)
                     /gene="NDAI0G03980"
                     /locus_tag="NDAI_0G03980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671370.2"
                     /db_xref="GeneID:11495674"
     CDS             complement(947806..949518)
                     /gene="NDAI0G03980"
                     /locus_tag="NDAI_0G03980"
                     /inference="similar to DNA sequence:INSDC:YOL122C"
                     /note="similar to Saccharomyces cerevisiae SMF1 (YOL122C);
                     ancestral locus Anc_3.50"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671418.2"
                     /db_xref="GeneID:11495674"
                     /db_xref="GOA:G0WEG4"
                     /db_xref="InterPro:IPR001046"
                     /db_xref="UniProtKB/TrEMBL:G0WEG4"
                     /translation="MTVGSSSQQVSNEPHLHKRNDNDLEGDDCKNAISESKPHTIAQT
                     VSISSNVSQQKVFKKHIRVKDHLLEVLRKYIQFIGPGLMVSVAYIDPGNYSTAVSAGA
                     SNQFSLLCIILLSNFIAIFLQLLCIKLGTVTGLDLSRACRMHLPKWMNYIIYFFAECA
                     IIATDIAEVIGTAIALNILIKVPLPAGVAITVADVFIIMFTYKPGSSSLRFVRYFEYG
                     VAVLVIGVCICFSIELAYIPKSTSVRKVFRGFVPSSQMFQHNGMYTAISILGATVMPH
                     SLFLGSGLVQPRLLDYDVQHGNYSLVDDNNEKKNKEEFLDKRYFNYRPTLDAIRYCMK
                     YSMVELALTLFTMALFVNCSILIIAGATLYDTPGASDADLFVIHDLLSKTLAPAAGTI
                     FMLALLLSGQSAGIVCTMAGQIVSEGHIDWKLIPWQRRLVTRSISMIPCLFISIFIGK
                     EAMSKALNASQVVLSIVLPFLVAPLIYFTCNKSIMKTEIVRKKGTEQNSNIDTETSAD
                     VERDTDDIVPAGSNGDEEEVDIVYMANNWIITIIGVIIWLFLSMLNTYAIVQLGLSHG
                     DISG"
     gene            complement(<950312..>951213)
                     /gene="NDAI0G03990"
                     /locus_tag="NDAI_0G03990"
                     /db_xref="GeneID:11495675"
     mRNA            complement(join(<950312..950726,951194..>951213))
                     /gene="NDAI0G03990"
                     /locus_tag="NDAI_0G03990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671371.2"
                     /db_xref="GeneID:11495675"
     CDS             complement(join(950312..950726,951194..951213))
                     /gene="NDAI0G03990"
                     /locus_tag="NDAI_0G03990"
                     /inference="similar to DNA sequence:INSDC:YNL302C,YOL121C"
                     /note="similar to Saccharomyces cerevisiae RPS19B
                     (YNL302C) and RPS19A (YOL121C); ancestral locus Anc_3.51"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671419.2"
                     /db_xref="GeneID:11495675"
                     /db_xref="GOA:G0WEG5"
                     /db_xref="InterPro:IPR001266"
                     /db_xref="InterPro:IPR018277"
                     /db_xref="UniProtKB/TrEMBL:G0WEG5"
                     /translation="MPGVSVRDVAAQDFINAYASFLQRQGKLEVPGYVDIVKTSSGNE
                     MPPQDSEGWFYKRAASVARHIYLRKQVGVGKLNKLYGGAKSRGVRPYKHIDASGSVNR
                     KVLQALEKIGVVEISPKGGRRISENGQRDLDRIAAQTLEEEE"
     gene            complement(<951974..>952883)
                     /gene="NDAI0G04000"
                     /locus_tag="NDAI_0G04000"
                     /db_xref="GeneID:11495676"
     mRNA            complement(join(<951974..952422,952772..>952883))
                     /gene="NDAI0G04000"
                     /locus_tag="NDAI_0G04000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671372.2"
                     /db_xref="GeneID:11495676"
     CDS             complement(join(951974..952422,952772..952883))
                     /gene="NDAI0G04000"
                     /locus_tag="NDAI_0G04000"
                     /inference="similar to DNA sequence:INSDC:YNL301C,YOL120C"
                     /note="similar to Saccharomyces cerevisiae RPL18B
                     (YNL301C) and RPL18A (YOL120C); ancestral locus Anc_3.52"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671420.2"
                     /db_xref="GeneID:11495676"
                     /db_xref="GOA:G0WEG6"
                     /db_xref="InterPro:IPR000039"
                     /db_xref="InterPro:IPR021131"
                     /db_xref="InterPro:IPR021132"
                     /db_xref="UniProtKB/TrEMBL:G0WEG6"
                     /translation="MGIDHTSKQHKRSGHRTAPKSDNVYLKMLVKLYSFLARRTDAPF
                     NKVVLKSLFMSKINRPPVSVSRIARGLKQEGSANKTIVVVGTVTDDARVFELPKTTVA
                     ALRFTAGARARIIKAGGECITLDQLAVRAPKGQNTLILRGPRNSREAVRHFGMGPHKN
                     KAPRILSKGRKFERGRGKRRSLGFKV"
     gene            <953416..>955299
                     /gene="NDAI0G04010"
                     /locus_tag="NDAI_0G04010"
                     /db_xref="GeneID:11495677"
     mRNA            <953416..>955299
                     /gene="NDAI0G04010"
                     /locus_tag="NDAI_0G04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671373.2"
                     /db_xref="GeneID:11495677"
     CDS             953416..955299
                     /gene="NDAI0G04010"
                     /locus_tag="NDAI_0G04010"
                     /inference="similar to DNA sequence:INSDC:YOL117W"
                     /note="similar to Saccharomyces cerevisiae RRI2 (YOL117W);
                     ancestral locus Anc_3.55"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671421.2"
                     /db_xref="GeneID:11495677"
                     /db_xref="UniProtKB/TrEMBL:G0WEG7"
                     /translation="MPEEYEDYDDFMMSDDESMNIDDIAFESDEGQQEHHTVGSSKET
                     ETTRYFPNIEYAYNTGLAFLDDREFEKAREQFIDVYKTVIDILPDDKEPVIIQFGFQA
                     LNQIISCWINEIPYNGMSGQIVSEIIRTCECLCDFIAVNNDDHDTNNLAKNLGNTFTT
                     LFYSNSRIFLFDLGSLDCSAVKLRMELQSAIVSIFLNSSCLHKKFVPLLQVKGRVSSI
                     WYDCLTTGYYSESDLSSLRSIRVIDNETEKYTEDLKIEITTVILQCYILEFLKAGDIK
                     EAGYFKESISILDKLASKSLSVSQTPEVMLILHFSQGIMLLMTKRPDINSSIQTSVFW
                     RMREAREAFLRSLKHLEELGRNQDKTPHLFHDIILAGFTFTSMILLKVGKEELDPFEF
                     EQVRILGNQDIIDNIQLIYVNFMNLDLMGLFNSLNCMKEINFILHHLVSDIYELAQSL
                     VLWTKIAVVYSCISIPDLENKLKLNEYKVPTRDDILTLLMQSILKGEAMVFYKLDLRK
                     DLVYFGAMYKKQLTMYGKESFRLMNQNKRKPAEAKECESLASLSDFEYANNVGLFTVP
                     RKLTKKSNITEFFEALKEARENIIYIDNAQHKSFNKLYPKDMKFTDKYMNLVDLMAPR
                     IHD"
     gene            <957452..>958633
                     /gene="NDAI0G04020"
                     /locus_tag="NDAI_0G04020"
                     /db_xref="GeneID:11495678"
     mRNA            <957452..>958633
                     /gene="NDAI0G04020"
                     /locus_tag="NDAI_0G04020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671374.2"
                     /db_xref="GeneID:11495678"
     CDS             957452..958633
                     /gene="NDAI0G04020"
                     /locus_tag="NDAI_0G04020"
                     /inference="similar to DNA sequence:INSDC:YOL116W"
                     /note="similar to Saccharomyces cerevisiae MSN1 (YOL116W);
                     ancestral locus Anc_3.57"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671422.2"
                     /db_xref="GeneID:11495678"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:G0WEG8"
                     /translation="MNKEDAILISRVADLERRMAMFEGMFHALSGRLDQHFKKYDIVM
                     NSQQQQIIELNSVISTLLNDQFRHAEMIKEKLSTTIHGISSMDTNSIHQTDTSDIFSN
                     GGRPYDGNSNIPADVLFDDIISNNKNGTTNAPVSAQTTENAIKNQGFAHQETQGTTQQ
                     EGEQPRAPQNQQQPHQGYQPSVVFRGPVLSYGNFNQLSHPSLSRPPNLLNEPEGNISE
                     SSPSISSEVIFNNSSNNNGIGNNNGNNGKNELLTARHEISNQSLEEEEQYRTKKGHKK
                     KRKIYIGPFEFLKSPNSVLDLWKEYTEGIHGHPSIKYMDAIYQTNWRRDAAVNRRYSR
                     RKVLWKAIESGLEKGYSLERVVDILENCRIIDSTKGTKQPIGWLCHSNNIPDILKDSL
                     N"
     gene            <959388..>961136
                     /gene="NDAI0G04030"
                     /locus_tag="NDAI_0G04030"
                     /db_xref="GeneID:11495679"
     mRNA            <959388..>961136
                     /gene="NDAI0G04030"
                     /locus_tag="NDAI_0G04030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671375.2"
                     /db_xref="GeneID:11495679"
     CDS             959388..961136
                     /gene="NDAI0G04030"
                     /locus_tag="NDAI_0G04030"
                     /inference="similar to DNA sequence:INSDC:YNL299W,YOL115W"
                     /note="similar to Saccharomyces cerevisiae TRF5 (YNL299W)
                     and PAP2 (YOL115W); ancestral locus Anc_3.58"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671423.2"
                     /db_xref="GeneID:11495679"
                     /db_xref="GOA:G0WEG9"
                     /db_xref="InterPro:IPR002058"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="UniProtKB/TrEMBL:G0WEG9"
                     /translation="MEKNNLANPSNLIQSTSNTTKFKKAKNPKKSRKSRKAPKRSQDA
                     LGNDKNHIERTTMDDIVVLDDVSDTEGYDDYDGHYDNPQSSEISNVAPQLKVNLLASN
                     EDFIALSNSSSDEEATDKVKAQPTKKPISDGVSSSVDTTHTAKLLTTDYPWIINHDHS
                     KQKEIADWLTMEIRDFVSYISPSKEEIKERNDTIGRIRDAVNHFWNDANLHVFGSYAT
                     DLYLPGSDIDCVIISEKGDKDSRSSLYALANFLKKRGLATDIEVIAKARVPIIKFIDP
                     RSKIHIDVSFERINGLEAAKLIREWLNDTPGLREITLIVKQFLHARRLNNVHTGGLGG
                     FSIICLVFSFLQMHPRIISNEIDPMENLGVLLVEFFELYGKNFGYDDIAITTANGYPI
                     YLPKSDWKGLQQLRSSFSLAIQDPGDATNNISRGSFNLRDIKKAFAGAFDLLTNRCFE
                     LDTASFKERIGKSVLGNVIKYRGKQRDFKDERSLVINKAIIENENYHKKRSTIVREEF
                     IESTDDTNDEKDDIYIVEEPPLKKQKPMLKKKESRGVVKINAQRDNIIAATPLTTPIA
                     IPGEQENNDDYNPLDC"
     gene            complement(<961644..>962141)
                     /gene="NDAI0G04040"
                     /locus_tag="NDAI_0G04040"
                     /db_xref="GeneID:11495680"
     mRNA            complement(<961644..>962141)
                     /gene="NDAI0G04040"
                     /locus_tag="NDAI_0G04040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671376.2"
                     /db_xref="GeneID:11495680"
     CDS             complement(961644..962141)
                     /gene="NDAI0G04040"
                     /locus_tag="NDAI_0G04040"
                     /inference="similar to DNA sequence:INSDC:YOL114C"
                     /note="similar to Saccharomyces cerevisiae YOL114C;
                     ancestral locus Anc_3.59"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671424.2"
                     /db_xref="GeneID:11495680"
                     /db_xref="GOA:G0WEH0"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="UniProtKB/TrEMBL:G0WEH0"
                     /translation="MNILNRHLFQKVKYRWFSTINGRDIQIYKKAKEWMENLSPATIP
                     LDTFQVRFDRSSGPGGQKVNKTSSKCTMTLRNLRDCQLIPFEIKKLIIEKPLRHYKKT
                     TDSIVIQSDTFRSREKNKQLCLNKLIEEIKNVCSFPSETAPSTLKNGMKSKGVVTKEG
                     YDKRN"
     gene            <962668..>964464
                     /gene="NDAI0G04050"
                     /locus_tag="NDAI_0G04050"
                     /db_xref="GeneID:11495681"
     mRNA            <962668..>964464
                     /gene="NDAI0G04050"
                     /locus_tag="NDAI_0G04050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671377.2"
                     /db_xref="GeneID:11495681"
     CDS             962668..964464
                     /gene="NDAI0G04050"
                     /locus_tag="NDAI_0G04050"
                     /inference="similar to DNA sequence:INSDC:YNL293W,YOL112W"
                     /note="similar to Saccharomyces cerevisiae MSB3 (YNL293W)
                     and MSB4 (YOL112W); ancestral locus Anc_3.64"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671425.2"
                     /db_xref="GeneID:11495681"
                     /db_xref="GOA:G0WEH1"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:G0WEH1"
                     /translation="MISDGHPYGAFVGTLLRSDDFCTSIFQRQIKSKGVDSLIYSKRQ
                     NGISSIDPGCSAQKELSDEILTRQFSAIPDIIELYTDNATHLEESDGEDYMDEAESEL
                     TSLITTKLPISYKPEDFDRYGFRKQTTKISKEEYEKWWAGYSLYCARQKVKWVQFLQN
                     RNFDIPNDNPEKFPPRDEELKNYVRKGIPAEWRGNAWWYFANGQHILEENIGVYADLL
                     SEVEKLRDHDQQQHHLLDDIEIIERDLNRTFPDNIHFQREQFQKQPPLIVSLRDVLTA
                     FALYDRKIGYCQSMNFLAGLLLLFMDEERTFWMLVIITNIYLPDVYSLDLEGVSRDQG
                     VLLLCIKEYLPELWIQIDRNSFREDTLHRPIGNKRERKEQFLRNSKVTEIPQITLCTS
                     SWFMSCFTGILPIETTLRIWDCLFYESSHFLFKSTLAILKLGEYELLGXKNNMQGIIF
                     FNQKNGRSKVSKNIRENDHPEEICMQITHLIQNLPGTLLDPNLFFERNLLAKKLTFNS
                     LDQQEIDACREYIRSQRSKFKGMLEISAIKDAVAAGEEYPTIPFASTYANTRSATYEF
                     NKERYNKKNAWKFNSYRNIKETVKKLKKTTSF"
     gene            complement(<964609..>965241)
                     /gene="NDAI0G04060"
                     /locus_tag="NDAI_0G04060"
                     /db_xref="GeneID:11495682"
     mRNA            complement(<964609..>965241)
                     /gene="NDAI0G04060"
                     /locus_tag="NDAI_0G04060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671378.2"
                     /db_xref="GeneID:11495682"
     CDS             complement(964609..965241)
                     /gene="NDAI0G04060"
                     /locus_tag="NDAI_0G04060"
                     /inference="similar to DNA sequence:INSDC:YOL111C"
                     /note="similar to Saccharomyces cerevisiae MDY2 (YOL111C);
                     ancestral locus Anc_3.65"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671426.2"
                     /db_xref="GeneID:11495682"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G0WEH2"
                     /translation="MSSAEQEFVSKFLTLTNLSESLLPGNYQKPLQEIVSLGVPLPAL
                     KYKYDPKRFNNALNKENHGALSTSPVTLTLKSIRPPKFLLSKEFNTNDTIHQVKQFII
                     GKTDIGNEGELKLLQKGKVLHDGMLLLDLGTNNAVINVLVSRQSPSSISIGTPVGKIP
                     IERKSLDNEKPQEVSVPWEDIRTLLKAKFNSDVDADEVLARLKKGWDMAK"
     gene            <965623..>966474
                     /gene="NDAI0G04070"
                     /locus_tag="NDAI_0G04070"
                     /db_xref="GeneID:13926873"
     mRNA            <965623..>966474
                     /gene="NDAI0G04070"
                     /locus_tag="NDAI_0G04070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980019.1"
                     /db_xref="GeneID:13926873"
     CDS             965623..966474
                     /gene="NDAI0G04070"
                     /locus_tag="NDAI_0G04070"
                     /inference="similar to DNA sequence:INSDC:YOL110W"
                     /note="similar to Saccharomyces cerevisiae SHR5 (YOL110W);
                     ancestral locus Anc_3.66"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980068.1"
                     /db_xref="GeneID:13926873"
                     /db_xref="InterPro:IPR019383"
                     /db_xref="UniProtKB/TrEMBL:J7RT63"
                     /translation="MGNHNAQKVQSNSISSANFSKYSSSNIEGKAHIEHVASELDQSE
                     ANGTSIPPGTVETPKGKEDDAPQFFNYHEFSETFYADYKDPGCLKEHDFLHAISITHF
                     PNVYVPSCSEAFKRTRIVRIPRNFEASLGSPYFSTVLPGFEPAAFTSENDEEMFIPRG
                     IYDDDQVFGCNSISPLSSYITQARYEEIVKDINDILAYSFQVYSWYNILDVVLGSLTL
                     GIWSWLSKYICPNRKLFSLELYVEQVNQTPLFKSQGIQIISPRRSGYLSLDFQIPMPP
                     LPDGKIA"
     gene            <968143..>968616
                     /gene="NDAI0G04080"
                     /locus_tag="NDAI_0G04080"
                     /db_xref="GeneID:13926874"
     mRNA            <968143..>968616
                     /gene="NDAI0G04080"
                     /locus_tag="NDAI_0G04080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980020.1"
                     /db_xref="GeneID:13926874"
     CDS             968143..968616
                     /gene="NDAI0G04080"
                     /locus_tag="NDAI_0G04080"
                     /inference="similar to DNA sequence:INSDC:YNL289W"
                     /note="similar to Saccharomyces cerevisiae PCL1 (YNL289W);
                     ancestral locus Anc_3.70"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980069.1"
                     /db_xref="GeneID:13926874"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:J7SAY2"
                     /translation="MPTVLATVCYVARLSSIIPRDAICLPSTLHRLFLSSLILSCKFH
                     NEAAPSFRQWVDYSGDYFTLQDLVAMEKEMMNLLDYNLLIKSTEFFSVLNPLLEPISQ
                     DLKHIILQKQKVKNVLQITYKPHRRTYRISDKNIGPPGCFSQSALQSLLLILEIC"
     gene            complement(973457..973528)
                     /gene="NDAI0Gtrna11G"
                     /locus_tag="NDAI_0Gtrna11G"
                     /db_xref="GeneID:11497357"
     tRNA            complement(973457..973528)
                     /gene="NDAI0Gtrna11G"
                     /locus_tag="NDAI_0Gtrna11G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGA"
                     /db_xref="GeneID:11497357"
     gene            complement(<976848..>981140)
                     /gene="NDAI0G04090"
                     /locus_tag="NDAI_0G04090"
                     /db_xref="GeneID:13927082"
     mRNA            complement(<976848..>981140)
                     /gene="NDAI0G04090"
                     /locus_tag="NDAI_0G04090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980021.1"
                     /db_xref="GeneID:13927082"
     CDS             complement(976848..981140)
                     /gene="NDAI0G04090"
                     /locus_tag="NDAI_0G04090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980070.1"
                     /db_xref="GeneID:13927082"
                     /db_xref="GOA:J7RE75"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:J7RE75"
                     /translation="MRQTTESTTQNNERQGNMVNFLKIVKTFKGEPDEYFTWKAAMQG
                     NKELFEVSDRQFMAGLYNYFEGNAANWLKNTTFNSYEEFWLTLDTKYQSDKNNEIAIN
                     FRSLMSPPKKIRTYREYVNHFENRLAFLPADFKDSSWKLACFLFPLQLGLQDAIRSQN
                     PQNVQEAIVIGENRSIMFKDSILDPRFCGLVSDVHGDNTKGNQHHNTPSIVCYICGRP
                     GHKSNECRNSKNRQFGRHRYNQKSFRKSGPNTIPISDLSYKKLNRSPVVYINNLHVSP
                     QGDHPSFSTENITLINELQNSITSHEHQALINELPHVTTKFSNKQKVQALLDTGASSN
                     IIDPTWANRLNFITRKLTKPIHCKTGDGTMSEISHACKVKFIIDGEPFTLSALIAPFT
                     LTSAIILGMPFINNHPNILRSALKTMVQPSELVPWRTIRNDITNKNNEVHLCWISTSD
                     SSTEPPSEITKEFGDILVEKIPARDEHTKTIHHQITLKEGATPVFQRAYRMAEEERKA
                     LEDELKDLMKDNKISPSDSPFAAPVIYVKKKDGSRRLCVDYRRLNEITVKARYPIPLI
                     DDLFDQLRGATIFSKLDLVSGYHQVPIAEGDRYKTAFITQRGQYQWNVMPFGLTNAPA
                     TFQRLMNHILREYIGKFCIVYLDDILIYSKTEEEHIKHITNIMQALREHHLFAKRSKC
                     SFFLHQVGFLGHVINSTGIHSDPEKIVCIKNWSAPKDNKSCQRFLGLIGYYRRFIKDF
                     SNIAKPLREYANDKSKKVKWNKEQEFAFEKLKRALLEAPVLKPFDHNLDVVVTTDASN
                     TAIGGTLELFKDGRFYGVVAYMSKALHGHELNWPIREKEFFAIICCLEKWRHYLLGKK
                     FKLYTDHQSLKYVLTERSFKLRLARWWEDMAEYSFEIDYIKGKTNHVDALSRINLMDT
                     ESTERTISRISLDPQYLTTLRKEYQKDPELLDIYSNLQKDTPLPRKFVTIIKHYSFKD
                     GLLYYSAKIPFDSRLVIPKGTIRQTLIHLHHDSLLAGHPGSFRTYQNLVHDYYWPNMV
                     SIIEQYTRTCPQCQRNKHSRILPPGIFQPLAVPYRPWSSIGIDFVSGMKEAHNFNCVL
                     VVIDRLTKMARFIPTKKTIDASHCADLLINHIICHHGVPDEIVSDRDKLFTGKIWDRL
                     KQRLRIHLKFTTSYNPASNGQTERTNDTMRKIVASYTNQHATDWPMYCSVAAFAYNNT
                     YQSSIKTTPFFANYGFHPRLPGFTNPILDHSQNNEEQQTPSTSQSNLDYHLQALQNIM
                     VSIQTNMADAQDRQSIHFNEHHRVTNFKVGDSVLVHKDAYNNKPFTKFHHLWYGPFKI
                     IETLGDQTYRLNSQLGNRRTNTFHVRRLKLYNHRQDNAYNVPHTDYKNKLHLIERVVR
                     IFRNSTCEVQWSNAETWDTSIIPLHIIFNSEYRHLLDPYYNPSTQEITVTSS"
     gene            complement(<985479..>985922)
                     /gene="NDAI0G04100"
                     /locus_tag="NDAI_0G04100"
                     /db_xref="GeneID:13926875"
     mRNA            complement(<985479..>985922)
                     /gene="NDAI0G04100"
                     /locus_tag="NDAI_0G04100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980022.1"
                     /db_xref="GeneID:13926875"
     CDS             complement(985479..985922)
                     /gene="NDAI0G04100"
                     /locus_tag="NDAI_0G04100"
                     /inference="similar to DNA sequence:INSDC:YOL108C"
                     /note="similar to Saccharomyces cerevisiae INO4 (YOL108C);
                     ancestral locus Anc_3.75"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980071.1"
                     /db_xref="GeneID:13926875"
                     /db_xref="GOA:J7SBL9"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:J7SBL9"
                     /translation="MYPITGENSSFGFEILEDNVPSKQLKNRDQRTGMVTKQTERKKI
                     RVRARKANKLTEDEVRINHVTSEKKRRENVRSIYDDLVKLVPDLEQNENRSELIIYLK
                     TTYYLRWLYKKNNQLRTKLKEFKDDAYESEAYSQELVWEINQGEK"
     gene            <986519..>987505
                     /gene="NDAI0G04110"
                     /locus_tag="NDAI_0G04110"
                     /db_xref="GeneID:13926876"
     mRNA            <986519..>987505
                     /gene="NDAI0G04110"
                     /locus_tag="NDAI_0G04110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980023.1"
                     /db_xref="GeneID:13926876"
     CDS             986519..987505
                     /gene="NDAI0G04110"
                     /locus_tag="NDAI_0G04110"
                     /inference="similar to DNA sequence:INSDC:YOL107W"
                     /note="similar to Saccharomyces cerevisiae YOL107W;
                     ancestral locus Anc_3.76"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980072.1"
                     /db_xref="GeneID:13926876"
                     /db_xref="InterPro:IPR013861"
                     /db_xref="UniProtKB/TrEMBL:J7S4D6"
                     /translation="MRYSSDFIEVNIPRSLLRINEIPTATRILLLAYIFNTSCLFYIR
                     NSTYYSLLASDASLKYSEVICPFLQLVPEKLAEYPLSIVFSNFVDTELWKILVNLVNI
                     IIGGTFIEKNWNSSREVLIFTIVIGSITNISVVLCTFLFSQFFSGLNMKVPIDGNYTI
                     IVGFPIIYKQLLPETTILNIKSPKIIAKNFRFKLLPIFTLCLLTGMQLIWFHHIAQLL
                     SIWVTFFSCWIYLRFFQTLPFNENTIIGDASDTFQLIYFFPDIIKPVLKPIFDSVYNI
                     LCVKLKVIKPFEVIDIDKGNDIASQRGAKKIDATVEDRRRELALMVLQERIV"
     gene            complement(<988969..>989724)
                     /gene="NDAI0G04120"
                     /locus_tag="NDAI_0G04120"
                     /db_xref="GeneID:13926877"
     mRNA            complement(<988969..>989724)
                     /gene="NDAI0G04120"
                     /locus_tag="NDAI_0G04120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980024.1"
                     /db_xref="GeneID:13926877"
     CDS             complement(988969..989724)
                     /gene="NDAI0G04120"
                     /locus_tag="NDAI_0G04120"
                     /inference="similar to DNA sequence:INSDC:YOL102C"
                     /note="similar to Saccharomyces cerevisiae TPT1 (YOL102C);
                     ancestral locus Anc_3.88"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980073.1"
                     /db_xref="GeneID:13926877"
                     /db_xref="GOA:J7RT68"
                     /db_xref="InterPro:IPR002745"
                     /db_xref="UniProtKB/TrEMBL:J7RT68"
                     /translation="MVESEIAKRDIRISKALSYLLRHGAVKEGLSIDSDGYVDLSALL
                     KHNRLKTYKCTRDDIHRVVETNEKKRFNIKKLENVEYICAVQGHSMKIINPDGKLLER
                     ITTLAQLPDTLVHGTTISSCIAILESGAIKKCGRNHVHLATGITGVNSSVISGMRLSS
                     PVHIYLNLDKSLIDGIGLVKSLNNVYLTEDDIGLTFFKKVVIKLPIENRRKKAVAVNL
                     AILLALLQDKNIPYEMLDGNSDKASHDLTMNAP"
     gene            complement(<990835..>993366)
                     /gene="NDAI0G04130"
                     /locus_tag="NDAI_0G04130"
                     /db_xref="GeneID:13926878"
     mRNA            complement(<990835..>993366)
                     /gene="NDAI0G04130"
                     /locus_tag="NDAI_0G04130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980025.1"
                     /db_xref="GeneID:13926878"
     CDS             complement(990835..993366)
                     /gene="NDAI0G04130"
                     /locus_tag="NDAI_0G04130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980074.1"
                     /db_xref="GeneID:13926878"
                     /db_xref="GOA:J7SAY4"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="UniProtKB/TrEMBL:J7SAY4"
                     /translation="MTTSIHSTDLSENLSPELSPTTSVAGSMVSMKTEDHNELYDHRQ
                     QADSLPIRKNPEVQQDNSSEKEPHPSFRNANTPSAIQKNRFPAMEYDTDHPLGHRQLR
                     TTEILTSNARPSRLSYSIAHQKQLFAEDRNQNLNKETENKKQDVLHDQEKPNPVMSLP
                     KTHSERDTFDHQKRKEQGRTRSRSRTNSDASDFPSIKPLTHLKETISNHTSTRRDLSD
                     DNLPSQIPQPPKKKQTRASFDSDASQLSGDSQETEEDVCFPMPPQLHTRVNGIDFDEL
                     EEFAEHCNDLKKQYVTSLNTNQQSASSYFQNGGAMSTCTSTSSSSAALKYTPKVANIS
                     QEKTDNYNEALEEDEHKEEEENKEKLPSSYFGNTPGVSFGNNKIEADYSGNDIGVSDF
                     AYGNETFNVPDRFSFFCSESEETTHSPDVASLVKSKQSFYDLFRGGEPTWWLDCSCPT
                     DDEMRCFAKAFGIHPLTAEDIRMQETREKVELFKSYYFVCFHTFENDKESEDFLEPIN
                     VYIVVFRSGVLSFHFGPISHCANVRRRVRQLRDYVNVNSDWLCYALIDDITDSFAPVI
                     QSLEYEADAIEDSVFMARDMDFARMLQKIGESRRKTMTLMRLLSGKADVIKMFAKRCQ
                     DEANGIGPALTSQINIANLQSGSEPNFTNHLPNSYNRLTTQPRGDIALYLGDIQDHLL
                     TMYQNLLSYEKIFSRSHSNYLAQLQVESFNSNNKVTEMLGKVTMIGTMLVPLNVITGL
                     FGMNVKVPGNDTEHLGWWFGILGVLVFLAVCGWFLASFWIKRIDPPTTLNEAAESGSK
                     SIISNFLPKNEQSLNKSKDRQMRSQWNHPSNKSIASLPSKYSRYD"
     gene            <994071..>997076
                     /gene="NDAI0G04140"
                     /locus_tag="NDAI_0G04140"
                     /db_xref="GeneID:13926879"
     mRNA            <994071..>997076
                     /gene="NDAI0G04140"
                     /locus_tag="NDAI_0G04140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980026.1"
                     /db_xref="GeneID:13926879"
     CDS             994071..997076
                     /gene="NDAI0G04140"
                     /locus_tag="NDAI_0G04140"
                     /inference="similar to DNA sequence:INSDC:YBR150C,YOL089C"
                     /note="similar to Saccharomyces cerevisiae TBS1 (YBR150C)
                     and HAL9 (YOL089C); ancestral locus Anc_3.109"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980075.1"
                     /db_xref="GeneID:13926879"
                     /db_xref="GOA:J7RE79"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:J7RE79"
                     /translation="MMQDNIDESKKSQNPIETRLLGQELLGEQYWRMAETHQISGKEA
                     NFEPTTAAELSAPNPASSPSLIEAQKNIEREGNNDVHFEINNESNILNHPPKKRASKA
                     CDLCRRRKIKCDAFDDRLKKCSNCIKYHSECTFSNQNKRKGDLIEKAEESKRSRSKAD
                     IASALMQSTEFAPQASVEIPQRTLAEKRLPDQLTSKQEDAGVTLQTTSVPLKEAGLND
                     SKTTNISQFKIPDSLNSKIEKLDRKVAVVIDNMARFEWLLDKLIKKTENPNPTLNSSR
                     KPRRKLYSTAILTAPKIEWVKYKLSPLTSDLQFISPINSILSISLKWYVVQVRKLMSG
                     NVITQGLTQSQYYSLPDKNLATRLLINFHQFCISSVTGIIKLEECLSLASRYYDNVAR
                     ETMTYPELFLLNVCVCSGASITRKMDSMVNEHRLLQIIENETFFNSNQYYHKLSMVCA
                     HTKTIQALLIYYHYLQDNVSTELAVPVLDTAVRFAMELRLKRKKIHMSFLDVNEVLDR
                     GSLWWHCFSADARASMILSRPPIISLDNMDVLTDAGYFDLLKKNILPKLVKDTVAIEK
                     IDNVHKALDIIGNHCEYFPFFISYFVSKLLSLESRVFSQCFAVRSTLHLSFDEILHSI
                     SDLNKELRTWFDKLPPAMKLESYKQYLSLLLMDPTIHNTTLSFKVACSQVISCHLHYL
                     YLTNILSMFACSFILDNQNLFTDSTHDVPAVFKTFCEQSKMASITALKVFQSLEYQPC
                     MHNDMLYPFSTAVFVLIFFIIDGLEDDNSGDLISLLNLLHDSHIHLVGDNQRNLSYNN
                     MKWSTTVFMYSFLLKNIISKMKEMPMFRGSLNIDESYYDSILSSLLTSSNSIKTEAVQ
                     EYIDTLKSMGVHSGDFDDIDEIGFNNKPSSNSRDTETILNPFKDVSSEFFQLLKSSNF
                     IGNIRREANLPDKVEEADNSLFANFPYPLSFIYPRYRSSKGIDINEEWRKSEVLQAKQ
                     QQPSQIKELLPFGSLLFDRDFSVMNIFSN"
     gene            complement(<997652..>998608)
                     /gene="NDAI0G04150"
                     /locus_tag="NDAI_0G04150"
                     /db_xref="GeneID:13926880"
     mRNA            complement(<997652..>998608)
                     /gene="NDAI0G04150"
                     /locus_tag="NDAI_0G04150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980027.1"
                     /db_xref="GeneID:13926880"
     CDS             complement(997652..998608)
                     /gene="NDAI0G04150"
                     /locus_tag="NDAI_0G04150"
                     /inference="similar to DNA sequence:INSDC:YCL005W"
                     /note="similar to Saccharomyces cerevisiae LDB16
                     (YCL005W); ancestral locus Anc_1.414"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980076.1"
                     /db_xref="GeneID:13926880"
                     /db_xref="UniProtKB/TrEMBL:J7SBM1"
                     /translation="MNCSSARLQFYSILLVLVPTSILLRNVFSLIALPLNIPLKIFTG
                     SSIQQIILGTNISITNYIAITICQYLVVLISLGTLIGLSLGGVLITFHSIFVIPNVYL
                     DLSEVYKAITHQISANLPFIAKSSPDKTAITIDDGSTNKIMHKPTGNVETSKRPGVLT
                     PQTPPHEIFDTYQSNPYTDGSDISSNWRKQDAMFTTLTSPLSSSRENVLNVATNLPSD
                     FFQEKEKNSNSYNISMFENMYTPSNNENHYISSAQSPRQFKNRQSSSTSSSMSDLLDP
                     FSTITVPTTLRTRRDHGTLVNRKAAYSGNILKAAKAGLFQDA"
     gene            <1000667..>1001830
                     /gene="NDAI0G04160"
                     /locus_tag="NDAI_0G04160"
                     /db_xref="GeneID:13926881"
     mRNA            <1000667..>1001830
                     /gene="NDAI0G04160"
                     /locus_tag="NDAI_0G04160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980028.1"
                     /db_xref="GeneID:13926881"
     CDS             1000667..1001830
                     /gene="NDAI0G04160"
                     /locus_tag="NDAI_0G04160"
                     /inference="similar to DNA sequence:INSDC:YCL008C"
                     /note="similar to Saccharomyces cerevisiae STP22
                     (YCL008C); ancestral locus Anc_1.412"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980077.1"
                     /db_xref="GeneID:13926881"
                     /db_xref="GOA:J7S4E0"
                     /db_xref="InterPro:IPR008883"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR017916"
                     /db_xref="UniProtKB/TrEMBL:J7S4E0"
                     /translation="MFVDIESLQKNAKLKINRNLDSSGQLYLPIFANWDPRTCNIALV
                     IQDFIRIAMKEDLLQTVPIQSPIRSPTNNFHNEFTSPTNSEINQVVNNESINFRPPLP
                     PKPATALEPEIKNLIISRADSSPDTIVTKKLPIHSKFQVTSNLPLPPKKIPLVDRASS
                     ITSPPPFQATSNISTQTPIGNKNSPTVSKPPLHLKDDLDSVQVDLLDAGFKLQQDPNH
                     KNAIKEVQGLLNQLTTNDKIYINNNILNRKASIDSAIKQFENLYQYETKNTINLHNSI
                     QEMIKNLKSETESVDKQFAKLNVFQNTSEPSLEEEYDPLWMTTTETIGLNQLYTLVAK
                     DKALSDTINMLYQMLNRGIIQLDIFVKKSRELGRQQFLTRLHIEKIAGLLLRI"
     gene            <1002354..>1003265
                     /gene="NDAI0G04170"
                     /locus_tag="NDAI_0G04170"
                     /db_xref="GeneID:13926882"
     mRNA            <1002354..>1003265
                     /gene="NDAI0G04170"
                     /locus_tag="NDAI_0G04170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980029.1"
                     /db_xref="GeneID:13926882"
     CDS             1002354..1003265
                     /gene="NDAI0G04170"
                     /locus_tag="NDAI_0G04170"
                     /inference="similar to DNA sequence:INSDC:YCL009C"
                     /note="similar to Saccharomyces cerevisiae ILV6 (YCL009C);
                     ancestral locus Anc_1.411"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980078.1"
                     /db_xref="GeneID:13926882"
                     /db_xref="GOA:J7RT70"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR004789"
                     /db_xref="InterPro:IPR019455"
                     /db_xref="UniProtKB/TrEMBL:J7RT70"
                     /translation="MIRTLLSSNTKRCLVRYSSSSTSALAYKQLHRHAARPPLPTLET
                     PSWDANSAVSSILYETPAPSRQPRKQHVLNCLVQNEPGVLSRISGTLAARGFNIDSLV
                     VCNTEVKDLSRMTIVLQGQDGVVEQARRQIEDLVPVYAVLNYTNSQIIKRELVMARIS
                     LLGTEYFEDLLLHHHKSTSDVDQTQELVNEIREKKFHPSNLPASEVLRLKHEHLNDIT
                     NLANNFGGRVVDISETSCIVELSAKPTRISAFLKLIEPFGVLECARSGMMALPRTPLK
                     TTAEEAEEADSESKINDIVDISQLPPG"
     gene            <1003918..>1004682
                     /gene="NDAI0G04180"
                     /locus_tag="NDAI_0G04180"
                     /db_xref="GeneID:13926883"
     mRNA            <1003918..>1004682
                     /gene="NDAI0G04180"
                     /locus_tag="NDAI_0G04180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980030.1"
                     /db_xref="GeneID:13926883"
     CDS             1003918..1004682
                     /gene="NDAI0G04180"
                     /locus_tag="NDAI_0G04180"
                     /inference="similar to DNA sequence:INSDC:YCL010C"
                     /note="similar to Saccharomyces cerevisiae SGF29
                     (YCL010C); ancestral locus Anc_1.409"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980079.1"
                     /db_xref="GeneID:13926883"
                     /db_xref="InterPro:IPR010750"
                     /db_xref="UniProtKB/TrEMBL:J7SAY6"
                     /translation="MDGQWDLVISSLQDIYNANEVIQFDDDLNSKRIQFANLSDEQLQ
                     NHLTKFQDHMENVKRAHRLLDAVRVNLDTILGYTPPDSSIQPAHKAAKSQSRKNTAPT
                     GMVYWVSQYNPSEGIQNGSEVAYKPRKGGDGEWFQCEVIKIATDGMKFEVRDPEPDEL
                     GKTGKIFKCTWKDIILIPSINTPKSLTPNYPAGSKVLARYPETTTFYPAVVIGSKRDG
                     TCRLRFDGEEEVDKETEVPRRLVLPFPMVSSSPAKK"
     gene            <1005539..>1006618
                     /gene="NDAI0G04190"
                     /locus_tag="NDAI_0G04190"
                     /db_xref="GeneID:13926884"
     mRNA            <1005539..>1006618
                     /gene="NDAI0G04190"
                     /locus_tag="NDAI_0G04190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980031.1"
                     /db_xref="GeneID:13926884"
     CDS             1005539..1006618
                     /gene="NDAI0G04190"
                     /locus_tag="NDAI_0G04190"
                     /inference="similar to DNA sequence:INSDC:YCL011C,YNL004W"
                     /note="similar to Saccharomyces cerevisiae GBP2 (YCL011C)
                     and HRB1 (YNL004W); ancestral locus Anc_1.408"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980080.1"
                     /db_xref="GeneID:13926884"
                     /db_xref="GOA:J7RE83"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:J7RE83"
                     /translation="MSSEYELEPPRSYDSRRNDSRRGRSRGRGSFRGGRGSWRGNDRF
                     SRPRGRGFRGSFQPPPEENINYDNRVFVGNLSFDTTAEDLVDYFSQVGEVVTADIITF
                     KGRHKGLGTVEFTNADDATEAIERCDNTHFMGRDIYVKDDQPPPGARQKTMRIAPIRD
                     INRQGYEAFVINLPYSITWQNLKDLFRECGDILRADIELDYNGFSRGLGSVLYATEDA
                     MHRAIDTFNGYELEGRVLEVREGKFNPSHKEHIPEGTLDEVEPSIPTQSPFVEGVVGN
                     GERNPTVFCQSLPLSTTVPDLYDLFGSFGDINHAELIYDTNGLSTGSAVVEYMSADYA
                     EMCIDKLNNYNYGGHQLDISFAHRL"
     gene            complement(<1006828..>1011537)
                     /gene="NDAI0G04200"
                     /locus_tag="NDAI_0G04200"
                     /db_xref="GeneID:13926885"
     mRNA            complement(<1006828..>1011537)
                     /gene="NDAI0G04200"
                     /locus_tag="NDAI_0G04200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980032.1"
                     /db_xref="GeneID:13926885"
     CDS             complement(1006828..1011537)
                     /gene="NDAI0G04200"
                     /locus_tag="NDAI_0G04200"
                     /inference="similar to DNA sequence:INSDC:YCL014W"
                     /note="similar to Saccharomyces cerevisiae BUD3 (YCL014W);
                     ancestral locus Anc_1.406"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980081.1"
                     /db_xref="GeneID:13926885"
                     /db_xref="GOA:J7SBM3"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR021895"
                     /db_xref="UniProtKB/TrEMBL:J7SBM3"
                     /translation="MATTQDLSSLYSNHNNDITGKENANTLTIPLYRNLIESYLPESI
                     SIGNHFLQNEKQLNACFDDSSHEASRYAGIFKGFDELLWGQFIVCLYKETASKKYNAI
                     MLDKLGPTTFNSIDVSKDSQFYAAIENLNTTNRKSTLRKAIAVILLQKFVEIPKEGVH
                     KIIQPNKTLNFEYDPQYVGELTNSCEEISSSNHNNSSNSYQVISFMKKLYTMGSFQRK
                     YINSTLLDVVYENNESTIEINNRLVFHLGEQLEQLFNPVIEYSPEHTGYVYKPPDEEE
                     STSNISNNGNDNSNGKNDQEDNALIKAICNELLELQTNFTLSLVEFLQNFLIVLRVKV
                     LNDEIDRLSTRKLNRLFPPTIDEVTRINCIFLDSLKAAIPYGSLEVLKACSMTIPYFY
                     KAYTRHEAATKNFSKDIKSFLRNFDDAIPKNQSLTEMKISTIINGPQEKLLKVKLIID
                     RLYTSKKNWNIPNKTKADKYYNNIVDVVDSFGKLSNTSLSSSYNTRVFTPSGKILTEL
                     AKGWPVELQYNWLKRRVVGVFDIVDETYGGRKKLLVVFSDYIIFLNIINPDSYYSIET
                     DNQDNSLIKPHLSDILMNSLINEVPLPAKIPKLEVDNYCYIDDIFASTFEENYLRFDA
                     FKEDKSFSVSYRLSTESTPVSTVADLIMKAKILEKDTAFHLFKASFNNITLYSTAHEL
                     AAYNTEKIKAKYALFLNIEPSKELLIQNDLHMAIFAKFANENEGKFINLDILTSTEVH
                     RKDTFEAAKIIPELIGQLLLEIPIYRSSIVSSQAIKLMAINEGLVKQCISCLEKETPS
                     IPITDSYNKPAQTDKQAKEKPYETTLTSKNIVNNSRALRGKSVNTKTAVEKDNTVKKI
                     EKNTNKKLPSAKNLPRKQTGKLPTNVPSQLLAKKEKRRSGLITAFRGIFGSKKNKDAE
                     KGRNQLDDKSKNYQKTTPRQKLVPKVSQKDSIRKENTTPQPIKNESVTSFARVSKNQK
                     IEPPMLSEEQRITSVIHNRQYTEDIQGNKVMNNLDSESKENVLSETATTTPLTSKEIS
                     VSSDKQLRTALESPPGSIGNSEKVLPDPNRSLSNKNTTSRMPQIQIFTDDLFGDFVKP
                     PSLDKQTAKQEETECDNGDEDAEHYQKHLQEDALGEGVSSKDNSPLPTTANATSENRG
                     FIAPSENPSFRDGEIQHEKVKIFPDIPKMQLSKIQFDRSTSFVELFKGMRLVLDDSDA
                     KYNWKRIPSEQGLNINNLVNNATTIKNTDRNMVGNEIEKVIPKEKCYSEAAQEQRPST
                     PESSSNITEAEEEPREEKEGGHITSPQPVLSTIALLPDQTRRRLPTFKVTKTSPVRII
                     NKTLNSPQKVVGKVENDSCFSSDVTIGNIENNKRLHKLTFRSQEDVFDAKICTASREN
                     IDTIEATVQADRSKNNEEQSSKLHDRLARSGSNENLLEAFEFSSFNMSFQDLPENNEE
                     CVTSIHPVTIHDTVVPPLQNLEPAPMVYRLSNEHSSNKNKLEADDDPIWVSPSKLDLL
                     SSNKLRDRVLVNKTENEALSNQKTPIASIKNKSIPSQKLLDTSLIRNASYVYLTDFVD
                     FHDDEKYEDKPTRLQFQ"
     gene            <1011898..>1013154
                     /gene="NDAI0G04210"
                     /locus_tag="NDAI_0G04210"
                     /db_xref="GeneID:13926886"
     mRNA            <1011898..>1013154
                     /gene="NDAI0G04210"
                     /locus_tag="NDAI_0G04210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980033.1"
                     /db_xref="GeneID:13926886"
     CDS             1011898..1013154
                     /gene="NDAI0G04210"
                     /locus_tag="NDAI_0G04210"
                     /inference="similar to DNA sequence:INSDC:YCL016C"
                     /note="similar to Saccharomyces cerevisiae DCC1 (YCL016C);
                     ancestral locus Anc_1.405"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980082.1"
                     /db_xref="GeneID:13926886"
                     /db_xref="InterPro:IPR019128"
                     /db_xref="UniProtKB/TrEMBL:J7S4E3"
                     /translation="MSINLHSQLELDTSYKLLQLTPDLLNILTNPEYKGDELKFKSLH
                     DNGKSDVVLCSKEKTWSIKQKNHSNTVLLMKEFVPEDNENDDGEDNDRIETFNMPRPI
                     NDFLGFTKTTFEYETRLSKGEINLEMVPVYDGEKDFFDHNNTKGKKKNGKISKLQNMS
                     ELIENSCCSEKECLEQWNRLGGCEINGYVCLLSSDFLSKSLHVVLMSVMAEQLNMDQL
                     TVDETFNAIDKDVGDGFSPYTREVVKTVLNKFGTSISKNEDKGTRDVEKYRLDTPEIT
                     KWYGILALKKYVSRSSMALDEFLIKWKSLFPPFFPCNLDIAMLRGWHFKESNLHDDIG
                     VVDNTNDRHDTSMVRVQYISRDTLSMDPKQRFQRLFSLQSRWDMEDLWPFVEELNIRG
                     LKPDSFVAKFARRRKVGRRVVISSRG"
     gene            <1013765..>1015324
                     /gene="NDAI0G04220"
                     /locus_tag="NDAI_0G04220"
                     /db_xref="GeneID:13926887"
     mRNA            <1013765..>1015324
                     /gene="NDAI0G04220"
                     /locus_tag="NDAI_0G04220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980034.1"
                     /db_xref="GeneID:13926887"
     CDS             1013765..1015324
                     /gene="NDAI0G04220"
                     /locus_tag="NDAI_0G04220"
                     /inference="similar to DNA sequence:INSDC:YCL017C"
                     /note="similar to Saccharomyces cerevisiae NFS1 (YCL017C);
                     ancestral locus Anc_1.403"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980083.1"
                     /db_xref="GeneID:13926887"
                     /db_xref="GOA:J7RT74"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020578"
                     /db_xref="UniProtKB/TrEMBL:J7RT74"
                     /translation="MLRYTATPFLRLSSSSCAASLASRRTLPSLVSRSNIIIPNTKNK
                     RLYSAVAATSPAVKVAKDISLETHTDTQRAAKETQEARSAAATTPLSKSSIIDEIDTS
                     GTTALNAAYQENTGFGTRPIYMDMQATTPTDPRVLDTMLKFLTGLYGNPHSNTHSYGW
                     ETHKEVEDARDHVAKLIGANAKEIIFTSGATESNNMVIKGVSRFYKNTKKHIITTRTE
                     HKCVLEAARAMINEGFEVTFLNVDEQGLINLKELEDAIRPDTCLVSVMAVNNEIGVIQ
                     PLKEIGNICKKKKVYFHTDAAQAYGKIKLDVNDMNIDLLSISSHKIYGPMGIGGLYVR
                     RRPRVRLEPLLSGGGQERGLRSGTLAPPLVAGFGRAAKLMYDEFESDHEHIKRLSDKL
                     VKGLLALDHTNLNGSADHRYPGCVNVSFAYVEGESLLMALRDIALSSGSACTSASLEP
                     SYVLHALGRDDVLAHSSIRFGIGRFTTEKEVDYVIKAISERVQFLRNLSPLWEMVQEG
                     IDLDSIEWSGH"
     gene            complement(<1015689..>1016780)
                     /gene="NDAI0G04230"
                     /locus_tag="NDAI_0G04230"
                     /db_xref="GeneID:13926888"
     mRNA            complement(<1015689..>1016780)
                     /gene="NDAI0G04230"
                     /locus_tag="NDAI_0G04230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980035.1"
                     /db_xref="GeneID:13926888"
     CDS             complement(1015689..1016780)
                     /gene="NDAI0G04230"
                     /locus_tag="NDAI_0G04230"
                     /inference="similar to DNA sequence:INSDC:YCL018W"
                     /note="similar to Saccharomyces cerevisiae LEU2 (YCL018W);
                     ancestral locus Anc_1.402"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980084.1"
                     /db_xref="GeneID:13926888"
                     /db_xref="GOA:J7SAY8"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004429"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:J7SAY8"
                     /translation="MSTKKIVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHL
                     IGGAAIDATGVPLPDEALEASKNSDAVLLGAVGGPKWGTGAVRPEQGLLKIRKELGLY
                     ANLRPCNFASESLLGLSPLRPEIAKGTDFMVVRELVGGIYFGKRKEDEGDGVAWDSEQ
                     YSVPEVQRITRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPTLTV
                     QNQLIDSAAMILVKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDT
                     NTAFGLYEPCHGSAPDLPKGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVKKVLDA
                     GIRTGDLGGSNSTTEVGDAIAKAVKEILA"
     gene            <1018001..>1020868
                     /gene="NDAI0G04240"
                     /locus_tag="NDAI_0G04240"
                     /db_xref="GeneID:13926889"
     mRNA            <1018001..>1020868
                     /gene="NDAI0G04240"
                     /locus_tag="NDAI_0G04240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980036.1"
                     /db_xref="GeneID:13926889"
     CDS             1018001..1020868
                     /gene="NDAI0G04240"
                     /locus_tag="NDAI_0G04240"
                     /inference="similar to DNA sequence:INSDC:YLR176C"
                     /note="similar to Saccharomyces cerevisiae RFX1 (YLR176C);
                     ancestral locus Anc_1.400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980085.1"
                     /db_xref="GeneID:13926889"
                     /db_xref="GOA:J7RE88"
                     /db_xref="InterPro:IPR003150"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:J7RE88"
                     /translation="MLTPMVQSIEYKIIILYQPKEIIIICIIVMYPNNTFSMNNQPVL
                     VPQQQQQQQQQQQQQQQPSYPNHLRPLLPSIMSTSPILSRHSASPSTGATASTVGTSN
                     TENNSNNNIHIQKQHSFQMMNPSTPPPSLLPLLPHSHPNSQLSRTQSSISSFNYQTNN
                     STSTNTDSQTNNTATDNNLRNINQYASMLKNEGSYGLTKESNNITKAKRYHSFQNFTI
                     QNRNILPKLQNNSNIQGVSDKPEASSTTITTTANTTTATTDIDDNNEPITKKLAKKKL
                     KPGSSVVAAAKKAKTESPSPSISPPITTNNNNNNNTTSQATSNNLSSNLLITRRNTQE
                     VLAKTIAEKHLDKPISEYATIVRKAEIVVLNMDTQTHSKASLQIAEQNRERERQVYAL
                     LWLMKNCQSKHDSYVPRGRIFAQYASSCAQNNLKPLSQASLGKLIRTVFPDLTTRRLG
                     MRGQSKYHYCGLQLIDNEDFNPNELSQSPLQEQEFKDPSLIQMVKEQEEEQDMGNNFK
                     DEYTRKIRKITESSSAASLSSTSSLTIIKAEPMQNESLMHDPISDPISSEVKTEKEEP
                     SKLDYTISETEKKQYKRSHKDHDGESRNNDNIEEVTKPNCDDLPFLNDLYRKVFAKYS
                     TNEEDISLTLPSIPRGKLPPGTDDDIVSSLESLYHVHCHSLYKNIKFMKFDELSESLF
                     GSGLLSPQMYNLFISEPLFDWIHECDLITHIELVKYLSSLAINKTFINESVLFKLEIF
                     TKNYYNYVSNSTIDLPVPVVNSKLELAKDFSNLIKKLIKLFKFILGFQNCFESFVLGM
                     RYDWANIVNLEDILELVNNEKQHDLMIEIKEFIGVNTPAFLNDNSDSAENAGSTSLTT
                     STSSSFVSRAEPSKSRASGVREPMIKIMKKFLVFISNRRHDTSALPFIDCFVRFTNAI
                     VGDISLKSSENLLPWLYFNNITVQLLTYSFEVTKFLNETKI"
     gene            <1021818..>1022909
                     /gene="NDAI0G04250"
                     /locus_tag="NDAI_0G04250"
                     /db_xref="GeneID:13926890"
     mRNA            <1021818..>1022909
                     /gene="NDAI0G04250"
                     /locus_tag="NDAI_0G04250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980037.1"
                     /db_xref="GeneID:13926890"
     CDS             1021818..1022909
                     /gene="NDAI0G04250"
                     /locus_tag="NDAI_0G04250"
                     /inference="similar to DNA sequence:INSDC:YNL007C"
                     /note="similar to Saccharomyces cerevisiae SIS1 (YNL007C);
                     ancestral locus Anc_1.398"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980086.1"
                     /db_xref="GeneID:13926890"
                     /db_xref="GOA:J7SBM5"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:J7SBM5"
                     /translation="MVKETKLYDLLGVTPSANEQEIKKGYRKAALKYHPDKPTGDTEK
                     FKQISEAYEILSDSNKREIYDQYGLEAARNGGAMPMPGQDGTTFTSTGGFPGGGGAHA
                     FSNEDAFNIFSQFFGGGGSDGGFGFQSFPGSGGSGHTNVKFSSSGFPGGFGGMSQEMP
                     GGFSSASTGGIPNGFNSPYEERMSAQEEGVDEVHISVSLEDLFAGKKKSFKIGRKGPG
                     GVQEKTQIDIQLKPGWKAGTKLTYKNKGDYNPRTHGRKTLQFIIDEKPHPTFQREDDN
                     LVCTVPLTFKESLLGFSKTVQTIDGRNLPISRSQPIQPTEITRYPGQGMPISKKPGQR
                     GDLIVKYKIAYPITLTQAQRDAIKTNFNV"
     gene            <1023344..>1024273
                     /gene="NDAI0G04260"
                     /locus_tag="NDAI_0G04260"
                     /db_xref="GeneID:13926891"
     mRNA            <1023344..>1024273
                     /gene="NDAI0G04260"
                     /locus_tag="NDAI_0G04260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980038.1"
                     /db_xref="GeneID:13926891"
     CDS             1023344..1024273
                     /gene="NDAI0G04260"
                     /locus_tag="NDAI_0G04260"
                     /inference="similar to DNA sequence:INSDC:YOL096C"
                     /note="similar to Saccharomyces cerevisiae COQ3 (YOL096C);
                     ancestral locus Anc_3.99"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980087.1"
                     /db_xref="GeneID:13926891"
                     /db_xref="GOA:J7S4E6"
                     /db_xref="InterPro:IPR010233"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:J7S4E6"
                     /translation="MLQRTQFLKRILTLNRLNRIQLRCSSTGTTSDEVSHFESLASTW
                     WDVNGSQAILHRMNLARLDFVQRIIRNSIALNEEPTKASQDDVYIPGYNYKAFFPKEV
                     SNAVSQDIRMTASSKLQKMKLNVLDVGCGGGILSESMGRLPFIKHVTGIDLAPDCITV
                     AKSHARSDPLLQGKVSYHVKSLENVKGKFDIVTCFEMLEHVDHPEAILNHAWKRLNKE
                     GILFISTINKDLVSWFTTIFVAENILGIVPRGTHHLSKYVNSKDIVQWFQKNEGSKYE
                     LLDLKGTMFIPIKGWVEHDCPNVGNYIMAIRKE"
     gene            <1024813..>1026135
                     /gene="NDAI0G04270"
                     /locus_tag="NDAI_0G04270"
                     /db_xref="GeneID:13926892"
     mRNA            <1024813..>1026135
                     /gene="NDAI0G04270"
                     /locus_tag="NDAI_0G04270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980039.1"
                     /db_xref="GeneID:13926892"
     CDS             1024813..1026135
                     /gene="NDAI0G04270"
                     /locus_tag="NDAI_0G04270"
                     /inference="similar to DNA sequence:INSDC:YOL097C"
                     /note="similar to Saccharomyces cerevisiae WRS1 (YOL097C);
                     ancestral locus Anc_3.97"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980088.1"
                     /db_xref="GeneID:13926892"
                     /db_xref="GOA:J7RT79"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002306"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:J7RT79"
                     /translation="MTSEEKPVAQVTEETAKLDISDNAGNKEQVVTPWDVEGAVDAEG
                     NAQAIDYDKLIQKFGTKPVNQETLERFERVTGHKPHHFMQKGYFFSERDFNKILDLYE
                     QGKPFFLYTGRGPSSDSMHMGHMIPFLFTKWLQDVFDVPLVIELTDDEKFLFKHKLTI
                     DDVKKFAKDNAKDIIAVGFNPENTFIFSDLQYMGGGFYETVVRVSRQITGSTAKAVFG
                     FTDSDCIGKFHFASIQIASAFPSSFPDVLGLPPKTQCLIPCAIDQDPYFRVCRDVAEK
                     LKYAKPALLHSKFFPALQGSTTKMSASDENSAIFMTDTPKQIQKKINKYAFSGGQVSI
                     DLHRELGGNPDVDVAYQYLAFFKDDDKFLKECYDKYKSGELLSGEMKKLCIEVLQEFV
                     KDFQERRAKVDDEIMEKFMKPHKLVWGQKERLVPAKPKVKAPKDSKKK"
     gene            <1027206..>1030310
                     /gene="NDAI0G04280"
                     /locus_tag="NDAI_0G04280"
                     /db_xref="GeneID:13926893"
     mRNA            <1027206..>1030310
                     /gene="NDAI0G04280"
                     /locus_tag="NDAI_0G04280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980040.1"
                     /db_xref="GeneID:13926893"
     CDS             1027206..1030310
                     /gene="NDAI0G04280"
                     /locus_tag="NDAI_0G04280"
                     /inference="similar to DNA sequence:INSDC:YOL098C"
                     /note="similar to Saccharomyces cerevisiae YOL098C;
                     ancestral locus Anc_3.93"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980089.1"
                     /db_xref="GeneID:13926893"
                     /db_xref="GOA:J7SAZ0"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:J7SAZ0"
                     /translation="MAFNKLLSFQLEYAPQYHLTKYVSARTGLQLVHIDHKSSPLVQG
                     YFAVGTECPNDSGVPHTLEHLIFMGSKEHPYKGLLDTVGNLCMSSTNAWTATDQTVYT
                     LTSAGWKGFSKLLPSYLNHILFPTLTDEACTTEVYHVDPEDFSDKGVVFSEMEAIESQ
                     SWFVTMLEKQRLMFPEGSGYRSETGGLTNNLRTLTNDEIKKFHKEMYSSDNLCLIICG
                     NVPQSELLDIMENWDSTLPEKDNSTKKRPFLDTPESQIPSSRNEIIESTVEFPELDES
                     QSEILFSWIGEPYLSYTTDLAVSMLLDYFTESALAPFTKQLVEISDPLANSTDYWTDD
                     YMRTIINLGIHGVPTEKMEQTKAKVMEILATHEIDMARIKQVVDNGKWEYILRCEKNG
                     DSVLSQAVITDFLYGDLHGSSLEASVKSLSDFNELSKWTSEQWSSLIKKIFIDNKPII
                     VLGKPSSELYESIDKEKEKLLRERKEQYGEHGLSKLRETLDQAQTHNNTPIPESLLEA
                     FILENPEKTVDFISTVSITVCDDTKHKNEADPLTRSILNSKPENFPLFLHLGHFPSQF
                     IELHCLLNSTCIKDTTLLPYYHVFTELFSMPMKGENNEIVIPYEEVVSKLKSETVDSQ
                     ISLGLNATCPELIDLRIRCKSDDYSKAVNWIKHCLFDMIFDEKRVSVLVENYLNSIVE
                     LKREGDVMLESLTCRNIYSTRSMKKSVDPLYVESILEDVLNDIEDGKFQEKVLPRLET
                     MRIQLREHFNKFHILIFGDVSKIQSEVYKPWESLIANLDAAPQSYKVKTPPVPRLLSS
                     VSPLCKKPSERAYIITAPASESSYMNVITPVPFNLNYNDPEYAAVLLASEYLQCVEGP
                     FWKGIRGSGLAYGANMVKMTEINSWGFNIYRGTDIVKCYQAGKQIVEGYATGVAQFQP
                     NLMQGAVNSIINRLATIENGYFAASISKYVDDFLLARGPNFNKMILERLADVSIKELQ
                     HVMQKYFVNLFDSDKSVVFICCHPSKVEAVQEFLEEQGFTVDIEELEDEEQDEDEDDE
                     GNSD"
     gene            complement(<1030530..>1033871)
                     /gene="NDAI0G04290"
                     /locus_tag="NDAI_0G04290"
                     /db_xref="GeneID:13926894"
     mRNA            complement(<1030530..>1033871)
                     /gene="NDAI0G04290"
                     /locus_tag="NDAI_0G04290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980041.1"
                     /db_xref="GeneID:13926894"
     CDS             complement(1030530..1033871)
                     /gene="NDAI0G04290"
                     /locus_tag="NDAI_0G04290"
                     /inference="similar to DNA sequence:INSDC:YDR490C,YOL100W"
                     /note="similar to Saccharomyces cerevisiae PKH1 (YDR490C)
                     and PKH2 (YOL100W); ancestral locus Anc_3.92"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980090.1"
                     /db_xref="GeneID:13926894"
                     /db_xref="GOA:J7RE93"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:J7RE93"
                     /translation="MILTQNDSLRPLLPTDEDELNSQIAKKKKELQENEFESLTLKKK
                     TATTTLNPQRSASNKNVANMILEKKATPVQKALTDTHNFIQMRSKDQNKDQNKEKDEG
                     ELEGNDTSDQVSLDSINNTLNGLTMADSFKKRKDEWAEKGAAKIIQEIVDPETGQTTK
                     QVIKKGIKDFKFGEMIGDGAYSTVLLATSIDSGKKYAVKVLNKEYLIRQKKVKYVNIE
                     KIALQRLNNSRSIIRLFFTFQDEASLYFLLEYAPNGDFLSVMKKYGSLNEECACYYGA
                     QILDAIGFMHTRGIIHRDIKPENILMDKDMKVKITDFGTAKILDEKTNGNNKTSYELL
                     TRSKSFVGTAEYVSPELLNDNYSDSRCDIWAFGCILYQMIAGKPPFKATNEYLTFQKV
                     MKVQYAFTAGFPTIIRDLIKRILLKVPEQRLTIGQIKSHLFFSEKNFSDDSIWDDPAP
                     EIQPYKINAKSMQPVPQLKDHLNNKRTVIMLNKRPSPKPTAATIPMITKANIDGKSSS
                     PSLSSDIKKPARKPADNRTKEILENARRSVNQRKQNLMTKASNGGATSAATAALAKRI
                     HNPVRSSSSPKIKTTKSSSTTKVDLTNPSHSIKYSATPRIMKTADNLHSNTTPITVLK
                     EKSNETSQKMPHRRLSASVSSPMLPIVSPPATPRELVKKPELFSKFMNKSDIEWSFYL
                     KSIDEHIIKIGEFNVITLDTGLLEKRLNRFHITSATPQIFANQKTTLLSQVARSGGGV
                     TGFRNDMNDNMPLFPESTYYKETTFDPESIVEEYKQSTTDLLTLLFPTSRQEADTEEP
                     NTSPSADTEGSVITGKFKKLFQHAKQPLQYETTPEEKLYKRLLLLTSYGRFLMFVKRS
                     KPMEITNIIYDLVYEIDLCQNESAIKEILVPTPANISAVGSNNLISIQTPYKSFILNS
                     LKNDQEAWFGALKKAIKLGYDVKLASRTRRNTSSRPHAGSSPLPDVSPSIQEEKEISV
                     ALPNTSIGKGQIRESSAVSESNKGPPTSSELGWTSRPITAGNNSTNRSSRLFNAFVNS
                     KEKTGKKTSKSSVPITTKLINGLPNTSAHTLLGLGLSDSPGSSSISIDRPSTASSSSN
                     SSTFKRGSTSSRLQNISEQYFRPHK"
     gene            <1035664..>1036620
                     /gene="NDAI0G04300"
                     /locus_tag="NDAI_0G04300"
                     /db_xref="GeneID:13926895"
     mRNA            <1035664..>1036620
                     /gene="NDAI0G04300"
                     /locus_tag="NDAI_0G04300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980042.1"
                     /db_xref="GeneID:13926895"
     CDS             1035664..1036620
                     /gene="NDAI0G04300"
                     /locus_tag="NDAI_0G04300"
                     /inference="similar to DNA sequence:INSDC:YDR492W,YOL101C"
                     /note="similar to Saccharomyces cerevisiae IZH1 (YDR492W)
                     and IZH4 (YOL101C); ancestral locus Anc_3.90"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980091.1"
                     /db_xref="GeneID:13926895"
                     /db_xref="GOA:J7SBM8"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="UniProtKB/TrEMBL:J7SBM8"
                     /translation="MSSITTTKGGCPNDNYPTSKRYTVISKLSTRNHYKLKELPEWQR
                     EFNSGKVITGFLKETNSFKKCLWSTMYWHNSSINISLNGIAATVYFMLLFFFTDCYLI
                     PSFPSTTMSDYIVLNLYLLTATQNFMVGTIFYIMKSHSKQQAFLWYKLNNIGLINHIA
                     SSVVTLLYYHYFDYVFYFKFFTIVTLLLITLFTCSIISDSFNKMTRIRKNFLLLAYII
                     LLTLMPSLFAILRFGLAKVLERISLNLIILEIFIYAFGLTIRTSQLPERFFNSFDFLG
                     NSENVYQLSIIVCSFIHFKILMNSYCLMHSGVNPPTLVTFQD"
     gene            complement(<1036686..>1038977)
                     /gene="NDAI0G04310"
                     /locus_tag="NDAI_0G04310"
                     /db_xref="GeneID:13926896"
     mRNA            complement(<1036686..>1038977)
                     /gene="NDAI0G04310"
                     /locus_tag="NDAI_0G04310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980043.1"
                     /db_xref="GeneID:13926896"
     CDS             complement(1036686..1038977)
                     /gene="NDAI0G04310"
                     /locus_tag="NDAI_0G04310"
                     /inference="similar to DNA sequence:INSDC:YOL095C"
                     /note="similar to Saccharomyces cerevisiae HMI1 (YOL095C);
                     ancestral locus Anc_3.101"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980092.1"
                     /db_xref="GeneID:13926896"
                     /db_xref="GOA:J7S4F0"
                     /db_xref="InterPro:IPR000212"
                     /db_xref="InterPro:IPR014016"
                     /db_xref="InterPro:IPR014017"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:J7S4F0"
                     /translation="MNNNKKKTTLTPSQTRVVEYPYRPATTLKVIAGPGSGKTLTLLH
                     KVRHLILSGQVRPDEILILSLTNKAVDTITCNLLSTFEEGNLYESIDNQLKLDELKEI
                     VEQIGIYTIHGLANRVVIENEGIVTIIEENGWRGLLKLLPSDFWQRNRRSLNNNINGL
                     TRQLQKILQEYKGRNDQKLDIGKNGQVIEKLVQIMNSGKVFTNDDLILKATQHLESPI
                     TLELDKTTMNVEGKEDEEGDASFTEKLLSKYKVVLIDEYQDLYPSLLPIIEKISKGKQ
                     LLMFGDTNQSIYGFLGDNEIVMKSLDNLHEKEKSETLHLYDNFRCTPEIISSANKIIS
                     NANHLHNTHSTAKDLILKPLSNYEPQVHEIDDPIDELETIVDQIIQHVCSGAKFSDIA
                     ILSRTNNHIQSIADHLTSYGIPFEKLTIQPDWINDIRIQFILDLMKMIMLSSRERLES
                     INDGQHTHKWQSDFNVIVTLSSIKGIGNQSLQTLYSDCNREGISLWKYISEIPKSKWN
                     PKISNKKKIEQYTTLLKPWIESEKIWQMDNPGEILKIIIDIVYQLDYDPLKFKTNQEM
                     KKFRNNLEEMFKIMKLSKFNQPQDQCFVEWFLETCFEQSIIFHRAKLETETNPESLGS
                     IKLSTIHSSKGLEFPIVILSNGPFGLSYPIDDKSLYVGMTRARTLLNIINTKHPNLSK
                     PIKSKVALLSSSSPLETSPLLANKQFWEYYNNDLRRDISNLPSFDTNMARYKMLQTKF
                     GINNGRSFSTLCSKTISLTKRFL"
     gene            <1039571..>1041022
                     /gene="NDAI0G04320"
                     /locus_tag="NDAI_0G04320"
                     /db_xref="GeneID:13926897"
     mRNA            <1039571..>1041022
                     /gene="NDAI0G04320"
                     /locus_tag="NDAI_0G04320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980044.1"
                     /db_xref="GeneID:13926897"
     CDS             1039571..1041022
                     /gene="NDAI0G04320"
                     /locus_tag="NDAI_0G04320"
                     /inference="similar to DNA sequence:INSDC:YLR175W"
                     /note="similar to Saccharomyces cerevisiae CBF5 (YLR175W);
                     ancestral locus Anc_1.397"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980093.1"
                     /db_xref="GeneID:13926897"
                     /db_xref="GOA:J7RT84"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR002501"
                     /db_xref="InterPro:IPR004521"
                     /db_xref="InterPro:IPR004802"
                     /db_xref="InterPro:IPR012960"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:J7RT84"
                     /translation="MSKDFVITPEAAGSTANTSEWPLLLKDYDKLLVRSGHYTPIPTG
                     STPLKRDLKSYISSGVINLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKVTGCLI
                     VCVDRATRLVKSQQGAGKEYVCIVRLHDALKDEKDLGRSLENLTGALFQRPPLISAVK
                     RQLRVRTIYDSNLIEFDNKRNLGVFWASCEAGTYMRTLCVHMGMLLGVGGHMQELRRV
                     RSGALSENDNMVTLHDVLDAQWVYDNTRDESYLRKIIQPLETLLVGYKRIVVKDSAVN
                     AVCYGAKLMIPGLLRYEEGIELYDEVVLITTKGEAIAVAIAQMSTVDLATCDHGVVAT
                     VKRCIMERDLYPRRWGLGPIAQKKKQMKADGKLDKFGRTNENTPEDWKKSYKPLDSNP
                     ESTTTTSESAPLIKEVESKEEKKQEEESKEKESNDEETKVEKKEKKDKKEKKDKKEKK
                     EKKDKKEKKEKKRKADEDGEGEGEEKKKKKSKK"
     gene            complement(<1041570..>1042625)
                     /gene="NDAI0G04330"
                     /locus_tag="NDAI_0G04330"
                     /db_xref="GeneID:13926898"
     mRNA            complement(<1041570..>1042625)
                     /gene="NDAI0G04330"
                     /locus_tag="NDAI_0G04330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980045.1"
                     /db_xref="GeneID:13926898"
     CDS             complement(1041570..1042625)
                     /gene="NDAI0G04330"
                     /locus_tag="NDAI_0G04330"
                     /inference="similar to DNA sequence:INSDC:YFR007W"
                     /note="similar to Saccharomyces cerevisiae YFR007W;
                     ancestral locus Anc_8.101"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980094.1"
                     /db_xref="GeneID:13926898"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:J7SAZ2"
                     /translation="MVDIAQLKGEILEFLKQKITTNYRIAIVIVGPPGSGKSTIATRL
                     ANELNNDYNAYLESHPSVKPSFNHSTENIDLLSDIPEIDPDLKKELTACDGISKRLVE
                     DLEFRPVKYSINQDETLVIGRGGLPNSIQVRSSKNKQNNDDANKSGNIAQIIPMDGFH
                     LSKACLDEFKDPKQAHKRRGSPPTFDSNNYLELCRLLGKTCIISPPRKDRNDMEENIM
                     EEIASTFIDNVPEICVSGFDHALGDPTRGDICISNDTRILIFEGLYLLYDQENWSKIY
                     PVLMETGAVLVWNIDSDEKLIEERVAKRHLKSGLVNSLREGIDKFKQNDLLNARSIRK
                     HAIKAKNISTIHNEVPL"
     gene            <1042891..>1043715
                     /gene="NDAI0G04340"
                     /locus_tag="NDAI_0G04340"
                     /db_xref="GeneID:13926899"
     mRNA            <1042891..>1043715
                     /gene="NDAI0G04340"
                     /locus_tag="NDAI_0G04340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980046.1"
                     /db_xref="GeneID:13926899"
     CDS             1042891..1043715
                     /gene="NDAI0G04340"
                     /locus_tag="NDAI_0G04340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980095.1"
                     /db_xref="GeneID:13926899"
                     /db_xref="GOA:J7RE96"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:J7RE96"
                     /translation="MKFCTTLFGSLLILIQIAQAAKNNVKHVTSIDQFYNICNNANGS
                     YTMVKYYTTWCHHCKRLGPIYEELSDLYKNVEGDDNVTFLNVNCEIFGSTLCVDLPGF
                     PIINLIKPLDKPLNIKEFDWNSLSFFERIWKRIYDKLYLKNPYWQIDPDRIVKYQGRR
                     DVEPLDNFIKTVKAKDELSKKVSSILNPNYHCSDADLFCKEGKIYLLEFLEQLDHSKQ
                     NGDKRDAIFKERMKLENIIRNNEKSVDKDTLQVIKLKLELLNTYEDTIQDVQHDEL"
     gene            <1044163..>1045698
                     /gene="NDAI0G04350"
                     /locus_tag="NDAI_0G04350"
                     /db_xref="GeneID:13926900"
     mRNA            <1044163..>1045698
                     /gene="NDAI0G04350"
                     /locus_tag="NDAI_0G04350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980047.1"
                     /db_xref="GeneID:13926900"
     CDS             1044163..1045698
                     /gene="NDAI0G04350"
                     /locus_tag="NDAI_0G04350"
                     /inference="similar to DNA sequence:INSDC:YCL004W"
                     /note="similar to Saccharomyces cerevisiae PGS1 (YCL004W);
                     ancestral locus Anc_1.415"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980096.1"
                     /db_xref="GeneID:13926900"
                     /db_xref="GOA:J7SBN0"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="InterPro:IPR016270"
                     /db_xref="InterPro:IPR025202"
                     /db_xref="UniProtKB/TrEMBL:J7SBN0"
                     /translation="MIARSQSLLFIPKHTVSMSSKTSSLPTPLSSFLRTKFYFEKGQI
                     EIIDTPTNFYNTLKFKISTAERRIFLASLYLGKTENEFIECISTAMTRNPQLKLYFLI
                     DGLRGTRESPDLCSASMLAKLDKQFGDRVDLRLYRTPKFIGWKKLIPKRFNEGIGLQH
                     MKIYGFDDEVILSGANLSNDYFTDRQDRYYLFKSCPAFASYYFKLQQLVSSISYRIQY
                     SSSEQEKYKLSWPQTNLIKKPATLLTKHHFVQKTSKALTEFLYPDSTSAGQQQQQQLS
                     KPELDCPTVVYPISQFTPLYPHNKDQSTEKPTIIKLLQSKSTKKPWLFTAGYFNIHSD
                     LKRTLLETPTKDSLIITASPKANGFYKSKGASGMLPDAYLYLSYKFLKAIPKMRREDI
                     RLKEWQNGIANTPGGWSYHAKGIWFMEKDTRTNTNTNGYIPYLTIIGSSNYTRRSYSL
                     DLETNCVIFTKDESLQLEMKKELDKLLMNTKEVTLNDFKNDKERHVSKRVKLATNIFG
                     KRL"
     gene            complement(<1045852..>1046676)
                     /gene="NDAI0G04360"
                     /locus_tag="NDAI_0G04360"
                     /db_xref="GeneID:13926901"
     mRNA            complement(<1045852..>1046676)
                     /gene="NDAI0G04360"
                     /locus_tag="NDAI_0G04360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980048.1"
                     /db_xref="GeneID:13926901"
     CDS             complement(1045852..1046676)
                     /gene="NDAI0G04360"
                     /locus_tag="NDAI_0G04360"
                     /inference="similar to DNA sequence:INSDC:YCL002C"
                     /note="similar to Saccharomyces cerevisiae YCL002C;
                     ancestral locus Anc_1.416"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980097.1"
                     /db_xref="GeneID:13926901"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:J7S4F3"
                     /translation="MIIPTILQLLCGILSVSSILYQKRYNRIHRSIYGLSYDLYLYDI
                     LGHLISLYCSINYKYSPLVRRQLANRYPLFYSNPHDIPISILLLLKDILMVYCDLLIF
                     RQLYHYRTTKHIHQGISSTSTVLIIIFPVFTVFTFACSCLNLPIEDSGKFGIFYLDHI
                     NYLWIIGNFFLTFKFIPQISLNWMGLSTTGLSSKFVILNTLSNVTYLLIYYILSTTNL
                     FSEQDLPFWKWPFNFKPIFVICFQLLSLLFILYQAQFLYIHSKNYLPKGKGSSSLF"
     gene            <1047117..>1047629
                     /gene="NDAI0G04370"
                     /locus_tag="NDAI_0G04370"
                     /db_xref="GeneID:13926902"
     mRNA            <1047117..>1047629
                     /gene="NDAI0G04370"
                     /locus_tag="NDAI_0G04370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980049.1"
                     /db_xref="GeneID:13926902"
     CDS             1047117..1047629
                     /gene="NDAI0G04370"
                     /locus_tag="NDAI_0G04370"
                     /inference="similar to DNA sequence:INSDC:YCL001W"
                     /note="similar to Saccharomyces cerevisiae RER1 (YCL001W);
                     ancestral locus Anc_1.417"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980098.1"
                     /db_xref="GeneID:13926902"
                     /db_xref="GOA:J7RT88"
                     /db_xref="InterPro:IPR004932"
                     /db_xref="UniProtKB/TrEMBL:J7RT88"
                     /translation="MEKIDQLKQLYQVNLDKVTPHYKERWAVLIALNVLFLLRIVMAQ
                     GWYVVCYALGLFQLNQFLAFLTPKFDMSLQQDEANKELEAGERADDFKPFIRRLPEFK
                     FWYNSMRATLISLVLSLIRIVDIPVFWPILLMYFLVLFFLTMRKQIQHMIKYKYVPLD
                     IGKKKYSNSK"
     gene            <1048279..>1049508
                     /gene="NDAI0G04380"
                     /locus_tag="NDAI_0G04380"
                     /db_xref="GeneID:13926903"
     mRNA            <1048279..>1049508
                     /gene="NDAI0G04380"
                     /locus_tag="NDAI_0G04380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980050.1"
                     /db_xref="GeneID:13926903"
     CDS             1048279..1049508
                     /gene="NDAI0G04380"
                     /locus_tag="NDAI_0G04380"
                     /inference="similar to DNA
                     sequence:INSDC:YNL001W,YCL001W-B"
                     /note="similar to Saccharomyces cerevisiae DOM34 (YNL001W)
                     and YCL001W-B; ancestral locus Anc_1.418"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980099.1"
                     /db_xref="GeneID:13926903"
                     /db_xref="GOA:J7SAZ5"
                     /db_xref="InterPro:IPR004405"
                     /db_xref="InterPro:IPR005140"
                     /db_xref="InterPro:IPR005141"
                     /db_xref="InterPro:IPR005142"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:J7SAZ5"
                     /translation="MKVVSINKGVTEKAPTVITLVPENKEDLFTVYQIVDKDDEVIFK
                     KLFTSKNEDAKKNNTDLVNLKLKILSNEFDMRDEYLRYKGITVIDQTGVANIDIPIGK
                     FLSFNIVYTHPITIYKHHFNKYAEKLLKEACAEENKSDTAAVVLQEGISHVCLLTSSS
                     TIMKQKIEFTMPKKKSATDIAKFDVKTESFYKATYEAMKKNFDFDELKMIILCSPGFY
                     AKTLLEKVLKYAEEEQNNSILDNQMIFFVAHCSTGYLQGISEVLKNPEYASKLEDTKF
                     SKFAVIMDGFLKHLDDDDDRAWYGRREIFRACSMNAIETLLITDTKLRSDNIATREKY
                     LDLLDDVEKDGGKVAIFSTLHTTGEELDRLSGLACILKYPIANLDEGFDSEDEGDNEE
                     EDNEAKKQKLKEIETSA"
     gene            <1050217..>1050840
                     /gene="NDAI0G04390"
                     /locus_tag="NDAI_0G04390"
                     /db_xref="GeneID:13926904"
     mRNA            <1050217..>1050840
                     /gene="NDAI0G04390"
                     /locus_tag="NDAI_0G04390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980051.1"
                     /db_xref="GeneID:13926904"
     CDS             1050217..1050840
                     /gene="NDAI0G04390"
                     /locus_tag="NDAI_0G04390"
                     /inference="similar to DNA sequence:INSDC:YCR003W"
                     /note="similar to Saccharomyces cerevisiae MRPL32
                     (YCR003W); ancestral locus Anc_1.420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980100.1"
                     /db_xref="GeneID:13926904"
                     /db_xref="GOA:J7REA0"
                     /db_xref="InterPro:IPR002677"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:J7REA0"
                     /translation="MPHKYMCISNTFFYHLSPVNSRLLQKMNGSMITRTLSSNTSLTV
                     PIIGVPKVDAQIDTGSIIGQWLRKKLFGEENGSSNGRGGISIDTGILKAVPKKKVSHQ
                     KKRQRLYAPGSKQVKMINNLNKCPSCGHYKRAHTLCMYCVGEIRRIWNSQTRKPYEEP
                     PQERELSDVDKRILYPGKKLTKDKQKLLDRDSYLERRMRTLSVEKKK"
     gene            complement(<1051305..>1052093)
                     /gene="NDAI0G04400"
                     /locus_tag="NDAI_0G04400"
                     /db_xref="GeneID:13926905"
     mRNA            complement(<1051305..>1052093)
                     /gene="NDAI0G04400"
                     /locus_tag="NDAI_0G04400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980052.1"
                     /db_xref="GeneID:13926905"
     CDS             complement(1051305..1052093)
                     /gene="NDAI0G04400"
                     /locus_tag="NDAI_0G04400"
                     /inference="similar to DNA sequence:INSDC:YCR004C"
                     /note="similar to Saccharomyces cerevisiae YCP4 (YCR004C);
                     ancestral locus Anc_1.421"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980101.1"
                     /db_xref="GeneID:13926905"
                     /db_xref="GOA:J7SBN2"
                     /db_xref="InterPro:IPR005025"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR010089"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:J7SBN2"
                     /translation="MVKVAIITYSTYGHITTLARSIQKGVESAGGKADLFRVEETLPD
                     EVLEQMNAPAKPDDIPVATEQIMGEYDAFLFGVPTRFGTMPAQWSSFWDKTGAMWAQG
                     TLNGKVAGFFVSTSGYGGGQESTVKNCLSYLVHHGIIYVPLGYRDVFAELSNVEEVHG
                     GSPWGAGTLAGADGSRQASELELRIAEIQGKTFYEAAKKFPSSVGTADAKAKTTNKGA
                     AEKKPVEKKTTTTAKRTTAAPAAKTEEKKEEKKDEGLMSCCVVM"
     gene            complement(<1053421..>1054833)
                     /gene="NDAI0G04410"
                     /locus_tag="NDAI_0G04410"
                     /db_xref="GeneID:13926906"
     mRNA            complement(<1053421..>1054833)
                     /gene="NDAI0G04410"
                     /locus_tag="NDAI_0G04410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980053.1"
                     /db_xref="GeneID:13926906"
     CDS             complement(1053421..1054833)
                     /gene="NDAI0G04410"
                     /locus_tag="NDAI_0G04410"
                     /inference="similar to DNA sequence:INSDC:YCR005C,YNR001C"
                     /note="similar to Saccharomyces cerevisiae CIT2 (YCR005C)
                     and CIT1 (YNR001C); ancestral locus Anc_1.422"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980102.1"
                     /db_xref="GeneID:13926906"
                     /db_xref="GOA:J7S4F6"
                     /db_xref="InterPro:IPR002020"
                     /db_xref="InterPro:IPR010109"
                     /db_xref="InterPro:IPR016141"
                     /db_xref="InterPro:IPR016142"
                     /db_xref="InterPro:IPR019810"
                     /db_xref="UniProtKB/TrEMBL:J7S4F6"
                     /translation="MSSSILSTQARTLLSRQRSSIYLLPRLYTTASPERTLKETFANI
                     IPAKAEEIKKFKKEHGKTVIGEVLLEQAYGGMRGIKGIVWEGSVLDPEEGIKFRGRTI
                     PEIQNQLPKINDEPLPEGLFWLLLTGEIPTLNQVNALSADLASRSELPDHVVQLLDNL
                     PKHLHPMAQFSMAVTALESESKFAKAYAQGVSKKDYWSYTFEDSLDLLGKLPNIAAKI
                     YRNVFKDGKLGQFDAQADYGKNLANLMGYSNKDFIELMRLYLTIHSDHEGGNVSAHTT
                     HLVGSALSSPYLSLAAGLNGLAGPLHGRANQEVLEWLFKLREEVKGDYSTETIEKYLW
                     DTLNSGRVVPGYGHAVLRKTDPRYMAQREFALKHFPDYELFTLVSKIYEVAPKVLTKH
                     GKTKNPWPNVDSHSGVLLQYYGLSEASFYTVLFGVSRAFGVLPQLIIDRAVGAPIERP
                     KSFSTEKYMELVKKIESSSK"
     gene            complement(1056168..1056239)
                     /gene="NDAI0Gtrna8P"
                     /locus_tag="NDAI_0Gtrna8P"
                     /db_xref="GeneID:11497390"
     tRNA            complement(1056168..1056239)
                     /gene="NDAI0Gtrna8P"
                     /locus_tag="NDAI_0Gtrna8P"
                     /product="tRNA-Pro"
                     /note="codon recognized: CCU"
                     /db_xref="GeneID:11497390"
     gene            <1056624..>1057808
                     /gene="NDAI0G04420"
                     /locus_tag="NDAI_0G04420"
                     /db_xref="GeneID:13927092"
     mRNA            <1056624..>1057808
                     /gene="NDAI0G04420"
                     /locus_tag="NDAI_0G04420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980054.1"
                     /db_xref="GeneID:13927092"
     CDS             1056624..1057808
                     /gene="NDAI0G04420"
                     /locus_tag="NDAI_0G04420"
                     /inference="similar to DNA sequence:INSDC:YIR026C"
                     /note="similar to Saccharomyces cerevisiae YVH1 (YIR026C);
                     ancestral locus Anc_2.660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980103.1"
                     /db_xref="GeneID:13927092"
                     /db_xref="GOA:J7RT92"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR016278"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:J7RT92"
                     /translation="MSNSTSTSTTTSNPAVSTDATSVSTDAVPATIVAPMPTDPNVTR
                     ILGGLYLGGIQPIVDHTPLSAQFKISHILSIIKFQVIPEYLVRKGYTLKNIPIDDDHT
                     TDILQYFNETNSFIDSCLFPNEKEYDPRIVNFKKKQQNGAIYVHCHAGVSRSATFMIA
                     YLMYRYGLSLKNSIYAIKRKLPKIEPNENFMEQLEIFSRMGGQYVDFENQEYKSWKLK
                     NSIKLDPTGDSILSKDETFKMDQDEEKDLAKMTPEELGKVTTVRCKKCRQRLALSTSF
                     IKHDPPSRESSEGHFIKRAAGSRRIIDIQESQSQCSHFFTEPLNWMKDELRGKQELEG
                     KFSCPGCNSKVGGYNWKGSRCSCGKWVIPAIHLQANKVDQFPLNQKALPNLIHFKSKD
                     GN"
     gene            complement(<1057940..>1059607)
                     /gene="NDAI0G04430"
                     /locus_tag="NDAI_0G04430"
                     /db_xref="GeneID:13926907"
     mRNA            complement(<1057940..>1059607)
                     /gene="NDAI0G04430"
                     /locus_tag="NDAI_0G04430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980055.1"
                     /db_xref="GeneID:13926907"
     CDS             complement(1057940..1059607)
                     /gene="NDAI0G04430"
                     /locus_tag="NDAI_0G04430"
                     /inference="similar to DNA sequence:INSDC:YIR025W"
                     /note="similar to Saccharomyces cerevisiae MND2 (YIR025W);
                     ancestral locus Anc_2.659"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980104.1"
                     /db_xref="GeneID:13926907"
                     /db_xref="GOA:J7SAZ7"
                     /db_xref="InterPro:IPR008402"
                     /db_xref="UniProtKB/TrEMBL:J7SAZ7"
                     /translation="MVNRWNNELFKQLEPIGEEDKHTESLNDFQLFQGIKDELQSGNQ
                     RKIGLNPTFSAITQERKATEVLPSPVNSSFVPLKAYSTFDHKPYRPRNRQNRIDELEM
                     KVERIESQFDKIRKLGNDTFRPIGVGRTLNEMTPEYREKLKRQLNNSELCDVEVELLP
                     SLSQENIDVNIANTDNTNNDNISNTSSDTSNDSDRNNTHEDTDIANHIRVPHARPRFF
                     NDDSESDTYGAPTHFDPDASPDFHDYMMAGVPFPEPSYEERLSDDEDKLKPNSRQTSS
                     SPSSSSSSPSPLPSSSAGEGNEEEKDLVAKQVNEAGTERVVTFEKPISNESRETSTFS
                     LLGNTSKVQTEWLDSPRKEVEENRINVGKAENKDESDSNDSSSILPPLADLETYNTDK
                     IPNNAQVRAISTSSALSVVTSSTIPSLRIPSINLPDDEFVHIGTSQDTKSNNNKILNN
                     IDDKSLASARTLLNSTRSTINKIPIDYLEMLRSQKKHTNEKTGSDAHVSAVIGDDVDE
                     RGESSGEGFMEDHAINMSDTVDTKETSRIVSTELILKRLGKEINDEL"
     gene            complement(<1060016..>1065142)
                     /gene="NDAI0G04440"
                     /locus_tag="NDAI_0G04440"
                     /db_xref="GeneID:13926908"
     mRNA            complement(<1060016..>1065142)
                     /gene="NDAI0G04440"
                     /locus_tag="NDAI_0G04440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980056.1"
                     /db_xref="GeneID:13926908"
     CDS             complement(1060016..1065142)
                     /gene="NDAI0G04440"
                     /locus_tag="NDAI_0G04440"
                     /inference="similar to DNA sequence:INSDC:YKL014C"
                     /note="similar to Saccharomyces cerevisiae URB1 (YKL014C);
                     ancestral locus Anc_2.653"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980105.1"
                     /db_xref="GeneID:13926908"
                     /db_xref="InterPro:IPR021714"
                     /db_xref="UniProtKB/TrEMBL:J7REA5"
                     /translation="MDKRKNFSSQYSSSREERKEKYTQGQDLDNSTLETLEKIINELK
                     SNTESRNYQALIQFCQNRFLSQLLQSWSYFAQVNNHSKFIYTSKLILNLLKLLGSDPC
                     VIPFGTELIHSIFTNYTKVMYRGLNNNRIKLNIPILHLMKEIILFNESQHVDQILSYF
                     NLGSPSILRILTPSKSDLTESNPTSTSNDKMSVRNSFLDFWLTLIEKSSPLARKDLLS
                     DNFKIMSAWFKYMDKLDSIDIAERTMIVFTESILMEKTFKRMTKTKILNELALSKIHK
                     FYYSNDKALVLKTNKFFLTYAANHETSVAFPDDCVWFTESPTNGTNNGVPITVHQKEF
                     NIYNKLLFNMLRFFKPWEDDHQSSTVLKVLENVPELVAPYCTYLASLGSHDPKMTSYW
                     FGATLMLCRIMKLEIPSFMTNIDTDLIPSLPLVIENILPSPLTKNSLTKGLQHESSLV
                     KQLTCQLLVFAFQKLQKVLTLYDKKGWGSAKAPLNVAFHSNLPDLNVITSVLTQSYAS
                     NKENKILPLSVTIILKYYSECFSNFFSVNLPSSNIYVDIMQKNTFSGMELTILDNFLQ
                     YQEFNETQTKWWNSTSNENSLFTSLLKLSSSPNSTDPVSSKISTLIDSLIYSTVIFNK
                     LLISPIVALVNSLQIIQLQEQKKYDSLTKLWKLLDETIARCIKTPYKYVDISNEYDSI
                     SPFITALLEQWKFVPRNTSTDDIVKFIFIFLRNMSIIGESHDGIKRAATALLKDVDNN
                     YFDLYLDFHNTEKKIEELNKDSYLLSSISDSSFFQYISLLPYTRLKNVSRFPINEYDV
                     IGTIYRLNTIVDNDSIQFNKEFKSVIDNLSSKVAKFAFIEKDFDLMRLQLIQPFFNKI
                     SEDDSTENTISKSLCIINTLLHIYDQLGRANEPFEEFLLNWTQANHSKLPSDTLVAIA
                     MCIDPSKIDIFIRPPFNFGPAELSIVFSRLYKETPKTIEYSDIEYLLTHSMDSIIPAI
                     PSLSKFILEGRISSLDSKSFLSQLLNNISTSKLLEVFLQSPYFSIDVISENLETLKEN
                     KYAKKIAIGILEKNQQEQENIKEFVELCVKQCYENLRTPQENEDIEDSLALLTLGVQL
                     LSSEQVADLITFVTIEYSHKYSPLAVKLITLVGDFENDQIIKWCNKAVLYITKFLSED
                     VELTSKFSNVLKEFKKSIQKVNIWEKVNHVLINSQLEVILKGKLLSDAQVAEYALLLI
                     LGGDSKSVQSEKMVQLLLNNEKSVLNSKSTAEDAYTRYLTVTILYVLFNLNVTKNSTV
                     LIQRKVLSYYSGSVSCEDRLLLQILERIESKSSISWTNDIYTWDFLENVEEEALDFIG
                     ATKLITQEKEGLILTLRKDYIDNTIRNYALKRPAVPILSKSKSISSKWDHLNMFYENT
                     KRDLVNNSELIYDPLFILLLTIHNKELVSYSKKEDGTLKYKFEVQKFLSSKLFQLIIF
                     SLADPIEEVNKIALSLLNGMMNSLENNVQFKDGHIFQILIKKIIFTLDNNEKKRSHSI
                     PPIVWFSISRICDILLQPTSQLYEKAFRWVLNGPLIRSNDIPLMHDLIAPPTSEVNYE
                     NYYKQLSWVLENLEEGVRTQDDIDLLKIRDVFEWLYNLMNLPYLNPRMKSMISRIFFN
                     IQRIENGASSLLTRYASVATLELQSIITQQKEREVEDSLLKNQMNSKHLRKKLLLEEQ
                     LLNHKEVLQGYVEVMKSQKRLREWTEDDGEGILKRMCASK"
     gene            <1065576..>1066301
                     /gene="NDAI0G04450"
                     /locus_tag="NDAI_0G04450"
                     /db_xref="GeneID:13926909"
     mRNA            <1065576..>1066301
                     /gene="NDAI0G04450"
                     /locus_tag="NDAI_0G04450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980057.1"
                     /db_xref="GeneID:13926909"
     CDS             1065576..1066301
                     /gene="NDAI0G04450"
                     /locus_tag="NDAI_0G04450"
                     /inference="similar to DNA sequence:INSDC:YIR024C"
                     /note="similar to Saccharomyces cerevisiae YIR024C;
                     ancestral locus Anc_2.652"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980106.1"
                     /db_xref="GeneID:13926909"
                     /db_xref="UniProtKB/TrEMBL:J7SBN4"
                     /translation="MLRQLLGRRLPVVVTRGTTQSSRLYSQTAALPSAHTQPNLKKKK
                     VKYDRSVLKPILLILAFGSLLSAVSDKEREYNELERRYQLKIKILEELIERVESGDTD
                     FRIDEELKHVNRLFLNSNKSVFLNDVKRLREEEKAAPGKGFVNTVVNEKEETLDDVLK
                     SIMDEINDATVEGGDKSNYLSREHEVNTNEEIIKNKYRLEKLKEKEKKILEYIPETKT
                     HIMTENVGDFTDAAKDNDIPKFL"
     gene            complement(<1066524..>1069940)
                     /gene="NDAI0G04460"
                     /locus_tag="NDAI_0G04460"
                     /db_xref="GeneID:13926910"
     mRNA            complement(<1066524..>1069940)
                     /gene="NDAI0G04460"
                     /locus_tag="NDAI_0G04460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980058.1"
                     /db_xref="GeneID:13926910"
     CDS             complement(1066524..1069940)
                     /gene="NDAI0G04460"
                     /locus_tag="NDAI_0G04460"
                     /inference="similar to DNA sequence:INSDC:YIR023W"
                     /note="similar to Saccharomyces cerevisiae DAL81
                     (YIR023W); ancestral locus Anc_2.651"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980107.1"
                     /db_xref="GeneID:13926910"
                     /db_xref="GOA:J7S4F9"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:J7S4F9"
                     /translation="MSAEYQESSSWHSPGAKHPSPLPSTGPIVKDSSTQSSNNDNANA
                     NANANANPNPNATPNKQQEEQLRLSDSSQKQQQQQQNHLASEASNGGNHSAPNGTTTT
                     TTTTTTNTNTTSSNKMMESKPSNSHLLDLNDNYSSMLETFTNNTDNKAANTTTTTTTT
                     TNNNNNNNNNNNTNTNNNSTSETTNNQYQDIHQNEHPSSNNNNKGNEEENLVTKQGLD
                     VLLQQYQNLLGKSGNDHKLPTETMRSQVNNKINALSSNDNNNSNNNNNNKNIDNNRNT
                     NLIKSKNKRGEDMHPSSSEHQNKRTKLDNGVSAIVGDHNNNPQQYYSEFLQTLNNTML
                     HTQNINNQNTMSSQTPISYDAPPNLNIPSSQPQLQPHQQYNNQQQLQRHNQTSQLAFN
                     QTQMPPVLQQQQQQQQQQQRQGQQQSPSQQLQHSRSSFYVGPTSVYDMNLINCIKLDK
                     VHQIQLSKSLALRKVSPTVQFILRDDINQEDLQGNEDFVESLVYPHGKLLIDIFFKLI
                     HPYFPIIHEYVFLERYSRSYKELPEPLLATIYSLALQWWDYHPGLIGFPKPDVTTQLN
                     EFAFKAFFNGIERPKLSLIQTGLLLMQCRSERLNNWILSSATVSLAEELGLGVDCSDW
                     RLPKWEKDLRRRLAWAVWNQDKWTALIESRHSHLILGRNWMVTPLRSDDFPQTSSLVE
                     DNTNGDHQFGNNTINTNTMLGASLVDMSLTQDDYNNGIMMYQQMVSLSIILGEVMDTF
                     YTQAAIQIDTTIEHILKLAKPLQLKLREWYHSLPQFLSMNNFTPRKFNANATLTLAYF
                     ATEITLHRKIISSLKPDTSKELVTVCRQAAKTRLIAAIEFIRDLKNEHVNSFWYTCST
                     GNLMLIGTFAALLYVTSPTKEESFTFRDCLRNYIWILRVGAKQFDKFGNALNNIHMLL
                     AEIPGLLTDEQPTAAASPPKSYSQMFQQTQQNMSNTLSPAITEQGSPAMLHQQKTIAT
                     DLLQSFNNMQSSNQRINNTAPSEQSQTPIHYQNISQPADMNMSLQIPTDNNNNNNNSN
                     SHNYSNNAGSIHGSDHLSPTNRGSFSKITGHCNKDDHISSGNIQQQQQQQQQQQQRLS
                     NSKPNTPQANIHGGMVNGPKQNSNRTNVSSHRSPQNIQDISGNNNNTAAV"
     gene            complement(<1071044..>1072729)
                     /gene="NDAI0G04470"
                     /locus_tag="NDAI_0G04470"
                     /db_xref="GeneID:13926911"
     mRNA            complement(<1071044..>1072729)
                     /gene="NDAI0G04470"
                     /locus_tag="NDAI_0G04470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980059.1"
                     /db_xref="GeneID:13926911"
     CDS             complement(1071044..1072729)
                     /gene="NDAI0G04470"
                     /locus_tag="NDAI_0G04470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980108.1"
                     /db_xref="GeneID:13926911"
                     /db_xref="GOA:J7RT96"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:J7RT96"
                     /translation="MSTRSSLEVERTVHSIKSDGIRKEEDEVSPIGLNTSSNSPKTDK
                     ETLLVSEVDTTTIATKPLTSYITVICLCLMIAFGGFIFGWDTGTISGFVAQTDFIERF
                     GILQSNGEYKLSNVRTGLIVGIFNIGCAFGGLLLGRLGDYFGRRIGLMVVAVVYIGGI
                     TIQISSSDKWYQYFIGRVISGMGVGGIAVLSPGLISEIAPKHLRGMCVSLYQLMITAG
                     IFVGYCANYGTKSYNNSVQWRVPLGLGYAWALFMILGMWLVPESPRYLISVGKKDEAK
                     ASLARSNKTTVEDTLVLAEFDAISAGVEAEKLAGNATWRELFSRKNKVLNRVIMGVMI
                     QSLQQLTGCNYFFYYGTLIFKAVGLEDSFQTSIILGAVNFASTFVALWTVERFGRRKC
                     LLWGSAAMACCFVVFASVGVTRLWPNGKDQATSTGAGNCMIVFTCFFIFCFAITWAPI
                     AFVIVAETYPLRMKQRAMAIAVGANWIWGFAIGFCTPFITSAINFYYGYVFMGCLVFS
                     FIYVFFFVCETKGLTLEEVNQMYIEGVKPWKSTNWTPPANRQQSLDDSTGVQV"
     gene            <1073913..>1074776
                     /gene="NDAI0G04480"
                     /locus_tag="NDAI_0G04480"
                     /db_xref="GeneID:13926912"
     mRNA            <1073913..>1074776
                     /gene="NDAI0G04480"
                     /locus_tag="NDAI_0G04480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980060.1"
                     /db_xref="GeneID:13926912"
     CDS             1073913..1074776
                     /gene="NDAI0G04480"
                     /locus_tag="NDAI_0G04480"
                     /inference="similar to DNA sequence:INSDC:YMR063W"
                     /note="similar to Saccharomyces cerevisiae RIM9 (YMR063W);
                     ancestral locus Anc_2.630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980109.1"
                     /db_xref="GeneID:13926912"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:J7SAZ9"
                     /translation="MRILSIERLITILLTVVIVFEIFPVISRPVIDGIVLAYYKNYSY
                     GVFGWCIDVPIDNKDTVLDDSPSPQEIYRQCTQRKVGYKVSDSDVVDHELLLPSPSKY
                     SVTRLLIVHPMSLVITVILWIMVLLITFTSRMEKSQFFLLMTAVISLLAFLFSLFCFL
                     VDLLLFLSALKWPGWLMFASTVILAICCSLLWSLRRNISIRDYEALNTNDVESFAQIS
                     RHPSSSSIDIELETYSVQVTDQSGLSMKGKIIHKGLDIGSTIPRKTSQENRSISSTMY
                     RSPESTHPGFI"
     gene            <1075018..>1076550
                     /gene="NDAI0G04490"
                     /locus_tag="NDAI_0G04490"
                     /db_xref="GeneID:13926913"
     mRNA            <1075018..>1076550
                     /gene="NDAI0G04490"
                     /locus_tag="NDAI_0G04490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980061.1"
                     /db_xref="GeneID:13926913"
     CDS             1075018..1076550
                     /gene="NDAI0G04490"
                     /locus_tag="NDAI_0G04490"
                     /inference="similar to DNA sequence:INSDC:YMR064W"
                     /note="similar to Saccharomyces cerevisiae AEP1 (YMR064W);
                     ancestral locus Anc_2.631"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980110.1"
                     /db_xref="GeneID:13926913"
                     /db_xref="UniProtKB/TrEMBL:J7REB0"
                     /translation="MQRVCPLSCSKSKISNGKLLYSTATGIKGKIQPRQRQPIPMKRT
                     ILDIKKLWHPFYKPSSIEQFKMCFTELDPANQFEEFKPFLIEIDENMENLCYTTQDKT
                     FSHLLKGYFYDLKQNESIDYQLMKGEFWEERRRTRETNQVNQAGNPEFDALTNILFHN
                     DWTYKFKVEELNVKITKLVMNSSNLFCEDIYLWLLDPKIFKSIENLQIIIDSITIHLS
                     SPDALLLDHFSMIEPIILRIVKSFSEELRPTTSIMNCFTNLFESINHEFNIPNIQHCF
                     TKFNPLTLQYLLLFFLRSTGDYHLNECKLLIDLLILYHKKIPLESSIIDYLISLNKKN
                     STHLGAADKLRYVRSIGLILNQLNDIKTFQELLPMCQSTIEIIHLLKIIRSKDNGIHM
                     IRQLIPSVITYINNLSNDELVNSSNLCFLLKFLKDSKIIKNDKIRRQFMLGFAINKNY
                     SMLAQLFEELEDKELLKKEYVQLLLMKLNERKSLTHDHNEYLREKFFNKYIIDKYPHV
                     NK"
     gene            <1076990..>1078519
                     /gene="NDAI0G04500"
                     /locus_tag="NDAI_0G04500"
                     /db_xref="GeneID:13926914"
     mRNA            <1076990..>1078519
                     /gene="NDAI0G04500"
                     /locus_tag="NDAI_0G04500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980062.1"
                     /db_xref="GeneID:13926914"
     CDS             1076990..1078519
                     /gene="NDAI0G04500"
                     /locus_tag="NDAI_0G04500"
                     /inference="similar to DNA sequence:INSDC:YMR065W"
                     /note="similar to Saccharomyces cerevisiae KAR5 (YMR065W);
                     ancestral locus Anc_2.632"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980111.1"
                     /db_xref="GeneID:13926914"
                     /db_xref="InterPro:IPR007292"
                     /db_xref="UniProtKB/TrEMBL:J7SBN6"
                     /translation="MMRIKISVIILITLYFQITTQQMQERDDEVMVSGSKKTIKELIN
                     VYFPEFISISNKSCIEEAISYDGFLSRCIHGDDMSLISDTHKMIVSIKLTICEFENSA
                     SIRILQPCLYHISDERNSKSEYQDRYVQFMDCMVGNSNEFWTSYSGYYQRLNSLCFEN
                     EEFYNKERFFNMINNVTNFFEDFNYEMHEMNEDFNVKNFNRMQEYVDDIFDGFVDLQM
                     KQNSVLEDDFNKFRNQMNENLNKNDLEYQLRLSKREMELRDYFLKVNDIIKDISSSIT
                     REKLDIKDEIQSFKNQIIANASNEMVSYEIEKNLENEKKLQEVLLTTSEGLVMINELV
                     NDTVRNFQGQLSGELIESITSSIELELMPSIIHFKQIMLKEMSMMTSILNDEMKHWNY
                     EITNNFENINMRIIDTMEKINDLDSRLNKFIKALNGLFASFTKLLQLVKLMWAYKIIM
                     ILVFLIISQRTIWRRVLIKTLTLPKMFIRLLRLMLKWLMLIVVIIFGSQFGKFIIASF
                     I"
     gene            <1079325..>1080725
                     /gene="NDAI0G04510"
                     /locus_tag="NDAI_0G04510"
                     /db_xref="GeneID:13926915"
     mRNA            <1079325..>1080725
                     /gene="NDAI0G04510"
                     /locus_tag="NDAI_0G04510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980063.1"
                     /db_xref="GeneID:13926915"
     CDS             1079325..1080725
                     /gene="NDAI0G04510"
                     /locus_tag="NDAI_0G04510"
                     /inference="similar to DNA sequence:INSDC:YKL082C"
                     /note="similar to Saccharomyces cerevisiae RRP14
                     (YKL082C); ancestral locus Anc_2.636"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980112.1"
                     /db_xref="GeneID:13926915"
                     /db_xref="InterPro:IPR007019"
                     /db_xref="InterPro:IPR029188"
                     /db_xref="InterPro:IPR029190"
                     /db_xref="UniProtKB/TrEMBL:J7S4G3"
                     /translation="MSNSLEERLRANSSAFDGLLSLIPAKYYYDESTQDQWKSKKKSK
                     AQSHQDKVKKLNPMEINDDNSSALQVKNKKQANAKPVVFPGSKKPTQENVSVDESLDN
                     DEELEEQEVLEHQANEEEEEEEEEEEEEDIKLIFDDEGNEIKSSQEAEDDEETTVETR
                     EDKENPKNKNEDDLKKQQKLNELRLKLQSKIQDLKKKRKAVGTKIDGAPNSRDDILNQ
                     RKRKLELKKSRKEQQLQQEDAESDSSSDSDLSDNDMIDDPSRKKQKKNTDDISTKDIM
                     FQNIMFDDGAKTTSDLQRLRNSKDNKKLKGPSNNDIKSHLKILEKKKSKINEMDELDQ
                     IKMNEKLKWQKAMSLVEGVKLKDDEKLLKKSLKRKEVQKRKSANQWNERKRVVAQNKN
                     EKIKRREENLRIRKENKGLKRNKKQKMLKKFSINKNGKQLKQMRREKEKNSNKDNNNN
                     SGKRAGFEGRMKSNKR"
     gene            <1081291..>1084044
                     /gene="NDAI0G04520"
                     /locus_tag="NDAI_0G04520"
                     /db_xref="GeneID:13926916"
     mRNA            <1081291..>1084044
                     /gene="NDAI0G04520"
                     /locus_tag="NDAI_0G04520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980064.1"
                     /db_xref="GeneID:13926916"
     CDS             1081291..1084044
                     /gene="NDAI0G04520"
                     /locus_tag="NDAI_0G04520"
                     /inference="similar to DNA sequence:INSDC:YMR066W"
                     /note="similar to Saccharomyces cerevisiae SOV1 (YMR066W);
                     ancestral locus Anc_2.637"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980113.1"
                     /db_xref="GeneID:13926916"
                     /db_xref="UniProtKB/TrEMBL:J7RT98"
                     /translation="MYLSSIPLRPSYLPFCYISSRFLPTVLLHRNIRYIHYSYRSKKL
                     DTNIDTKLPHDLKPLQDPNEIIKTLKQTHGFSDINDASPIEETFLQYLTFLNKGFQKS
                     DQNLRLLKENLKSTGNNNNEKFNLIFSYLLTESTLELQRFKQLGPEGLKSIKQQQQQQ
                     SNDEDENSVVKNEKDLELRIMNEIFSTLTEKNKENEVYLHNVDFLFKILTELNSTITE
                     DKGFEHGLSIEQFVEAFEISKLIPIEGRKSRGIFLSGNLIYSTKKVRMDPINESLYID
                     SLLKYRLFKKAFQLYDSRKDKVNERWWNELGMMILLRSNHLASFKSLLQTTDEQFNVF
                     PYLSPRVLKLAIRKYLAINDHSMLKQLIDRFLLIVDTYGIEKSNSYMESSALMKTFQE
                     ENEASAYLNEQESYTTLDFASIIESLLYNKRINFASKLSSRFVELPQVINNDDHLKEF
                     LTVTKLNLLKDFHSLKTFIEPHMSNAKRNLGTLQEVFNDIIKGSRNESSPGNELLFDN
                     INSLVSTPLLTNLAHEFIYNEIASTSTRNQDEDPMTNSKRFYGLIKVLLVSGKEKTAL
                     KVLRKMEEARQLMNKKEGNETANEFYPEVNAHHYAEFIAHYTILLKASKINNASKLKI
                     YEHKVENILNKMSKENIGMNATFLSKLLIFYRTTFNLNKSFEIINQILDSKDIEQRLP
                     DVSRTNFYQSRTITKKLYLEIWNCYYLYNKIFHDEIGRIKKTSNYVAWKNHSKKIKME
                     TNIHPKFNSRWLLKTMLEQDNILPDDKFFHLIIATFIRERCWTVLPSVLILMNKRYNI
                     KITTSLGQYINQGIKKEYILSETDKLNQHHQYIEGTTNIISTDDNKFKAKQTITKMVN
                     NGEILKKVPIGESLELLVCELLKLLQFKNHNSSPLNEVLEVANELAVDNVIIQNIIDK
                     IKH"
     gene            complement(<1084178..>1085605)
                     /gene="NDAI0G04530"
                     /locus_tag="NDAI_0G04530"
                     /db_xref="GeneID:13926917"
     mRNA            complement(<1084178..>1085605)
                     /gene="NDAI0G04530"
                     /locus_tag="NDAI_0G04530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980065.1"
                     /db_xref="GeneID:13926917"
     CDS             complement(1084178..1085605)
                     /gene="NDAI0G04530"
                     /locus_tag="NDAI_0G04530"
                     /inference="similar to DNA sequence:INSDC:YMR067C"
                     /note="similar to Saccharomyces cerevisiae UBX4 (YMR067C);
                     ancestral locus Anc_2.638"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980114.1"
                     /db_xref="GeneID:13926917"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR021569"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:J7SB01"
                     /translation="MSSITIHYNFNKFQVHVAANTSLKGSLQQAITHFKLPANESTIR
                     WVLMHDKKKVPLDLPFRFLNFPNGVNLILTKEEVSKNANELGELIKIRFHIPGYNSVI
                     ADVRAKGKVIEVLDQLNLGVSFEGSKLQIFAKMYLYDELDDNTTLEDIGVDDSSSIRI
                     TLASQSKRNSIRQEEEEKKVVEKVDEEGKTEGIQQQELEKQEEEDNNNNDDDDDDDDD
                     DDDDDDDDDDDDDDESVQTPEPRSSSSLPQIHRINAYLPPSTPILNQINAEEEDEVTY
                     EMTLEHARKFQNILSKQAGTSNGPLLTKRLREQQQQQLQQKKIKIRQCSIRVRFPDRS
                     CIEVNFRPQETMQDVYTVVSQGLEDPNQSFTLNLPHPFQILPPNELKLVDGLNFGSKT
                     LLLFESTTNDQGPFLKNEILKNAKDLSEAEDVKIDRTGKADEDAKKTINKEKSTATTD
                     GSTSKKTGNGKSLNKVPKWLKLGKK"
     gene            <1085981..>1087351
                     /gene="NDAI0G04540"
                     /locus_tag="NDAI_0G04540"
                     /db_xref="GeneID:13926918"
     mRNA            <1085981..>1087351
                     /gene="NDAI0G04540"
                     /locus_tag="NDAI_0G04540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980066.1"
                     /db_xref="GeneID:13926918"
     CDS             1085981..1087351
                     /gene="NDAI0G04540"
                     /locus_tag="NDAI_0G04540"
                     /inference="similar to DNA sequence:INSDC:YMR068W"
                     /note="similar to Saccharomyces cerevisiae AVO2 (YMR068W);
                     ancestral locus Anc_2.639"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980115.1"
                     /db_xref="GeneID:13926918"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:J7REB5"
                     /translation="MLPEPSIRLREAIIEGNLLIVKRLLHRYPDLLTNIDPTNGWSSL
                     HYASYHGRYLICVYLIQLGHDKFELIRTFKNNTCVHLSLINGHEQTTHLLLQHFPQFM
                     NAKGDHGWTPVHIACMHDHYQCLSLLIGVGADVLLTDDNGETPLHICLEYGSVQCMRL
                     LVKETNLINDNVKDMNNFKPSDVVETFELGKLYNKVLKEEQQQTSDLSTTKKNTLQSF
                     KTPTLPATKTFDNGPSPVFSMHSPYSSSFSLGNSNIPPLPNISMSRRTSLAATTALFT
                     PRGASRKSSSSNVSTNSALGNTNKNGLLIETTPKLAPNNNNNNNNNNNNQKLSYVSNM
                     PNSPISTVHNNNNSMLVNKYLLSNSSDELQPLQLSPIRQRRMTASANPGMESIDSSSA
                     SSSLSATVVPLPVQQTTTTTTTTTPTAKEHRLFPLGSGTTRRLSLLNIPISKLRNNVS
                     TSSTEE"
     gene            complement(<1087590..>1089056)
                     /gene="NDAI0G04550"
                     /locus_tag="NDAI_0G04550"
                     /db_xref="GeneID:13926919"
     mRNA            complement(<1087590..>1089056)
                     /gene="NDAI0G04550"
                     /locus_tag="NDAI_0G04550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980067.1"
                     /db_xref="GeneID:13926919"
     CDS             complement(1087590..1089056)
                     /gene="NDAI0G04550"
                     /locus_tag="NDAI_0G04550"
                     /inference="similar to DNA sequence:INSDC:YHR005C"
                     /note="similar to Saccharomyces cerevisiae GPA1 (YHR005C);
                     ancestral locus Anc_2.643"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980116.1"
                     /db_xref="GeneID:13926919"
                     /db_xref="GOA:J7SBN8"
                     /db_xref="InterPro:IPR001019"
                     /db_xref="InterPro:IPR002975"
                     /db_xref="InterPro:IPR011025"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:J7SBN8"
                     /translation="MGCSASTQIIEDENDPFLQNQRVNDVIEQSLQMEKQRDKNEIKL
                     LLLGAGESGKSTVLKQLKLLHQGGFTNQERLQYSQVIWADAIQSMKILIIQARKLGIP
                     LNCDDSKSELFQLKRILMRVKALDFIDAGTAGGSDFLNDYVLKYSERYEMKRRVQSTG
                     QAKAFDEEGIEQRRKQMSNSSSNPNDLDIEEEEEEELTEDNANVDGNNNLDFQEISKN
                     LNESGNDTMFIKKDSKHVQQQNQKSTRVPSVTRITKKQIAHAIKELWTKDKGIKQCFA
                     RANEFQLEGSAAYYFDNIEKFAQSNYVCSDEDILKGRIKTTGITETEFHIGSSKFKVL
                     DAGGQRSERKKWIHSFQGITAVLFVLAMSEYDQMLFEDERVNRMHESIMLFDTLLNSK
                     WFRDTPFILFLNKIDIFDEKVKKMPIRKYFPDYQGRVGDSEAGIKYFEKIFLSLNRSN
                     KPIYVKRTCATDPQTMKFVLSAVTDLIIQQNLKKSGII"
     gene            complement(<1089599..>1090966)
                     /gene="NDAI0G04560"
                     /locus_tag="NDAI_0G04560"
                     /db_xref="GeneID:13926920"
     mRNA            complement(<1089599..>1090966)
                     /gene="NDAI0G04560"
                     /locus_tag="NDAI_0G04560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980068.1"
                     /db_xref="GeneID:13926920"
     CDS             complement(1089599..1090966)
                     /gene="NDAI0G04560"
                     /locus_tag="NDAI_0G04560"
                     /inference="similar to DNA sequence:INSDC:YMR097C"
                     /note="similar to Saccharomyces cerevisiae MTG1 (YMR097C);
                     ancestral locus Anc_2.463"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980117.1"
                     /db_xref="GeneID:13926920"
                     /db_xref="GOA:J7S4G6"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:J7S4G6"
                     /translation="MNYVTKLQHFLPKTIAFSYRQRWLSQLVNIQTVSPSDSNLKANN
                     TNNNNNNNNIKQPFVPRYEFPQYNITLTDFKGHQMKALKNFQKLLPQLNMIIELRDIR
                     APLSTRNLLFDTLLSRTKKSSTLSKLIIYTKKDLLSSSPQDPKKYLDKLIKWHNEINE
                     KFIIMNCNHNKDIKTLMDLINWQNNKFIKNPLPMGFRILIIGMPNVGKSTLTNSLRSF
                     ATHNDTDHHHHDKEKKNTVVAKTGGQAGVTRSISECIRISNDKSSSTMHGIYIVDSPG
                     VGLPGRINNCQRMLTLSLAGCIKDNLIDPIIQADYLLYLINLQQQLTGKKRNSHELYP
                     GSIQNPTNNVYEVLKRLKGKANINDNSMAMSWVDNWRQSRKGIIFDPELLLECDEFSL
                     KDYLGNESKKIRTLYSDGMLNTTTTTTTTAANNNNNDNNGAKSKKKKKDKKVSSNNNN
                     KLFIN"
     gene            complement(<1091433..>1091714)
                     /gene="NDAI0G04570"
                     /locus_tag="NDAI_0G04570"
                     /db_xref="GeneID:13926921"
     mRNA            complement(<1091433..>1091714)
                     /gene="NDAI0G04570"
                     /locus_tag="NDAI_0G04570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980069.1"
                     /db_xref="GeneID:13926921"
     CDS             complement(1091433..1091714)
                     /gene="NDAI0G04570"
                     /locus_tag="NDAI_0G04570"
                     /inference="similar to DNA sequence:INSDC:YHR005C-A"
                     /note="similar to Saccharomyces cerevisiae MRS11
                     (YHR005C-A); ancestral locus Anc_2.645"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980118.1"
                     /db_xref="GeneID:13926921"
                     /db_xref="GOA:J7RTA3"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="InterPro:IPR027100"
                     /db_xref="InterPro:IPR027247"
                     /db_xref="UniProtKB/TrEMBL:J7RTA3"
                     /translation="MSLFGFGGGQPQLTSDQKIQAAETELDLVTDMFNKLVDNCHQKC
                     ISRSYTDGELNKEESNCLDRCVAKYFETNVKVGEHMQKMGQTFNSAGKF"
     gene            complement(<1092057..>1092869)
                     /gene="NDAI0G04580"
                     /locus_tag="NDAI_0G04580"
                     /db_xref="GeneID:13926922"
     mRNA            complement(<1092057..>1092869)
                     /gene="NDAI0G04580"
                     /locus_tag="NDAI_0G04580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980070.1"
                     /db_xref="GeneID:13926922"
     CDS             complement(1092057..1092869)
                     /gene="NDAI0G04580"
                     /locus_tag="NDAI_0G04580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980119.1"
                     /db_xref="GeneID:13926922"
                     /db_xref="UniProtKB/TrEMBL:J7SB03"
                     /translation="MVGSFRTKQFFHHRRETYQNPSTDIESKVNLNKDFDLAYNDLIT
                     KKNKENQYHHHHHIRRWKNNKVPFYDFDDSKLESMTSFGSSKTPAKENIMEGVGGDDG
                     YYGYNDKRHKPLRFFKKQTGVKNKKNNSENTGSGVEEDEIKTLDYNDDWNSTLERKIY
                     NLEKEVFSKNSFVSTGGDDDSSTISEEESCPSSPYVKSTRAKKEDKVISREKVLGELG
                     MGDSPIGNININSNIVSGLSDTLTLVTSAQSTTPDEERIFSEIYGNRNDSYL"
     gene            <1093238..>1094590
                     /gene="NDAI0G04590"
                     /locus_tag="NDAI_0G04590"
                     /db_xref="GeneID:13926923"
     mRNA            <1093238..>1094590
                     /gene="NDAI0G04590"
                     /locus_tag="NDAI_0G04590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980071.1"
                     /db_xref="GeneID:13926923"
     CDS             1093238..1094590
                     /gene="NDAI0G04590"
                     /locus_tag="NDAI_0G04590"
                     /inference="similar to DNA sequence:INSDC:YIR021W,YKL011C"
                     /note="similar to Saccharomyces cerevisiae MRS1 (YIR021W)
                     and CCE1 (YKL011C); ancestral locus Anc_2.647"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980120.1"
                     /db_xref="GeneID:13926923"
                     /db_xref="GOA:J7REB8"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR015242"
                     /db_xref="UniProtKB/TrEMBL:J7REB8"
                     /translation="MKFALKKRSSIDALDMYCKKASKRTLKFLSIALGSKHIDIEHKS
                     DIRSNIINHCEILEAARRKLIQKNQIIISSIHLGVKTFTISKFKIELLDENNNKNTDD
                     NIEKQLTVSKPILLDWDKLKLEELFLPDNRSKITLHPTDMTDSIFKLSQYLTTEKENR
                     ADLFTIGRPKDTYRLSSKPNSFENVLKINLFEQLLYSTLKNKLSYLNLKQPQTKNNDD
                     AYLPIISDTKLVSQFWCNLTPVRSILNKSFGKGSDESNLQLKSPILLNSIKMHLVRRI
                     IESALQIDNSSNKVTLTPNWEHRLRTYITEDTLGTYTFSECLGFLGRQRECDNRELAN
                     VFLQGLSWMEWLQTYIEIENIVTSEKGNYTDEILNQFNAYCHYKKNKIQEFQKGTSPR
                     LTSLENYHDDYDNAPYPNNNNNRNNGERKRKFTPYTQYITGEDKDGSMEDPWIDKIKT
                     "
     gene            complement(<1094693..>1096636)
                     /gene="NDAI0G04600"
                     /locus_tag="NDAI_0G04600"
                     /db_xref="GeneID:13926924"
     mRNA            complement(<1094693..>1096636)
                     /gene="NDAI0G04600"
                     /locus_tag="NDAI_0G04600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980072.1"
                     /db_xref="GeneID:13926924"
     CDS             complement(1094693..1096636)
                     /gene="NDAI0G04600"
                     /locus_tag="NDAI_0G04600"
                     /inference="similar to DNA sequence:INSDC:YKL012W"
                     /note="similar to Saccharomyces cerevisiae PRP40
                     (YKL012W); ancestral locus Anc_2.649"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980121.1"
                     /db_xref="GeneID:13926924"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR002713"
                     /db_xref="InterPro:IPR027237"
                     /db_xref="UniProtKB/TrEMBL:J7SBP1"
                     /translation="MNRDQKNAVNGNQWRSAKDAKGRIYYYNLITKESKWEKPKELLP
                     ITAATSTTVRTSTISTNNAKTNIKIEKDDASIMENIGWKSNVTADGKTYYYNLKTGES
                     RWDISALIKQYKEKSQTKGQNQQVLSSKLSPSPATTTISVKQEIDTIGTSIPSQTAAD
                     GTSEPEELREYSNESPILTIIAKSQEDAEREFMNMLKENEVDSTWSFDKIIKELGTKD
                     PRYWIIDDDPLWKQEMFEKYLSNRSEDQLLKEHNEVSKFKDAFLNMLSNNSEIHYYTR
                     WPTARRIIENEPIYKHSVVSETIKKKSFLEYVTGLKSKYEEEQNKLKKQALQEFNDYL
                     DSIITNNQGDDGIIISWETLLNNYLFEKNKRFMANKHFKILTHEDILIEYLKRVKLRE
                     EELINELSKIDEMNYTRDRIARDQFKKLLMENDSKIKANSQWKDFYSEFKTHESFQNI
                     IGRNGSTSLDLFLDVVDDKKLIIVGKRSVAQQVLIDNNYEWLYDGIEREMYDKDYENI
                     DKILVMDRSFQDIDKIDLQLIIDQIIHSRIEKKEIQIETEKRVLEQKKHYFKLMLHNY
                     FRNVRAPLSLTWDKMKESIYETLEYKNLKDDEATMKQIFDELQNEIKNTPSIQGNNTV
                     IPQQQQAVSQKKRHLTPSVELDY"
     gene            <1097796..>1099130
                     /gene="NDAI0G04610"
                     /locus_tag="NDAI_0G04610"
                     /db_xref="GeneID:13926925"
     mRNA            <1097796..>1099130
                     /gene="NDAI0G04610"
                     /locus_tag="NDAI_0G04610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980073.1"
                     /db_xref="GeneID:13926925"
     CDS             1097796..1099130
                     /gene="NDAI0G04610"
                     /locus_tag="NDAI_0G04610"
                     /inference="similar to DNA sequence:INSDC:YMR062C"
                     /note="similar to Saccharomyces cerevisiae ECM40
                     (YMR062C); ancestral locus Anc_2.628"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980122.1"
                     /db_xref="GeneID:13926925"
                     /db_xref="GOA:J7S4G9"
                     /db_xref="InterPro:IPR002813"
                     /db_xref="InterPro:IPR016117"
                     /db_xref="UniProtKB/TrEMBL:J7S4G9"
                     /translation="MTFATKILQNTTRKVIDKYPLYVPKSGTFPKGFQVGSIASGVKK
                     NNALDLGIIINTNKSRPSSAAAVFTTNKFKAAPVLTSKNVLDSTNGVAINAIVVNSGC
                     ANSVTGELGMQDAKEMIDIVNEQLGDKTSPSTLVMSTGVIGQRLQMNKISEGIKKIFQ
                     ENKFGSDFTSWLNISKSICTTDTFPKLVTSKFKLLNGKEYTLTGLAKGAGMICPNMAT
                     LLGFIVTDLPIESKTLQKMLRHSTSRSFNCISVDGDMSTNDTICMIANGAVDTPEINE
                     NSQEFKQVQDQVTEFAQRLAQLVVRDGEGSTKFVTVNVKNSYSFEDAKIIAESISNSM
                     LVKTALYGQDANWGRILCAIGYAKLNDLKSLNVDKINVSFIATDNSEPRELKLIVNGV
                     PQLNIDEERASEILALNDLEVLVNLGTGKEEAQFWTCDLSHEYVTINGDYRS"
     gene            complement(<1099346..>1101409)
                     /gene="NDAI0G04620"
                     /locus_tag="NDAI_0G04620"
                     /db_xref="GeneID:13926926"
     mRNA            complement(<1099346..>1101409)
                     /gene="NDAI0G04620"
                     /locus_tag="NDAI_0G04620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980074.1"
                     /db_xref="GeneID:13926926"
     CDS             complement(1099346..1101409)
                     /gene="NDAI0G04620"
                     /locus_tag="NDAI_0G04620"
                     /inference="similar to DNA sequence:INSDC:YMR061W"
                     /note="similar to Saccharomyces cerevisiae RNA14
                     (YMR061W); ancestral locus Anc_2.627"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980123.1"
                     /db_xref="GeneID:13926926"
                     /db_xref="GOA:J7RTA7"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR008847"
                     /db_xref="UniProtKB/TrEMBL:J7RTA7"
                     /translation="MSTSLTPDPTIQEQEQGQGQQEQQEQQQADAQQTRHPNEKERQL
                     LDKLSNDPLDILTSLELIQYYESTDASLDKIRGVFQTLHETFPLLSFLWTIQLKMELA
                     RDEFATVESFLSMCLSSSSNLTGSSPTELASAPNNDLSLWLTYLDYVRRKNNIITGGQ
                     EARSIVIKAFELVLEKCANWEPQSSQFWLDYLLFLENWKPFNKWEEQQKIDMLRKLYK
                     RMLVVPFDQLEKMWNKYTQWEQDVNSLTARKFIAELSPNYMKARSVFQEWSNLTRNLK
                     RITPISLHTVNKNNVPSSPSSSTSSFSTDIEQLDIWLKWIEWEKQNKLELSEELLMDR
                     LNYVYKQAIQYLIFNPEIWYRYSMFLKDPIQREYILNLSLRANPTSATLTFKLSECFE
                     SNNQIDETKKCFEGCVDHLLKKTHQLVQSQESEQTINDSKRKLTFVYCIYMNTMKRLS
                     GLSAARSVFSKCRKLKKNLTHDIYIENAYMEFQNQNDYKTPCKVLELGLKYFQNDGIY
                     ILKYLDFLILLNKDSQIKTLFEISIDKIEDLNQLKLIFKKILNYESKFGNLNNLYQLE
                     KRFLEKFPNENLIDIFTDRYQIQNENLIKKLELRYLYDDTKNLKHYDTGNQTNRYKRK
                     FDTYISDENNHKNNIQIEDGGGNGPQNKQMRLNSQLIPQEVVDLLSILPKRQYFKNVL
                     LDSKN"
     gene            <1101781..>1102839
                     /gene="NDAI0G04630"
                     /locus_tag="NDAI_0G04630"
                     /db_xref="GeneID:13926927"
     mRNA            <1101781..>1102839
                     /gene="NDAI0G04630"
                     /locus_tag="NDAI_0G04630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980075.1"
                     /db_xref="GeneID:13926927"
     CDS             1101781..1102839
                     /gene="NDAI0G04630"
                     /locus_tag="NDAI_0G04630"
                     /inference="similar to DNA sequence:INSDC:YMR060C"
                     /note="similar to Saccharomyces cerevisiae SAM37
                     (YMR060C); ancestral locus Anc_2.626"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980124.1"
                     /db_xref="GeneID:13926927"
                     /db_xref="GOA:J7SB06"
                     /db_xref="InterPro:IPR019564"
                     /db_xref="UniProtKB/TrEMBL:J7SB06"
                     /translation="MSATTTAVTFANKCVLHIWGHADEGTPSLVSPSSIALIWYLNSL
                     PRELRDDFEIVCSNNTDLSMTKELPVLFINSPNGIVTRQRCGFIDIIRYIDTQQQGHK
                     KTSSSNQQNLLESALLTYTMTELTLLTDYQLYLNGKNYSNFTNKVFSKLLYWPMWYNT
                     PLNNRALTRKRYYVHDSPHKILDTEMEGFENIHIDEKHEHDPSMAHSKTFKLTKYKKM
                     QNKKTLQNLQDDMNYNKRFVEVLNDWFEVAKDVPSIYDGEGSCSSPTYLLLLANLYIQ
                     MELPNGSKIKEYLSSVEHWDKISNDLEYLKTSGYGEMIIQKDGSIDRNGGLQLQPAKF
                     NEQGNIITSLYNYITWYL"
     gene            complement(<1103492..>1104796)
                     /gene="NDAI0G04640"
                     /locus_tag="NDAI_0G04640"
                     /db_xref="GeneID:13926928"
     mRNA            complement(<1103492..>1104796)
                     /gene="NDAI0G04640"
                     /locus_tag="NDAI_0G04640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980076.1"
                     /db_xref="GeneID:13926928"
     CDS             complement(1103492..1104796)
                     /gene="NDAI0G04640"
                     /locus_tag="NDAI_0G04640"
                     /inference="similar to DNA sequence:INSDC:YKL075C"
                     /note="similar to Saccharomyces cerevisiae YKL075C;
                     ancestral locus Anc_2.623"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980125.1"
                     /db_xref="GeneID:13926928"
                     /db_xref="UniProtKB/TrEMBL:J7REC2"
                     /translation="MAPRNVDPSFNSMEDLVFLGARYKYITSKEYLEMEYGSKKGSFI
                     MKFIDCIHKKINHEVNKTNDKYIKQLNPWIKSNCSFTGNIIQRGDSDYRLGSNEEERM
                     KVRVFGNIIYRGEKEMLLPLDFTANIPEDNGTKENQYEFLNCLKSSTLIGQIMRENID
                     NELSGSKSDENYILSSIWANFMEGLINHYLEKVIVPQSEVKVYKELYNPMMKIISLYN
                     EYNEYNKLIAETEESRLLTPSDRCKFHLSDNIGINGKIDNKNNNNPKRLHNKRLSHKF
                     SITKNLDPERVQKAEELLXXMLAMIFLRPINNELTLLSEFYSTALADEQGYQLEEFLD
                     YAEGYIEQVYLPHLVRVLFANCGTDLFWKTMLILEPFFYYIEDIGEEEVDDEEEEKEE
                     RKADTLLRGESHRTTSNDNIRYCIDPRVTTFEKICGGAAGQH"
     gene            complement(<1105335..>1107266)
                     /gene="NDAI0G04650"
                     /locus_tag="NDAI_0G04650"
                     /db_xref="GeneID:13926929"
     mRNA            complement(<1105335..>1107266)
                     /gene="NDAI0G04650"
                     /locus_tag="NDAI_0G04650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980077.1"
                     /db_xref="GeneID:13926929"
     CDS             complement(1105335..1107266)
                     /gene="NDAI0G04650"
                     /locus_tag="NDAI_0G04650"
                     /inference="similar to DNA sequence:INSDC:YMR058W"
                     /note="similar to Saccharomyces cerevisiae FET3 (YMR058W);
                     ancestral locus Anc_2.622"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980126.1"
                     /db_xref="GeneID:13926929"
                     /db_xref="GOA:J7SBP3"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="UniProtKB/TrEMBL:J7SBP3"
                     /translation="MMLISYIITLLPIVATSALAKTHTFNWTTGWDYQNVDGVLNRPV
                     ITCNGQWPWPDIRVTKGDRIQVYLTNGFNDSDTSLHFHGLFQKDNNKMDGVPFLTQCP
                     IGPGDTYLYNFTVEDNVGTYWYHSHTAGQYEDGFRGMLIIEDGEDNVNFPYEYDYDVP
                     LGIGDWYDRTVDLLTADFMNLYNPTGAEPIPQNLILNNTRNLTWNVQPDTTYLLRIVN
                     IGGFVSQYFWIEDHDMTVVEVDGVYTEKNTTNMLYLTVAQRYSVLIHTKNDTSKNFAI
                     MQKFDDTMLDLIPKHLELNSTSYMVYNSSAPLPDENFVDSLDEYLDDFYLVPYEKVEL
                     FDEPDYRITLDVKMDNLINGINYAFFNNITYVTPKVPALISVLTSGNDSTNALVYGTN
                     TNSFVLKKDEIVDIVVNNYDTGKHPFHLHGHVFQTISRDRPYEADDGETVHPFDLTDH
                     TPYPDYPMMRDTIYLNPQSSFVIRFKADNPGVWFFHCHIEWHLIQGLAIVLIEDPENI
                     QAVESQNFTANELNVCKNKNIPVSGNAAGDSVDFLNLKDELVQPKAIPDGFTKKGIIA
                     MVFSCLCGVLGLIMLSVYGLMDISDVEEKVVKDFRLSPEILLDDKNMDHNESYQESVM
                     EKSGSKSKFFTSIRRLAPL"
     gene            <1109224..>1110156
                     /gene="NDAI0G04660"
                     /locus_tag="NDAI_0G04660"
                     /db_xref="GeneID:13926930"
     mRNA            <1109224..>1110156
                     /gene="NDAI0G04660"
                     /locus_tag="NDAI_0G04660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980078.1"
                     /db_xref="GeneID:13926930"
     CDS             1109224..1110156
                     /gene="NDAI0G04660"
                     /locus_tag="NDAI_0G04660"
                     /inference="similar to DNA sequence:INSDC:YMR056C"
                     /note="similar to Saccharomyces cerevisiae AAC1 (YMR056C);
                     ancestral locus Anc_2.621"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980127.1"
                     /db_xref="GeneID:13926930"
                     /db_xref="GOA:J7S4H1"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR002113"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:J7S4H1"
                     /translation="MVTIAKEQQHSSSFIVDFLMGGVSAAIAKTGAAPIERVKILMQN
                     QSEMLKQGSLDTPYLGIVDCFKKTASHEGIISFWRGNTANVLRYFPTQALNFAFKDKI
                     KAMFGYTKEKDGYRKWFVGNIVSGGSAGGLSLLFVYSLDYARTRLAADAKSKKSGMPR
                     KFNGILDVYKKTLNSDGILGLYRGFLPSVCGIMVYRGLYFGLYDSLKPVLLTGVLENS
                     FLASFLLGWAVTITASTTSYPLDTVRRRMMMTSGQAIKYKGALDCFKKIIAEEGVYSL
                     FKGCGANIFRGVAAAGVISLYDQLQLLLFGKKFK"
     gene            <1110450..>1111493
                     /gene="NDAI0G04670"
                     /locus_tag="NDAI_0G04670"
                     /db_xref="GeneID:13926931"
     mRNA            <1110450..>1111493
                     /gene="NDAI0G04670"
                     /locus_tag="NDAI_0G04670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980079.1"
                     /db_xref="GeneID:13926931"
     CDS             1110450..1111493
                     /gene="NDAI0G04670"
                     /locus_tag="NDAI_0G04670"
                     /inference="similar to DNA sequence:INSDC:YMR055C"
                     /note="similar to Saccharomyces cerevisiae BUB2 (YMR055C);
                     ancestral locus Anc_2.620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980128.1"
                     /db_xref="GeneID:13926931"
                     /db_xref="GOA:J7RTB1"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:J7RTB1"
                     /translation="MTSIERLISEPPLLIEPSLSHLRYLILSDGLPTSNDKKTQRLRS
                     YVWSILSRTSMEGSTQKYLYYLSLGLPNSKITQKILDDTFRTFSTDEKFTAEVKEDVL
                     IRCLSCFAWQTEEYSHQLGEKLRRSGKSNQKVGRGRNDIGPDNDDDEDKQEKEVRIHD
                     DTYIHEISPYLQGMNIILAPLLYACPTEPIAFKLFSTMCYDLFPAYITKNMKGSQNGA
                     KLLDLCLEIIDPKLSGLLHGHLLNAQTYAYSKILTFSSSTKPLDQVIKLWDFMFAYGF
                     HMNILLIIAMFERNRSLIMKSESPLSLILNGLPDIDADEIISLAVGFIAKIPTDIYEL
                     LVEHLVNSDIIIP"
     gene            complement(<1112168..>1114840)
                     /gene="NDAI0G04680"
                     /locus_tag="NDAI_0G04680"
                     /db_xref="GeneID:13926932"
     mRNA            complement(<1112168..>1114840)
                     /gene="NDAI0G04680"
                     /locus_tag="NDAI_0G04680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980080.1"
                     /db_xref="GeneID:13926932"
     CDS             complement(1112168..1114840)
                     /gene="NDAI0G04680"
                     /locus_tag="NDAI_0G04680"
                     /inference="similar to DNA sequence:INSDC:YMR054W"
                     /note="similar to Saccharomyces cerevisiae STV1 (YMR054W);
                     ancestral locus Anc_2.617"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980129.1"
                     /db_xref="GeneID:13926932"
                     /db_xref="GOA:J7SB08"
                     /db_xref="InterPro:IPR002490"
                     /db_xref="InterPro:IPR026028"
                     /db_xref="UniProtKB/TrEMBL:J7SB08"
                     /translation="MTYVQLYIPLEISRETVCLLGNLGNIMFRDLNKDLTDFQRSYVS
                     QLRKFDDVERLLNYLKETADKHSDATWKYILHVDEQGNDIISPSLTTVVQSLGSYSQD
                     SINNLIGDVTGSETRVRQLDDSLNGLKEKLNGLIENRCVIIQCSKYLERNPNTIGRST
                     SDSNSTANANENDFIFSDEEVDAVSNTLSDTFSFDDDDNNNNDTNNDNNSGQAPMNAR
                     LTTDETTSFEEFGFLETGYHHRYMIAGSINRTKVELLNRILWRLLRGNLFFQNFPIDI
                     PLLEGKEKVEKDSFIVFTHGDLLLSKVKRVIESLDGKVVTLERRPHDAVEKLNSEISD
                     IQQVVHTTEQTLHTELLVVNDQLPTWNAVVKREKYIHATLNLFKQEVQGLLAEGWIPS
                     SDVDELSDSLKDHSESLGSEYGTVVNIIHTNKNPPTFHRTNKFTQAFQSIVDAYATAT
                     YKEVNPGLATIVTFPFMFAIMFGDAGHGMIVLLIALYFILNEKKFEAMQKDEILDMVY
                     SGRYMICLMGAFSIYTGIIYNDIFSRPMTFFKSGWEWPSTFKKGDSIEAGKVGVYSFG
                     IDYAWHGAENGLLFMNSYKMKLSILMGFIHMTYSYAFAYINFRYKNSRVDIIGNFIPG
                     LIFMQSIFGYLSWAIVYKWSKDWIKDGKPAPGLLNMLINMFLSPGTIDEPLYRGQAVL
                     QSILLIAALVCVPWLLLYKPLTLRKQNKGYRRLQSSNADNPPMLNIEIQDPTLDSSNI
                     NNSNMTITDYGDDTIADDDNEEEEAFDFGDVMIHQVIHTIEFCLNCISHTASYLRLWA
                     LSLAHAQLSSVLWDMTIGISFSSNNSGSTLSVIKVIFLFGMWFVLSVCILVFMEGTSA
                     MLHALRLHWVEAMSKFFEGEGYPYEPFSFDNLIE"
     gene            <1115676..>1118381
                     /gene="NDAI0G04690"
                     /locus_tag="NDAI_0G04690"
                     /db_xref="GeneID:13926933"
     mRNA            <1115676..>1118381
                     /gene="NDAI0G04690"
                     /locus_tag="NDAI_0G04690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980081.1"
                     /db_xref="GeneID:13926933"
     CDS             1115676..1118381
                     /gene="NDAI0G04690"
                     /locus_tag="NDAI_0G04690"
                     /inference="similar to DNA sequence:INSDC:YKL072W,YMR053C"
                     /note="similar to Saccharomyces cerevisiae STB6 (YKL072W)
                     and STB2 (YMR053C); ancestral locus Anc_2.616"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980130.1"
                     /db_xref="GeneID:13926933"
                     /db_xref="UniProtKB/TrEMBL:J7REC7"
                     /translation="MSNSLNVKKTGHSRSVDKVSHQYSKQKYNTNNKLKVAPLTKARL
                     SSSSSSSLKSFNKKSASPENGNIQGLPLQASLNKKPASDRLYPAVSVPFSSFIFPDTR
                     ALFNLNLKSYMDLTYEEIKVVGFELYIIEQWAPERKLSTIITSLTGNSQDIITAIRVI
                     LPSDPKLWPGRFKQYHEELMEFSQPRVTPQGTLFISNLSNVNSSLNLIHIECGDLRSV
                     WILFKINFNLKMLHCAGRSAVLLSYPSSSAKEKFSQVYRIPIDKGQAQPPGRWASINE
                     RLMVPNFDTTDGNKGQHSRSMVSDLLPVSGYYPVIELINIIQISLGYFKLPVGKIIND
                     GLICNITKKAIDEWWDLYGKLYLGVEKPRNEATLGPTTVASLISLVLSCYFKLMVEDC
                     ISSKDAFDEPEFFNGIYNFQRKYGITTPGTQVCLEHRTLEKLFEVSAKFSAGNVTDIF
                     KMKKVVKSRVHDITGKGNPIHLSNEILTTDLNTLVNNIHGGSLGLLWKGKGKPRRKAD
                     LSSSINFLTFNFSHGNPMQQLKEHELNLYKLKQDEKLKERALLHNKLRFLDNIDDATG
                     NNNLVDRQRDQDLGSYNERDSDMFSLGRSDLRRVPFSSATISSMFCNYDRSKYLRNAD
                     INKRYQNEIFRRNSVDSDIQKAVNPNKLDHYFKDGIRLHRSNSASKIQNVIERWDLPF
                     DSSVVKVARDLLRIEDELHLQQQVDEKEKELHDNRISQVNDRGDENHDQDVEFDQAMK
                     ALQEIYQKYIKGANTFQAKSDNIETQQQLLLNEMHELNSLTSKLKYDVRILDHRVRDV
                     EESVSQFDTKLKAVRKTLVIREKGPKDLTPDMQNDKLLFEQCMNNLLKSENTQYQGVC
                     LKVLSKGFFQEMKRDIHEWYHWFFGKAPNKSVIENADVEIQSMPT"
     gene            complement(<1121097..>1124864)
                     /gene="NDAI0G04700"
                     /locus_tag="NDAI_0G04700"
                     /db_xref="GeneID:13926934"
     mRNA            complement(<1121097..>1124864)
                     /gene="NDAI0G04700"
                     /locus_tag="NDAI_0G04700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980082.1"
                     /db_xref="GeneID:13926934"
     CDS             complement(1121097..1124864)
                     /gene="NDAI0G04700"
                     /locus_tag="NDAI_0G04700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980131.1"
                     /db_xref="GeneID:13926934"
                     /db_xref="GOA:J7SBP5"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:J7SBP5"
                     /translation="MYTVSNKRNYNLNNTTVYSQDLSTTNQTIYHIRARHQWKTLPMA
                     TIWIDKRQVQALLDSGSEINLIQEDIAKMLEHQKNVSRINNNNPVRIECGGKISMSEY
                     LLLGSCFKLKERSYTALFHVVNISTNVPKMILGIPWLREHGIILNFEQNAYSIMDQGG
                     KIIDQVNNDTGYKSNFQQVTDNSSYLTQEHANSNLEDEGHDKVDNSEITLPPELSDLA
                     IYFAKPDYKGKLKESDFKTFIEFEKTKPNRMGTPGYPIPQAWLTQAKKQMQVMVDQGV
                     VEEVNGYCNYVSPGFFIRKRDTEELRLVINYRTANQYVIGMESQLPSIYDSIVTLPDS
                     VFTVLDITSAFYTVKLDKLSQDFLCFKVGNQTYRPLRAPMGYKNSAQLFAAFINHILP
                     SSLKPHLTIYVDDLLIIGKPNTIVSLTREVIQHLGGYGIRFSAKKIQFNQRSIEYLGY
                     KIVPGGIKPLERHIEAIVNLPPPQTVRDVRSLIGMANFIRNWIPNISESLKHMYQTIK
                     DYGDKGKKGRISISEELILEYQNFKETLQRLPTIGRFIPGYPILIFTDASRYSTGAVV
                     IQLSDKADSRKPIQIIIDEIKERNGKVQGKISGFSSHKLTPAEQNYSVYDLELLAIDK
                     VLEQYEQWLIGSPVTVITDHANLSRLTTKVRLTPRISRTMEFLMQFDVRIGFMEGDSN
                     TMADGLSRYPIHKSSEPSKIEVELFRRSKLRPEILEPSIPYEDTEIPNQVKRLFITTA
                     KINESDNVFLRVPEMTLEIVEKYQEDQIHDITGLPITLHDKLKEAVSNIKVNSKLHFL
                     TIQGDKLLTKEHKWWIPQEQYEIILWIIWNTHINNDMHRGIQETLRCIRKRYNFDDLY
                     KLTQVVVNSCKICQSNKPTNFSISNYRYIPTPSRPHMIMSADHITDLDTSKDGYNEIL
                     VIVDLFTRYTYLIAAKKQDTAEETFQRLEERLCLHGGLPITMLTDNGTKYKGEFNKNL
                     SWRGINHWNTSIYRAKSNGANERMNGIIKQCLRTHGALMRPHWPQHLSATEFFINSRT
                     HSATRRSPNELKFGYEPEWIDTNKRLEMLNTDTRIQVMSDEEWYNYIQEKVKPIQALL
                     VKSKDRNKQKITKTGKPVVFKVGEMVWISRHAYVAKGLKALKAVFIGPAVIKEAVRET
                     SYKVNILNSSIVLHVNAEFLSKFIKPIDTVRQLRIAMDEYFETIVTTDNTPKQTKLNG
                     IMKASQENGHPNQEDFQSTNKRGAPSELNEKNAINDANTTTRKKICRRSKH"
     gene            complement(<1124886..>1126241)
                     /gene="NDAI0G04710"
                     /locus_tag="NDAI_0G04710"
                     /db_xref="GeneID:11497419"
     mRNA            complement(<1124886..>1126241)
                     /gene="NDAI0G04710"
                     /locus_tag="NDAI_0G04710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671218.1"
                     /db_xref="GeneID:11497419"
     CDS             complement(1124886..1126241)
                     /gene="NDAI0G04710"
                     /locus_tag="NDAI_0G04710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671266.1"
                     /db_xref="GeneID:11497419"
                     /db_xref="UniProtKB/TrEMBL:G0WE12"
                     /translation="MSSVTTDQRELEESNTLLPEVITTGFVLDEEEEDEIKNVENPYL
                     KMFGQTPAIDALRNSERTKNFNTYEYAEFYCPELFGFKSLKPFRNYKGLVKETKDDDN
                     RNDSYKESGKSFSRSTGMEKYVYGEDPIKFVQQFLREYQKRNILESKSTIYTTFRSLL
                     PAKLTAMCAASDGKEDPDALIEQFVLTQVSWHQLVKNAIDTLKLLDDNVIIAERISQS
                     KVFLETASWVKTNKRLRNMMPLLSLSNSRAREFNSMYQEERFNEDFNLTKAIYSFTGN
                     EVATLTGWSIEHPQDIAIIAQFPRIEESELRNKLGVSKYTDAKYESLKDFITTKDSTM
                     SLTMTKLNKEENDESQTKKIAYLEYDYAFKLTDEEWTKNKPIIKRTNSILGTNFTANP
                     YANNTEFQATGRQWTTSAFKEIIRDRRCKHCGHKKDKNHYCSVGMVIYSYRVSKPRQP
                     K"
     gene            complement(1130782..1130853)
                     /gene="NDAI0Gtrna7M"
                     /locus_tag="NDAI_0Gtrna7M"
                     /db_xref="GeneID:11497420"
     tRNA            complement(1130782..1130853)
                     /gene="NDAI0Gtrna7M"
                     /locus_tag="NDAI_0Gtrna7M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:11497420"
     gene            complement(<1131331..>1131750)
                     /gene="NDAI0G04720"
                     /locus_tag="NDAI_0G04720"
                     /db_xref="GeneID:13927090"
     mRNA            complement(<1131331..>1131750)
                     /gene="NDAI0G04720"
                     /locus_tag="NDAI_0G04720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980083.1"
                     /db_xref="GeneID:13927090"
     CDS             complement(1131331..1131750)
                     /gene="NDAI0G04720"
                     /locus_tag="NDAI_0G04720"
                     /inference="similar to DNA sequence:INSDC:YJR044C"
                     /note="similar to Saccharomyces cerevisiae VPS55
                     (YJR044C); ancestral locus Anc_1.473"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980132.1"
                     /db_xref="GeneID:13927090"
                     /db_xref="InterPro:IPR007262"
                     /db_xref="UniProtKB/TrEMBL:J7S4H5"
                     /translation="MQFKVSPLTKIISLSVFLALGFLLVILSCALFHNYYPLFDILVF
                     ILAPIPNSIFGSRSYASSDFMSPSSNNGKDLGHFLTGMFVASGIALPLVFYHCQLIGS
                     VSCAMSMIGGLIIYSSIVIFSWFFHSSWENDEDNLFG"
     gene            complement(<1132250..>1134214)
                     /gene="NDAI0G04730"
                     /locus_tag="NDAI_0G04730"
                     /db_xref="GeneID:13926935"
     mRNA            complement(<1132250..>1134214)
                     /gene="NDAI0G04730"
                     /locus_tag="NDAI_0G04730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980084.1"
                     /db_xref="GeneID:13926935"
     CDS             complement(1132250..1134214)
                     /gene="NDAI0G04730"
                     /locus_tag="NDAI_0G04730"
                     /inference="similar to DNA sequence:INSDC:YEL030W,YJR045C"
                     /note="similar to Saccharomyces cerevisiae ECM10 (YEL030W)
                     and SSC1 (YJR045C); ancestral locus Anc_1.474"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980133.1"
                     /db_xref="GeneID:13926935"
                     /db_xref="GOA:J7RTB5"
                     /db_xref="InterPro:IPR012725"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:J7RTB5"
                     /translation="MLAAKNIMNKSAFGSSFRLAATRLQSTKVQGQVIGIDLGTTNSA
                     VAIMEGKIPKIIENAEGARTTPSVVAFTKEGERLVGIPAKRQAVVNPENTLFATKRLI
                     GRRFEDAEVQRDIKQVPYKIIKHSNGDAWVEARGQTYSPAQIGGFVLNKMKETAEAYL
                     GKAVKNAVVTVPAYFNDSQRQATKDAGQIVGLNVLRVVNEPTAAALAYGLEKSDSKVI
                     AVFDLGGGTFDISILDIDNGVFEVKSTNGDTHLGGEDFDIYLLREIVSRFKSESGIDL
                     ENDRMAIQRIREAAEKAKIELSSTVSTEINLPFITADASGPKHINMKFSRAQFETLTE
                     PLIKRTIDPVKKALKDANLATSDISDVLLVGGMSRMPKVVETVKQLFGKEASKAVNPD
                     EAVAIGAAIQGAVLSGEVTDVLLLDVTPLSLGIETLGGVFTRLIPRNTTIPTKKSQIF
                     STAAAGQTSVEIRVFQGERELVRDNKLIGNFNLAGIPPAPKGVPQIEVTFDIDADGII
                     NVSARDKASNKDASITVAGSSGLSESEIEQMVSDAEKFKTQDEARKQSIETANKADQL
                     ANDTENSLKEFEGKLDKAEVQKVKDQIASLKEIIARVQGGEEINAEELKTKTEELQTS
                     SMKLFEQMYKNSSDNSNNSNNDAQSGETKQ"
     gene            <1135051..>1136850
                     /gene="NDAI0G04740"
                     /locus_tag="NDAI_0G04740"
                     /db_xref="GeneID:13926936"
     mRNA            <1135051..>1136850
                     /gene="NDAI0G04740"
                     /locus_tag="NDAI_0G04740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980085.1"
                     /db_xref="GeneID:13926936"
     CDS             1135051..1136850
                     /gene="NDAI0G04740"
                     /locus_tag="NDAI_0G04740"
                     /inference="similar to DNA sequence:INSDC:YJR046W"
                     /note="similar to Saccharomyces cerevisiae TAH11
                     (YJR046W); ancestral locus Anc_1.475"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980134.1"
                     /db_xref="GeneID:13926936"
                     /db_xref="UniProtKB/TrEMBL:J7SB10"
                     /translation="MSTQNTRKQTIPIIDLDKISQEDELLPVVRSILLYTDTFLLKNY
                     ANKSSLDSLISHLNDSNNAPDTKQQFDANFTGTLSINNDISMEQYIYNSEPDLQFNRT
                     VNNPYLQKLSSRLFKVSLFFSQLCLKSIVQNTTLQNTLSETNFATKLTRYHHERGNLE
                     KVSVNGEDFQYLFNHDFINHTSAGILTVFPIAKGIKYKPPTASIDDNQWTSIDEPDCL
                     LFHTGTLLSTLSNGLHSTSPIQIDPSTNPIHLTIFPPLSTPLNGNKKVSAELLSQQIK
                     EFPQVAEKFYNKQSHQLILQQKLNLYKRLFTTSETILSLNSMSRVSNIAPELHSLLPQ
                     MSNMMNFKIVQDDFLKLLTIWPQAYIIEANSKCELAIKLPQIDPLMALSNKSRKLQFA
                     EMCDLWYLNHYDLDVVPKDVPPLKVNKRRGSIDNDNMDVSSPSYQTKRIQSPTKQKNY
                     IHNKKEQFIYKEKQHDSQSNLLDRLRERERRSAALLSERQRKYQEFLSVKMSQVFKIL
                     ISLNWNEPYTVTHLTELIADSLQNSNNPIGEYEAEEIIDKLQSLLSDQISCIVVEGGL
                     KVYKWDQLKSDKFESALNEFKEKAHETNIHMDV"
     gene            1137715..1137786
                     /gene="NDAI0Gtrna4H"
                     /locus_tag="NDAI_0Gtrna4H"
                     /db_xref="GeneID:11497423"
     tRNA            1137715..1137786
                     /gene="NDAI0Gtrna4H"
                     /locus_tag="NDAI_0Gtrna4H"
                     /product="tRNA-His"
                     /note="codon recognized: CAC"
                     /db_xref="GeneID:11497423"
     gene            complement(<1139503..>1140018)
                     /gene="NDAI0G04750"
                     /locus_tag="NDAI_0G04750"
                     /db_xref="GeneID:11495696"
     mRNA            complement(<1139503..>1140018)
                     /gene="NDAI0G04750"
                     /locus_tag="NDAI_0G04750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003671222.1"
                     /db_xref="GeneID:11495696"
     CDS             complement(1139503..1140018)
                     /gene="NDAI0G04750"
                     /locus_tag="NDAI_0G04750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003671270.1"
                     /db_xref="GeneID:11495696"
                     /db_xref="UniProtKB/TrEMBL:G0WE16"
                     /translation="MFIAKLFCFCVASVLPHKYGEKDVTSALAFGHFIFSTVEKFWGR
                     IDMSNVKNTKEGHFMKTLLSINSEITVETVGESIAAIQNNSERLLVLPSLIEKNDSLI
                     SNQLNGSDIFSIKSELDDIVALGEQYQGMIDKLSWKSRLFLNKAFKNAILSYIQFHAW
                     RINMLGKKCLR"
     gene            complement(<1144343..>1147486)
                     /gene="NDAI0G04760"
                     /locus_tag="NDAI_0G04760"
                     /db_xref="GeneID:13926937"
     mRNA            complement(<1144343..>1147486)
                     /gene="NDAI0G04760"
                     /locus_tag="NDAI_0G04760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003980086.1"
                     /db_xref="GeneID:13926937"
     CDS             complement(1144343..1147486)
                     /gene="NDAI0G04760"
                     /locus_tag="NDAI_0G04760"
                     /inference="similar to DNA sequence:INSDC:YKL068W,YMR047C"
                     /note="similar to Saccharomyces cerevisiae NUP100
                     (YKL068W) and NUP116 (YMR047C); ancestral locus Anc_2.610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003980135.1"
                     /db_xref="GeneID:13926937"
                     /db_xref="GOA:J7RED1"
                     /db_xref="InterPro:IPR007230"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="UniProtKB/TrEMBL:J7RED1"
                     /translation="MFGASRPAFGNTNQSQFGGNATTASPFAAPQPQQQQQGSGLAAF
                     GMNQQQQQPGNAFGARFGISQTTNNPPGFGNSGATTQPAFGSIQNTNTTGQSSLFGGG
                     NNNTMGMNTTTAGTNSGTSAKPFKPFQEKDSTTGVINVYQSISCMPEYRNFSFEELRL
                     QDYQMGIKNSTYAPTNTSTNMIMGQNKPSLFGNANTATTNNTFGGPNSFGTNNNTAAV
                     GSSGRTGLFGQNSNQGNSLFGNQTTPFGAQQGNTGLFGQQQQQQPHQQQGNTGMFGQQ
                     PQQQNMFGTNANTMGGSAGGLFGQQKPGGLFGNANQQQQQPNTAGGLFGNRPSGGGLF
                     GQTNANTATGGSGLFGQQQQPSQMNPFGNNAATNQQATTGGLFGNTPKPGGLFGQQQA
                     TPFGQSTSTSLFGQNQQQQQQPSGGLFGQTNTNQQTQPFGASNTTGGALFGGNKPATS
                     TGLFGNTSQQQPGATGGLFGNANANQQQQQQQPAAGLFGGNIQSGGGMFGQNNNASNF
                     GAGANTNTSTGLFGANKPTTSTGGLFGNTNVNANNNTVGGGGGLFGNTTNTGSTGLFS
                     GAKPGSAATTTSNTSTLSGLGGAGSAGLFGGANANANAGGLFGNKQQQPNTTITGGGG
                     LFGNNNTNNNTTALNNGMSGGLFGNTANFQQNQQQQLQQQQQLQQQQQEQQKQLLSSN
                     PYGTNELFSRVVIPNSSSTVQALSAKITADKKRNGTLLNSYRKAPKPLFAPKPNNDKL
                     LITSSSLTKTQTPTPQFLINADALNKNKFNTVSFDRDAEEAISNIAERLFKPEEKSYK
                     KLLMDKMVAQKEMEKQKLNEKNNQKLTEPSVPDAVLPNEKNINNNVGSPTIESKTDKL
                     KDNNNNKKDAPQNRELNGEKPVPEDENKEPIEQIKGLNREDFSYIDDFYYISPSLDTL
                     VKKSLIQLREVSELIVGHKKFGKIEFLEPVDLSTFPLPSLCGEIIHFESKKCSFYKNS
                     NIVPVENEGINVAARITLNGCYPYDKSTREPIKDPSHPSVK