GenomeNet

Database: RefSeq
Entry: NC_016501
LinkDB: NC_016501
Original site: NC_016501 
LOCUS       NC_016501            1418021 bp    DNA     linear   CON 03-APR-2018
DEFINITION  Torulaspora delbrueckii CBS 1146 chromosome 1, complete genome.
ACCESSION   NC_016501
VERSION     NC_016501.1
DBLINK      BioProject: PRJNA79345
            BioSample: SAMEA2272433
            Assembly: GCF_000243375.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Torulaspora delbrueckii (Candida colliculosa)
  ORGANISM  Torulaspora delbrueckii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Torulaspora.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 1418021)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1418021)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-DEC-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE616742.
            Accession numbers for all the chromosomes in this genome project:
            HE616742-HE616749.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1418021
                     /organism="Torulaspora delbrueckii"
                     /mol_type="genomic DNA"
                     /strain="type strain:CBS 1146"
                     /db_xref="taxon:4950"
                     /chromosome="1"
     gap             1044..1309
                     /estimated_length=266
     gene            complement(<5449..>6897)
                     /gene="TDEL0A00100"
                     /locus_tag="TDEL_0A00100"
                     /db_xref="GeneID:11503165"
     mRNA            complement(<5449..>6897)
                     /gene="TDEL0A00100"
                     /locus_tag="TDEL_0A00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678505.1"
                     /db_xref="GeneID:11503165"
     CDS             complement(5449..6897)
                     /gene="TDEL0A00100"
                     /locus_tag="TDEL_0A00100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678553.1"
                     /db_xref="GeneID:11503165"
                     /db_xref="InterPro:IPR018789"
                     /db_xref="UniProtKB/TrEMBL:G8ZL48"
                     /translation="MLPSLLLCLLGVASAIPMNPNDDNGKTAVSILRRSTSDVSGITK
                     MCPDLNFEWHAMNTNTMPYYMDLLSVVNVDGNVYELTIHVKGKEQIPLKYLWSLKIIG
                     INGPPRVLNNFMVRTKIPIYIDNPTDFTTTSSNLWSNVITVMIVKLPCLPFQIPSMNT
                     YKVMQHNILKVESGVQLLFDLMTGCNADNNGNSNADFPLWYWNNPKCSPSSTTSSSTS
                     SAPSSSTSSVPTSSSSSTPVKPSSSTSSVPTSSSSSTPVKPSSSSSSTPVKPSSSTSS
                     VPTSSSSSTPVKPSSSTSSAPKSFSVSSSHQPSTLPTRNTTSIYPTSSTQTSSVPCET
                     STYITTRNGYPVTETTTYTVPCETSTYITTRNGTPVTETTTYRAPRETTAYVTTNNGV
                     PFTHETTEVVELPTTVGLESTSEGLAFTSSTTQGSVPIKRSMSVEASGSQGAIQSGVG
                     STINSLSIIEGAGHKLNAGITGLLFMASFLLL"
     gene            complement(<9567..>11174)
                     /gene="TDEL0A00110"
                     /locus_tag="TDEL_0A00110"
                     /db_xref="GeneID:11502630"
     mRNA            complement(<9567..>11174)
                     /gene="TDEL0A00110"
                     /locus_tag="TDEL_0A00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678506.1"
                     /db_xref="GeneID:11502630"
     CDS             complement(9567..11174)
                     /gene="TDEL0A00110"
                     /locus_tag="TDEL_0A00110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678554.1"
                     /db_xref="GeneID:11502630"
                     /db_xref="GOA:G8ZL49"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR006589"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR015902"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G8ZL49"
                     /translation="MLAIPGHPETLPTWWKEAIIYHIYPASFKDSNNDGWGDMNGVTS
                     KLEYIKDLGGNAILLCPICDSPQDDMDYDIASYKKVWPTYGSNEDCFNLINKTHELNM
                     KFIIDLIIHPHHCSSEHPWFKESRSSKNNAKRDWFFWRPPKGFDKEGEPIPPDDSKSF
                     FSGSAWTFDEHTQEFYLHLFAETQPDLNWENEECRQAIYEDVISFWLDHGVDGFRIDA
                     GGLHSETQDLPDVSNIISDSKWQPCVVYHSNGPRIHERHPEMNQLMNRLKDGREIVIV
                     GEMAYSTDEDKRLLTSTGRNDMSHQFHFHHIHYGLDPSFRYNLAPTELKYWKLAIQES
                     FKFINGNDAWSTIHMENHNQARSISRFCDDSPKYRAISGKLLQSIPETMTKTPMPWSH
                     EEPNAGFCEPSVRPWLSLNESFRDGIDVENEIKDPQSVLHFWRKALKFRATHKELAVY
                     GYDFEFVDFDNKKLFSFTKKYCHKTLFAALNFSSDEISFEIPNDNLTYSLAFGNYSEE
                     KVDPSLRSLKPWEGRIYIHENFSLLDL"
     gene            complement(16476..16548)
                     /gene="TDEL0Atrna8A"
                     /locus_tag="TDEL_0Atrna8A"
                     /db_xref="GeneID:11502674"
     tRNA            complement(16476..16548)
                     /gene="TDEL0Atrna8A"
                     /locus_tag="TDEL_0Atrna8A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:11502674"
     gene            17478..17582
                     /gene="TDEL0Atrna5Y"
                     /locus_tag="TDEL_0Atrna5Y"
                     /db_xref="GeneID:11503270"
     tRNA            join(17478..17517,17544..17582)
                     /gene="TDEL0Atrna5Y"
                     /locus_tag="TDEL_0Atrna5Y"
                     /product="tRNA-Tyr"
                     /note="codon recognized: UAC"
                     /db_xref="GeneID:11503270"
     gap             17529..17548
                     /estimated_length=20
     gene            18346..18418
                     /gene="TDEL0Atrna4K"
                     /locus_tag="TDEL_0Atrna4K"
                     /db_xref="GeneID:11503180"
     tRNA            18346..18418
                     /gene="TDEL0Atrna4K"
                     /locus_tag="TDEL_0Atrna4K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:11503180"
     gene            complement(<18845..>20452)
                     /gene="TDEL0A00120"
                     /locus_tag="TDEL_0A00120"
                     /db_xref="GeneID:11502558"
     mRNA            complement(<18845..>20452)
                     /gene="TDEL0A00120"
                     /locus_tag="TDEL_0A00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678507.1"
                     /db_xref="GeneID:11502558"
     CDS             complement(18845..20452)
                     /gene="TDEL0A00120"
                     /locus_tag="TDEL_0A00120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678555.1"
                     /db_xref="GeneID:11502558"
                     /db_xref="GOA:G8ZL50"
                     /db_xref="InterPro:IPR020946"
                     /db_xref="UniProtKB/TrEMBL:G8ZL50"
                     /translation="MTQGDKFNIQSVAIIGSGAAGLTTLFELLNTKKEGSTALKYTNN
                     GELDVPALENNDPAFTKLVAFEQTSRVGGIWAPSFDSPDIIPQEALDTEKYNDPFTLK
                     PKTTLPQELGTGDYSQENPLYLKNKNAGFTWNNSGIYRHLYSNVPNRYLRNSFIPYEE
                     KPQHEFSTENVLDPLITNSKVTNRLLQFAEKFHLVDHVRLNSEVVDIRKTSDGKQWKV
                     TVKKTSKNDPNAQWYTEYFDAVIVSTGHYSVPYIPRIKGLSSWNKELPSSLFHSKSFR
                     DPKIFKDKVCLFVGTGLSGIDILQYAFPVAKQVIVSRSVGKEEIYEWLTKAANSDGLI
                     VKPRIKELKPSKQRKVIFEDDSIISGVDYIIFSTGYHWHYPFLNTEDTGVSIVGKNGA
                     SPDGSSMVKGLYRNTFSIKDPTLAFVGVTLTPFKWPSFELEAAAIAGTWTNNGAWPDK
                     QDQVASVQIRVEQTGESILFHYYPVTHFAKYIEEVREFLPKGRDATTIFDADHIDDMY
                     ASMVAAERLFYQLKNGEIPIEDTVGQP"
     gene            complement(<21007..>22545)
                     /gene="TDEL0A00130"
                     /locus_tag="TDEL_0A00130"
                     /db_xref="GeneID:11502716"
     mRNA            complement(<21007..>22545)
                     /gene="TDEL0A00130"
                     /locus_tag="TDEL_0A00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678508.1"
                     /db_xref="GeneID:11502716"
     CDS             complement(21007..22545)
                     /gene="TDEL0A00130"
                     /locus_tag="TDEL_0A00130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678556.1"
                     /db_xref="GeneID:11502716"
                     /db_xref="GOA:G8ZL51"
                     /db_xref="InterPro:IPR011251"
                     /db_xref="InterPro:IPR016215"
                     /db_xref="UniProtKB/TrEMBL:G8ZL51"
                     /translation="MTADNGKRNSSEGNDGTFKRTKTEHHKKKELIINAFLMGSAGNQ
                     TIGNWRHPKDKSTELYQNPEYWTDLAKLLERGKFNTVFLADVLGPYDVYQGGKNFGPV
                     AKTGAQWPISDPSYFIPLMAYVTSKLAFGITISTISEQPYHLARRLGTLDLITNGRVG
                     WNIVTSYLDSASRNLLNGENLPGNKERYERAEEYVDVVLELFLSSWQDGAVKLDRENG
                     VFTDPNGLRHINHVGAYFNVPGPAITPPSQQKLPVIIQAGTSSRGKELAARNAEIIFL
                     ASLTPEDLGKSIRDIKNIAETKYGRDVSKIKFIALVTVILGDTHEEAENKYLEYLQYS
                     DEEGAKAMFSGWTGVDIDKFGDDEVLTNVEHVAIASAVKKWQNAYPRIEKWTKKAIVQ
                     EIKVGGSGPLIIGTAEEVADTIQQWVDISDIDGFNFAYTVLPQTYEEIVDKLLPELRK
                     WGLARRDYPDGDGTSEILTFREQLFGQKTVDITHPAHDLNWTAEESRKEFENRLRNIE
                     SLEK"
     gene            <23016..>24233
                     /gene="TDEL0A00140"
                     /locus_tag="TDEL_0A00140"
                     /db_xref="GeneID:11502721"
     mRNA            <23016..>24233
                     /gene="TDEL0A00140"
                     /locus_tag="TDEL_0A00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678509.1"
                     /db_xref="GeneID:11502721"
     CDS             23016..24233
                     /gene="TDEL0A00140"
                     /locus_tag="TDEL_0A00140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678557.1"
                     /db_xref="GeneID:11502721"
                     /db_xref="GOA:G8ZL52"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZL52"
                     /translation="MLKRSYADSYYLLGEGSQKSIEAAGIFKSRKLSEGEISLIKIPK
                     VQKGLVVSTFERDLAFASDLPVKQHLKEYEILVQNKYVGLNHVDWKSKKYRFNIYSFP
                     WINGRESSGIVIRRGSKVDTQKFPISAEVFLASTSYRDLETSTFQEYTVFDSRLVWKL
                     PQYRLPNGRLHKRFDLEFAAGVGVGLVTAGSAISSLVDLSLRDQADHQKLGNIVIWGG
                     SSSVGLYVIQLAKASKMFEKIVVVSASKHKEYLLELGASCIIDRHQSEEEILDDILSH
                     CPEGIDFGIDVISKETATLLTKILQNNNENVKKLVCIVGVPQIATELFEKNSKSKFII
                     ETVNIKRFHEDVAFGSWFVNYTSRLFETGQLKPITALKIFKSLDNFGEGIKSGLKELE
                     ERGASAEKFVVSL"
     gene            <24714..>26414
                     /gene="TDEL0A00150"
                     /locus_tag="TDEL_0A00150"
                     /db_xref="GeneID:11502757"
     mRNA            <24714..>26414
                     /gene="TDEL0A00150"
                     /locus_tag="TDEL_0A00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678510.1"
                     /db_xref="GeneID:11502757"
     CDS             24714..26414
                     /gene="TDEL0A00150"
                     /locus_tag="TDEL_0A00150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678558.1"
                     /db_xref="GeneID:11502757"
                     /db_xref="GOA:G8ZL53"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZL53"
                     /translation="MTDNKILDEKAVVVDEVSSTSSSGIQAVFQTYQPDDVVLGEVKE
                     IVGKYGLEEYEELLIRGALLANKPEIIENEEYTVEERKAIVRETTHPLLSLSPSMIMA
                     AICTSCAAINFGMDESAVGGAQLQYQKQFNITDPNIQGLTVAAPYLAAAVFGAPLTVF
                     LSSHIGRKWVVLISCFIAFAGSLIQGFANGLPAMLFARLFMGIGMGLNSSTVPIYTAE
                     CSPAVSRGAILMLWQTFIALGVALGSIFNRAFVQINGSLSWRLMIGSASVPPLITGFL
                     IFFPPESPRWLISKGRTRESFDSLIKLRSCALSGAKDFYILYESLKFESELETKLTKW
                     EQFTSLFTVPRNRFALIVSSIGILGQQYGGVNILVSYTTTILTRAGIDPVTAIAGSIG
                     IGGGCFLATFISTQLIDRFGRRKMLLFTLPVEGICLFWLGGVINITNDQVRLGLGLAA
                     MYVYVLFYGTGIGPVSFTLVAETPSITVRMAHSAVCMSLNWILDFCLSMTWPKMDATM
                     TTSGGLYFYGAFNFVVWALSYFCIPETKRFTLEQLDEVFKAGVSPFFQKNLRRLIGKR
                     "
     gene            complement(<26970..>27998)
                     /gene="TDEL0A00160"
                     /locus_tag="TDEL_0A00160"
                     /db_xref="GeneID:11502708"
     mRNA            complement(<26970..>27998)
                     /gene="TDEL0A00160"
                     /locus_tag="TDEL_0A00160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678511.1"
                     /db_xref="GeneID:11502708"
     CDS             complement(26970..27998)
                     /gene="TDEL0A00160"
                     /locus_tag="TDEL_0A00160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678559.1"
                     /db_xref="GeneID:11502708"
                     /db_xref="GOA:G8ZL54"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZL54"
                     /translation="MSTVLVSGANGFIAQHIINVLLKRGYLVIGTLRSEQKAMSLLKL
                     FNHKNLKLEIVSDLAKPGVFDEVLLKYGKDLKYVIHTASPCHYESTDYEIDMLIPAVA
                     GTQSILNSIKKYAPNSIQRVVYTSSFAAISNVKNAYNSSLTLNEESWNEDSWCDTLED
                     AKTAYYGSKVFAEKAAWRFWKDNQNSVNFSLTTINPCYVFGPQLFDESVSSTLNASCQ
                     LINEAVFSKAGDDVDQKFASLFIDVRDVAKAHVLALEKSNLACKRLILANDKFSTQDI
                     LDNINKNFPQLTGKIAKGVPAHGLKVCQYIATVDNSKSKNLLGFGFRSFESAVNDTVS
                     QILRARTT"
     gene            complement(<28512..>30518)
                     /gene="TDEL0A00170"
                     /locus_tag="TDEL_0A00170"
                     /db_xref="GeneID:11502768"
     mRNA            complement(<28512..>30518)
                     /gene="TDEL0A00170"
                     /locus_tag="TDEL_0A00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678512.1"
                     /db_xref="GeneID:11502768"
     CDS             complement(28512..30518)
                     /gene="TDEL0A00170"
                     /locus_tag="TDEL_0A00170"
                     /inference="similar to DNA sequence:INSDC:YJL093C"
                     /note="similar to Saccharomyces cerevisiae TOK1 (YJL093C);
                     ancestral locus Anc_1.273"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678560.1"
                     /db_xref="GeneID:11502768"
                     /db_xref="GOA:G8ZL55"
                     /db_xref="InterPro:IPR003280"
                     /db_xref="InterPro:IPR013099"
                     /db_xref="UniProtKB/TrEMBL:G8ZL55"
                     /translation="MGYASKGNGFVWDVALKESLSLNHERVSIIRCNAGSKYFITWFH
                     ISCYFPVFTACLGPIANTISIACVVERWRLTRIFENGIQTGVHSFKDPVGIFAFNVIS
                     LVLGFMSNLVLLLHFSERLSYLKAQCICILGWTTASFMLLIDVIVCGTRYFDENHEKS
                     IGFWYAVITSGLYFGCTITLTTHFIGYFLGVYPPRFNLIKNERSLMVFTVSFSIILIW
                     GGGMFSKLLHLSFGNSLYFCVVSVLTIGLGDILPSSDATRILILVYSYLGVINLALIV
                     AMTTGIIKNAGSSVVFFHQVEAFREKEVTRLNNHEVTYTSEEAFNKMVEFRKRALSRK
                     RIHSLLSVLFAFIIFWNLGSLALKFAENWSYFDGIYFCFLCLITIGYGDYAPASGAGR
                     AFFVLWALGAVPLMSAIISTVGDILLDLSDSLDLSIANRFRPGLQGIMIYCSRSFQKY
                     VLNTDEILPEDDTDGVDSEENESHNSSSSSDRYPKGATECYSDVGNVAVRGHTESPPK
                     STKFKRKTPWNLPHQFFHRKDDEHLLGRLELFDEMRRLVNALREFRFITRQSKNYSLS
                     YKQWNEVKSLNILTRDPTVANDPSFWLSDHSPLRFPMDQPKFVVIRLLTRMEELFKSF
                     FDDEEAYQMHPTKGGLTNLSTNHQKAGELPNRRSIGQRGRSLSI"
     gene            <31123..>32817
                     /gene="TDEL0A00180"
                     /locus_tag="TDEL_0A00180"
                     /db_xref="GeneID:11502845"
     mRNA            <31123..>32817
                     /gene="TDEL0A00180"
                     /locus_tag="TDEL_0A00180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678513.1"
                     /db_xref="GeneID:11502845"
     CDS             31123..32817
                     /gene="TDEL0A00180"
                     /locus_tag="TDEL_0A00180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678561.1"
                     /db_xref="GeneID:11502845"
                     /db_xref="GOA:G8ZL56"
                     /db_xref="InterPro:IPR002081"
                     /db_xref="InterPro:IPR005101"
                     /db_xref="InterPro:IPR006050"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR018394"
                     /db_xref="UniProtKB/TrEMBL:G8ZL56"
                     /translation="MKRGPVGSPIVKSNKKPKVHGDYEQYMHLNTTYYTHPITCQKAN
                     NFNNQSRKKPVDLLKQLNSKQEKSGGIKTFIHWFRGDLRVHDNRALLEALEQFKKYKE
                     QGPAQFLTIFTINEHDWRAHLDSGWKLKFQLNAVRNLGERLSKMSIPLHVLHFQPEDP
                     LLCSSGEYASWLKSECLKLAKDSGPTLVTANLQYGADEQYRDVKVFERCDAKFKFQVF
                     HDACVIDPGTLATGKGTQYTVFTPWYKKWIAEVQEDLKDSGFVKEEPEKPISDQKVEF
                     KNPDYELPSEFANYIPEGGPEVPEASEKAAFQQLSDFLKGKVHDYEKKDHLPDEGSSH
                     LSCYITSGLISTRVVVKESVKESNGAVAAKDVRKNSPVQEFIREVAWRDFYKHAFSNW
                     PFLSMDIPYHFELNDMNWRDDKEAFISWCEGKTGVPIVDAIMRKLLCTGYINNRARMI
                     TASFMCKNLLLDYRWGERWFRKHLIDFDLASNVGGWGFCSSTGIDSQPYFRILNMELQ
                     SKKFDPKGDYIRKWVPELKDCKDVHTFHLARKGYKSAIVDYKKSREDALAAYREII"
     gene            complement(<33505..>34557)
                     /gene="TDEL0A00190"
                     /locus_tag="TDEL_0A00190"
                     /db_xref="GeneID:11503074"
     mRNA            complement(<33505..>34557)
                     /gene="TDEL0A00190"
                     /locus_tag="TDEL_0A00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678514.1"
                     /db_xref="GeneID:11503074"
     CDS             complement(33505..34557)
                     /gene="TDEL0A00190"
                     /locus_tag="TDEL_0A00190"
                     /inference="similar to DNA sequence:INSDC:YMR315W"
                     /note="similar to Saccharomyces cerevisiae YMR315W;
                     ancestral locus Anc_3.0"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678562.1"
                     /db_xref="GeneID:11503074"
                     /db_xref="GOA:G8ZL57"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR004104"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZL57"
                     /translation="MSTVLNVGIVGTGIFARDRHLPSYQEMPSEFKVVAAFNRTKSKA
                     LDFAKVAGVSEDKVYDDLDGILNDKDVSYVDALLPAQFNLATAQKAIAAGKPILMEKP
                     IAATMEQARGLVKLSDSTDLPIGIAENWLYLSVIDIAKKHLARIGPIVGFTHNSTGPF
                     VTQNKYLATTWRKTPEHIGGFLSDGGVHQLALVTDLVGNFDTVSAQTKQVRKESGTDD
                     IVFSTVKIVDSDVIGTFTYGSAFGATDKSVYLKIYGLNGSVLIQLSDRKKPYVRVQVG
                     GSAETAGKEEIYPVEAEDSFGVNEEFKSFHEAVSNKDKSLYKGSPRVAFHHLACVAAF
                     LESSSKSGDNVKVERI"
     gene            <35387..>35998
                     /gene="TDEL0A00200"
                     /locus_tag="TDEL_0A00200"
                     /db_xref="GeneID:11502794"
     mRNA            <35387..>35998
                     /gene="TDEL0A00200"
                     /locus_tag="TDEL_0A00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678515.1"
                     /db_xref="GeneID:11502794"
     CDS             35387..35998
                     /gene="TDEL0A00200"
                     /locus_tag="TDEL_0A00200"
                     /inference="similar to DNA sequence:INSDC:YOL149W"
                     /note="similar to Saccharomyces cerevisiae DCP1 (YOL149W);
                     ancestral locus Anc_3.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678563.1"
                     /db_xref="GeneID:11502794"
                     /db_xref="InterPro:IPR010334"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G8ZL58"
                     /translation="MTTENDGASAMTMEFYRKALNFNVIGRYDPEIKQLLFHTPHASV
                     YKWDFGKDEWTKLDYQGVLAIYLRDVTGGKDLPPPTDSSEQSVTSAVSQNMDIPACGA
                     TLSGRDIYNYGLIILNRINPDNFSMGIVPNSVVNKRKVFDARENLNNPLECMGVEVKD
                     ELVIIKNLKNEVYGIWIHTVADRQNIYELIKYLLESDPQTSFA"
     gene            complement(<36045..>37739)
                     /gene="TDEL0A00210"
                     /locus_tag="TDEL_0A00210"
                     /db_xref="GeneID:11502950"
     mRNA            complement(<36045..>37739)
                     /gene="TDEL0A00210"
                     /locus_tag="TDEL_0A00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678516.1"
                     /db_xref="GeneID:11502950"
     CDS             complement(36045..37739)
                     /gene="TDEL0A00210"
                     /locus_tag="TDEL_0A00210"
                     /inference="similar to DNA sequence:INSDC:YOL148C"
                     /note="similar to Saccharomyces cerevisiae SPT20
                     (YOL148C); ancestral locus Anc_3.2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678564.1"
                     /db_xref="GeneID:11502950"
                     /db_xref="GOA:G8ZL59"
                     /db_xref="InterPro:IPR021950"
                     /db_xref="UniProtKB/TrEMBL:G8ZL59"
                     /translation="MSSSLYGNGDANNSFGIPVNAGNVGSPGAPVNAQQLQQQRNSKQ
                     RMLLQQRALQQQKHQQAMQNYESQFYQLLMTLNKKPKRIYNFVEDTDQTLKKYEQYRP
                     SFEFHIYENNYKISAPANTRLQQQQKAPELTSDGLILNKNNAVLKNFLEYVARGKIPE
                     SITEVLRDCNIQFYEGNLILQVYDHTNTVDVVSNDQNVQSPQPRNGSLPTKQQDSDVN
                     TVESQSSSDTTDPKKIRSTTFKRPRVYRTLLKPNDLTHYYDMMSYADHTRFSDSIYQQ
                     LESEILSLTKRNLMLDVPLNPYEHRNILEPESFASPHYDNKSNSFVHKHRKECKEPGT
                     KGAVGHIEEHEELPQNSSNYEQMMLIMSERTTTSTNATFAASLTKNAMQAEASQSKLN
                     IGRNSSPTSVSGKSGSRNPSTSRNQVAIAAAAAAAAAGLTVGNENNQFSRLKFIEQWR
                     LNKEKRKQQALNNNIAPNSFNNVISMAAPLTPQQQLLQQQQAMERADQRQGYQADQGV
                     GQQAQGAKKRMNSEKPKPKRPRKTKKADGPEAPPKKKRVTKKKTTDSSPADANESF"
     gene            complement(<37868..>38569)
                     /gene="TDEL0A00220"
                     /locus_tag="TDEL_0A00220"
                     /db_xref="GeneID:11503208"
     mRNA            complement(<37868..>38569)
                     /gene="TDEL0A00220"
                     /locus_tag="TDEL_0A00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678517.1"
                     /db_xref="GeneID:11503208"
     CDS             complement(37868..38569)
                     /gene="TDEL0A00220"
                     /locus_tag="TDEL_0A00220"
                     /inference="similar to DNA sequence:INSDC:YOL147C"
                     /note="similar to Saccharomyces cerevisiae PEX11
                     (YOL147C); ancestral locus Anc_3.3"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678565.1"
                     /db_xref="GeneID:11503208"
                     /db_xref="GOA:G8ZL60"
                     /db_xref="InterPro:IPR008733"
                     /db_xref="UniProtKB/TrEMBL:G8ZL60"
                     /translation="MVCDTVVYHPSVSRLIRFLDSTAGREKVLRLLQYLSRFLAFQQS
                     SVLAKYLQGQFTVVRKILRFLKPLNHLQAASKFYDNKLSGDALVRLCNVIKNLAYAGY
                     LTFDQVNLLRMLRVVPVTDFTGKKAPLWSNWCWFFGLLSGLVMDLRKIQLSQTKIVAL
                     VSEEGKGEKFEQDKLLAKSYEERSTATRRLLWDSIDSFIVLNNLNFLHNQEGYIALAG
                     VATSLLGLQDLWKAA"
     gene            <38780..>39352
                     /gene="TDEL0A00230"
                     /locus_tag="TDEL_0A00230"
                     /db_xref="GeneID:11503151"
     mRNA            <38780..>39352
                     /gene="TDEL0A00230"
                     /locus_tag="TDEL_0A00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678518.1"
                     /db_xref="GeneID:11503151"
     CDS             38780..39352
                     /gene="TDEL0A00230"
                     /locus_tag="TDEL_0A00230"
                     /inference="similar to DNA sequence:INSDC:YOL146W"
                     /note="similar to Saccharomyces cerevisiae PSF3 (YOL146W);
                     ancestral locus Anc_3.4"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678566.1"
                     /db_xref="GeneID:11503151"
                     /db_xref="GOA:G8ZL61"
                     /db_xref="InterPro:IPR010492"
                     /db_xref="InterPro:IPR021151"
                     /db_xref="UniProtKB/TrEMBL:G8ZL61"
                     /translation="MGYYDIDDVLADSVEFPCKFQYFLPGLGYLEGNPGKPIEKNCRL
                     DLPLWLARILAIVGGDEEGQEDEEALPFVELLRPEMFSPKVVNAIKAGASDLDLHTIN
                     AHFYSLAVKWITLFGDEELAGVVSEMVLERSLEMNGHASSVAVQAAGVEAQSSLIGSP
                     FLITMDESEKQLYRLAHDSYKRTKKWIIQT"
     gene            complement(<39383..>42562)
                     /gene="TDEL0A00240"
                     /locus_tag="TDEL_0A00240"
                     /db_xref="GeneID:11502991"
     mRNA            complement(<39383..>42562)
                     /gene="TDEL0A00240"
                     /locus_tag="TDEL_0A00240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678519.1"
                     /db_xref="GeneID:11502991"
     CDS             complement(39383..42562)
                     /gene="TDEL0A00240"
                     /locus_tag="TDEL_0A00240"
                     /inference="similar to DNA sequence:INSDC:YOL145C"
                     /note="similar to Saccharomyces cerevisiae CTR9 (YOL145C);
                     ancestral locus Anc_3.5"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678567.1"
                     /db_xref="GeneID:11502991"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G8ZL62"
                     /translation="MTDAVKSGAYPSMEWPSSLDIPLKASEEVVSIDLETDLPDDPAD
                     LKTLLVEEGSDKEHWLTIAIAYCNHGKTAEGIRLIEMALESFGTTENAALHTFLTWGH
                     LKMAKEHPYDAEVKERELVEAEVHLKSAIGFDPTWVGNMLATIDLYYQRGHYDRALET
                     CELFVKSIYAEDSRNGKTSKQNAFFLFLRAKLLYQKKNYAASLRSFQELLVINPVIQP
                     DPRIGIGLCFWQLKDYKIAIASWKRAHELNPNNQSAAILVLLGDFHESLVTSENDTVF
                     QETYSKVLQNLNGLFSEDRENPVLLTLLEVYFYLKGDYNKVIDIYESKIKGISTTVTS
                     TVLSESLFWCGRAYYALEDYRKAFTMFQQSLKQNEDNMLAKFGVGQTQVKNKLVEESI
                     LTFENLYKNLENIQELNYILGLLYAAKCFDKQSTKVLSRNEALALNEKAVQFLEKYVK
                     LTSSKKNQVVVPRAYLTLSELYEDQNNYKQSLEYLSKAYEQFKALGSKNIPLELLNNL
                     GCFHFINGDLTKAHEFFEDAKARVEQSSGLTIEYNVARTLESVDKSESENIYSGILSS
                     HPGYIDARMRSLLLRFVQDEADISAIENAVTKFYKENDSNLEVRSFYSWFLKKGKKEK
                     RNDSLETAHNKETLTKYDSHDLYALISLGNLYSVIGRGERKSSKPKEQENAKQSFLKA
                     VQLFQKVLQIDPYNVFAAQGIAIVFAENKRMGPALEIFRKLRDSLDNEDVYCNIAHCL
                     LEMHENAKAVETYEYTLKRFSNAQNRSRLLNLLGKAWYSRGVREKSYEFFQKALKNAE
                     MALKCEEDNKSSERTIASFQYNVALLHFQIAETLRRATFKQRKVVYITDAISGLQSGL
                     DILKELQKSKNFNIIPEEELEQRIQLGETTMKSALERIAKEQEEFELEQSNKLDEARK
                     ILEENEIERQEKQKKEEEIRQMKLEKQKEEYRKLQDEAQRLIQERESMITAEDEKDEL
                     SENEAENGEDGKKTKKKRKAKKPAGEKKRRRKDEPAEPPKKEEEDDEEDANVQSGRRN
                     KKNALSNEFIDDSDEEEAVPSGEDENDLF"
     gene            <42761..>44164
                     /gene="TDEL0A00250"
                     /locus_tag="TDEL_0A00250"
                     /db_xref="GeneID:11503245"
     mRNA            <42761..>44164
                     /gene="TDEL0A00250"
                     /locus_tag="TDEL_0A00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678520.1"
                     /db_xref="GeneID:11503245"
     CDS             42761..44164
                     /gene="TDEL0A00250"
                     /locus_tag="TDEL_0A00250"
                     /inference="similar to DNA sequence:INSDC:YOL144W"
                     /note="similar to Saccharomyces cerevisiae NOP8 (YOL144W);
                     ancestral locus Anc_3.6"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678568.1"
                     /db_xref="GeneID:11503245"
                     /db_xref="GOA:G8ZL63"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8ZL63"
                     /translation="MSAVTRRLYVGNVFQDTDVCLEELYNRFAKFGRCLSEDFEKHGT
                     FAYINMEFDDEAQFHRLRNSFNNVKFKGNELRVNVAKPDWKTAWEIKHKQDEEQRQTL
                     NAVTEKRNWEHFKKIENIEMSWEDRKNVIPGRVRKSPRSKVQMRNITFRLNVNGSLKV
                     YKCYKTKLWGYEREKDVKDLVSKFVNNKWRNGEDHIVDRLDYSRAKRSVGSMVEDDSP
                     EQHEDAEVIDEKEEMNKVKNVLAGVLDEFEFDKPLQLSDDEGNEIPLYQKSKIQDVNA
                     DADEESMLPNNKEPDQANEDDEEQEEEDEAEDEDEDEPIPTFTNGPSAETPPNDGTVS
                     NTGTLRSLFNPEGTEPTSSFKLIAESDEDIDHQMDEEVEQVTVTTQEIQQMERPVQNK
                     EKHHLFFPHFDSPFMVGQTMLSKLKTSDVMEKLTDWEDRFWENRGDWTKELKRRRRDA
                     LRHLNKRKAGKGSGLLL"
     gene            complement(<44208..>44711)
                     /gene="TDEL0A00260"
                     /locus_tag="TDEL_0A00260"
                     /db_xref="GeneID:11502789"
     mRNA            complement(<44208..>44711)
                     /gene="TDEL0A00260"
                     /locus_tag="TDEL_0A00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678521.1"
                     /db_xref="GeneID:11502789"
     CDS             complement(44208..44711)
                     /gene="TDEL0A00260"
                     /locus_tag="TDEL_0A00260"
                     /inference="similar to DNA sequence:INSDC:YOL143C"
                     /note="similar to Saccharomyces cerevisiae RIB4 (YOL143C);
                     ancestral locus Anc_3.7"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678569.1"
                     /db_xref="GeneID:11502789"
                     /db_xref="GOA:G8ZL64"
                     /db_xref="InterPro:IPR002180"
                     /db_xref="UniProtKB/TrEMBL:G8ZL64"
                     /translation="MAIGGLGQLDQEYDGSELKVLIIHARWNREIIDALVEGAVKRMT
                     GLGVKKSNITIETVPGSFELPYACRVMGKSQLYDAIIPIGVLIKGSTMHFEYIADSTT
                     KELMSLQEKINTPIIFGLLTCMTEEQALARAGIDEGHTMHNHGEDWGAAAVEMGIKYG
                     RCPQHSR"
     gene            complement(<44950..>46251)
                     /gene="TDEL0A00270"
                     /locus_tag="TDEL_0A00270"
                     /db_xref="GeneID:11503093"
     mRNA            complement(<44950..>46251)
                     /gene="TDEL0A00270"
                     /locus_tag="TDEL_0A00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678522.1"
                     /db_xref="GeneID:11503093"
     CDS             complement(44950..46251)
                     /gene="TDEL0A00270"
                     /locus_tag="TDEL_0A00270"
                     /inference="similar to DNA sequence:INSDC:YNL330C"
                     /note="similar to Saccharomyces cerevisiae RPD3 (YNL330C);
                     ancestral locus Anc_3.8"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678570.1"
                     /db_xref="GeneID:11503093"
                     /db_xref="GOA:G8ZL65"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR003084"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:G8ZL65"
                     /translation="MVYEAKPFDPITVKPNEKRRVAYFYDADVGNFSYGQYHPMKPHR
                     IRMAHSLIMNYGLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESV
                     KFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKCDVAINYAGGLHHAKKAEASGF
                     CYLNDIVLGIIELLRYHPRVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGT
                     GELRDIGVGSGKYYAVNVPLRDGIDDATFRNVFEPVVGKIMEWYQPAAVVLQCGGDSL
                     SGDRLGCFNLSMRGHANCVNYVKSFGIPMMVVGGGGYTMRNVARTWCFETGLLNNVIL
                     DSELPYNDYYEYYGPDYKLDVRPSNMYNVNTPEYLDKIVRSIFENLENTKYAPSVQLN
                     NVPKDPEDLGDVAEDTAQAKDTKGGSQYARDQQIEQDNEFY"
     gene            complement(<46558..>49620)
                     /gene="TDEL0A00280"
                     /locus_tag="TDEL_0A00280"
                     /db_xref="GeneID:11502967"
     mRNA            complement(<46558..>49620)
                     /gene="TDEL0A00280"
                     /locus_tag="TDEL_0A00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678523.1"
                     /db_xref="GeneID:11502967"
     CDS             complement(46558..49620)
                     /gene="TDEL0A00280"
                     /locus_tag="TDEL_0A00280"
                     /inference="similar to DNA sequence:INSDC:YNL329C"
                     /note="similar to Saccharomyces cerevisiae PEX6 (YNL329C);
                     ancestral locus Anc_3.9"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678571.1"
                     /db_xref="GeneID:11502967"
                     /db_xref="GOA:G8ZL66"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZL66"
                     /translation="MKVGLQFNFLPRCNSCEVSLNIWEEWKGHKGPRYASIRLQSYDS
                     PVPKAIISECTLNESLAFDSIKVAAKLYNVSPVGPTASQCELEILKQKLPVFKSVTML
                     LKAPLYTKLMQLPHPSHRVEFLELKYGLHHRETVIYDGYVVEPSWCRVSYCGPYSEGL
                     IDFKETQVVFVKDDRDILVEKVVSDHFDEILKLTEASHSSVKLSALQNSVPLDLISPT
                     TAMNDDDSTFVFADFRTLLFLGVTSGSFIRISNEHISRVVKVFILNAPHNFESFTIYA
                     SPRIIASFPEDTEISASKHPVDEFQLPTAFSVSLARVGSWNQAQKIYQNIILHNLKNF
                     FTSKRRVLHVGDMIPISFDSNLATLYTEEFGFEQLIEEHDSLVWFYVESVQINETDEI
                     SPETEFFIDPEKTKLITANVVMKDPLKLTRCDYISFYGLDPVFVYNLNKFPYAKKLID
                     ILNASTRCESKGIAVSTTILLYSTSPNTGKSTLVRFAALQLGFNLLHVDCMSLTTNAG
                     SQDATAKIVGYLRGKIESVLSHASPAIIYLSHLDVLLAKTDQNQDPEGSRAPRSMDLE
                     VSKLIEDFTVEYKGTVFIGSATEIDNISTSVRNHIKFELEVQVPDEIQRGAFFQWFLS
                     CSILNRGLKNSYRRYAVKSDVSLSKLSLQSAGLSPLDIRTIVETAKYNCAKRYVDGNQ
                     WASSAYSITMADLNSAISKARDDFSVSIGAPKIPNVTWDDIGGMDQVKGEIMDTIDMP
                     LKHPELFASGMKKRSGVLFYGPPGTGKTLMAKAIATNFSLNFFSVKGPELLNMYIGES
                     EANVRRVFQKARDAKPCVIFFDELDSVAPKRGNQGDSGGVMDRIVSQLLAELDGMGSS
                     GDGVFVIGATNRPDLLDEALLRPGRFDKLLYLGISDTNEKQHNIISALTRKFNLESDV
                     NLMKLAEKCPFNYTGADFYALCSDAMLNAMTRTAGEIDVKVEEYNKLTRLDLSVTHWF
                     DKVATAKDTEVTVKMEDFLKAQQEMAPSVSEEELRHYLRVKANFENAA"
     gene            complement(<50116..>50550)
                     /gene="TDEL0A00290"
                     /locus_tag="TDEL_0A00290"
                     /db_xref="GeneID:11502970"
     mRNA            complement(<50116..>50550)
                     /gene="TDEL0A00290"
                     /locus_tag="TDEL_0A00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678524.1"
                     /db_xref="GeneID:11502970"
     CDS             complement(50116..50550)
                     /gene="TDEL0A00290"
                     /locus_tag="TDEL_0A00290"
                     /inference="similar to DNA sequence:INSDC:YNL328C"
                     /note="similar to Saccharomyces cerevisiae MDJ2 (YNL328C);
                     ancestral locus Anc_3.10"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678572.1"
                     /db_xref="GeneID:11502970"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:G8ZL67"
                     /translation="MVLPIIIGLGVTIVALTARSGIRAWEAYKLLSPMAIARMNNIKL
                     RAKPYPYNSKFQQGRLNESLKARLEEYRGGFHGKMTESEALLILNISPEEIESLDDKM
                     LKRKYRMIMLQNHPDKGGSPYLAMKLNEAREVLEHSVMLRRR"
     gene            <51773..>53908
                     /gene="TDEL0A00300"
                     /locus_tag="TDEL_0A00300"
                     /db_xref="GeneID:11503103"
     mRNA            <51773..>53908
                     /gene="TDEL0A00300"
                     /locus_tag="TDEL_0A00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678525.1"
                     /db_xref="GeneID:11503103"
     CDS             51773..53908
                     /gene="TDEL0A00300"
                     /locus_tag="TDEL_0A00300"
                     /inference="similar to DNA sequence:INSDC:YNL327W"
                     /note="similar to Saccharomyces cerevisiae EGT2 (YNL327W);
                     ancestral locus Anc_3.11"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678573.1"
                     /db_xref="GeneID:11503103"
                     /db_xref="UniProtKB/TrEMBL:G8ZL68"
                     /translation="MASLFRFLIGSLISLAFLTTVTAAGKHEPFFMNVELSDAYTGTT
                     NCTDKNHWFLITADVFLPQGSSDDIYLTVPDDFSSLPNGSFSLKYNSKTMGSVFINGS
                     NVLKISPEGKAASNVTASFDFLAQLTTDAKKQIQSPGKIDYTFEVSTGSDFTTSINYV
                     AQDLQALTSNGGINADNSTAWFTADIPVSMLNRPLYFTSQEAANTTYQFNTALTSAEI
                     VVAVDAFNQPTRSFSFSAFKDLSDSSQIKLLFNTTINGGKYIRVNFFTNVLNTASIGN
                     TVSLDYANQLSKRNAITVTSNLYSSSQSNVQNQDSDESSNNLASSTATQETYETYYLE
                     STTEPGVYTEIGTWIPISTLSSHIATTSATSSVLDSLNSISSPSISTSFVSSTPVTTS
                     LLAANSSTSYTATKTKAAPGKLLLGSKSNSSEEYLTYSVITTTINGEVITLTSLTPIS
                     TLSSVMPSTQGFYLNKTASSQSTFLTAAEDSIITKSKSALSSDSATSTSVSAISSSLQ
                     TKFNNSTTTSTESHGTTTIASSKSTSVEVDSYKTYAVITKDDSGAFTTYTSVRALSTL
                     SSSSVPASSQVVVTKDKGDFTTYASGYPLTTLNSGSASRANIISSSSRGAFTKDDSES
                     FTSYSKSPTAPTTSPSSTSAISSRVASSTVLTNSVMNSTSSLWIQTQLTSTGDLQTSH
                     SVLMYQDGGARASAGFGGLLVSFVLLWIL"
     gene            complement(<54006..>54995)
                     /gene="TDEL0A00310"
                     /locus_tag="TDEL_0A00310"
                     /db_xref="GeneID:11503104"
     mRNA            complement(<54006..>54995)
                     /gene="TDEL0A00310"
                     /locus_tag="TDEL_0A00310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678526.1"
                     /db_xref="GeneID:11503104"
     CDS             complement(54006..54995)
                     /gene="TDEL0A00310"
                     /locus_tag="TDEL_0A00310"
                     /inference="similar to DNA sequence:INSDC:YNL326C"
                     /note="similar to Saccharomyces cerevisiae PFA3 (YNL326C);
                     ancestral locus Anc_3.12"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678574.1"
                     /db_xref="GeneID:11503104"
                     /db_xref="GOA:G8ZL69"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:G8ZL69"
                     /translation="MCFTGHCSITTIFPRTLVVVLYSWTAYVTCTRVDQVSPVVVRSP
                     VLSTLVLGLYTYYKLISEGPGSPLEYSELVVRDVAAAENGTELPPEFLSRRSITSKRD
                     GRFRLCRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLMYATL
                     YAFNVLIFDTIQLYIWFHQGDYERQLIDLVLFSVWLLAFAVSIALSCFTGFSIYQVAH
                     NQTTIELHIQGRYREELDILGESRRDDATDNVFDLGSSSKNWMDVMGTTVFEWLLPIP
                     TSKRIRNRHSLDQKGLYFDFRSDVSERLLDSMDLQDRLLRRVTPRSSMERGLI"
     gene            <55178..>55894
                     /gene="TDEL0A00320"
                     /locus_tag="TDEL_0A00320"
                     /db_xref="GeneID:11503107"
     mRNA            <55178..>55894
                     /gene="TDEL0A00320"
                     /locus_tag="TDEL_0A00320"
                     /product="exosome complex component RRP40"
                     /transcript_id="XM_003678527.1"
                     /db_xref="GeneID:11503107"
     CDS             55178..55894
                     /gene="TDEL0A00320"
                     /locus_tag="TDEL_0A00320"
                     /inference="similar to DNA sequence:INSDC:YOL142W"
                     /note="similar to Saccharomyces cerevisiae RRP40
                     (YOL142W); ancestral locus Anc_3.13"
                     /codon_start=1
                     /product="exosome complex component RRP40"
                     /protein_id="XP_003678575.1"
                     /db_xref="GeneID:11503107"
                     /db_xref="GOA:G8ZL70"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR026699"
                     /db_xref="UniProtKB/TrEMBL:G8ZL70"
                     /translation="MSTLIFPGDQLNIDSEQPTTLGPGLYFDPVTQEIGPTNAGVEVI
                     ANTKRGQTVYVDYDSKRYIPAVGDYVIGIIVGQFSDSYKVSLSSFSSSVTLSYMAFPN
                     ASKKNKPTLKVGDLVYARVCAAEKELEAEIECLDSTTGQDAGFGLLEGGIVIDVTLGF
                     ARHLLFDKDFPLLKILSSFTQFEVAIGVNGKIWVKCEEVKNTLACYRSIIDCQKTSVS
                     EYKNTIKSHFKNIVDAAGGK"
     gene            complement(<55967..>58552)
                     /gene="TDEL0A00330"
                     /locus_tag="TDEL_0A00330"
                     /db_xref="GeneID:11502954"
     mRNA            complement(<55967..>58552)
                     /gene="TDEL0A00330"
                     /locus_tag="TDEL_0A00330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678528.1"
                     /db_xref="GeneID:11502954"
     CDS             complement(55967..58552)
                     /gene="TDEL0A00330"
                     /locus_tag="TDEL_0A00330"
                     /inference="similar to DNA sequence:INSDC:YNL325C"
                     /note="similar to Saccharomyces cerevisiae FIG4 (YNL325C);
                     ancestral locus Anc_3.14"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678576.1"
                     /db_xref="GeneID:11502954"
                     /db_xref="GOA:G8ZL71"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="UniProtKB/TrEMBL:G8ZL71"
                     /translation="MIPESIEDGAHVEGAGSPEAFNEMSLSNEAPKQRRTTKFILSKY
                     TIYETKERMYIVGSNKRETMFRILEIDLSVPQDRLSVLEDNVFFTRNEIMNVLSGLEE
                     ASEEGLNKKLTGYGLMGFIRFTTCYYLIVVQKCSQVAVLAGRSIFHIDGTALVPISNN
                     YRKPDKYSAEARLMSTFQSLDLTKTFYFSNTYDITNTLQTNLLREKLKAVGRSDISVP
                     NGIPDYNEMFMWNNNLLEAVLPCIDTVYDWFRPIVHGFIDQVDVSVLGKSIYITLVAR
                     RSHQFAGARFLKRGVNKQGYVANEVETEQIVTDMLLTGFHRPGNGYFDSDRYTSFVQH
                     RGSIPLYWTQEASNLTGKPPIQVTAVDPFFSSAAMHFDMLFQRYGKVQVLNLIKTKEK
                     TPRETKLLREFEQCITYLNQFLPENKKIQYTSWDMSRASKQDGQGVIEFLEKYAAETV
                     STTGIFHNGANFKVTKIQEGVCRSNCIDCLDRTNAAQFVVGKRALGVQLKSLGIIDNS
                     YLEYDSDIINILTELFHDLGDTIALQYGGSHLVNTMETYRKINQWSSHSRDMIESIKR
                     FYSNSFVDAQRQDAINLFLGHYVWKKGYPALWEMNTDIYLHNEYVSHGPKRSYTHWWN
                     NYHIISISDMLKEEIIDQNKDVSLRDVMRNIRGYPGAFDNYWNEYYLPRSLTWMPDLF
                     AYNMNSTRRYHAARGENKDLSPFASRKQSWLNNKLRAITIKGDEHPKAESTSTTQETE
                     LEYEDDLRLSSYQLKKVLAKDAAIKRSLAIAERNDKVPLPLEDSMSNDSEITAIENEE
                     EMRDRDTPLDCVSQLDDVITYSDYYVDIDIDVEYYTNIMKVDSYQPSEDYQDMITREK
                     VTVKQ"
     gene            <58839..>60872
                     /gene="TDEL0A00340"
                     /locus_tag="TDEL_0A00340"
                     /db_xref="GeneID:11503247"
     mRNA            <58839..>60872
                     /gene="TDEL0A00340"
                     /locus_tag="TDEL_0A00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678529.1"
                     /db_xref="GeneID:11503247"
     CDS             58839..60872
                     /gene="TDEL0A00340"
                     /locus_tag="TDEL_0A00340"
                     /inference="similar to DNA sequence:INSDC:YOL141W"
                     /note="similar to Saccharomyces cerevisiae PPM2 (YOL141W);
                     ancestral locus Anc_3.15"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678577.1"
                     /db_xref="GeneID:11503247"
                     /db_xref="GOA:G8ZL72"
                     /db_xref="InterPro:IPR007213"
                     /db_xref="InterPro:IPR011043"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZL72"
                     /translation="MTTELTPRQLKQLEKQNRRKKYADLAIQGTNNSSIASKRSVEVL
                     YLSKLSENDRSTQANEYFKYFVKKTPKRSPCINRGYWLRLHAIRSRLDSIVEATQKKI
                     VVVNLGCGFDPLPFQLLDPNNEASRKYSGRVRFLDLDYPDLISKKVQIIKQNDELTNI
                     LGPECDELSDAVKFGTVNYIAAPCNLNYLETFKKDIVPFGLDDPELIKVFVAEVSLAY
                     MKPERADDIIKLCGELPNSHFLMLEQLIPEGENEPFSKQMLKHFRKNDSPLLSVLQYK
                     TLQSQRERFSKLGFPNINAGDMFKLWESVDVEQRLKVKYLELFDELEEFHLFCHHYII
                     CHATNDTGFAFDGTYKFTPSKSIRSLEILTEAKFQILESSLARKFGAAAQDKLVLYFG
                     GSSPARLNELIEVDVDTGNYIPLDTGEAPPVRMCHTLTSLGSSQEFMMIGGRQSPKDG
                     YTDTWVFNMGSNLWRQGPSLPESRYRHAACLIENQILVFGGSTTGSPFLTYDPVQQTF
                     ETPDHNLDLDRPLISAAMDYNHEAQVGVIVGGSFDETLVSDALYTFSYNGNTVKIKNS
                     LKHPLLQRYGAKVKFINNHTLMLVGGTSPEMLFGQETSIVIIDIKSGKICGLKIHPDI
                     WDDHPLFLVGFELVQISLDEFLVIGGGATCYGFGAVANKSFKISISNILNGLD"
     gene            <61099..>62337
                     /gene="TDEL0A00350"
                     /locus_tag="TDEL_0A00350"
                     /db_xref="GeneID:11502966"
     mRNA            <61099..>62337
                     /gene="TDEL0A00350"
                     /locus_tag="TDEL_0A00350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678530.1"
                     /db_xref="GeneID:11502966"
     CDS             61099..62337
                     /gene="TDEL0A00350"
                     /locus_tag="TDEL_0A00350"
                     /inference="similar to DNA sequence:INSDC:YNL323W"
                     /note="similar to Saccharomyces cerevisiae LEM3 (YNL323W);
                     ancestral locus Anc_3.16"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678578.1"
                     /db_xref="GeneID:11502966"
                     /db_xref="GOA:G8ZL73"
                     /db_xref="InterPro:IPR005045"
                     /db_xref="UniProtKB/TrEMBL:G8ZL73"
                     /translation="MVNFDLSRVGVFRKKDQEHKDVDVPEEDDVDASEFEDEEVQPKK
                     VKTRRPLDTEFSQQRLKSWNPVPSPKNVFLLYLLVAAVFVIVGGCLLSVASKVSELTV
                     YYQDCKDKAPTGDDWEDMPSDHYSMIFTKHKDFSTAPQWRYVADPDDQDEESGTCQLR
                     FTTPQEIPKDVYVNYLIENFAANHRKYVLSFNEDQIKGIAASRSDLEDNVGINCKILG
                     HNGDGKLYYPCGLIANSMFNDTFPFELSNVQDSNNNYPLSNSNINWHTDRTRYRKTKY
                     NHTDIVPPPFWARQFPDGYNETNIPNIHEWEEFQNWMRPAALHKFSKLIRRNSNDSLQ
                     AGTYQIDIGLHWPTTMYNGKKAVYITHGSSIGSRNYFLGTVYLIGGCICVAFAIVLLG
                     FWMISGRKFADPAQLSWEQK"
     gene            <62714..>63985
                     /gene="TDEL0A00360"
                     /locus_tag="TDEL_0A00360"
                     /db_xref="GeneID:11502626"
     mRNA            <62714..>63985
                     /gene="TDEL0A00360"
                     /locus_tag="TDEL_0A00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678531.1"
                     /db_xref="GeneID:11502626"
     CDS             62714..63985
                     /gene="TDEL0A00360"
                     /locus_tag="TDEL_0A00360"
                     /inference="similar to DNA sequence:INSDC:YOL140W"
                     /note="similar to Saccharomyces cerevisiae ARG8 (YOL140W);
                     ancestral locus Anc_3.17"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678579.1"
                     /db_xref="GeneID:11502626"
                     /db_xref="GOA:G8ZL74"
                     /db_xref="InterPro:IPR004636"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8ZL74"
                     /translation="MLKRFLSSTASRRVANVLDEKIYQVTTYARPDDLCITRGQNAKL
                     YDDLNGKEYIDFTAGIAVTALGHSNPKVAEILYKQANKLVHSSNLYYNKECLDLSANL
                     IKKTKQLGGQFDASKVFLCNSGTEANEAALKFAKKHGITINPKKQGIIAFQNSFHGRT
                     MGALSVTSNPKYRTPFGDLIPNVSFLNVNDELTKLKDYISSNKNELAGLIVEPIQGEG
                     GIFPIPSEKLTGLTQICKDNDVIVIYDEIQCGLGRTGKFWAHAHLPKEAHPDIFTSAK
                     ALGNGFPIAATVVNEKVNNALKVGDHGTTYGGNPLGSAVGNYVLDVIGDEKFLKQVEA
                     KGKILEAGLRELQKKFPEQIKDIRGQGLIIGAEFAEPPTEVIKKARDLGLLVITAGKS
                     TARFVPALTIEDETIHEGLKIFEKAVESVYK"
     gene            complement(<64068..>65102)
                     /gene="TDEL0A00370"
                     /locus_tag="TDEL_0A00370"
                     /db_xref="GeneID:11502974"
     mRNA            complement(<64068..>65102)
                     /gene="TDEL0A00370"
                     /locus_tag="TDEL_0A00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678532.1"
                     /db_xref="GeneID:11502974"
     CDS             complement(64068..65102)
                     /gene="TDEL0A00370"
                     /locus_tag="TDEL_0A00370"
                     /inference="similar to DNA sequence:INSDC:YNL322C"
                     /note="similar to Saccharomyces cerevisiae KRE1 (YNL322C);
                     ancestral locus Anc_3.18"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678580.1"
                     /db_xref="GeneID:11502974"
                     /db_xref="UniProtKB/TrEMBL:G8ZL75"
                     /translation="MWATLSIVWLLFLRLTAAVVTTSLVTTTDANGLALTRTSVFDPA
                     TLAAAATPITTVITTTNVAGVLVTLTQTTTPTGTTGTTTGTGTTTTAATAATGTTPVT
                     SVITTTNAAGATITSTTVITPTGTATGTTTGTATGTGLTTSLITTTNAAGATVTSTTV
                     ITPGTTNTGVTTTGATATGLTTSVFTTTNAAGVTLTSTTVFSPTATVSSSTTKAAAYD
                     GTRPDPSTAFTSPPLTPVTTLSMDTLITVTEGTTKTYTSSREKTSNLWVTIVTNGNTV
                     VVQTTFAQRFTSQYDTVASPSSGSVGLGTISGTIGRVRTDMQSTVSGNAAVFGTSFFV
                     SMLAFVAMFL"
     gene            <66253..>69069
                     /gene="TDEL0A00380"
                     /locus_tag="TDEL_0A00380"
                     /db_xref="GeneID:11503133"
     mRNA            <66253..>69069
                     /gene="TDEL0A00380"
                     /locus_tag="TDEL_0A00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678533.1"
                     /db_xref="GeneID:11503133"
     CDS             66253..69069
                     /gene="TDEL0A00380"
                     /locus_tag="TDEL_0A00380"
                     /inference="similar to DNA sequence:INSDC:YNL321W"
                     /note="similar to Saccharomyces cerevisiae VNX1 (YNL321W);
                     ancestral locus Anc_3.19"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678581.1"
                     /db_xref="GeneID:11503133"
                     /db_xref="GOA:G8ZL76"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="InterPro:IPR005185"
                     /db_xref="UniProtKB/TrEMBL:G8ZL76"
                     /translation="MPKDNPLHSLHSDGTMASNNTPDHVYRVFSVDDDPDEIEHDVRY
                     LEGLHDGLKYALHSSKSKTVSGPGPDASSSQNKPELKLKNKSKSRAKQSNNSSPRLKK
                     PALENHSSKQNFPSRGTPQDASNIDSNTDSGKFVIHDHVSGRGHDLIFEDRDVDEEQG
                     LDHDRNSTASSIESYTLRERQDAINETHPFGIRIWKPALYKKQRSVQKVAAEDIHETR
                     LKKISWLVHLSNILWSLTCGAILFLLMNTAGILVYVFGIFTRSSREYALLLFNLGQYL
                     LWPFGKVVYLTRDEHYMQEDKDEGISSQQFYDWVTSYSNRLFFHQSQTEGEDASISKH
                     NSLQHPSYGSVRQHLGASHEQPPSIQGVSTEPSGDQNDDSHRASTGAAAQRRYFGRGK
                     WTWGRVVFYACFHVVVQPIVFVLCLLTWLPVFTIPMSNILWNLMYHCRRHPLALGFKY
                     IKNTSAQDDSIVKEQAGKNILLCTFRCAGWHYYKFTVDGTNVIVVNLMSLVLFTICDF
                     YLFKNAWGVATWLTHETTIFTLCLASIIPLAFYIGQAVASISAQTSMGVGAVINAIFS
                     TVVEIFLYCVALKQSKGLLVEGSMIGSILGAVLLLPGLSMCGGALNRKTQRYNPASAG
                     VSSTMLIFSMIVMFVPTIFYEIYGGYIVRCENEVDLPLNLMNVAKVFSSQRCYLSHPP
                     LEHTKMYVHVIEPMSISCAVVLFLAYIIGLWFTLRTHAVMIWQLPISEQSKELSSSRT
                     LENNAEVQQVADDDDNGGHEAPNWSRNKSTCILLVATLLYAVIAEILVSCVDTVLEDV
                     PSLNPKFLGLTIFALVPNTTEFLNAISFAIHGNVALSMEIGSAYALQVCLLQIPALVL
                     YSVIYTWRMDFSEISIRDSMFSLVFPKWDLIASMASVFLFTYLYAEGKSNYFKGSMLI
                     LLYIITVLGFYFQGIIDGWNTISV"
     gene            complement(<69159..>69794)
                     /gene="TDEL0A00390"
                     /locus_tag="TDEL_0A00390"
                     /db_xref="GeneID:11502761"
     mRNA            complement(<69159..>69794)
                     /gene="TDEL0A00390"
                     /locus_tag="TDEL_0A00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678534.1"
                     /db_xref="GeneID:11502761"
     CDS             complement(69159..69794)
                     /gene="TDEL0A00390"
                     /locus_tag="TDEL_0A00390"
                     /inference="similar to DNA sequence:INSDC:YOL139C"
                     /note="similar to Saccharomyces cerevisiae CDC33
                     (YOL139C); ancestral locus Anc_3.20"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678582.1"
                     /db_xref="GeneID:11502761"
                     /db_xref="GOA:G8ZL77"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="InterPro:IPR019770"
                     /db_xref="InterPro:IPR023398"
                     /db_xref="UniProtKB/TrEMBL:G8ZL77"
                     /translation="MSVEEVSQKFEETVSVSDNNEPKSVLSDSQFDVKHPLNTKWTLW
                     YTKPAVEQSESWSDLLRPVTSFETVEEFWAIVQNIPEPHELPLKSDYHAFRNDIRPEW
                     EDEANAKGGKWSYQVKAKRADIDELWLRTLLAVIGETIDEDDSQINGVVLNVRKGGYK
                     FALWTKSEDKDPLCNIGARFKQVLKLGDDDHIEFFPHSAANAKHHQPSITL"
     gene            <70059..>70919
                     /gene="TDEL0A00400"
                     /locus_tag="TDEL_0A00400"
                     /db_xref="GeneID:11503138"
     mRNA            <70059..>70919
                     /gene="TDEL0A00400"
                     /locus_tag="TDEL_0A00400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678535.1"
                     /db_xref="GeneID:11503138"
     CDS             70059..70919
                     /gene="TDEL0A00400"
                     /locus_tag="TDEL_0A00400"
                     /inference="similar to DNA sequence:INSDC:YNL320W"
                     /note="similar to Saccharomyces cerevisiae YNL320W;
                     ancestral locus Anc_3.21"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678583.1"
                     /db_xref="GeneID:11503138"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR029059"
                     /db_xref="UniProtKB/TrEMBL:G8ZL78"
                     /translation="MLWRVLKMFVEGVAAMASVSLTALYFMQNRLIYPSWAQGARDQV
                     DTPASYGLPYRLVQLTTSDGIKIEAYDMQNTSGGSESTVLILCPNAGNIGYFIPIADI
                     FYRQLNMSVFLYSYRGYGHSEGSPSENGLKLDADCVMAHLSQDSFHKKNKLVLYGRSL
                     GGANAIYIASKFANLCDAVILENTFLSIPKVVPYVFPALKYFRGMVHEIWNSEELIKG
                     CDDTLPFLFLRGLKDEIVPPSHMRKLYDECPSRNKQVFEFPLGTHNDTIIQEGYWSMV
                     RDFLEEFGLI"
     gene            complement(<70940..>74728)
                     /gene="TDEL0A00410"
                     /locus_tag="TDEL_0A00410"
                     /db_xref="GeneID:11503149"
     mRNA            complement(<70940..>74728)
                     /gene="TDEL0A00410"
                     /locus_tag="TDEL_0A00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678536.1"
                     /db_xref="GeneID:11503149"
     CDS             complement(70940..74728)
                     /gene="TDEL0A00410"
                     /locus_tag="TDEL_0A00410"
                     /inference="similar to DNA sequence:INSDC:YOL138C"
                     /note="similar to Saccharomyces cerevisiae YOL138C;
                     ancestral locus Anc_3.22"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678584.1"
                     /db_xref="GeneID:11503149"
                     /db_xref="GOA:G8ZL79"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8ZL79"
                     /translation="MSSTSIPRGQSSTSFSKSDFKPLSVGRSSFRVHDYPNNTQVSSI
                     GSSPRSRPTPRYSFNTVSSLHDGSLRESPYSEQTHSERATGQRKRRFPTVPKSSGPIY
                     STQARKELTSIDRINDSASNSLVCAGKSHLGLYKFNPDKKSIKCVHDFMAVGNGQSNS
                     LSPNFKKRNKQIKLSTIADVKTGFHNHKNYVAVCSSSTAISVFDMNRTGSSESSFVTA
                     LSEHTRSINSFDFNTVQTNLIISGGQDSCIKVWDLRSSNAKNSKNCDLSINTASDSIR
                     DVKWMPFQNYAFNHQQEFKNGSNAGFKFASIHYSGLLLNFDLRQPGQIEKRINAHSGP
                     GLCLSWHPNLEYIATGGRDGKCGLWYVGDRQQYENACGTPSSNLYGHSAHANLAALPE
                     TTLSTGLPVTKLKFRPAYEKNVFNSLLALSPMTDDAALNIYSLARKYIPKHVLLKSTQ
                     TLGLVWWDEELIFDIDKENNINGWDIAHEPTILDNLPKTVTRWRDIEGNGLLFVDQNC
                     GSYDLNQNQLIMPEDSKKVANHRISMSSLSANNGGSTTGLINNLKKGISHSTLSSYNG
                     DRPPYQKSGVSFNAKSPSAGMSHNTSNVSTPYISQTESKDTTPPTMVTLDLPYILSSM
                     RISRLSPERNMARSPEVVAIRESPVKVFKFLARELEFSGNHEKREGSAKSVYQQGSVK
                     DEDFKEDLMQRFGLLENTTWAALVNKKSEQDIKLSRELTNNDISNDQEEKPQRRESSS
                     EEGDSGVHSKRRSALTESIEVANSVQQKVDRLLELIPICGHNASVYSYIDDLPNFKVW
                     LLIRDSLLWDLKKISLDELQTQQHDYEDHSAMADDISAAAMEINESVNPGCSSGVTSG
                     VNSFVDEAPQALNSESIDGMKKHLEAAGKSKLKQQIMAGKMEISTEKNPTLASSSKST
                     HKLDEPPFQQRQTANEAEAVSIEDDSDRDTLDVPNTVGGLETIGIPILQKRKQRPSFI
                     DTFMTDVRSPHDVNTENEFLERSRRSHSFTHSSPNSKLSSMQSFGNGVSPSAALKKFA
                     YQADSIMSLSPKKQPNHLPSSFEQLMGVRTSKVGSKKTPSSRSKDTPPPWNTKRLLKQ
                     LYQQAVEMGNILLAVNILLLFQNIYHLTSTEVVKNSLAQFTTILHQYELFEISAAILK
                     YCPWDDIFDTEGSQSLITLFCDKCGKLITNEPSKEKFAKEAQIVGDTTPLARFGHWYC
                     DSCKKPNSLCVMCEQPMKNLTMTLLECGHEGHFECLKGWFLDDNLTECPAGCSYKVIT
                     "
     gene            complement(<75025..>76554)
                     /gene="TDEL0A00420"
                     /locus_tag="TDEL_0A00420"
                     /db_xref="GeneID:11503229"
     mRNA            complement(<75025..>76554)
                     /gene="TDEL0A00420"
                     /locus_tag="TDEL_0A00420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678537.1"
                     /db_xref="GeneID:11503229"
     CDS             complement(75025..76554)
                     /gene="TDEL0A00420"
                     /locus_tag="TDEL_0A00420"
                     /inference="similar to DNA sequence:INSDC:YNL318C"
                     /note="similar to Saccharomyces cerevisiae HXT14
                     (YNL318C); ancestral locus Anc_3.23"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678585.1"
                     /db_xref="GeneID:11503229"
                     /db_xref="GOA:G8ZL80"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZL80"
                     /translation="MSTPIGHYTGESNYNTAKMTSSAKLSTPAFSGIARERQALAVPI
                     MLCTSVSFGGFLAGWDVGTIGGITNMESFSQNFGTLVNTWTGERRLPAISVGLIISVF
                     SVSSAVGGLTLAKLGDYQGRKFGIYVALVVYCVGLWITLMNDTNWIQFLIGRIVTGLA
                     VGSTGVLVPIYLSEIAPVTIGSTMIGSYQVQTTLGILMGNIVNYFCHQVLDNDVRNMS
                     WQLPLILGYLWVLIITIGLIFTPESAPFLVVHKNAIPDAKASFAKMNAISRADPKTLE
                     FIDRSLREKHKSRKEDKSQDILDWARSRPRLGLRLLVGICVMSFQQLSGINYFFYYGT
                     TIFEARQMDSYVVTIILSLVNFLSTFGGLYVVQASGRRPSLLIGSIGMFCCMLVYASV
                     GSFAPRGTASYVVVIIATCVYLIFFATTLGPVTVILVAELFPMRTKATSMAVCTSFYW
                     MCNFLVSFLTPIIADQIGFLYGYFFAGFLLVSAVFAWFMVPETKYMTQADIDAFYDKV
                     R"
     gene            <77117..>78529
                     /gene="TDEL0A00430"
                     /locus_tag="TDEL_0A00430"
                     /db_xref="GeneID:11503087"
     mRNA            <77117..>78529
                     /gene="TDEL0A00430"
                     /locus_tag="TDEL_0A00430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678538.1"
                     /db_xref="GeneID:11503087"
     CDS             77117..78529
                     /gene="TDEL0A00430"
                     /locus_tag="TDEL_0A00430"
                     /inference="similar to DNA sequence:INSDC:YOL137W"
                     /note="similar to Saccharomyces cerevisiae BSC6 (YOL137W);
                     ancestral locus Anc_3.24"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678586.1"
                     /db_xref="GeneID:11503087"
                     /db_xref="GOA:G8ZL81"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZL81"
                     /translation="MPSYQSEGKDDTPIEMVNLLEQEEGFSVDSGVEFNGGSLMKDVE
                     WKGEKIKVYPLNYQTVGIVRWQIAANLAMFIMFGLNDQTTGTLIPTLTERYGISKVVV
                     SNIFLTQVLGYMLASVLNEKLHKKWGMRGAMIISAGSSVIFFSILALQPSSFFVYTIC
                     YLPIGFSIGIADSTANVMIGNLETHKNEWMGVTHGLYGASSMITPPIVSYFNKYGRWS
                     DFFYIPLVVSLLGLLIILAACRFETATKYDYICTAHKAEDDSTEEDEENDSSGILALL
                     KNPAVLLYALYLFVYLGAEITTGSWMFSYLLATKSDDTISMSYVTSAFWVGLTVGRFL
                     LGFVTKRVFPSEYRASHVYGLCCVFFYTIFTLVGFINTDSQWYIGILFFVLFFCGVFI
                     GPLFPNASIVALQVLPRKLHVSGVGLAVAIGGAGNAALPYLVGIALHITGMKWFPLMC
                     WMLVAAFTVVWLMYPRYLAV"
     gene            <78820..>80175
                     /gene="TDEL0A00440"
                     /locus_tag="TDEL_0A00440"
                     /db_xref="GeneID:11502693"
     mRNA            <78820..>80175
                     /gene="TDEL0A00440"
                     /locus_tag="TDEL_0A00440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678539.1"
                     /db_xref="GeneID:11502693"
     CDS             78820..80175
                     /gene="TDEL0A00440"
                     /locus_tag="TDEL_0A00440"
                     /inference="similar to DNA sequence:INSDC:YNL317W"
                     /note="similar to Saccharomyces cerevisiae PFS2 (YNL317W);
                     ancestral locus Anc_3.25"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678587.1"
                     /db_xref="GeneID:11502693"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8ZL82"
                     /translation="MNDSNVQDQSQKRYLTQRRTVDMSSPFEKLYYYRRHGLELPIIE
                     PENSYTTDIMPPCAYRSRDRVINFTNKFTHLSSNKVKHVIPAIKWTPEGRRLVVATYS
                     GEFSLWNGSSFNFESIMQAHDSAVTTMEYSHAGDWMVSGDSDGTIKIWQPNFNMVKEL
                     DRAHTECIRDVAFSGNDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVKSCDWHPE
                     MGLIASASKDNLVKLWDPRVGQCISTILKFKHTVLKTRFQPTGGNLLAAISKDKSCRV
                     FDIRHSLKELMVVRDEVDYMTLLWNPINESMLTVACYDGSLKDFDVVQDLKKPVHTIP
                     YAHDKCITSLSYNPVGHILASASKDRTIRFWTRARPSDPNAFDDPTYNNKKVNAWFFG
                     INNGINAVREKTENGAAPPSTNGTDGYSIPPLSSSSNTSSLPGLDYAPSKSTSLPGLS
                     I"
     gene            complement(<80330..>81598)
                     /gene="TDEL0A00450"
                     /locus_tag="TDEL_0A00450"
                     /db_xref="GeneID:11503355"
     mRNA            complement(<80330..>81598)
                     /gene="TDEL0A00450"
                     /locus_tag="TDEL_0A00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678540.1"
                     /db_xref="GeneID:11503355"
     CDS             complement(80330..81598)
                     /gene="TDEL0A00450"
                     /locus_tag="TDEL_0A00450"
                     /inference="similar to DNA sequence:INSDC:YOL136C"
                     /note="similar to Saccharomyces cerevisiae PFK27
                     (YOL136C); ancestral locus Anc_3.26"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678588.1"
                     /db_xref="GeneID:11503355"
                     /db_xref="GOA:G8ZL83"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZL83"
                     /translation="MSSSSFVSRNGSLKSNPTSTNSLFSLGKKSYSNLLLNKSSYYYQ
                     NDEISEEQEDVLPLPHGLILNNIATEGFPDLTRVDSQSPLSFDPPRDFRRRSITNTNG
                     GAKGSKFVFILVGLPAVGKSTISAQLIRFLQSNPATHSLRCSVFNAGKVRRKMSFKNL
                     GKLSMELANNSSDDLFNPKNTEKKEKYARITLDKLLQELDSDVCDVGIFDATNSRVQR
                     RQFVFEELCAYNENPESNFHVTPIVLQITCDDQSFIRYNVHKKSFNEDYFDKPYEFAV
                     RDFARRLKNYYSQFTPFSTEEFNSIVKLINDRGLGHGVFAYNIVNTGLVTSQHMNNNY
                     FPLKCAKEVIQMVNLMENFVEHYTRMFGYTYIERVKEFFNEEMKTAEQRPTPGGLSYI
                     STLSSILNEEYFSNLQALLAKNLEDSCISC"
     gene            complement(<82004..>82633)
                     /gene="TDEL0A00460"
                     /locus_tag="TDEL_0A00460"
                     /db_xref="GeneID:11503091"
     mRNA            complement(<82004..>82633)
                     /gene="TDEL0A00460"
                     /locus_tag="TDEL_0A00460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678541.1"
                     /db_xref="GeneID:11503091"
     CDS             complement(82004..82633)
                     /gene="TDEL0A00460"
                     /locus_tag="TDEL_0A00460"
                     /inference="similar to DNA sequence:INSDC:YOL135C"
                     /note="similar to Saccharomyces cerevisiae MED7 (YOL135C);
                     ancestral locus Anc_3.27"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678589.1"
                     /db_xref="GeneID:11503091"
                     /db_xref="GOA:G8ZL84"
                     /db_xref="InterPro:IPR009244"
                     /db_xref="UniProtKB/TrEMBL:G8ZL84"
                     /translation="MSTADTNEISALYPPPPPYIKFFTQENLDKLPEYIKNKKDAKSD
                     AEEDEEKPQCPLDFLIPPPLPKSSQYRAFGSVWQLKDQLPDLETMGLTQLYKKAGDAD
                     TNDYQNKIKELHKLLKSLLLNYLELVGILSVDPTLYEQKVDHIRTILVNIHHLLNEYR
                     PHQTRESLIMLLEEQLAYKRKEIWDIDQVCDQIRDKLAHIDIDIDNGSA"
     gene            <82852..>83208
                     /gene="TDEL0A00470"
                     /locus_tag="TDEL_0A00470"
                     /db_xref="GeneID:11502646"
     mRNA            <82852..>83208
                     /gene="TDEL0A00470"
                     /locus_tag="TDEL_0A00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678542.1"
                     /db_xref="GeneID:11502646"
     CDS             82852..83208
                     /gene="TDEL0A00470"
                     /locus_tag="TDEL_0A00470"
                     /inference="similar to DNA sequence:INSDC:YOL133W"
                     /note="similar to Saccharomyces cerevisiae HRT1 (YOL133W);
                     ancestral locus Anc_3.28"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678590.1"
                     /db_xref="GeneID:11502646"
                     /db_xref="GOA:G8ZL85"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024766"
                     /db_xref="UniProtKB/TrEMBL:G8ZL85"
                     /translation="MSEAEKMDVDSEGVDQPVSESTQTSKTKPKRFEIKKWTAVAFWS
                     WDIAVDNCAICRNHIMEPCIECQPLAMTDTDNECVAAWGTCNHAFHLHCINKWIKTRD
                     ACPLDNQPWHLARCGR"
     gene            complement(<83249..>84232)
                     /gene="TDEL0A00480"
                     /locus_tag="TDEL_0A00480"
                     /db_xref="GeneID:11503109"
     mRNA            complement(<83249..>84232)
                     /gene="TDEL0A00480"
                     /locus_tag="TDEL_0A00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678543.1"
                     /db_xref="GeneID:11503109"
     CDS             complement(83249..84232)
                     /gene="TDEL0A00480"
                     /locus_tag="TDEL_0A00480"
                     /inference="similar to DNA sequence:INSDC:YNL316C"
                     /note="similar to Saccharomyces cerevisiae PHA2 (YNL316C);
                     ancestral locus Anc_3.29"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678591.1"
                     /db_xref="GeneID:11503109"
                     /db_xref="GOA:G8ZL86"
                     /db_xref="InterPro:IPR001086"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="UniProtKB/TrEMBL:G8ZL86"
                     /translation="MEQSKPDQSVRVAFLGPEGTYTHQAALQEFGSQPQAHFVSTNSI
                     PQCFQQLENDHTIDYSVVPLENSTNGQVVFTYDLLRDRMMAGLNDSTDNNRVIPTIEV
                     VGEQYVSIAHCLISPNDIKLDALPIYKKIRIHSHPQVWGQVSGYLEQLKKKCPNTFVE
                     RIDTASTSEAVSKAQLSPKEDSVLNLAIASETAAKLNKAYIIDREINDILGNTTRFLI
                     FKRRSHTDTTQPANSKRVALMTFAVKQDDPGALVEVLTVLKNHSVNMCSINSRPLNSA
                     LLGRKWQYLFFIEYYKTKPKTNEEAFYSDMSNSCSSWCLWGTFVRNERYYN"
     gene            complement(<84378..>85349)
                     /gene="TDEL0A00490"
                     /locus_tag="TDEL_0A00490"
                     /db_xref="GeneID:11502771"
     mRNA            complement(<84378..>85349)
                     /gene="TDEL0A00490"
                     /locus_tag="TDEL_0A00490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678544.1"
                     /db_xref="GeneID:11502771"
     CDS             complement(84378..85349)
                     /gene="TDEL0A00490"
                     /locus_tag="TDEL_0A00490"
                     /inference="similar to DNA sequence:INSDC:YNL315C"
                     /note="similar to Saccharomyces cerevisiae ATP11
                     (YNL315C); ancestral locus Anc_3.30"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678592.1"
                     /db_xref="GeneID:11502771"
                     /db_xref="GOA:G8ZL87"
                     /db_xref="InterPro:IPR010591"
                     /db_xref="UniProtKB/TrEMBL:G8ZL87"
                     /translation="MSYLVRQIPKRLSTPLTQARLASLVSQNTFQRLSKNSFNHYSTD
                     PVETKYHEKLLKKAKEEGFNSVDQFLLSSKTELEAKKKEFNKIDPLKELEDYEQRMKM
                     SANNAGMTKSKGPIDASQPKIPFKTLDSFLDVEKIKELSKQEVEFLWRAKWMSKDDAL
                     CAVVPVDIFEKMIVNAKSNPIFVLPLPRQSQDDGKDAKENQSVELHYIQWQFVGPNTV
                     HCIMTSLAEFKLHNEYSKPHTIFQFHSEMAADKKIILMNGQVEPDTNISLQDAQLLLL
                     NVQRFWGAMGEETPVAQQRVKLLRDFTKGSPDFSVDALISLAQSMEN"
     gene            <85589..>86332
                     /gene="TDEL0A00500"
                     /locus_tag="TDEL_0A00500"
                     /db_xref="GeneID:11502864"
     mRNA            <85589..>86332
                     /gene="TDEL0A00500"
                     /locus_tag="TDEL_0A00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678545.1"
                     /db_xref="GeneID:11502864"
     CDS             85589..86332
                     /gene="TDEL0A00500"
                     /locus_tag="TDEL_0A00500"
                     /inference="similar to DNA sequence:INSDC:YNL314W"
                     /note="similar to Saccharomyces cerevisiae DAL82
                     (YNL314W); ancestral locus Anc_3.31"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678593.1"
                     /db_xref="GeneID:11502864"
                     /db_xref="UniProtKB/TrEMBL:G8ZL88"
                     /translation="MAEKSLSADDCVLLQLMDKFKPHLKPYAYRQDAWSRVLNEYNGL
                     TDSLYRQARTLRVKFEKMKQLCKDSHRGNIDLENFELLKKLADETGEGKSKRSKVKKN
                     HVKKMASAESSLRPDFNIDHKSSTLLADEVEIIAPQINTTQRNDGLQPPPLDSIVVGF
                     GQGLDPASLATLPTYDHPMARDYDGSSPLSNKSSISRVHQNQNGSPAMEEEDDDPTQP
                     PPLDSITVGFRQAQKSRNHQLDDVARPGT"
     gene            complement(<86493..>89204)
                     /gene="TDEL0A00510"
                     /locus_tag="TDEL_0A00510"
                     /db_xref="GeneID:11502880"
     mRNA            complement(<86493..>89204)
                     /gene="TDEL0A00510"
                     /locus_tag="TDEL_0A00510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678546.1"
                     /db_xref="GeneID:11502880"
     CDS             complement(86493..89204)
                     /gene="TDEL0A00510"
                     /locus_tag="TDEL_0A00510"
                     /inference="similar to DNA sequence:INSDC:YNL313C"
                     /note="similar to Saccharomyces cerevisiae YNL313C;
                     ancestral locus Anc_3.32"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678594.1"
                     /db_xref="GeneID:11502880"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G8ZL89"
                     /translation="MEVLLHSYLLIGADPAVLNGKVFEEYDSRELAFAHNILTGHPYK
                     VVESLLGSLEVSPTMNDDLTEERLLHSLRDFLSSHFNSRFGLLFAIALLQTFIQNNFT
                     GPLAPIDLNKLLFKDQILSKDLGKLAISLLNAGGQPAYDLTENPLYLILPLLLLELLT
                     KQQSCFAVDSDTEFEVPEVSATSTPGLLAISHWWRARALLAQVSLLHEPAGSQPAVAS
                     SILSSIDLAQAVTKDLPQETSQDLKASLYTIFYLENVKCSLAINTEHLCLPSLIKAKK
                     LTNFSLIMTGARAKRTKFQQKAHAGLVILAQSSSNLDASKDLKDSANPDYIALESEIL
                     LEKPHFEDIAAEPLDEQIVKKQKVVDGTGVEEDRILPVAIRQENIPTELKDLDPNNQP
                     QLSGYDNVQLLLRLYVIRQTSPAKDPLVEEELAAIISRVIYQQGSKDWTIFSRALWER
                     SIGETTKAKTIERGLLQMQSLVEELGIKLQTRLIPNAPNDEQSTRLRYIHQLPFIPHW
                     DLEATLAEKYMSLGVLKSAVEIYERLHMACEAALCYAAVGEEKIAEEIILQRIANNPK
                     DARAYSILGDIRQDPQLWKKSWEIGKYVNAKNSLGRYFYNPPPSSGLTRDYAAALTHL
                     NDSLRQYPLSFETWYFYGCVGLECGKFELAAEAFSRCVALDSTHAMAWSNLSAAFVEQ
                     NKLKEALSCLKRAVASDSQSNWRIWENYMLVAAKMNEWSDVLLACRHLVNIKRDKAGE
                     GSIDLPVVEKLVELLVRTDYPADNDQKLTHFQRSCIEFVCDILPSVITTSSRCWRLVA
                     KVELWRKRPWSALECHEKAYRAVSHNPDIEIDEKVWNATVDACEDLVAAYESLGELEG
                     RHGPGSLVCKDWKYKSRATIKALMSKGKGRWDDSDGWERLVAVRNQI"
     gene            <89407..>90331
                     /gene="TDEL0A00520"
                     /locus_tag="TDEL_0A00520"
                     /db_xref="GeneID:11502583"
     mRNA            join(<89407..89413,89487..>90331)
                     /gene="TDEL0A00520"
                     /locus_tag="TDEL_0A00520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678547.1"
                     /db_xref="GeneID:11502583"
     CDS             join(89407..89413,89487..90331)
                     /gene="TDEL0A00520"
                     /locus_tag="TDEL_0A00520"
                     /inference="similar to DNA sequence:INSDC:YNL312W"
                     /note="similar to Saccharomyces cerevisiae RFA2 (YNL312W);
                     ancestral locus Anc_3.33"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678595.1"
                     /db_xref="GeneID:11502583"
                     /db_xref="GOA:G8ZL90"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014646"
                     /db_xref="InterPro:IPR014892"
                     /db_xref="UniProtKB/TrEMBL:G8ZL90"
                     /translation="MATYQPYNEYSSVGGGDGGGFETTDQRPNSSESGGAQGRFTTLT
                     PVTIKQILQSQQQVQDGPFVIDQQELFHVSFVGVVRNIVDETSNVRLTIEDGTGQIDV
                     KKWSADPNDVAASQDENLKKNYSSQVAQQYHIGTYVKVFGALKEFGGKQHVQYALIKN
                     IESFNEVITHHLEVIKWFTISNGKFSPSKANADEQATTSNNGPSLFVRESDSHDTGNP
                     LQRVLAFCREQCAGKDPNNFAVQVQLIAQSLNLDETTVRDCCTTLTEQGFIYPTINDS
                     KFFALTS"
     gene            <90536..>91996
                     /gene="TDEL0A00530"
                     /locus_tag="TDEL_0A00530"
                     /db_xref="GeneID:11502711"
     mRNA            <90536..>91996
                     /gene="TDEL0A00530"
                     /locus_tag="TDEL_0A00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678548.1"
                     /db_xref="GeneID:11502711"
     CDS             90536..91996
                     /gene="TDEL0A00530"
                     /locus_tag="TDEL_0A00530"
                     /inference="similar to DNA sequence:INSDC:YOL132W"
                     /note="similar to Saccharomyces cerevisiae GAS4 (YOL132W);
                     ancestral locus Anc_3.34"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678596.1"
                     /db_xref="GeneID:11502711"
                     /db_xref="GOA:G8ZL91"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G8ZL91"
                     /translation="MIRQMTLSVLFLILGLAQFARGDVDHIEVKGKQFFNSRTGEPFY
                     IRGVDYQPGGSSDVSEKKDPLSDPEACARDIVLFQELGINTVRIYSVNPDLNHDKCMT
                     ILATAGIYLILDVNSPMENQHLNRYQPWTTYNEIYLEHVLKVVEQFSHYDNTLGFFAG
                     NEIVNDEQSAKHSPPYIKAVVKDMKKYIKKNSPRIIPVGYSAADDLFYRVPLSYYLEC
                     CEDPDDDISVDFYGVNSYQWCGVQTMESSGYDELVEAYKNFTKPVFFSEFGCNEVLPR
                     QFDEIKALYSKDMCGIFSGGLLYEFTQGPNNYGLVDLDSDGNVRLLDDFTTLKNHYNT
                     TKMPSKSDLEQAITADNTLTKLDESQRNVAICQKSYENLKIDGKVASGLADNLIKKGV
                     TVDHGNYVDLNDDDLTTKFEILNANGDEWKGSKSIRKVNHMTASERSRGTSENPNGGT
                     TGVGSRGSKNHAVKSLSVPFKIMPIVLAHMLYHFLV"
     gene            complement(<92056..>94239)
                     /gene="TDEL0A00540"
                     /locus_tag="TDEL_0A00540"
                     /db_xref="GeneID:11502827"
     mRNA            complement(<92056..>94239)
                     /gene="TDEL0A00540"
                     /locus_tag="TDEL_0A00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678549.1"
                     /db_xref="GeneID:11502827"
     CDS             complement(92056..94239)
                     /gene="TDEL0A00540"
                     /locus_tag="TDEL_0A00540"
                     /inference="similar to DNA sequence:INSDC:YNL311C"
                     /note="similar to Saccharomyces cerevisiae YNL311C;
                     ancestral locus Anc_3.35"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678597.1"
                     /db_xref="GeneID:11502827"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:G8ZL92"
                     /translation="MKRLQLFGNSKYFSISSKEEKPPRESSPARTRSPKPRQSTPKST
                     AELSLLSLPPKVLAAILEQLDVNTLLSLCQVNSALYKLTSDQFLYRNITLDNKLSLLK
                     FNALIHSEFHTSNALNERHGSRRASQNARFLVRSIKFINPQCQDSLLKYSKFHNKVDQ
                     QSIIGGAYHYESALSASNQSRSHSKDRRSRSSSRRSSDKLDHAAAEWYKSICKLEGTY
                     SQYTYIELLLDIVDYLPNLTHIILDEVQPGFKIPLWYSVMNDGSRDFFKKIINGQQSM
                     NRNDLRTFELSESFASDYERRFHALPRVPTLEIRAALDKRNKHQVHLRPNLLCCFGII
                     NELILQNVIIDTESLDTPWEFMPFHLKTDLPGFYDVHSTTRKLTLKSCHILPGSGILK
                     LFHQYFKCVKELQLLQITSKFDMLLCSCFTSLTHLTIDCNSKCFVDEAIVSDDYYYKK
                     QDISAEYNEDSDGDLASVTETLLDPPVDNSLLAPPPTSPVVLSIDRNYLTRATVQSQL
                     GNRKMAIITNSQSDFFKFLRVPAFHVFYHYYKKLWDRLPRKNINISIVNIPFTNVFPM
                     SPQLFCDRLLRPLADDQQTLIPLRTSRANGTDQDRQYYWNDAVKNCLRDSIQVSFGGG
                     TAGPTMIDTLSEISSDILNNHENFKMFQDIPNLNSWFFLKSLSEFKSVRIHMLKRWLF
                     CTPRTRYDWEILLKPVLNVNVPIEVRDKDGYVLYSYGSRMTDVKG"
     gene            complement(<94467..>95012)
                     /gene="TDEL0A00550"
                     /locus_tag="TDEL_0A00550"
                     /db_xref="GeneID:11502633"
     mRNA            complement(<94467..>95012)
                     /gene="TDEL0A00550"
                     /locus_tag="TDEL_0A00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678550.1"
                     /db_xref="GeneID:11502633"
     CDS             complement(94467..95012)
                     /gene="TDEL0A00550"
                     /locus_tag="TDEL_0A00550"
                     /inference="similar to DNA sequence:INSDC:YNL310C"
                     /note="similar to Saccharomyces cerevisiae ZIM17
                     (YNL310C); ancestral locus Anc_3.36"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678598.1"
                     /db_xref="GeneID:11502633"
                     /db_xref="GOA:G8ZL93"
                     /db_xref="InterPro:IPR007853"
                     /db_xref="InterPro:IPR024158"
                     /db_xref="UniProtKB/TrEMBL:G8ZL93"
                     /translation="MIPRLFTRHYANSLRRVICGNVRRSTSLTPLLQRHSFTSSSIRL
                     NQDGANDGSRKLGSFKVDKPMLMIAFTCKKCNTRSSHTMSKQAYTGGTVLITCPSCKN
                     RHLIADHLKIFRDDHVTIEDILKAKGESVSSTTDDLAFEDIPKELRNVIGHHAKDAPE
                     NLRGKLDNETVHTLPGSSKND"
     gene            <95171..>96235
                     /gene="TDEL0A00560"
                     /locus_tag="TDEL_0A00560"
                     /db_xref="GeneID:11502930"
     mRNA            <95171..>96235
                     /gene="TDEL0A00560"
                     /locus_tag="TDEL_0A00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678551.1"
                     /db_xref="GeneID:11502930"
     CDS             95171..96235
                     /gene="TDEL0A00560"
                     /locus_tag="TDEL_0A00560"
                     /inference="similar to DNA sequence:INSDC:YNL309W,YOL131W"
                     /note="similar to Saccharomyces cerevisiae STB1 (YNL309W)
                     and YOL131W; ancestral locus Anc_3.37"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678599.1"
                     /db_xref="GeneID:11502930"
                     /db_xref="UniProtKB/TrEMBL:G8ZL94"
                     /translation="MANECGKNGEGQLSPEKEQEITNRILKRAELAQMTRQLKMKLSK
                     VPTSREASPVKNRRKRVVDSSDHEITEAIARVSPVKKEWIKGRLGEDEAENASSGATS
                     PVKDLKKLGTPPPAPPTSSSSCMRDLNSSRDGQAMPSTPGRTRSRNRNALPLVISTSS
                     DGQVTQPIVSTPQRSVNGKKGDHGENEVGADLLMFLAASPYTSTTNSNRQTRMPSTPM
                     AYMSHNGGQQDSEDAIRFSHMKPSMSSPQSTFKVPSHVINHNYNNHNSSEVLIEPPSI
                     YSSSTHSPSPSKRRHMGVPEPTHIPTTPSRELRSSHLLRTPNFNMGDYVHALFSPSPR
                     VPSTATSRPATAQDLRNNRG"
     gene            <96698..>99046
                     /gene="TDEL0A00570"
                     /locus_tag="TDEL_0A00570"
                     /db_xref="GeneID:11502969"
     mRNA            <96698..>99046
                     /gene="TDEL0A00570"
                     /locus_tag="TDEL_0A00570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678552.1"
                     /db_xref="GeneID:11502969"
     CDS             96698..99046
                     /gene="TDEL0A00570"
                     /locus_tag="TDEL_0A00570"
                     /inference="similar to DNA sequence:INSDC:YOL130W"
                     /note="similar to Saccharomyces cerevisiae ALR1 (YOL130W);
                     ancestral locus Anc_3.38"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678600.1"
                     /db_xref="GeneID:11502969"
                     /db_xref="GOA:G8ZL95"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="UniProtKB/TrEMBL:G8ZL95"
                     /translation="MSDAHSRNSSNSGLSPTTSLASSLVSMNTEDHNGLYDHRQHPES
                     TFIAQNSPTAVVAGRSSRARPAKSHQDEPPAPARRGSRAHSINENIQNVRSSKKSSHH
                     LPKVGNVGVGRAMSTVSASPYDQRSRANSMASAGSITSKVHISKTLSHINVPPKQQQR
                     RASFDSDDSKASRESQETEEDVCFPMQPQLHTRVNGIDFDELEEFAQQSTEENQNLAM
                     MNQHSLNQTFQENGPTFKNGGSSSSTSTTVSSAALKYTPKQPSSSVEASPKHSYINQA
                     LGVSFGHNKVEGDEPEEKYSKSQEDAGTYRSDIPPEQAGVPNQPGYYDPNFLAPDRFS
                     FFSSESEETVHATDIASLVKPGQHFYELFRDGEPTWWLDCSCPTDDEMRCIAKAFGIH
                     PLTAEDIRMQETREKVELFKSYYFVCFHTFESDHESADFLEPINVYIVVFRSGVLTFH
                     FAPISHAANVRRRVRQLRDYVNVSSDWICYAIIDDITDSFAPVIQSLEYEADAIEDSV
                     FMARDLDFSHMLQRIGESRRKTMTLMRLLSGKADVIKMFAKRCQDEANGIGPALTSQV
                     NIANLQAGDNEAVRFAVPTTKQHQQFQQTAQPRGDIALYLGDIQDHLLTMFQNLLAYE
                     KIFSRSHTNYLAQLQVESFNSNNKATEMLGKVTMLGTMLVPLNIIPGLFGMNVTVPGE
                     AGNPAWWYGILGVMILLALSAWFGASYWIKRIDPPTTLNEAAESGGKSVISSFLPKSA
                     RNQQNKGAVNPPNRLLGYPHSGPLPASNRSVASCPSKYSRYD"
     gene            complement(<99187..>100875)
                     /gene="TDEL0A00580"
                     /locus_tag="TDEL_0A00580"
                     /db_xref="GeneID:11503330"
     mRNA            complement(<99187..>100875)
                     /gene="TDEL0A00580"
                     /locus_tag="TDEL_0A00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678553.1"
                     /db_xref="GeneID:11503330"
     CDS             complement(99187..100875)
                     /gene="TDEL0A00580"
                     /locus_tag="TDEL_0A00580"
                     /inference="similar to DNA sequence:INSDC:YNL308C"
                     /note="similar to Saccharomyces cerevisiae KRI1 (YNL308C);
                     ancestral locus Anc_3.39"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678601.1"
                     /db_xref="GeneID:11503330"
                     /db_xref="InterPro:IPR018034"
                     /db_xref="InterPro:IPR024626"
                     /db_xref="UniProtKB/TrEMBL:G8ZL96"
                     /translation="MPRKKSNAKKARESGKKLELEKSAIKNNPEVTSPSFVKENSDDD
                     ESSSSEEEDDYGELITEEVEDGINRVLSAIKNNEKDKLLDPKVRFFEDPEKAAEKLVK
                     GEKHKPVYLKDYHRMNILAGNTFADDEEATVDGEQSYASQQREERSQLIDEIKNAFSG
                     DENDEEEDENDGDFLKKKEPSNKTATPRLRLPNPNQDEEKFLAEFVNNQAWIPRKGDK
                     VIPLDNDPNMEEDDEEFEDAVEKFENAYNFRYEDPNAATIVSYARTQATLRRSETSSR
                     RRKRDEEKQVKEVEKTEKEKSIQKKKKEKIHKLTDVLEQLKKEYGSDINQDMVKKITD
                     TLLNSDFKENEWDTVVSELFNEEFYGQKGKPTWDEDDEVMADFYKEKQEAEGEEESHE
                     EESDEQESSKKSRKEKLKDKKLQKKGKRELEEIVEDAVEQNKISIIEEVEKDNEERKS
                     RARTKDEQQLKFRYREVSPESYGLSTREIFAADDTQLNQFIGLKKFAPYRAKEQRMKD
                     KRKVTKSRRLRDWRKEVFHTEKGLEADSDFVEVPVEAETKKKASHKKKKHKSTA"
     gene            <101085..>101639
                     /gene="TDEL0A00590"
                     /locus_tag="TDEL_0A00590"
                     /db_xref="GeneID:11503219"
     mRNA            <101085..>101639
                     /gene="TDEL0A00590"
                     /locus_tag="TDEL_0A00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678554.1"
                     /db_xref="GeneID:11503219"
     CDS             101085..101639
                     /gene="TDEL0A00590"
                     /locus_tag="TDEL_0A00590"
                     /inference="similar to DNA sequence:INSDC:YOL129W"
                     /note="similar to Saccharomyces cerevisiae VPS68
                     (YOL129W); ancestral locus Anc_3.40"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678602.1"
                     /db_xref="GeneID:11503219"
                     /db_xref="InterPro:IPR007919"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G8ZL97"
                     /translation="METDQRTRLFRLPFKFPNFAGLRKISVYLSGVFYALGFWFFLDA
                     VIYSKHANASDVHVTFIDWIPFLCSIFGTLIVNSIEKNTLLQGALSNGGGMSSFAGSD
                     LDSAMAWQARAVLFFGFALLAGGLSGSIVVLIIKFLAKDYNTYPTVGMGVNNVLGNFF
                     ILLSCVVLWIAQNMEDEYSYSLTL"
     gene            complement(<101753..>102877)
                     /gene="TDEL0A00600"
                     /locus_tag="TDEL_0A00600"
                     /db_xref="GeneID:11503095"
     mRNA            complement(<101753..>102877)
                     /gene="TDEL0A00600"
                     /locus_tag="TDEL_0A00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678555.1"
                     /db_xref="GeneID:11503095"
     CDS             complement(101753..102877)
                     /gene="TDEL0A00600"
                     /locus_tag="TDEL_0A00600"
                     /inference="similar to DNA sequence:INSDC:YNL307C,YOL128C"
                     /note="similar to Saccharomyces cerevisiae MCK1 (YNL307C)
                     and YGK3 (YOL128C); ancestral locus Anc_3.41"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678603.1"
                     /db_xref="GeneID:11503095"
                     /db_xref="GOA:G8ZL98"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZL98"
                     /translation="MSSSQGTKCDEFVADDVTSNRSNNTRRMLIKEYRKIGHGAFGTV
                     VQAFITPDKEKWYGPYAIKKVPAQTEYKSRELQILRIADHPNVVKLEYFFTHVSPQDG
                     KVYQHLAMECLPETLQIEISRYASNKLELPIKHVKLYSYQIARGMLYLHAFGICHRDV
                     KPSNILVDPTNGVLKICDFGSAKKLEQTQPSISYICSRFYRAPELIVGCTQYTTQIDI
                     WGLGCVIGEMLIGKAVFQGQEPLLQLREIAKLLGPPDKKFIFFANATYDGPLFSKPLF
                     SGSPQQRFEKHFSHAGPDGIDLLMKVLVYEPQARLSPRRIMAHPFFDDLRNEQYFFPR
                     GQTQPVHLPNLFEFSDFESQILGEFADKVKPKRDTVETDN"
     gene            <103088..>103690
                     /gene="TDEL0A00610"
                     /locus_tag="TDEL_0A00610"
                     /db_xref="GeneID:11503102"
     mRNA            <103088..>103690
                     /gene="TDEL0A00610"
                     /locus_tag="TDEL_0A00610"
                     /product="mitochondrial 37S ribosomal protein YmS18"
                     /transcript_id="XM_003678556.1"
                     /db_xref="GeneID:11503102"
     CDS             103088..103690
                     /gene="TDEL0A00610"
                     /locus_tag="TDEL_0A00610"
                     /inference="similar to DNA sequence:INSDC:YNL306W"
                     /note="similar to Saccharomyces cerevisiae MRPS18
                     (YNL306W); ancestral locus Anc_3.42"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein YmS18"
                     /protein_id="XP_003678604.1"
                     /db_xref="GeneID:11503102"
                     /db_xref="GOA:G8ZL99"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="UniProtKB/TrEMBL:G8ZL99"
                     /translation="MLKRFGAFTSLARRYKSTGPVSFSSITDGKEISNVVSPNRNESS
                     TTRSFKRDLRPVKYVLNCLFAKNNTHFTYSAIVEDVHYMKNNPDVSYNNAFLYYLKLP
                     QKVKFAISTGCLGFRKAARGEYEAAFQTSAKVFQMIQEKKLLDKDIEIVLKDFGKGRA
                     AFVAALNGKEGTAIRKNVTRISDRTPLKFGGVRAPRLRRL"
     gene            <104059..>104487
                     /gene="TDEL0A00620"
                     /locus_tag="TDEL_0A00620"
                     /db_xref="GeneID:11503246"
     mRNA            <104059..>104487
                     /gene="TDEL0A00620"
                     /locus_tag="TDEL_0A00620"
                     /product="60S ribosomal protein L25"
                     /transcript_id="XM_003678557.1"
                     /db_xref="GeneID:11503246"
     CDS             104059..104487
                     /gene="TDEL0A00620"
                     /locus_tag="TDEL_0A00620"
                     /inference="similar to DNA sequence:INSDC:YOL127W"
                     /note="similar to Saccharomyces cerevisiae RPL25
                     (YOL127W); ancestral locus Anc_3.43"
                     /codon_start=1
                     /product="60S ribosomal protein L25"
                     /protein_id="XP_003678605.1"
                     /db_xref="GeneID:11503246"
                     /db_xref="GOA:G8ZLA0"
                     /db_xref="InterPro:IPR001014"
                     /db_xref="InterPro:IPR005633"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR013025"
                     /db_xref="UniProtKB/TrEMBL:G8ZLA0"
                     /translation="MAPSAKATAAKKAVVKGTNGKKALKVRTSATFRLPKTLKLARAP
                     KYATKAVPHHIRLDSYKVIEQPITSETAMKKVEDGNTLVFQVSLKANKYQIKRAVKEL
                     YEIDVQSVNTLIRPNGTKKAYVRLTADHDALDIANRIGYI"
     gene            complement(<104522..>105331)
                     /gene="TDEL0A00630"
                     /locus_tag="TDEL_0A00630"
                     /db_xref="GeneID:11503249"
     mRNA            complement(<104522..>105331)
                     /gene="TDEL0A00630"
                     /locus_tag="TDEL_0A00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678558.1"
                     /db_xref="GeneID:11503249"
     CDS             complement(104522..105331)
                     /gene="TDEL0A00630"
                     /locus_tag="TDEL_0A00630"
                     /inference="similar to DNA sequence:INSDC:YNL305C"
                     /note="similar to Saccharomyces cerevisiae YNL305C;
                     ancestral locus Anc_3.44"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678606.1"
                     /db_xref="GeneID:11503249"
                     /db_xref="GOA:G8ZLA1"
                     /db_xref="InterPro:IPR006214"
                     /db_xref="UniProtKB/TrEMBL:G8ZLA1"
                     /translation="MSAPPPYQAIASADERPHNHSDIPDDFKYSTTIVSCDFEIRQQF
                     MAKVYSILSTQLLCTLIFCYLTIKSPKVQLFLIKHTGLYIVAAITTLVSCIWLALSPR
                     PEEYEGPAPWYSLQGRTQYALLGLFTVAESYCMAGCVMFESLEIVLSALVVTFVVVVG
                     VSLMAFSGRFQIALESATSIYYWLNLAVLLLIGVGLSAIFVGGMNSTVSILYGWLGAV
                     VFSIYLFIDTQLIFRKMYLGEEVRCAMMLYLDIVNLFLSILRILSSQNGDD"
     gene            <106331..>107521
                     /gene="TDEL0A00640"
                     /locus_tag="TDEL_0A00640"
                     /db_xref="GeneID:11502976"
     mRNA            <106331..>107521
                     /gene="TDEL0A00640"
                     /locus_tag="TDEL_0A00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678559.1"
                     /db_xref="GeneID:11502976"
     CDS             106331..107521
                     /gene="TDEL0A00640"
                     /locus_tag="TDEL_0A00640"
                     /inference="similar to DNA sequence:INSDC:YDL237W"
                     /note="similar to Saccharomyces cerevisiae YDL237W;
                     ancestral locus Anc_2.21"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678607.1"
                     /db_xref="GeneID:11502976"
                     /db_xref="GOA:G8ZLA2"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="UniProtKB/TrEMBL:G8ZLA2"
                     /translation="MISLRAWFMVLVLYLIAICTLLSRSATNSDFLFLSSVDKRDLDG
                     TGHRMDHLGLTGGKLIRLFEKHLVHVASKDRGDVPIKVSRYYDAFKDYLFDESSKCNP
                     VRSVVARLTRDVEPVPIHSHNDYWRSLPLFEALAYGATSVEADVWIVKDPQDSQKNAL
                     AVAHNENYIDSVHQSLDNLYTDLLLQMLNEVNCQDEDRSHGVFFDSPETTLFLFIDFK
                     SQDNRETYSLLMNRYLKPLIDQNYTSYYDMNQHKMVWRQITVVLTGDFPNDLDVVDED
                     LDHGYFHDDKRYVTLESSIIDQSTMIPNTSVMAASSFSEMLEGCHSSLANAVWRGRLD
                     HQEITCMKSMISKTQQNGVRTRIWGVPNWPRRTVKTFWRQIVDDLQSDVLNVDKLRLA
                     TRRF"
     gene            complement(<108333..>110843)
                     /gene="TDEL0A00650"
                     /locus_tag="TDEL_0A00650"
                     /db_xref="GeneID:11502975"
     mRNA            complement(<108333..>110843)
                     /gene="TDEL0A00650"
                     /locus_tag="TDEL_0A00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678560.1"
                     /db_xref="GeneID:11502975"
     CDS             complement(108333..110843)
                     /gene="TDEL0A00650"
                     /locus_tag="TDEL_0A00650"
                     /inference="similar to DNA sequence:INSDC:YNL221C"
                     /note="similar to Saccharomyces cerevisiae POP1 (YNL221C);
                     ancestral locus Anc_2.22"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678608.1"
                     /db_xref="GeneID:11502975"
                     /db_xref="GOA:G8ZLA3"
                     /db_xref="InterPro:IPR009723"
                     /db_xref="InterPro:IPR012590"
                     /db_xref="UniProtKB/TrEMBL:G8ZLA3"
                     /translation="MSGGRKQLNKNQQFKRQKVRDARTIRAEAAGSNELSESGGMLKV
                     QEFIGSREYEIRQLQTAMDKSKAASCTRVFQSLPRKLRRRTASHNVKRIPMRMRNRAL
                     REMLKSDQTTTSKSGKGKKHGLNAYQLYRAKMSARLLRLAGKCTSMKIALPADVTAAN
                     CNLRQKLRVLRKTLKPENRDSGRLLTNRTGSYDNMSVGALAPIPRGRVKYCKRQRHFT
                     WLPTHIWHAKRSHMIKRWGFQVPWSPTQKCFKMAHRLGGSVAASDGALCMDSSFYGTM
                     ILRDLSGGDSEPLKELVSKLTNKRGVIRKYRDSKTWFEGFVHDISEESPVVLGEMDLL
                     WIDFGTALIRLHPSIYTRVFEILLQKLPEGLQIEDCRYALGSITLKGAKSLVALSSIL
                     RSSGPSSSYQQLKRISRVTDTSNLPHRTMFAFNCVDPRHLSRPRRVHTSDVNGVPTTD
                     DIVSLQNDFPLEEVTAVLKRLCTATERDQSYNNQQTLKELAKRRQALLSKTPNQHKNI
                     IPYGSEDPSIPLLLAKRQQNKDWVIVLPWFWLLPFWHQLNRVSRIYHFGLRQQQQLNY
                     ENRKLYFPDDYPFTEVGYAENTYKGDALRSRWQKKPLSKRVNFEKIPGLHKDSVPAFD
                     GEIGDAFTCDWKLLQLLRNGLTFLSEKPLKLVEVAKTSQFGPNGVREIQTVNDIFELH
                     KDLNAVDQTLSDNPIKLSVPGTSSGEQQWQEPIQLSISQTALNVIPVSCTYIERGRPR
                     DNARIYQIPAQDREHWQKVKNGIYRADGRLDHEIEHPVPSITDLIGFITSGAFHLGEG
                     KGVAHGFIDAKTNDFQYVLIRNVGSTTYRMASIDIINI"
     gene            <111257..>112558
                     /gene="TDEL0A00660"
                     /locus_tag="TDEL_0A00660"
                     /db_xref="GeneID:11503232"
     mRNA            <111257..>112558
                     /gene="TDEL0A00660"
                     /locus_tag="TDEL_0A00660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678561.1"
                     /db_xref="GeneID:11503232"
     CDS             111257..112558
                     /gene="TDEL0A00660"
                     /locus_tag="TDEL_0A00660"
                     /inference="similar to DNA sequence:INSDC:YNL220W"
                     /note="similar to Saccharomyces cerevisiae ADE12
                     (YNL220W); ancestral locus Anc_2.23"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678609.1"
                     /db_xref="GeneID:11503232"
                     /db_xref="GOA:G8ZLA4"
                     /db_xref="InterPro:IPR001114"
                     /db_xref="InterPro:IPR018220"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLA4"
                     /translation="MVNVVLGSQWGDEGKGKLVDLLVGHYDLVARCAGGNNAGHTIVV
                     DGVKYDFHMLPSGLVNPGCQNLLGNGVVIHVPSFFKELEDLEAKGLKDARGRLFISSR
                     AHLVFDFHQRTDKLRELELSGRAKDGKNIGTTGKGIGPTYSTKASRSGIRVHHLVNDN
                     PESWDEFVTKYRRLLETRRQRYGDFDYDAEEELARFKKYKEELKPFVVDSVVFMHKAI
                     EAKKKILVEGANALMLDIDFGTYPFVTSSNTGIGGVVTGLGIPPRTIDEVYGVVKAYT
                     TRVGEGPFPTEQLNEFGEKLQEIGAEFGVTTGRKRRCGWLDLVILKYSTLINGYTSLN
                     ITKLDVLDTFKEIPIGISYSINGKKLDLFPEDLTTLGKVEVEYVTLPGWNQDITKIKN
                     YDDLPENAKKYLSYIEDFVGVPIEWVGTGPSRDSMLHKNIK"
     gene            complement(<112632..>114296)
                     /gene="TDEL0A00670"
                     /locus_tag="TDEL_0A00670"
                     /db_xref="GeneID:11502933"
     mRNA            complement(<112632..>114296)
                     /gene="TDEL0A00670"
                     /locus_tag="TDEL_0A00670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678562.1"
                     /db_xref="GeneID:11502933"
     CDS             complement(112632..114296)
                     /gene="TDEL0A00670"
                     /locus_tag="TDEL_0A00670"
                     /inference="similar to DNA sequence:INSDC:YNL219C"
                     /note="similar to Saccharomyces cerevisiae ALG9 (YNL219C);
                     ancestral locus Anc_2.24"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678610.1"
                     /db_xref="GeneID:11502933"
                     /db_xref="GOA:G8ZLA5"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:G8ZLA5"
                     /translation="MNCKLVTTALILLLGFSRLSLQPITSVISDCDETFNYWEPLNLL
                     VRGFGKQTWEYSPEYSIRSWAFLLPIWGFLYPLNKLVNFDADWNFYVTRGLLGLGSFL
                     LECNLHREIANTLSLKVANLWLIFQLFSPGWFHSSVELLPSSVAMLLYLGSIKYALRY
                     LSRHSTSSFLASLAFNVIAGVVGWPFVLVLSLPLCFHYLCTHRLIVTMRTAFDSAVII
                     ALITAVVFAIDSIFYGKFAPVSWNIFWYNVINADAESGPNIFGVESWSYYLFNMFLNF
                     PLPVLMLSVIGLFHLRLWPLWSSLLLWISVFIAQPHKEERFLYPVYALVTLSASVGFN
                     NLLQLFNRSKSMQRLIKFATISTVVIIGASRITALLVNYSAPLTVYSELHLSNSTSDH
                     TVNVCTGREWYHFPNSFFLPDNHRLRFTASGFDGLLPGDFPEDGSLFSKIRQVPEGMN
                     KKNIFDKGKLWPADNCDYYVDIMIPTDNSKDHYNPHIMPRDWHKLRCAHFIDVEHSKI
                     LGRAFYIPSVISDFLQSHFPKYWNKVYGAQKVDYCLFEKTHTSQTV"
     gene            <114694..>115620
                     /gene="TDEL0A00680"
                     /locus_tag="TDEL_0A00680"
                     /db_xref="GeneID:11502850"
     mRNA            <114694..>115620
                     /gene="TDEL0A00680"
                     /locus_tag="TDEL_0A00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678563.1"
                     /db_xref="GeneID:11502850"
     CDS             114694..115620
                     /gene="TDEL0A00680"
                     /locus_tag="TDEL_0A00680"
                     /inference="similar to DNA sequence:INSDC:YDL236W"
                     /note="similar to Saccharomyces cerevisiae PHO13
                     (YDL236W); ancestral locus Anc_2.25"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678611.1"
                     /db_xref="GeneID:11502850"
                     /db_xref="GOA:G8ZLA6"
                     /db_xref="InterPro:IPR006349"
                     /db_xref="InterPro:IPR006357"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023215"
                     /db_xref="UniProtKB/TrEMBL:G8ZLA6"
                     /translation="MTTGSPTKISTKAIAQEFLDSFDTFLFDCDGVLWLGSHLLPSIK
                     ETLGLLNQLGKQLVFVTNNSTKSRAAYTKKFASFGIDVKEDQIFTSGYASAVYVRDFL
                     KLEPGKDKVWVFGESGISEELALMGFESLGGVDPRLDEAFDHKTSPFLVNGLDPNVRC
                     VVAGLDTKINYHRLAVSLQYLQQEDKVHFVGTNVDSTFPQKGFIFPGAGSCIASLACS
                     SGRTPIYCGKPNINMLNTIVSAKNLDKSRCCMVGDRLNTDIRFGVEGKLGGTLLVLTG
                     IETEERALENTADHPNPKFYADKLGDVYELTH"
     gene            <116066..>117724
                     /gene="TDEL0A00690"
                     /locus_tag="TDEL_0A00690"
                     /db_xref="GeneID:11503259"
     mRNA            <116066..>117724
                     /gene="TDEL0A00690"
                     /locus_tag="TDEL_0A00690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678564.1"
                     /db_xref="GeneID:11503259"
     CDS             116066..117724
                     /gene="TDEL0A00690"
                     /locus_tag="TDEL_0A00690"
                     /inference="similar to DNA sequence:INSDC:YNL218W"
                     /note="similar to Saccharomyces cerevisiae MGS1 (YNL218W);
                     ancestral locus Anc_2.26"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678612.1"
                     /db_xref="GeneID:11503259"
                     /db_xref="GOA:G8ZLA7"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR021886"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLA7"
                     /translation="MSNSRSSQGQLISCPICNRQIPYNSINSHLDTCTTGPGESGSKR
                     QPTLTSILGGNKKRKLPSPSVIDLESSEQVELKEEQESVETPIAKKNKPTKDYSAEHE
                     YRHLQKISHLPLSEKLRPKDIREYVGQQHILSQEKGTLFKYIKQGILPSMILWGPPGV
                     GKTSLARLLTKTACNNGVVYNLIETSATRANTQELRSIFEKAKNDFNLTRRRTVLFID
                     EIHRFNKSQQDLLLPYAENGDIVLIGATTENPSFQLNNALISRCHIFVLEKLSVQETC
                     IVLSRGIALLNKCRQQIWKVGHPLKLPRPTLEYIVEISMGDTRRALNFLEMIEVSSRE
                     PGTKEITIEDARSIIKSNSEGISTYYDTHGDNHYDTISAFHKAIRGSDENASLYYLGR
                     MLQGGEDPLYIARRLIRIASEDVGLVDNSMLPLAVAAHDAVMKVGLPEADLALAQCCV
                     ALARSPKSVELYRGWNQLKAMLRENKFSMASSGIPMHIRNAPTELMKELGYHKGYKYN
                     PDFKDGQVKQDYFPEEVLEQCTNRDQLVFLNGKHLGDQVDPDLE"
     gene            complement(<117817..>118296)
                     /gene="TDEL0A00700"
                     /locus_tag="TDEL_0A00700"
                     /db_xref="GeneID:11502889"
     mRNA            complement(<117817..>118296)
                     /gene="TDEL0A00700"
                     /locus_tag="TDEL_0A00700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678565.1"
                     /db_xref="GeneID:11502889"
     CDS             complement(117817..118296)
                     /gene="TDEL0A00700"
                     /locus_tag="TDEL_0A00700"
                     /inference="similar to DNA sequence:INSDC:YDL235C"
                     /note="similar to Saccharomyces cerevisiae YPD1 (YDL235C);
                     ancestral locus Anc_2.27"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678613.1"
                     /db_xref="GeneID:11502889"
                     /db_xref="GOA:G8ZLA8"
                     /db_xref="InterPro:IPR008207"
                     /db_xref="UniProtKB/TrEMBL:G8ZLA8"
                     /translation="MPIPKEIVNWGILSEIVSMDEDDPEFSKSLIIQFIDQAQTTFEQ
                     MQNQLEGPKELKALADLGHFLKGSSSALGLQRIAWVCERIQNLGRKKENTLPEKEFLV
                     YQSTLEIPNQGNYYDRRIGDDADDETYLALIARALEQARYEFTLARGELSSYYGCEL"
     gene            <118519..>119472
                     /gene="TDEL0A00710"
                     /locus_tag="TDEL_0A00710"
                     /db_xref="GeneID:11503021"
     mRNA            <118519..>119472
                     /gene="TDEL0A00710"
                     /locus_tag="TDEL_0A00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678566.1"
                     /db_xref="GeneID:11503021"
     CDS             118519..119472
                     /gene="TDEL0A00710"
                     /locus_tag="TDEL_0A00710"
                     /inference="similar to DNA sequence:INSDC:YNL217W"
                     /note="similar to Saccharomyces cerevisiae YNL217W;
                     ancestral locus Anc_2.28"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678614.1"
                     /db_xref="GeneID:11503021"
                     /db_xref="GOA:G8ZLA9"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8ZLA9"
                     /translation="MKRIVGGIVFVVAVVCLTVASSWKSYRMENTELNGAPIKIEFPQ
                     LRLLEQWTMPTDQDWRLIFVGDVHGQYTELMNIVEGELGGLDDQTTLVLLGDVVSKGP
                     DSGRVIQFILEYRDRVKCVLGNHDLAVLFALVNPELSNHHNLLPLRVGDSQFIPKDLS
                     KVKKMHQQLAHELGFVKAKSWALHSSLAVQFTLPNGQILYGCHAGMLPGDFSQRTPSV
                     HALTEMKFVDPKDWTHTSKEKFKNSKHWYKLWDDVSEHITVLYGHDAKRGLNLRSHTK
                     GLDSGCVKGKELSALQYSYDHITGKITTKLFQTSCVNNQAK"
     gene            <119639..>121675
                     /gene="TDEL0A00720"
                     /locus_tag="TDEL_0A00720"
                     /db_xref="GeneID:11502578"
     mRNA            <119639..>121675
                     /gene="TDEL0A00720"
                     /locus_tag="TDEL_0A00720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678567.1"
                     /db_xref="GeneID:11502578"
     CDS             119639..121675
                     /gene="TDEL0A00720"
                     /locus_tag="TDEL_0A00720"
                     /inference="similar to DNA sequence:INSDC:YNL216W"
                     /note="similar to Saccharomyces cerevisiae RAP1 (YNL216W);
                     ancestral locus Anc_2.29"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678615.1"
                     /db_xref="GeneID:11502578"
                     /db_xref="GOA:G8ZLB0"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR015280"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="InterPro:IPR021661"
                     /db_xref="UniProtKB/TrEMBL:G8ZLB0"
                     /translation="MSSPAEFQDASEDQQEDGLFSGMRFYLNCGADSGAESRQLGDLI
                     ESRGGEVVDKLPEDVKEGEKLYVVALYNDTRLPTVTPAYIKACCENGTLLKIENYLIP
                     FDEFRSVIDTELQNEQQQDGGGPQKVEEKQPEETPKPEPEQDKAVEQPAEQPVEQPLV
                     EMVQQGSPKVQETEESSDGSSDQNYPSMRSVLRANLPAHNKASFTEAEDEFILDVVRK
                     NPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEFVYATDKNGKLERDEHGNL
                     IKTKNLPPSIKKKFTADEDYLLAIGIKKQFYRDLYQVDPDTGKSLITDEDSPTAVAKR
                     NMTMDPNHVPGTEPSFQDYRVGDRRGPIAREFFKSFGENNPTHTENAWRDRFRKFLLS
                     YGIDNYVGYYETAKEQGQEPEPMKNLTNRVKRPGIPTPGNYNSATKRARSIGPEKASP
                     NGSVAPSSAAAAIAATAGNGGNNLENGAANYALAENELLDEDTMNFISSLKNDLSKIE
                     SSIPFEYPQEIAEAIRNDFSNEEAIYDNVDPDTLPFPPAIASTDLFLPAFFRMSSTRE
                     FLEKLQEVISRDYEPSQAEKLVQDLCNETGVRKTFSTSILTALSGDLMVFPRYFLNMF
                     KNNANPPMDVPGIWTREDDRMLRSNKEEDIRALIKKHGSGRMEMRKKFVEKDLI"
     gene            complement(<121965..>124229)
                     /gene="TDEL0A00730"
                     /locus_tag="TDEL_0A00730"
                     /db_xref="GeneID:11502874"
     mRNA            complement(<121965..>124229)
                     /gene="TDEL0A00730"
                     /locus_tag="TDEL_0A00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678568.1"
                     /db_xref="GeneID:11502874"
     CDS             complement(121965..124229)
                     /gene="TDEL0A00730"
                     /locus_tag="TDEL_0A00730"
                     /inference="similar to DNA sequence:INSDC:YDL234C"
                     /note="similar to Saccharomyces cerevisiae GYP7 (YDL234C);
                     ancestral locus Anc_2.30"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678616.1"
                     /db_xref="GeneID:11502874"
                     /db_xref="GOA:G8ZLB1"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:G8ZLB1"
                     /translation="MSMELLFCKSKVFVHPSKSSQDNIPGFLIITLEQGQPRQECVLA
                     WVPESALDKKQLNWLYHADLTLGKSELQKLKMGPGTLGGISSMAWSFSIKLGYLYSIE
                     FRVPSPTGLWHGSVILHSKSPQEDDTLPVLFFHDKACPSTERKMKELNKSFDPFTSSG
                     DIYWGGIDFRSSVASLVDLKQTYVDPTVWLVNASLDDLRNFSPQLMQRRLSEGKAKTE
                     VGSSNLWDKWEAAKWGFMTRVADATSKTGSYMGSLIRKHPLVMLAEKNGNNPYVKKLL
                     ENPRVQEVQDDFDSARVYLAKWALGVKQQADQYQRTHEIGDSYRKALTKELGFDSQSD
                     VQFTEEELSRALERKFPVSKQKWESFFDSQGRISLTVNEVKDFIFHGGIEDFGTRKEV
                     WLFLLGVYPWDSSSDEREQLDQTLAEIYNNNYKSKWLNRSTHPDAQEEEYWQDQLFRI
                     EKDVKRNDRNFDIYKYNTPDGSAPETKETEDPSEGDKTEESEHWSIKNPHLLSLKNIL
                     ICYNIYNPNLGYVQGMADLLSVVYYIVRDEALSFWCFVNFMDRMERNFLRDQSGIRDQ
                     MLTLTELCQLLLPQLTEHLNKCDSSNLFFCFRMLLVWFKREFEFPDVCSIWEIFLTDY
                     YSSQFQLFFMLAILQKNSQPIIQNLNQFDQVLKYFNDLHGTMDWSDLMTRSELLFIRF
                     KKIMEVMERKSEIEENIPNNDGGKTTGVQLHDFEIEDNDNQTLPCASKYLQLLLSKKL
                     VVQRENPRAKDSIK"
     gene            <124415..>125260
                     /gene="TDEL0A00740"
                     /locus_tag="TDEL_0A00740"
                     /db_xref="GeneID:11503022"
     mRNA            <124415..>125260
                     /gene="TDEL0A00740"
                     /locus_tag="TDEL_0A00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678569.1"
                     /db_xref="GeneID:11503022"
     CDS             124415..125260
                     /gene="TDEL0A00740"
                     /locus_tag="TDEL_0A00740"
                     /inference="similar to DNA sequence:INSDC:YNL215W"
                     /note="similar to Saccharomyces cerevisiae IES2 (YNL215W);
                     ancestral locus Anc_2.31"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678617.1"
                     /db_xref="GeneID:11503022"
                     /db_xref="GOA:G8ZLB2"
                     /db_xref="InterPro:IPR006880"
                     /db_xref="UniProtKB/TrEMBL:G8ZLB2"
                     /translation="MDSDLSDLRSEASESSGKGEEFDGELANEKINGDDEDYVDEFEE
                     VKATKPRRTGSRRETSKRGKSTLAEDDDADFDEVIPSRKRTKVSKTVQDEDDEDDLID
                     EQKVEPGFEDVGFESQEDSEKIDQIDMDEDDDLSVDAGSRLPSRMLDDEDEEETREDT
                     QDSLKPPNKSKMLRSLLGNSQGRKALTEEEVQLKRAENARKRKNLSEKRIEEEKQETI
                     NKLLRRRAGKSRSHLPKDDEPEDGSTDAMAFAKPRRPYDSTGMTRTLRKYEQDLYCTV
                     SPNQN"
     gene            <125602..>127410
                     /gene="TDEL0A00750"
                     /locus_tag="TDEL_0A00750"
                     /db_xref="GeneID:11503258"
     mRNA            <125602..>127410
                     /gene="TDEL0A00750"
                     /locus_tag="TDEL_0A00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678570.1"
                     /db_xref="GeneID:11503258"
     CDS             125602..127410
                     /gene="TDEL0A00750"
                     /locus_tag="TDEL_0A00750"
                     /inference="similar to DNA sequence:INSDC:YDL233W"
                     /note="similar to Saccharomyces cerevisiae YDL233W;
                     ancestral locus Anc_2.32"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678618.1"
                     /db_xref="GeneID:11503258"
                     /db_xref="InterPro:IPR029005"
                     /db_xref="UniProtKB/TrEMBL:G8ZLB3"
                     /translation="MNGSRKRQVEWAERHERGENLRHQQPSQEVGSRVFPVTNQAPMQ
                     QQMYPFVPPQQHHPSDYVQGQAPFVLASRTNDSTYNGTAFPMGLNGTVGPSRISTAIP
                     QQPKSANQVVPPTGIPFDNGELAQTVPGYYPQAQLSRKSAEVKTFVQAYNTGPGAPAN
                     MQTPHEAKHSTGNTGFPGPYPTGTHGPIYTAGMNTSPNPETTDENLNHQRSIDEEVTN
                     NGAQIHAPGGNMMTAALRFQNLRKYHSDRAILRLHEFINTINQSGPKMADSEYWRKKM
                     NEMFVPRATLRYTKKVNSEYKYFEIAALMMPMMWVALSTLDVRRIEIVMMQLRADTLS
                     NGNVFFHTPALTFSYHYSDGSQITYHAHMKGSFSQALKLEWLDVLVHKFTPGLSWNSM
                     EKMLRTRPETVVKLSQRLLEAKENDAKIAEKGKDAEQKQDATIHNTIKELQSNFKVFR
                     NISDQGIHEGMMRVLQVGDVMSALTDVYLYQKDRNIKSPLESLSLYVKDIKDGANSSS
                     MTENIDGRTSVENSDTFKTERLAAGSDSMAMGNASPACSPRDVKGMRSGSVESVPAVR
                     RRRSNKAVSRSAKTPSDTTPSHDDRNGIPGTKKIKF"
     gene            <127779..>128366
                     /gene="TDEL0A00760"
                     /locus_tag="TDEL_0A00760"
                     /db_xref="GeneID:11503243"
     mRNA            <127779..>128366
                     /gene="TDEL0A00760"
                     /locus_tag="TDEL_0A00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678571.1"
                     /db_xref="GeneID:11503243"
     CDS             127779..128366
                     /gene="TDEL0A00760"
                     /locus_tag="TDEL_0A00760"
                     /inference="similar to DNA sequence:INSDC:YNL214W"
                     /note="similar to Saccharomyces cerevisiae PEX17
                     (YNL214W); ancestral locus Anc_2.33"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678619.1"
                     /db_xref="GeneID:11503243"
                     /db_xref="UniProtKB/TrEMBL:G8ZLB4"
                     /translation="MNIETGIDWPKDDLIVQVHRRRTIGDTIQNLFSNTGIAVSILYI
                     LIKKIIEPCLESHFSQRTSLSVSTLIQLRRLVATLQGKLIYTPISSIGFDEEDGKVER
                     STQTSEDGKLLEARESRWKRLNDCLKEANGNLQSFNTTAIDSSINMDSFQFQMKLVVD
                     GIRLNEDADETSEHCRRIVDSVREVKGLLVNGRFP"
     gene            complement(<128416..>129051)
                     /gene="TDEL0A00770"
                     /locus_tag="TDEL_0A00770"
                     /db_xref="GeneID:11503108"
     mRNA            complement(<128416..>129051)
                     /gene="TDEL0A00770"
                     /locus_tag="TDEL_0A00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678572.1"
                     /db_xref="GeneID:11503108"
     CDS             complement(128416..129051)
                     /gene="TDEL0A00770"
                     /locus_tag="TDEL_0A00770"
                     /inference="similar to DNA sequence:INSDC:YNL213C"
                     /note="similar to Saccharomyces cerevisiae YNL213C;
                     ancestral locus Anc_2.34"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678620.1"
                     /db_xref="GeneID:11503108"
                     /db_xref="InterPro:IPR010487"
                     /db_xref="UniProtKB/TrEMBL:G8ZLB5"
                     /translation="MNFPRVFSRLLHYGQPLWQDAGRGKTAKQVLKFMNNQPSQKNDV
                     PHEKLPSWKKQTLALKEKFNGERWNPAKKLSRAEMESMRVLRDRFPQLTASDLAERYK
                     VSPEVVRRILKSKWQPTEEEMVRIHERWKRRGERIQELYSSTPDLINPTDKVIVPKKI
                     SISSARDSSEFIVRKVNNMAKRSQARDMTNSGNKSATSKNKLFLLQRSTSK"
     gene            <129292..>131685
                     /gene="TDEL0A00780"
                     /locus_tag="TDEL_0A00780"
                     /db_xref="GeneID:11503257"
     mRNA            <129292..>131685
                     /gene="TDEL0A00780"
                     /locus_tag="TDEL_0A00780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678573.1"
                     /db_xref="GeneID:11503257"
     CDS             129292..131685
                     /gene="TDEL0A00780"
                     /locus_tag="TDEL_0A00780"
                     /inference="similar to DNA sequence:INSDC:YNL212W"
                     /note="similar to Saccharomyces cerevisiae VID27
                     (YNL212W); ancestral locus Anc_2.35"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678621.1"
                     /db_xref="GeneID:11503257"
                     /db_xref="InterPro:IPR013863"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:G8ZLB6"
                     /translation="MNLIRKFMDSGVKSELALIASGQFDLLRSKRSPKASLECIYTDA
                     TLSLRETGQYSYALVVRKNADELEVSNGDGSDDFSDDSVSALSVQSKKKEDEWVFELS
                     EETGFHKRWNKHGDMSFLWNNTLGDEEDEKVQFVVASDVSMGDCDKFLLTAQRCEYEV
                     KYKESYSNATREDLKKIAAHAALLANDFDYESVSASDKDRLDLAENLRSLELEESNES
                     DSSEFEDAKETVQDLKTPVKEIKSGPKGGQLCLLTCEISIFDPKLEKFVLQSDNVRAA
                     VIETGNYEFWLAIEGDDLRLGTNISPKINPTTDVQRNAFIFNYAFSGITLSYMLTFAT
                     KVDCLTFESTVSRCLWLSLNRTPWDKVPDQGKQYIVSSATAVERELDEILADDYSESE
                     SENESSDEESDEEEHSKIAISSESFGDFSKGRIRDEGNRSLTVAFKNDRSYVVRGDKI
                     GVFKTDSEGLDFVTAIRDVKDLSGKRLDPQNPMLYMEDQAMIIRDGINGNKLYKMDLE
                     RGQVIEEWEAGGKNVVQVGPTKKFDQLTPEQTLLGVSNKGLFKLDPRLNKKDKVVQDQ
                     SKEYATNYKFSSLGTTENGYIAVGSEKGDVRLYDRLGIRAKTAIPSLGQPIEHITTSS
                     DGRWLLCTCESSLLLFDLTVKTGKNAGNIGFLKSFPKDENAKTYILKISPEHASYIVT
                     STKKPIKFSKAYFNTGIGKEEQTIVTSSGPFAISWSLKKVLKGDKKPYVMKKYQADVI
                     EDNFEFGTDRKVIVALKNDVSMSKIRSFKSPDKQIMAPNLSLFYSDEDEEKTVVKPE"
     gene            complement(<131752..>132015)
                     /gene="TDEL0A00790"
                     /locus_tag="TDEL_0A00790"
                     /db_xref="GeneID:11502791"
     mRNA            complement(<131752..>132015)
                     /gene="TDEL0A00790"
                     /locus_tag="TDEL_0A00790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678574.1"
                     /db_xref="GeneID:11502791"
     CDS             complement(131752..132015)
                     /gene="TDEL0A00790"
                     /locus_tag="TDEL_0A00790"
                     /inference="similar to DNA sequence:INSDC:YNL211C"
                     /note="similar to Saccharomyces cerevisiae YNL211C;
                     ancestral locus Anc_2.36"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678622.1"
                     /db_xref="GeneID:11502791"
                     /db_xref="InterPro:IPR020301"
                     /db_xref="UniProtKB/TrEMBL:G8ZLB7"
                     /translation="MRKPPRSLEEWLYYKLMDSQGFHRFVGKVYRKVNNIQDPNYEKA
                     SSISESTFKPSSLQMFKAYRMLFWDEIRGIFGLPRKTNKYFKD"
     gene            <132193..>132309
                     /gene="TDEL0A00800"
                     /locus_tag="TDEL_0A00800"
                     /db_xref="GeneID:11502851"
     mRNA            <132193..>132309
                     /gene="TDEL0A00800"
                     /locus_tag="TDEL_0A00800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678575.1"
                     /db_xref="GeneID:11502851"
     CDS             132193..132309
                     /gene="TDEL0A00800"
                     /locus_tag="TDEL_0A00800"
                     /inference="similar to DNA sequence:INSDC:YDL232W"
                     /note="similar to Saccharomyces cerevisiae OST4 (YDL232W);
                     ancestral locus Anc_2.37"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678623.1"
                     /db_xref="GeneID:11502851"
                     /db_xref="InterPro:IPR018943"
                     /db_xref="UniProtKB/TrEMBL:G8ZLB8"
                     /translation="MINDNQLNTLVISLGLVMMTLIVVYHAISSTVGKKAKA"
     gene            complement(<132428..>135715)
                     /gene="TDEL0A00810"
                     /locus_tag="TDEL_0A00810"
                     /db_xref="GeneID:11502852"
     mRNA            complement(<132428..>135715)
                     /gene="TDEL0A00810"
                     /locus_tag="TDEL_0A00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678576.1"
                     /db_xref="GeneID:11502852"
     CDS             complement(132428..135715)
                     /gene="TDEL0A00810"
                     /locus_tag="TDEL_0A00810"
                     /inference="similar to DNA sequence:INSDC:YDL231C"
                     /note="similar to Saccharomyces cerevisiae BRE4 (YDL231C);
                     ancestral locus Anc_2.38"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678624.1"
                     /db_xref="GeneID:11502852"
                     /db_xref="InterPro:IPR018823"
                     /db_xref="InterPro:IPR023244"
                     /db_xref="UniProtKB/TrEMBL:G8ZLB9"
                     /translation="MVEGSLSGSLSGSLPVGKDSRSADVGISKGSYSHASYMSLRDMN
                     NKSGNVPSPQVSRVNLSRLRLDSSAKIKAWKDLDDFNLEELRDGFFDPAFTKPEKHVQ
                     HDDKEVDNGLFCLHTIPAEAKQFIRYKELLNNFWAQKLSIFKYSVAFFISLVICVIHP
                     SGKWIGDEYRYFLPIATLIHHPVRNIGVQAEMTIASVIGASFGLGWSALAWYISVATR
                     PTAIHQGGVLFASLTLALLWSTWLRELYQRLQYITLSFSIAIIFLHNVSLVSSKQDLH
                     WKVFWDFGISYLFGILLSLVVCVFVDPHSGNAELMEHFGDSITNIRQFLLALIDKGDG
                     LDERKLKELQQNMVNSITVDLSEGYREFANQWTVSKFNAHYLKELRNSLTSFMSPLRA
                     LPVGHKLLDNAELEKLYNKLMNRQSRTDDTEAGTDCTTEHASPMDYSNPVTPLPTGFG
                     SLPKGVALNSELYLSVLRSTFSKDIFALIVEMIIVLENMAKVLKCFEKSKSKKDEIEE
                     LNKLFNHSSQKLKRKIYNLDVCYKEFTKSNFFCKELLTDADSVDIFLFLRYLRNAAKH
                     LILANENCQRLGSDIKWRIVPMHYPLQRALLRLPKQCSLDEGAANILHYFETKKDVDD
                     IFERLYNAYTSRHQYKRHGEKNTMVSVRAIDHNDFNFHTTNNRWRFRLWKVSSLLVGA
                     EMKWTIKVLFVMIFYCLPGWIPESHGWYDYYQCWWAPLTFFLLAHRKLSGTWDTMLRR
                     LGCALVGIFWGWAANQSRHFGSPYVICTFGGLIVIVFATNVLVYKNTKSSFTALMCFS
                     VIALKPYSEGSSSLNTAAIWKNTWVTGLAFIIAVLTSVPVNWIAWSFKARSELRLSVS
                     SLLAHLSQSYQSVTDRYLYRDMNDAPTELTLALSHIREVRLTQSAVAVRDLITKSANE
                     LSLISDFSPAKYYRLLDACDFLLEKIVEARISGSFFEIWNGDPDNESTRALLSLRRDS
                     VSSVIFVFYILSNCYRTKNKIPMYLPNPMVSRKKLYDFLAELEMQNSKNPPCLTSRAS
                     TACHNISLEKKMFKEHAPSYDTEDYEKSRWTEIHGMAFARAFTDITEAMQVVVACSKD
                     ILGEEVV"
     gene            <135976..>136992
                     /gene="TDEL0A00820"
                     /locus_tag="TDEL_0A00820"
                     /db_xref="GeneID:11502853"
     mRNA            <135976..>136992
                     /gene="TDEL0A00820"
                     /locus_tag="TDEL_0A00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678577.1"
                     /db_xref="GeneID:11502853"
     CDS             135976..136992
                     /gene="TDEL0A00820"
                     /locus_tag="TDEL_0A00820"
                     /inference="similar to DNA sequence:INSDC:YDL230W"
                     /note="similar to Saccharomyces cerevisiae PTP1 (YDL230W);
                     ancestral locus Anc_2.39"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678625.1"
                     /db_xref="GeneID:11502853"
                     /db_xref="GOA:G8ZLC0"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G8ZLC0"
                     /translation="MKCAVPWYLKQSDKELVGKFRFIQQQEDERLREATIDGKNSRWS
                     LGVSVDEQNDERNRYVNIMPYERNRVKLDVMKGNNYINASFVKLDVQGQSLGPGHYIA
                     TQGPTRETWPQFWQMCYQKCPNENIVVVMVTPLIESNRVKCHQYWPLGPQAEDQTRTS
                     PQLQFPGGILDETKFNDEIVIEYQDEVRIEDLYTLTTLKMKPQHGSGPVKTVHHFILY
                     QWRDMSKPEEVVPIMKLCKHSHSCNSPGNPIVVHCSAGVGRSGTFIALDHLIHDTRDF
                     SPAKNDHGELVPVQDYKHDLIEQIVLQLRSQRLKTVQMIDQYMFIYHAAKYLYDLSQK
                     KRLK"
     gene            <137075..>137872
                     /gene="TDEL0A00830"
                     /locus_tag="TDEL_0A00830"
                     /db_xref="GeneID:11502854"
     mRNA            <137075..>137872
                     /gene="TDEL0A00830"
                     /locus_tag="TDEL_0A00830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678578.1"
                     /db_xref="GeneID:11502854"
     CDS             137075..137872
                     /gene="TDEL0A00830"
                     /locus_tag="TDEL_0A00830"
                     /inference="similar to DNA sequence:INSDC:YNL210W"
                     /note="similar to Saccharomyces cerevisiae MER1 (YNL210W);
                     ancestral locus Anc_2.40"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678626.1"
                     /db_xref="GeneID:11502854"
                     /db_xref="GOA:G8ZLC1"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:G8ZLC1"
                     /translation="MESPLKDLDVNVAFRCGDTDVKRVVREEPPMAKVMDALECGETW
                     YNQSGLDERCVSLEIDWFEFRAIEWNQGLIAVFNTHKGTVAAKCRMEQEVIKALSKCR
                     WVTLHLTQMMCKDDLSFQSDFRLCADFKSISIAKPQFEPLYKDLMNHLDLFEHQWTQL
                     MPSIPPKDPGLSGCILASPSAPSIETQELSLTPRQVTYLIGTAGTRIETTRDHSQATI
                     KVLPLPHRTRSKTQTLAITGTTHQVAAALALLEAQLTIHKLQPNRLF"
     gene            <138115..>139956
                     /gene="TDEL0A00840"
                     /locus_tag="TDEL_0A00840"
                     /db_xref="GeneID:11502855"
     mRNA            <138115..>139956
                     /gene="TDEL0A00840"
                     /locus_tag="TDEL_0A00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678579.1"
                     /db_xref="GeneID:11502855"
     CDS             138115..139956
                     /gene="TDEL0A00840"
                     /locus_tag="TDEL_0A00840"
                     /inference="similar to DNA sequence:INSDC:YDL229W,YNL209W"
                     /note="similar to Saccharomyces cerevisiae SSB1 (YDL229W)
                     and SSB2 (YNL209W); ancestral locus Anc_2.41"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678627.1"
                     /db_xref="GeneID:11502855"
                     /db_xref="GOA:G8ZLC2"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:G8ZLC2"
                     /translation="MAEGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFV
                     AFTPEERLIGEAAKNQAALNPENTVFDAKRLIGRRYDEESVQNDMKTWPFKVIDVEGS
                     PVIEVQYLGETKTFSPQEISAMVLTKMKEIAEAKIAQKVEKAVITVPAYFNDAQRQAT
                     KDAGSIAGLNVLRIINEPTAAAIAYGLGAGKSDKERHVLIFDLGGGTFDVSLLHIAGG
                     VYTVKSTSGNTHLGGQDFDTNMLEHFKAEFKKKTGSDISKDARALRRLRTAAERAKRT
                     LSSVTQTTVEVDSLFDGEDFETSITRARFEDLNSALFKSTLEPVEQVLKDAKISKSQI
                     DEVVLVGGSTRIPKVQKLLSDFFEGKQLEKSINPDEAVAYGAAVQGAILTGQSTNDET
                     KDLLLLDVAPLSLGVGMQGDIFGIVVPRNTTVPTIKRRTFTTVADHQTTVQFPVYQGE
                     RVNCKENTLLGEFDLKNIPPMSAGEPVLEAIFEVDANGILKVTAVEKSTGKSANITIS
                     NAVGRLSSDDIEKMVNQAEEFKAADEAFAKRHEARQRLESYVASIEQNVTDPVLSSKL
                     KRGSKSKIEAALSDALAALEIEDASTDDLRKAEVGLKRVVTKAMSSR"
     gene            complement(<140069..>141814)
                     /gene="TDEL0A00850"
                     /locus_tag="TDEL_0A00850"
                     /db_xref="GeneID:11502856"
     mRNA            complement(<140069..>141814)
                     /gene="TDEL0A00850"
                     /locus_tag="TDEL_0A00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678580.1"
                     /db_xref="GeneID:11502856"
     CDS             complement(140069..141814)
                     /gene="TDEL0A00850"
                     /locus_tag="TDEL_0A00850"
                     /inference="similar to DNA sequence:INSDC:YDL227C"
                     /note="similar to Saccharomyces cerevisiae HO (YDL227C);
                     ancestral locus Anc_2.42"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678628.1"
                     /db_xref="GeneID:11502856"
                     /db_xref="GOA:G8ZLC3"
                     /db_xref="InterPro:IPR004042"
                     /db_xref="InterPro:IPR006142"
                     /db_xref="InterPro:IPR007868"
                     /db_xref="InterPro:IPR007869"
                     /db_xref="InterPro:IPR027434"
                     /db_xref="InterPro:IPR028992"
                     /db_xref="UniProtKB/TrEMBL:G8ZLC3"
                     /translation="MFEQGTKIMMANGQAKDIQDIAINSYVLCADGTIDRVTSISQDV
                     QTTYQILQKTKHRANEGEPGREDPMRRQVFHRLGFKCTVAHKLPLRTASKPTLENSFK
                     RNNFKVKWKNMEEHLTFDGRIVSLPKTHHKDFPMTSEGEFRARSFMAEKEAEHGRYLE
                     FSIQVRDLDLLEAQIRVNSFLRFSPVVTGRGILSEFLTGQKHLITPYVLDMAWLLGLW
                     LGDGTTKEPEISVDSFDTCLMEGLIERCKTWGLFPTYKDEPIPLRAKHTRLYFGQEPD
                     GNRRNRNLRKDNPFWNAVINLKFKRDLDGEKQVPSFMWTEDIEVREAFLAGLIDSDGY
                     VVKRNEGPDAFKASIQTIYPSIMNGIVHVSRSLGIASTVTTRSARTETIEGRKVNCHF
                     TYDCHIAGRTPLQKVLSYCCSGHKKRPVPKVIIREPIYFGFNEEKRGLQPVFGITTEQ
                     GKKILLDNKLVAHTCGEHCIKEQPKFTTTKGLKHCIACPRKGVRYFYKDWSGNHRICG
                     RCYGRYKFSGYRCLNCKYVPEAREVRKAKQRGEELGVSPDGITVSGLICGRCKGILKF
                     DEIRGPRKVNAIIAS"
     gene            <143723..>144982
                     /gene="TDEL0A00860"
                     /locus_tag="TDEL_0A00860"
                     /db_xref="GeneID:11502857"
     mRNA            <143723..>144982
                     /gene="TDEL0A00860"
                     /locus_tag="TDEL_0A00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678581.1"
                     /db_xref="GeneID:11502857"
     CDS             143723..144982
                     /gene="TDEL0A00860"
                     /locus_tag="TDEL_0A00860"
                     /inference="similar to DNA sequence:INSDC:YNL207W"
                     /note="similar to Saccharomyces cerevisiae RIO2 (YNL207W);
                     ancestral locus Anc_2.44"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678629.1"
                     /db_xref="GeneID:11502857"
                     /db_xref="GOA:G8ZLC4"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR015285"
                     /db_xref="InterPro:IPR018934"
                     /db_xref="UniProtKB/TrEMBL:G8ZLC4"
                     /translation="MKLDMGHMRYLTADDFKVLKAVEQGTKNHEVVPTGMIHQISGMR
                     ASSGTNRAIGDLAKVKLVAKVRNAKYDGYKLTYNGFDYLAVKSMLNRDTVYSFGNTIG
                     VGKESDIYQVSDKNGVAKVMKIHRLGRTSFHTVKNNRDYLKKNAHGTNWMHLSLLAAQ
                     KEYQFMSLLYSKGFIVPQPYDNSRHIVLMELIDGFPMRNLRNHSNIPKLYSDLMTFAV
                     KLANSGLIHCDFNEFNIMIKNTVEDSKDCGFVVIDFPQCISIQHKDADFYFQRDIECI
                     RRFFRKKLKYDPTPDPTMLDEDGYGDGYRYAYPEFERDVHRCDNLDELVQASGFSKKH
                     PGDRSLEEAVDSMRNAEYNSEDDEQYSDEEEEESEDYYTESDEDNDSEGSTTDEEEEE
                     NERIIEALSKGVGNLKMDKLGNYILED"
     gene            complement(<145028..>146287)
                     /gene="TDEL0A00870"
                     /locus_tag="TDEL_0A00870"
                     /db_xref="GeneID:11502858"
     mRNA            complement(<145028..>146287)
                     /gene="TDEL0A00870"
                     /locus_tag="TDEL_0A00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678582.1"
                     /db_xref="GeneID:11502858"
     CDS             complement(145028..146287)
                     /gene="TDEL0A00870"
                     /locus_tag="TDEL_0A00870"
                     /inference="similar to DNA sequence:INSDC:YNL206C"
                     /note="similar to Saccharomyces cerevisiae RTT106
                     (YNL206C); ancestral locus Anc_2.45"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678630.1"
                     /db_xref="GeneID:11502858"
                     /db_xref="InterPro:IPR013719"
                     /db_xref="UniProtKB/TrEMBL:G8ZLC5"
                     /translation="MDPFLARLPDELRSKVVGVVNVVPESLAVFEEIYKYASLDDGGQ
                     SRKTRKVEEVDQIDFKVPDESQVIFSIEDASILSPVRKKLNFVLHLSPESKPMISLIK
                     GDKIELSITELKKNITMATFLPVAEKQNYLYIFINYANTVDNKYTDPVLMTLNKNTML
                     TQFKQSGFLDASVDDFTKCIEYMRKQAILAGFRISDPFFTNHQEAEQNSSFHVECHRG
                     TKEGTLYFLPDHIIFGFRKPILLFNSSDIESITYSSITRLTFNVTLVTKDGSKYEFSM
                     IDQNEYSKIDEYVRRKQVKDKSMSEELKAKSKNKANQDNEDAPSALEEAAQQMGNGPT
                     LELNSDDDEEADQNFEAESDLSDGSGEESGAEEAEDGEADSENGNEEGLTANNHAVKE
                     DDFEVGLQDIPIEVDDEDDEGSGVEYA"
     gene            complement(<146523..>147599)
                     /gene="TDEL0A00880"
                     /locus_tag="TDEL_0A00880"
                     /db_xref="GeneID:11502859"
     mRNA            complement(<146523..>147599)
                     /gene="TDEL0A00880"
                     /locus_tag="TDEL_0A00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678583.1"
                     /db_xref="GeneID:11502859"
     CDS             complement(146523..147599)
                     /gene="TDEL0A00880"
                     /locus_tag="TDEL_0A00880"
                     /inference="similar to DNA sequence:INSDC:YDL226C,YNL204C"
                     /note="similar to Saccharomyces cerevisiae GCS1 (YDL226C)
                     and SPS18 (YNL204C); ancestral locus Anc_2.46"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678631.1"
                     /db_xref="GeneID:11502859"
                     /db_xref="GOA:G8ZLC6"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:G8ZLC6"
                     /translation="MSEWKVDPENRRRLLQLQKIGANKKCVDCEAPNPQWASPKFGVF
                     ICLECAGVHRSLGVHISFVRSITMDQFKPEELARMEKGGNEPFKEYMVAHNVDLTLPH
                     KVKYDNPIAEDYKQKLTCEVDGETFVEPEHPGFDAASLGKSSVQPEALAEVSRQQTPI
                     ESRRSVTPKNSIDQKTKNQAYFEQLGKQNQGKPNHLPPSQGGKYQGFGNTPASNDTSN
                     GQSAQQSNTLSLDNFQKDPLGTFTKGWGLFSSAVTKSFEEVNESVIKPGYQQWQSGEL
                     SEDTKRAAAQFGQKVQETSHLSMQAFSSFTKNIQHQYIGDDAAGNPQYSQIPQTTSQE
                     GLNQKSAPLNEKSKKAAEDEWDDF"
     gene            <147970..>148836
                     /gene="TDEL0A00890"
                     /locus_tag="TDEL_0A00890"
                     /db_xref="GeneID:11502905"
     mRNA            <147970..>148836
                     /gene="TDEL0A00890"
                     /locus_tag="TDEL_0A00890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678584.1"
                     /db_xref="GeneID:11502905"
     CDS             147970..148836
                     /gene="TDEL0A00890"
                     /locus_tag="TDEL_0A00890"
                     /inference="similar to DNA sequence:INSDC:YNL202W"
                     /note="similar to Saccharomyces cerevisiae SPS19
                     (YNL202W); ancestral locus Anc_2.47"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678632.1"
                     /db_xref="GeneID:11502905"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZLC7"
                     /translation="MVNTLDDSFVTEGTWKPNLFKGKVVLVTGGAGSICRVQTEAMVL
                     LGARAAIIGRRKEATVEAAEEISKLGEEGCVLPVYGVDVRNFEEVKDAVAQTVAKFGR
                     IDYVIAGAAGNFISDFQHLSPNGFKSVVDIDLLGSFNTAKACVSELQKTKGAIIFISA
                     TLHYYGVPFQAHVGAAKAGVDALSNALAVELGPLGIRCNCIAPGPIGDTEGLKRLVQS
                     GLKDKLITMVPLQRLGKREDVANTTVFLFSSAASFVNGSISVVDGGAWHIGTHFAQDM
                     YPEFVKGLKSQL"
     gene            complement(<148899..>151346)
                     /gene="TDEL0A00900"
                     /locus_tag="TDEL_0A00900"
                     /db_xref="GeneID:11502623"
     mRNA            complement(<148899..>151346)
                     /gene="TDEL0A00900"
                     /locus_tag="TDEL_0A00900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678585.1"
                     /db_xref="GeneID:11502623"
     CDS             complement(148899..151346)
                     /gene="TDEL0A00900"
                     /locus_tag="TDEL_0A00900"
                     /inference="similar to DNA sequence:INSDC:YNL201C"
                     /note="similar to Saccharomyces cerevisiae PSY2 (YNL201C);
                     ancestral locus Anc_2.48"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678633.1"
                     /db_xref="GeneID:11502623"
                     /db_xref="InterPro:IPR006887"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZLC8"
                     /translation="MPLEDSGCIDESAREEVLIPDTEPKRVKAYVLENNEWKDTGTGF
                     CIGKLDKEDEGRATSAYLVVTNEDAPREVLLRSKLEGNIEYQRQEETLIVWKDLNGRD
                     IALSFEESLGCDVLCEFIVEVQRHSETNISLVAVKSNDNGVGSVHEIITGPVSLPSVD
                     PEQNEQTLMESLRILNENVAFEFLKNETIEFILKSDYVGLLISHFHKAEAAKLPKDLF
                     LLGSLVKTLILYNQRDVLEKMTEDEYIMGIVGILEYDTEFPDSKTNHRKCLESNSPSI
                     KEVIPIQNEELKNILKKCFRLQFLKDVVLVRFLDDHNISFILDIILDLQTCIIDFIKV
                     DPFLDTLFALYDERPPEDVDAELIEKRKDGIRLLHQCVQMSKNLDAADKETFYRTLVG
                     KDIFKVLDYAFHKETESSLRILATDTIITIIEYDVLLIPNVQRLKPSSKNSDKEAKDE
                     NADQQSKPEGSEISLLLILSAILLTDKSPGMREQVSQALHTLLHPDGCLENDIALENN
                     HPGNVDLISDMNYDMHNGSDNINGFSSSSSHVMESFGNFYSQVAPVLFQPLIKDSKDK
                     NKLIDDDNLLIHLVKLVSLVCTEHNRRISREFILENGIVESLSHLIEPTHNLQLRLTA
                     VRCFKNIMCLDDDYYHRHMISKKLYRPIFKLLEENLDKDNLANSCVQDFCKIVLVHCL
                     STRTEANGKQQEMLRRKSNFTLLSKHIMEEYGEILQRARQIRVFNELIEFNQEQKATE
                     VDGSDDREDISMDNDVNDSAHLTLDDESKVFKRLHSEVTDVESPFGPTTLHTKKIIEK
                     LNTVEPPSAMLGKLMRE"
     gene            complement(<151710..>152444)
                     /gene="TDEL0A00910"
                     /locus_tag="TDEL_0A00910"
                     /db_xref="GeneID:11503140"
     mRNA            complement(<151710..>152444)
                     /gene="TDEL0A00910"
                     /locus_tag="TDEL_0A00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678586.1"
                     /db_xref="GeneID:11503140"
     CDS             complement(151710..152444)
                     /gene="TDEL0A00910"
                     /locus_tag="TDEL_0A00910"
                     /inference="similar to DNA sequence:INSDC:YNL200C"
                     /note="similar to Saccharomyces cerevisiae YNL200C;
                     ancestral locus Anc_2.49"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678634.1"
                     /db_xref="GeneID:11503140"
                     /db_xref="GOA:G8ZLC9"
                     /db_xref="InterPro:IPR004443"
                     /db_xref="UniProtKB/TrEMBL:G8ZLC9"
                     /translation="MSLFKVVSSKLAAEIDQELMGPQVGFTLQQLMELAGFSVAQAVS
                     REFPLDKASIDKHVFVIAGPGNNGGDGLVCARHLKLFGYNPIVYYPKRSERNEFYKQL
                     VSQLNFFKVPILSQEGDSTDWLEYLKPESTLCIVDAIFGFSFKPPMREPFKGILTQLH
                     ELENQVPIVSVDVPSGWDVDEGPITEDAINPAVLVSLTVPKPCSNFLKRNTAHYVGGR
                     FIPREFANKYGFEPFDYELTDQILKL"
     gene            complement(<152585..>153976)
                     /gene="TDEL0A00920"
                     /locus_tag="TDEL_0A00920"
                     /db_xref="GeneID:11502788"
     mRNA            complement(<152585..>153976)
                     /gene="TDEL0A00920"
                     /locus_tag="TDEL_0A00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678587.1"
                     /db_xref="GeneID:11502788"
     CDS             complement(152585..153976)
                     /gene="TDEL0A00920"
                     /locus_tag="TDEL_0A00920"
                     /inference="similar to DNA sequence:INSDC:YNL199C"
                     /note="similar to Saccharomyces cerevisiae GCR2 (YNL199C);
                     ancestral locus Anc_2.50"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678635.1"
                     /db_xref="GeneID:11502788"
                     /db_xref="UniProtKB/TrEMBL:G8ZLD0"
                     /translation="MTDLDFGNLSSQVLTTAGIMHHQTKLDVFIIRAYKLLSSGSIIN
                     SNTLQSVTSSPQTTSTTPAAATTNNGNSGPAINTTNGSTIQYQYSQLFGKISKLYNAT
                     ISSGAIDDRSTSPKSAIELYQRFQQIIKELELSYEVSPYGRYFQRLDQSLWQIKDDVE
                     LRTDKLWKLVSMSIFSIYDPRTGQMINQGRRKTGGSLAASTKGSPTEMMNNTGNGKAP
                     ARPGLVNEAINPTVNSMMMDASIPQQLQKRLQTISQDINSRSLNGYYTQPTSPGQGGS
                     FGFGLDNDATLYNPTSYGNNNSTGTSWKRRSLGSLAENELDDEAVEELLQLTNTSKRQ
                     RTATPINFNNNPSANTNNSMKTRQPNEHNTAPIMNPTANVARNATANTAAVNELTNPT
                     FNNGMSNALVAGDTLVRQLKDTYESLVAEKNQRIVQLEREVELQRQETQWLRKMLIED
                     MGCVRSLLKDLRR"
     gene            <154801..>156477
                     /gene="TDEL0A00930"
                     /locus_tag="TDEL_0A00930"
                     /db_xref="GeneID:11503006"
     mRNA            <154801..>156477
                     /gene="TDEL0A00930"
                     /locus_tag="TDEL_0A00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678588.1"
                     /db_xref="GeneID:11503006"
     CDS             154801..156477
                     /gene="TDEL0A00930"
                     /locus_tag="TDEL_0A00930"
                     /inference="similar to DNA sequence:INSDC:YDL225W"
                     /note="similar to Saccharomyces cerevisiae SHS1 (YDL225W);
                     ancestral locus Anc_2.51"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678636.1"
                     /db_xref="GeneID:11503006"
                     /db_xref="GOA:G8ZLD1"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLD1"
                     /translation="MDSPGAPPSLFRRKKENKRGITYTMLLCGPSGTGKTTFANNLLE
                     SNLFPHKYNQLDSYEVSGKIRIVSPTKVVSFNSKNGIPSYMSSFDPARAELEPGVTIT
                     STSVEIGMEETGARESRESQQEDETILFNLISAHGIGENLDDSLCFDEITLYLEQQFD
                     IVLAEETRIRRNPRFEDTRVHIALYFIEPTGHGLRQVDIELMKRMSRYTNVLPIISKA
                     DSFTKEELAQFRKNIMDDIERFHVPVFKFDVDPEDDDLETIEENQALANLQPFAVVCS
                     DLKNERGQYVRHYPWGTVDINDEKASDLHVLKNVLFGSHLQEFKDTTQNLLYENYRAE
                     KLSTVSETEAIEKDLAANSRQSNAPSLSNFASLVNTGHFKSSQSLALSSELPATPKIR
                     SPDLADDNESPIRQMSQSIKDENEEIIRTIKQESPRLSSTDNPERNKLRNISETVPYV
                     LRHERIIARQQKLEKLEAQSAKELQARIQELEKKAHDLKLREKLLREKKINGSSTSLA
                     SSQSGAQVQSQLKKKIHTRISHPLHLIGTKRTTISRYYNIQIYIIYTILC"
     gene            complement(<156781..>158829)
                     /gene="TDEL0A00940"
                     /locus_tag="TDEL_0A00940"
                     /db_xref="GeneID:11503066"
     mRNA            complement(<156781..>158829)
                     /gene="TDEL0A00940"
                     /locus_tag="TDEL_0A00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678589.1"
                     /db_xref="GeneID:11503066"
     CDS             complement(156781..158829)
                     /gene="TDEL0A00940"
                     /locus_tag="TDEL_0A00940"
                     /inference="similar to DNA sequence:INSDC:YDL224C,YNL197C"
                     /note="similar to Saccharomyces cerevisiae WHI4 (YDL224C)
                     and WHI3 (YNL197C); ancestral locus Anc_2.52"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678637.1"
                     /db_xref="GeneID:11503066"
                     /db_xref="GOA:G8ZLD2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8ZLD2"
                     /translation="MPLIQESHPMDNSAFFTQETFATGNESTLHNISPSHQSAINLDH
                     SSSETSIHRTSGSAHHTSAEVNNNNNSIGNSNERGSPLHLASMLHSLSLGGAIHQNVP
                     QAQQQQQQSTVSKPDMLQGSYLLILKKLPQDITLRECYAIFALANGVVNIDLIKERKN
                     SASSLTDDCEVSAIARFGSLQLVTHYASILSSKSDIFGPISSCSPYIELIDEVANQQI
                     HFERPKYGVSQSNYQLASATVPVTPVSAIHQQQQQQQQSSPIASTSTRPSLMQTRSRF
                     SFNDPFSSDQKTQHMSEQQQKLQTKPGSVITHSRSNQDSSSTDVGKSFLLLENDDIND
                     SIWGSNAMPSSMNGFSSTPQPSTPILEWGSNNRKPSSSFFLSQSGGATGAQPPVSQSV
                     DVSSSLHGMPGRTSNSASIATPFNLLGQIPTNGQPNIPSAMSGSDMSGQRKHNMFINT
                     KQQQQDQQKQQPHTHQQQQQHQQSMQEQAVSSSQTGTPQKSSQMRGSVSRVAHSANGT
                     QKGSISNPSSSTNVASSGAISQADLSLLARVLPPANPADQNPPCNTLYVGNLPPDTTE
                     QELRHLFSGQQGFRRLSFRNKNSNGNGHGPMCFVEFEDVSFATRALAELYGSQLPRAS
                     ASNKGGIRLSFSKNPLGVRGPNNRRNGSSTSVNTPTSSNSGNNSGFSNYSYPAGFNKV
                     "
     gene            complement(<160326..>162800)
                     /gene="TDEL0A00950"
                     /locus_tag="TDEL_0A00950"
                     /db_xref="GeneID:11502992"
     mRNA            complement(<160326..>162800)
                     /gene="TDEL0A00950"
                     /locus_tag="TDEL_0A00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678590.1"
                     /db_xref="GeneID:11502992"
     CDS             complement(160326..162800)
                     /gene="TDEL0A00950"
                     /locus_tag="TDEL_0A00950"
                     /inference="similar to DNA sequence:INSDC:YNL195C,YDL223C"
                     /note="similar to Saccharomyces cerevisiae YNL195C and
                     HBT1 (YDL223C); ancestral locus Anc_2.54"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678638.1"
                     /db_xref="GeneID:11502992"
                     /db_xref="UniProtKB/TrEMBL:G8ZLD3"
                     /translation="MLNLFFLFKCSKTEEKKTENEREGYPVDAFQEFKKNDQKNDTGF
                     HSTGSYDRILGEGQDDVNTAERLPGSYDASTAGKNATSTSTTKPVQSDLGQSRTQKTH
                     QPVQTDFGQSRTQQTSQHGRDNDPENVSGMYNMNLGEKTNITTGQTKGGHRVDQPLES
                     YIPGVGRSNKASEAMFPHTSETQGGHHISHKDDKPLESYIPGVGRNNHPTEHAAAQQG
                     NVGHAESHQARSGNYSEPHLGKNVTEQHQSKNHTSTPHIPGTGVITEPSQPMSKQKYD
                     PKQNTAYKMDPQQTPHLTQKTAMPGFNYGNKTNAAGGTDTIDRASVPKPAHLNPSPDS
                     GANAPVRRDSRTVNQFHEPDSQRGPSQHVVREEKETVIDFPAHSYDAGKGEGQQKHST
                     LDPNAGNFGQEAKHHHQIPEEREPTQKKTGIFGHESHGSQHGKQAPAHEAREAGVFGH
                     ESHGTQHEKAHDLGREPEGKKTNVFGHESHIQRDTKGADLNASEKSPKSGPTLFGKTI
                     NFGGSHKDDTHRDTTHKDASHKAGTGNTATKIGHVNTPNVESKHLPSKVATMEDQPVK
                     SSTGHEGLTKNRTKSIGSEEAGSYAREVGNHPSLVDPRLPTYREKDETFSPADRESGD
                     YKKETFTSAGHGSGDHHKDTFTSSGHGSGDHHKDTFTSSGHGSGDHHKDTFTSSGHGS
                     GDHHKDTFTSTGHGSGDHHKDTSSSTGYGSGGHQKDTSTSTGHGSGDHQKDTFTPAGL
                     GSGDYKVTTKETTYTRKFRLAMKRTSLVVNNIMVNNTCPPNHQSRKVEGSIPTHISLN
                     LSHVLIRRNKNNMHLKGNMRNIPILA"
     gene            complement(<162929..>163876)
                     /gene="TDEL0A00960"
                     /locus_tag="TDEL_0A00960"
                     /db_xref="GeneID:11502607"
     mRNA            complement(<162929..>163876)
                     /gene="TDEL0A00960"
                     /locus_tag="TDEL_0A00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678591.1"
                     /db_xref="GeneID:11502607"
     CDS             complement(162929..163876)
                     /gene="TDEL0A00960"
                     /locus_tag="TDEL_0A00960"
                     /inference="similar to DNA sequence:INSDC:YDL222C,YNL194C"
                     /note="similar to Saccharomyces cerevisiae FMP45 (YDL222C)
                     and YNL194C; ancestral locus Anc_2.55"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678639.1"
                     /db_xref="GeneID:11502607"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:G8ZLD4"
                     /translation="MIFKKFVHALTFIFLLGAGLLTFFLILSGGRPGGTLKNFYWFEG
                     NTSGFNDAPDVTRWYNYRWCGYSDGQTSDCSSTVPAQAFSPRDNFGRSDEMPSSFLNN
                     RNTYYYLSRVAWAMLLIGLVFIVGAIIPAVVMIFKTITVMAIWSTVSTWIAFFFILLA
                     ACLYTGCYAKAKNAFSDSNRSSKLGAKNFAFLWTTVFLLLVNTIWSTITVVLHGMNKF
                     RDYKESDHYAGGAGGYNNASSMDTTHNDKSTYDSDKHHSDRTFFTRLRTKKKMMQTQE
                     PGEQPEEVQYVTRDFVSQPTGNNNTQQTTGQGTGQPTAV"
     gene            complement(<164080..>166347)
                     /gene="TDEL0A00970"
                     /locus_tag="TDEL_0A00970"
                     /db_xref="GeneID:11502661"
     mRNA            complement(<164080..>166347)
                     /gene="TDEL0A00970"
                     /locus_tag="TDEL_0A00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678592.1"
                     /db_xref="GeneID:11502661"
     CDS             complement(164080..166347)
                     /gene="TDEL0A00970"
                     /locus_tag="TDEL_0A00970"
                     /inference="similar to DNA sequence:INSDC:YDL220C"
                     /note="similar to Saccharomyces cerevisiae CDC13
                     (YDL220C); ancestral locus Anc_2.56"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678640.1"
                     /db_xref="GeneID:11502661"
                     /db_xref="GOA:G8ZLD5"
                     /db_xref="InterPro:IPR011564"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:G8ZLD5"
                     /translation="MGLQYKYITSTAAYDEFPLESCVAIEFVALLTSISYERTHYLLE
                     LHNFADGNPDKMPFLVKVRCSDQFAEKLARMTISLMFQCLEIDLPDSILDEHTPLNDI
                     HLESLCFVKCQCLYLSKESKYGVYLENIKPFNAASVMDLALNHKDGHIGKTIFNIMQN
                     LIRMDTRFTSPFKFARLNNPPKDFRRLIEKLKANQPALVNNPLFTANRLNSAPAESQN
                     EFNSQCMGSSGSFDTMGFDAVEESDSSVEPELTVRKKPRLAGSDIQPNTSMSMVLGTT
                     VKLVGQIAGLFPVGPDAAGDFRLYFIPHDWPNAPHEPFVAGVNCLECFVERASPLYKL
                     IDAVFDTPDAFHDILARANLVIDVERTEWHLHDNLHSSRWTLTHVDQQEELMNRIQTP
                     NSKRDPLIEFKDLTLRGQEVKYVTMIGLLVSCSFENPSFVSMVFTDFTSNLDINQKFL
                     FDRFLLDFDNKLDQESGFRVIMYANQFAIFDKQLRELYNDLSLRNMFMPNSGENVSHK
                     GILCRMSLKLKLYNDKLNAIVRYCTPISTTTRLAYRDERLQLQNIRESALKILRQPSL
                     NRFYDNFTVCFPLVQDRSVWRVSMKERRPVVPELRLNAEDEEMVTCTTGTEPRVVRDI
                     AALNGSGPQAPENGTSSVHRVEGQLLLLQLKNGSVQLHVTNELITGNYVVPARILTLE
                     LPTSQAVQSFDQDCSDVLGEEFCFTVTRRNLPLLELNPTGKRLLVWCPIECSLPELRS
                     QLRHSQSVKQEEQPT"
     gene            <166516..>168069
                     /gene="TDEL0A00980"
                     /locus_tag="TDEL_0A00980"
                     /db_xref="GeneID:11503190"
     mRNA            <166516..>168069
                     /gene="TDEL0A00980"
                     /locus_tag="TDEL_0A00980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678593.1"
                     /db_xref="GeneID:11503190"
     CDS             166516..168069
                     /gene="TDEL0A00980"
                     /locus_tag="TDEL_0A00980"
                     /inference="similar to DNA sequence:INSDC:YNL193W"
                     /note="similar to Saccharomyces cerevisiae YNL193W;
                     ancestral locus Anc_2.57"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678641.1"
                     /db_xref="GeneID:11503190"
                     /db_xref="UniProtKB/TrEMBL:G8ZLD6"
                     /translation="MKVKAPKRTKNKLGQRQLVSQDDFYSEATDFEEQAERWILSDIR
                     KTLRFYVQAIELYEKGLNAPNATAHGTYNIMYNETRLFLQVYTDYLANTGYINLLQYV
                     RLDDIANVSQLALPLNEIIDRFEKVTERFPDERSWDLDSNLLTSYLTLIESADSYSLR
                     GEDIVELTRKFADLSRHSIENQFSELKSWDATIEEEESGFERDTTGSNASARDGSGVV
                     SQQDDMSESMEMTDQITVETLSELLSNSYKFVQSLMEIIIEARLGESSTINPVQLNYL
                     DDMMKKFTLQLKDVHQTISESLTLDEDQINVVLEANRGIEFIANGDLSSIETYVSETL
                     NSSEISTELLLAKIDVLDFAVTCIDSNGDLQVQWQMCSLLNKLLAEARKKLADVRANT
                     TGKMSSVGSQLSSLVFQQCDVLIASSDFELRRWVIKRRAGSNGDIKTMEVLMKNAKTF
                     LVNASKIAERPCGLEENIVDKLKRNYIYNQAQARLSVLEGRDQAISNADISELYADHP
                     FYKNAPTFQ"
     gene            <168284..>168643
                     /gene="TDEL0A00990"
                     /locus_tag="TDEL_0A00990"
                     /db_xref="GeneID:11502631"
     mRNA            <168284..>168643
                     /gene="TDEL0A00990"
                     /locus_tag="TDEL_0A00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678594.1"
                     /db_xref="GeneID:11502631"
     CDS             168284..168643
                     /gene="TDEL0A00990"
                     /locus_tag="TDEL_0A00990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678642.1"
                     /db_xref="GeneID:11502631"
                     /db_xref="UniProtKB/TrEMBL:G8ZLD7"
                     /translation="MGLDVLNGTQIIVPCGTQFNLTLNATTTPLDGWLCGLGAKDNSA
                     KDNFRSNTGQELNFTKISCGDGSYLQINSTTNVLDGYFCARSESKCYQAKNSASSKRV
                     SWKPLLAIIVCLSLANI"
     gene            <169032..>172214
                     /gene="TDEL0A01000"
                     /locus_tag="TDEL_0A01000"
                     /db_xref="GeneID:11502848"
     mRNA            <169032..>172214
                     /gene="TDEL0A01000"
                     /locus_tag="TDEL_0A01000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678595.1"
                     /db_xref="GeneID:11502848"
     CDS             169032..172214
                     /gene="TDEL0A01000"
                     /locus_tag="TDEL_0A01000"
                     /inference="similar to DNA sequence:INSDC:YNL192W"
                     /note="similar to Saccharomyces cerevisiae CHS1 (YNL192W);
                     ancestral locus Anc_2.58"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678643.1"
                     /db_xref="GeneID:11502848"
                     /db_xref="GOA:G8ZLD8"
                     /db_xref="InterPro:IPR004834"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR013616"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8ZLD8"
                     /translation="MSNYDPYRYGDPNANNRTQNYDGTYDEEEELRQQAYRHPESRLY
                     QNHSPHEASYDDFINHHPSDPHLQTETAYNDAFISNVPNTAYQQMPSINVVQHTPDVI
                     QNPQLLSPGGAPANVSTPYYNDEDYYYRTNLNAQSGSSMGSTSDLDDAADQADRPILA
                     HLQHVNPASAYSQDPIAMGTYRHNDQSFDDPEGGYIDQCGDDYQINTYLGRDGQMVDP
                     YEAGDVDMELQARNQNFKSGDLLHEEDLDNSSFDGHSHRDLGDYDDIDTLDRLNYTAS
                     GVPPSSSTASSVMNDRDLGKESENRLPKRTPTVMRKFKLWRGNFIFDSPVSQSLLQQY
                     SKAGGDEISNEFKFMRYQAVTCEPDRLAAENFTVRQLKYLTPRRTELMIVITMYNEDH
                     ILLGRTLKGVMDNIKRMVKKKNSSTWGPDAWKKIVLCVVSDGRSKINEKSLALMSALG
                     CYQDGFAKDEINGKKVAMHVYEHTTMMNITDVTSDGLELTSSANTVPVQMLFCLKEQN
                     QKKINSHRWAFEGFAELLQPNIVTLLDAGTMPGKESIYQLWREFRNPQVGGACGEIKA
                     ELGKGFKNLINPLVASQNFEYKMSNILDKTTESNFGFITVLPGAFSAYRLAAVKGQPL
                     QKYFYGESMEGRGFHFFSSNMYLAEDRILCFEVVTKKDSNWILKYCRSSYASTDVPER
                     VPEFILQRRRWLNGSFFAGVYSFFHFHRIWTSGHNIGRKFLLSIEFIYLLINTILSWF
                     SLSSFFLVFRILTLTIALTYHSVFSVLSVIFYWLYGICLVSTFILSLGNKPKSTEWFY
                     VATCIFFAVLMVYMIFCSIFMSVKSFENILSSGGLTFKGLLMKEAFRDMVISLGSTYC
                     LYLLSSIIYLQPWHMLTSFFQYILLSPSYINVLNIYAFCNVHDISWGTKGASAKPLGK
                     INAHEDGTFKMEILISNKEIQLNYDKYMNILAKTDDVDEEQEVPFEEQKAGYYAKVRS
                     LVIIVWLLTNFAVVAVVLEAGGIGDYLAMRPDQTTVDSTSTAQRPVITQKAAIYFTII
                     LWIVALLALIRFFGCSIYMASRFLKKLRMR"
     gene            <172355..>172875
                     /gene="TDEL0A01010"
                     /locus_tag="TDEL_0A01010"
                     /db_xref="GeneID:11502945"
     mRNA            join(<172355..172419,172488..>172875)
                     /gene="TDEL0A01010"
                     /locus_tag="TDEL_0A01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678596.1"
                     /db_xref="GeneID:11502945"
     CDS             join(172355..172419,172488..172875)
                     /gene="TDEL0A01010"
                     /locus_tag="TDEL_0A01010"
                     /inference="similar to DNA sequence:INSDC:YDL219W"
                     /note="similar to Saccharomyces cerevisiae DTD1 (YDL219W);
                     ancestral locus Anc_2.59"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678644.1"
                     /db_xref="GeneID:11502945"
                     /db_xref="GOA:G8ZLD9"
                     /db_xref="InterPro:IPR003732"
                     /db_xref="InterPro:IPR023509"
                     /db_xref="UniProtKB/TrEMBL:G8ZLD9"
                     /translation="MKIVLQKVSHASVVVNSKVISSIKNGYFLLVGITTEDTMDDIEK
                     LSRKVVNLRIFGDEPDGFWKKNIKEVQGEILSVSQFTLCARTKKGTKPDFHLAQRGHI
                     AKELYNNFLKLLGDSIGPEKVQDGEFGAMMSCSLTNEGPITILLDSKE"
     gene            <173170..>174243
                     /gene="TDEL0A01020"
                     /locus_tag="TDEL_0A01020"
                     /db_xref="GeneID:11503116"
     mRNA            <173170..>174243
                     /gene="TDEL0A01020"
                     /locus_tag="TDEL_0A01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678597.1"
                     /db_xref="GeneID:11503116"
     CDS             173170..174243
                     /gene="TDEL0A01020"
                     /locus_tag="TDEL_0A01020"
                     /inference="similar to DNA sequence:INSDC:YNL191W"
                     /note="similar to Saccharomyces cerevisiae DUG3 (YNL191W);
                     ancestral locus Anc_2.60"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678645.1"
                     /db_xref="GeneID:11503116"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR026869"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8ZLE0"
                     /translation="MCRFLIFKGKEPTLLSHLLTRPAHSIINQSFDSRLRLDRRRPMN
                     GDGFGVAYYSLDEELGLDGPCLYKAITPAWNNQNLGTLAEKTKSDLVFAHVRASTHGA
                     LSETNCHPFTYHSLCFMHNGGISNFKRIKRKLLSHIEDEYLNFIQGSTDSECAFALFL
                     DSLEKEGCNPRDKTGNFPHQAIRNALLKTIGYIRDWTKEANRDEEHAEPSLLNFAVTD
                     GSTVVVSRYITSKTDEAASLHFSCGSSFVESSPGEYRMERLNRSQDVIMVASEPLTFE
                     RGDWITVPTNSLLTIKRQTVLIHPIVDEYYQTDPLYLRSSKLAESKGLIGSVPLAKAV
                     ERNVPPLEREGRSRPVSATARLS"
     gene            <174737..>175294
                     /gene="TDEL0A01030"
                     /locus_tag="TDEL_0A01030"
                     /db_xref="GeneID:11503089"
     mRNA            <174737..>175294
                     /gene="TDEL0A01030"
                     /locus_tag="TDEL_0A01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678598.1"
                     /db_xref="GeneID:11503089"
     CDS             174737..175294
                     /gene="TDEL0A01030"
                     /locus_tag="TDEL_0A01030"
                     /inference="similar to DNA sequence:INSDC:YNL190W"
                     /note="similar to Saccharomyces cerevisiae YNL190W;
                     ancestral locus Anc_2.62"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678646.1"
                     /db_xref="GeneID:11503089"
                     /db_xref="UniProtKB/TrEMBL:G8ZLE1"
                     /translation="MKFSSVALTTLAALASFSVGAEEKAETTVTLINTSTHKYGKFDK
                     TSRTHGTTSGTHRFGRFNKTSRTHATTTGTHKYGRFNKTSRTHGTTTGTHKYGKFNKT
                     SRTHGTTTGTHKYGKFNKTSRTHATTTGTHKYGKFDNTRKHRATEIVYKAQANAAAPA
                     ANLGSLQVLGLTAGSAIVAGGLMLL"
     gene            <175963..>177591
                     /gene="TDEL0A01040"
                     /locus_tag="TDEL_0A01040"
                     /db_xref="GeneID:11503097"
     mRNA            <175963..>177591
                     /gene="TDEL0A01040"
                     /locus_tag="TDEL_0A01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678599.1"
                     /db_xref="GeneID:11503097"
     CDS             175963..177591
                     /gene="TDEL0A01040"
                     /locus_tag="TDEL_0A01040"
                     /inference="similar to DNA sequence:INSDC:YNL189W"
                     /note="similar to Saccharomyces cerevisiae SRP1 (YNL189W);
                     ancestral locus Anc_2.63"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678647.1"
                     /db_xref="GeneID:11503097"
                     /db_xref="GOA:G8ZLE2"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR002652"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024931"
                     /db_xref="UniProtKB/TrEMBL:G8ZLE2"
                     /translation="MNGDTDSSSTNKFVPEYRRTNFKNKERFSADELRRRRDTQQVEL
                     RKAKRDEALAKRRNFAPQTNGADSEDEDDASASADQQFYNQLQVELPEMIRQIQSPDM
                     QEQLAATVKFRQILSREHRPPIDMVIQSGVVPTLVNFMNENQPEMLQLEAAWALTNIA
                     SGTSAQTKVVVEAGAVPLFIQLLYTGSVEVQEQAIWALGNVAGDSTDYRDHVLQCGAM
                     EPILGLFNTNKTSLIRTAIWTLSNLCRGKKPQPDWTIVSKALPTLAKLIYSLDTETLI
                     DACWAISYLSDGPPEAIQAVIDVRIPKRLVELLNHQSTLVQTPALRAVGNIVTGNDLQ
                     TQVVINSGVLPALRNLLSSPKESIRKEACWTISNITAGNTEQIQAVIDASLLPPLVKL
                     LETADYKTKKEACWAISNASSGGLQRPEIIRYLVSQGCIKPLCDLLEIADNRIIEVTL
                     DALENILRCEADKEARGLNINENADYIEKAGGMEKIFNCQQNENDKIYEKAYKIIETY
                     FSEDDDAIDESMAPQTSGNTFGFGSNVKQQFNFN"
     gene            <177880..>178887
                     /gene="TDEL0A01050"
                     /locus_tag="TDEL_0A01050"
                     /db_xref="GeneID:11503216"
     mRNA            <177880..>178887
                     /gene="TDEL0A01050"
                     /locus_tag="TDEL_0A01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678600.1"
                     /db_xref="GeneID:11503216"
     CDS             177880..178887
                     /gene="TDEL0A01050"
                     /locus_tag="TDEL_0A01050"
                     /inference="similar to DNA sequence:INSDC:YNL188W"
                     /note="similar to Saccharomyces cerevisiae KAR1 (YNL188W);
                     ancestral locus Anc_2.64"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678648.1"
                     /db_xref="GeneID:11503216"
                     /db_xref="UniProtKB/TrEMBL:G8ZLE3"
                     /translation="MHSRLPNAPASYLPTKKSQRASEARIAKINELYESIKKKHQDSV
                     VSNNSTSVASDEQEADNCIQVNGLDYRLPSVSHTEEPSVTVKEEDAMNVFRLNQTPTP
                     PERLQRLGSENNHRAFEEEDDEDDYEAELRFTPKFKSRRSLITMKQSSSLQKKVHPVV
                     PNKVRRPSRVSSLRKALGDPLPLPYVGKRKLSNGIDPGLGFNNSLTDGTINKNRQMME
                     RKWKKLISQDRDLIEKRFAEIRQRSSQNNPDISFNDALPPPVSVSTAGQQNVNSLSEL
                     NKEIIANREKLDHIIGLLSHQQNVATRTIKLQRPSREVQHWTICIIVLIICNLYVYYY
                     L"
     gene            complement(<178965..>179543)
                     /gene="TDEL0A01060"
                     /locus_tag="TDEL_0A01060"
                     /db_xref="GeneID:11503081"
     mRNA            complement(<178965..>179543)
                     /gene="TDEL0A01060"
                     /locus_tag="TDEL_0A01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678601.1"
                     /db_xref="GeneID:11503081"
     CDS             complement(178965..179543)
                     /gene="TDEL0A01060"
                     /locus_tag="TDEL_0A01060"
                     /inference="similar to DNA sequence:INSDC:YDL217C"
                     /note="similar to Saccharomyces cerevisiae TIM22
                     (YDL217C); ancestral locus Anc_2.65"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678649.1"
                     /db_xref="GeneID:11503081"
                     /db_xref="GOA:G8ZLE4"
                     /db_xref="InterPro:IPR003397"
                     /db_xref="UniProtKB/TrEMBL:G8ZLE4"
                     /translation="MVYTGFGLQQIAHPDDRPFSELTPDEQGERGAQMMVNFMTSCPG
                     KFAISGITGFALGGVFGLFMASMAYDTPLHTPTPGGLNTAQQMADLPLKQQVKIQFAD
                     MGKRAYSSAKNFGYIGMIYSGVECVVESTRAKSDIYNGLTAGCITGGGLAYKSGPQAA
                     VVGCAGFAAFSAAIDLYMRSEDGRPPKNDFND"
     gene            <179752..>181053
                     /gene="TDEL0A01070"
                     /locus_tag="TDEL_0A01070"
                     /db_xref="GeneID:11503115"
     mRNA            <179752..>181053
                     /gene="TDEL0A01070"
                     /locus_tag="TDEL_0A01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678602.1"
                     /db_xref="GeneID:11503115"
     CDS             179752..181053
                     /gene="TDEL0A01070"
                     /locus_tag="TDEL_0A01070"
                     /inference="similar to DNA sequence:INSDC:YNL187W"
                     /note="similar to Saccharomyces cerevisiae YNL187W;
                     ancestral locus Anc_2.66"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678650.1"
                     /db_xref="GeneID:11503115"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZLE5"
                     /translation="MSGYSESEFQVKANTIGTFNCWNLRECWANEDEAWARMVGRDES
                     NGYPFPMLRQSIYLEDETRNLHKPIICQDMSWSHDGTSFVTVHDDYGIRQYLVPDTEI
                     AEGSVKELIPFTRSFKNQSVVSSRLHPGYSLFNESDASNLILLAMRGVPLQLCPLQID
                     SGDLQASRSFDVSNFTNGTYHVPHAIDFHGNSHFLAGFERNRICLYDINRSSPLWVSQ
                     STKKECGLSVHRAIVSCFDKQANAFLPEHSTRVCGTYRNELHMIDIRTSKNQFLHKLK
                     SGRGIIQILKSENGHYLYTLKRNSNLIDILDMRQPSKKLNTLKLPFNMGAQKFKASLT
                     AANGLTIGTDYGSVINWPRDLVEFGGNDRTFVENSLTQKLGADTFGWESDLPYGNSRI
                     NLIEESPVEPGLFLVSYSPDKFAEPSTSIQSGLGLVYHPTA"
     gene            complement(<181043..>182368)
                     /gene="TDEL0A01080"
                     /locus_tag="TDEL_0A01080"
                     /db_xref="GeneID:11503248"
     mRNA            complement(<181043..>182368)
                     /gene="TDEL0A01080"
                     /locus_tag="TDEL_0A01080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678603.1"
                     /db_xref="GeneID:11503248"
     CDS             complement(181043..182368)
                     /gene="TDEL0A01080"
                     /locus_tag="TDEL_0A01080"
                     /inference="similar to DNA sequence:INSDC:YDL216C"
                     /note="similar to Saccharomyces cerevisiae RRI1 (YDL216C);
                     ancestral locus Anc_2.67"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678651.1"
                     /db_xref="GeneID:11503248"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="UniProtKB/TrEMBL:G8ZLE6"
                     /translation="MPLKDESVAQLKIKLNKDKRHSQPVLPGHSGDHFFSHQERHAQV
                     PSQGKLLSISGQNKSSTSLQTCEPWKANPRYFSSIQVSKLACFKILGHALRGGSMEIM
                     GMLVGTTRGDQIIVLDSYELPVEGTETRVNAQSESYEYMVQYMSEMVPKSQTIVGWYH
                     SHPGYDCWLSNIDMHTQDLNQNYQDPYVAIVVDPTKSSKEGSLAIGAFRTFHTEGNND
                     DESLAFYELNMDIFESRLDESFDAQELKFKMPKVNQESESLPMSRLVDIMSQWNNLNQ
                     VRNNSLHHKKDTLTLSNLTKKMGEEDCEADQQSRQYNMFNRQTRSNSVASMKTSAEED
                     SDVDMNERHPEDTESLNSSVHTMTESSTPLGRPMAPPVVGTIRRSWTQALSGGLQRQH
                     INTGSVINGPETLQRDALLLDYDTNKRDLIELKTREYRKLRYCRDTFTL"
     gene            complement(<182565..>185735)
                     /gene="TDEL0A01090"
                     /locus_tag="TDEL_0A01090"
                     /db_xref="GeneID:11502962"
     mRNA            complement(<182565..>185735)
                     /gene="TDEL0A01090"
                     /locus_tag="TDEL_0A01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678604.1"
                     /db_xref="GeneID:11502962"
     CDS             complement(182565..185735)
                     /gene="TDEL0A01090"
                     /locus_tag="TDEL_0A01090"
                     /inference="similar to DNA sequence:INSDC:YDL215C"
                     /note="similar to Saccharomyces cerevisiae GDH2 (YDL215C);
                     ancestral locus Anc_2.68"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678652.1"
                     /db_xref="GeneID:11502962"
                     /db_xref="GOA:G8ZLE7"
                     /db_xref="InterPro:IPR006095"
                     /db_xref="InterPro:IPR006096"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR016210"
                     /db_xref="InterPro:IPR028971"
                     /db_xref="UniProtKB/TrEMBL:G8ZLE7"
                     /translation="MLSTTQKTPDIASLSISSMSDYHVFDFPGIDLQRERVVDILDQE
                     GFIPDELIEQEVAWFYGSLEIDDLFFSKQTPEMISSIINSLYASKLDSFAKSRFGSSG
                     GAGDKTIDEVVGEPNGFTIKNKVIHDDCALFMESQAKGASEKYGPYQLDTLIDDLFLD
                     NKERKSTRLVSFWTPESGLKLTFVYDSVFPPQSEIDQNKLLHGDIDCISDQTMSQVIS
                     PENKKLYGLLINLVGEREGPVIKTTHSVKNSDEIRLLIAFKRFTTKRYYSAINALFHY
                     YKLKPSKFYLESFNTNDVVIFSIYLNKSKQLDDILPNALELSIKQVEREASLLYALPS
                     NAFSDVYERRQFSPQEAIYAHVSSIFINHFINRLGSDYQDLIDQLNLQDSNTVLLEIV
                     SNLKRKLRNETFTQEMIADTLHKYPMIVSKLYKNFAELHYYHDSSKNMEKTLSYQRLA
                     KLEPFQNDQEFESYLNKFILNDSPDLVILKTLNLFNKSILKTNFFITRKVALSFRLDP
                     KLIMPEMEYPETPYGIFFVVGNTFKGFHIRFRDVARGGIRIVCSATPHVYEKNSKTVI
                     DENYQLASTQQRKNKDIPEGGSKGVILLNPGSVAHEETFIAFTQYVDSIIDILIKDPL
                     KEKYVDLLGHEEILFFGPDEGTAGFVNWATEHARKRGCPWWKSFLTGKSPELGGIPHD
                     EYGMTTLGVRSYVLKLYETLDLLDTTIYKFQTGGPDGDLGSNEILLSTKNECYVGILD
                     GSGVLCDPQGLDKSELIRLAHERKMVSHYDMSKLGKMGFFVSVDDIDTMLPNGFIVPN
                     GTTFRNTFHTQIFKFVDHLDLFVPCGGRPNSINLNNLHFFIDEKTNKCKIPYIVEGAN
                     LFIAQPAKVALENHGCILIKDASANKGGVTSSSMEVLASLALNDDDFLNKFTGNGTHE
                     KTALYKAYVEEVQRRIHHNAALEFDQLWKLRSATGQPISELSNTLSQTINKVNDDLIC
                     SMELWENDLKLRNYLLLNKIIPKLLIDVAGPEAVMKNIPVSYLKALLSSYLSSSFVYQ
                     FGIDVNIAKFLEFLGKLRREAAKSIQ"
     gene            <186399..>188384
                     /gene="TDEL0A01100"
                     /locus_tag="TDEL_0A01100"
                     /db_xref="GeneID:11502826"
     mRNA            <186399..>188384
                     /gene="TDEL0A01100"
                     /locus_tag="TDEL_0A01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678605.1"
                     /db_xref="GeneID:11502826"
     CDS             186399..188384
                     /gene="TDEL0A01100"
                     /locus_tag="TDEL_0A01100"
                     /inference="similar to DNA sequence:INSDC:YNL186W"
                     /note="similar to Saccharomyces cerevisiae UBP10
                     (YNL186W); ancestral locus Anc_2.69"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678653.1"
                     /db_xref="GeneID:11502826"
                     /db_xref="GOA:G8ZLE8"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G8ZLE8"
                     /translation="MTTQETVKPLVDRILSNPLHFRKASRAVLDGNQVDMKEQEGSYI
                     MIGRGHRDEEEASKEVKNAVQESQEAPKRVKRVPQSLAEAIGLYSQQEQPQDESLSDV
                     DVNAASGYTGSSSSEEEFHEASEYANGEDLGMAVDMEESGSSSDQEFKADDVPHESDE
                     SSEEESSEDSVSRVSDSERVQLQEEAQEAEAIVEKAKEEGEEEGEEEELKHKAPLSQR
                     SVTPPVILGDIQQFYQVGEDINDRGSNGSSRVVKNWGPHLSALRPKGLLNHGVTCYTN
                     AAVQAIVHIPAIQHYLFDILRGKYESTISRDSVSYVLAETSKKMWLPQDRSKKKNGPH
                     HINPKKLIARLDDINCMMSEWQQEDSHEYFMSLMSRLQEDSVPKGHKMTESIIYDIFG
                     GLLKQVVTCKSCGSVSKTEQPFYDLSLHLKGKKKQSLSQDSQSDDQNKSSDAKSDDSA
                     PSRRYSIEKSIRDFFNPELIRVDKEQKGYVCEKCHQTTNAVKRSSIIRAPETLLTHLK
                     KFRFNGTASSKMKQAVSYPMFLDLTEYCESNEKDHVVPVKYQLTTVVVHEGRSLSSGH
                     YIVHCKQPDGTWATYDDEYINKITERDVLKEPNAYYLLYTRLTPKEIETAQVLNVKDL
                     DIPVQMNGSSHATPTSSPVLNKSKKWKKNKKRRFNRY"
     gene            complement(<188526..>188975)
                     /gene="TDEL0A01110"
                     /locus_tag="TDEL_0A01110"
                     /db_xref="GeneID:11502833"
     mRNA            complement(<188526..>188975)
                     /gene="TDEL0A01110"
                     /locus_tag="TDEL_0A01110"
                     /product="mitochondrial 54S ribosomal protein YmL19"
                     /transcript_id="XM_003678606.1"
                     /db_xref="GeneID:11502833"
     CDS             complement(188526..188975)
                     /gene="TDEL0A01110"
                     /locus_tag="TDEL_0A01110"
                     /inference="similar to DNA sequence:INSDC:YNL185C"
                     /note="similar to Saccharomyces cerevisiae MRPL19
                     (YNL185C); ancestral locus Anc_2.70"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL19"
                     /protein_id="XP_003678654.1"
                     /db_xref="GeneID:11502833"
                     /db_xref="GOA:G8ZLE9"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR006519"
                     /db_xref="InterPro:IPR020783"
                     /db_xref="InterPro:IPR020784"
                     /db_xref="UniProtKB/TrEMBL:G8ZLE9"
                     /translation="MSQAAKNLLVKLVVGAGQAAPSPPVGPALGSKGIKAMDFCKEFN
                     ARTANYQPGTPIPVMITIKPDRSFSFEMKSPPTGYLLLKALGLQKGHGSPNVNSKENT
                     IGELSLKHVYEIAKIKKTDGRHAMLEMEGIVKSTVGVAKTMGIKIVP"
     gene            complement(<189217..>191466)
                     /gene="TDEL0A01120"
                     /locus_tag="TDEL_0A01120"
                     /db_xref="GeneID:11503358"
     mRNA            complement(<189217..>191466)
                     /gene="TDEL0A01120"
                     /locus_tag="TDEL_0A01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678607.1"
                     /db_xref="GeneID:11503358"
     CDS             complement(189217..191466)
                     /gene="TDEL0A01120"
                     /locus_tag="TDEL_0A01120"
                     /inference="similar to DNA sequence:INSDC:YDL214C,YNL183C"
                     /note="similar to Saccharomyces cerevisiae PRR2 (YDL214C)
                     and NPR1 (YNL183C); ancestral locus Anc_2.71"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678655.1"
                     /db_xref="GeneID:11503358"
                     /db_xref="GOA:G8ZLF0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZLF0"
                     /translation="MSSLTRLLQEKRKNENGDSHGKELRPLNAEGFDRNSTAHASTTS
                     VTTVTQIDSGEESSTAGSSFGGNAPFPSSFMNVNSAHTATMYGSSVQARDRGNSIHIE
                     TNPASYGSSLGHTGRNIRMTATSGSHHIGSSGARQIPSLSSSIPYSVPNSNKDNAGGS
                     GSNNSSFTSSWVDNYGGSMPSNISAIDSNVISSPKVDSVEPRFVISKQKLQKSSLDNA
                     AQAGSVSRSNSLTSQLGNLFFSKGAKDAHGSSIVSSPVSGMKSPSTAAATAIPKPSRT
                     RQSSIYSASRQPSNSYTENFAESPSSSHEVPPSQSIPKSRHASVVNLKSFFKKSSGTN
                     IAGSAGTFGSPGAQSVAVPFPSQASSSSGFAPSSYGSNNGDTIYSHANDTSLPFSKRY
                     VRTGEELGAGAGGSVKLIRRVADNKVFAVKEFRTKFDSETKRDYVKKITSEYCIGSTL
                     RHQNIIETIEIVYDNNRILQVMEYCEYDLFAIVMSNKMSYEETCCCFKQILSGVEYLH
                     GLGLAHRDLKLDNCVINEKGIVKLIDFGAAVVFSYPFSKSLVEASGIVGSDPYLAPEV
                     CIFTKYDPRPVDIWSVAIIFACMILKKFPWKIPKLRDNSFKLFCSGRDCDSLSALVTR
                     TPDPPSYDNVEEPSTNYAKKQNNNPADPNNPNIGPQRLYQSLPEECQHIIGRMVDLAP
                     ACRASIDEVMADPWVAGIDACCMVEDGLTFKIVSGGDHTHVKVDQSQAHIAGLEKRKK
                     KQAKEGTIS"
     gene            complement(<191795..>192442)
                     /gene="TDEL0A01130"
                     /locus_tag="TDEL_0A01130"
                     /db_xref="GeneID:11503230"
     mRNA            complement(<191795..>192442)
                     /gene="TDEL0A01130"
                     /locus_tag="TDEL_0A01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678608.1"
                     /db_xref="GeneID:11503230"
     CDS             complement(191795..192442)
                     /gene="TDEL0A01130"
                     /locus_tag="TDEL_0A01130"
                     /inference="similar to DNA sequence:INSDC:YDL213C"
                     /note="similar to Saccharomyces cerevisiae NOP6 (YDL213C);
                     ancestral locus Anc_2.72"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678656.1"
                     /db_xref="GeneID:11503230"
                     /db_xref="GOA:G8ZLF1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8ZLF1"
                     /translation="MSETETKLTKKQLKAQQFKKTKEDREQGKEQKRKHAEEPTTTES
                     EPVKKKRKTRRGRGGKGRNGDKKGNRFIVFVGSLPKDITATELQAHFKSSSPDHIRMR
                     SDKGIAFLEFDADKDKHNIQRRMDVALLQHRTLLKDKRINVELTVGGGGNSSDRLEKL
                     KNKNLKLEDERRERVKKMVEEGSQKKAANAATKQQTVQNSEPGQALHPDRAKLIQ"
     gene            complement(<192604..>194151)
                     /gene="TDEL0A01140"
                     /locus_tag="TDEL_0A01140"
                     /db_xref="GeneID:11502931"
     mRNA            complement(<192604..>194151)
                     /gene="TDEL0A01140"
                     /locus_tag="TDEL_0A01140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678609.1"
                     /db_xref="GeneID:11502931"
     CDS             complement(192604..194151)
                     /gene="TDEL0A01140"
                     /locus_tag="TDEL_0A01140"
                     /inference="similar to DNA sequence:INSDC:YNL182C"
                     /note="similar to Saccharomyces cerevisiae IPI3 (YNL182C);
                     ancestral locus Anc_2.73"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678657.1"
                     /db_xref="GeneID:11502931"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZLF2"
                     /translation="MDEQVIFTTNNTGSVASIHSFEQSTLRQCTVGSRNSAVRVGDKY
                     LFVAQAQKALINVYNLSGPHKRESVEQRLPLPEVLSCLATLEDPRCDTNHKIPDFNVP
                     YLLLGSTGSGKLYIWELNSGILLGVKPLAHYQAITKIQSILQGKYIVTSGADARVIIW
                     QTSDLVSMSEPKPVCILHDHTLPVTDFQVSSTNGDFLSLSGTKLFTVSEDGTLRCYDL
                     SSMARSKTSQPTLIATFTLPLAITALTLDPADRACYIGTAEGCFSLQLFYKLSGSKLV
                     NLVQLSDGKARIFSLTESSMELKATQDREKLYAIGQLLCEKVSSTAVTCFEISMDGTL
                     LLVGDSEGKVSVTEIYSKQILRTMQPISTSQTIHGGVTNLIIDTQLNANQNEVGADSA
                     KVSPNAKIPSLQRVIFDSSKPGQLHDIFHQVGEENGSTSLCLDDFDAYADQLRSQQSI
                     ISQSNGAQSTVLIAEQEPSKDSSAKDQEIADLKDNVESLKSAYKELRELHEKLYQEHE
                     KLLETTI"
     gene            complement(<194582..>196078)
                     /gene="TDEL0A01150"
                     /locus_tag="TDEL_0A01150"
                     /db_xref="GeneID:11503029"
     mRNA            complement(<194582..>196078)
                     /gene="TDEL0A01150"
                     /locus_tag="TDEL_0A01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678610.1"
                     /db_xref="GeneID:11503029"
     CDS             complement(194582..196078)
                     /gene="TDEL0A01150"
                     /locus_tag="TDEL_0A01150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678658.1"
                     /db_xref="GeneID:11503029"
                     /db_xref="InterPro:IPR001959"
                     /db_xref="InterPro:IPR010095"
                     /db_xref="InterPro:IPR021027"
                     /db_xref="UniProtKB/TrEMBL:G8ZLF3"
                     /translation="MNLPIPLVQNTHPLLKQTRISNDHLESKSSTSRPFWNKDAAHHS
                     KQWGLNTILPMAAKKLSQKINFDSWFSVVKHPQAPIINNSLNLPLSSGVKEEMIRARK
                     TRIYPTNSQRETLKKWFGCQRYIYNRALKLHRDGMAMTMKGLRQTLLNKDTNILERQE
                     QWLNDYNYDLKDEALRDLVKNFSSNMVKFKKTGVPFKLKFKTKKAPVQTISVLKKHWN
                     KGAKSFYGPIFSPSKICGAESLPEELPADSRLQRTRNNKYYLIVPMVGEEIARKSHAE
                     KFIFIDPGVRTFLTGYDSNQTVVEIGKDAVVRIEKLKRRRPQLQSKLAKLRKHKKRQN
                     HRKALHRLDGKISHIVQDMHKKSALFLCQYYNNIFLPKLDYHECTKLTRKSRSNMATL
                     AHCSFHDRLTMKAEQLHGASVHEVEEDYTSKTCSSCGNLKDGLGSVKVYSFLKCSSVF
                     DRDFNAAKNIMLKYICEHLMASGESSISSALSTENGRLAMMVPGPFVR"
     gene            <196920..>198104
                     /gene="TDEL0A01160"
                     /locus_tag="TDEL_0A01160"
                     /db_xref="GeneID:11503039"
     mRNA            <196920..>198104
                     /gene="TDEL0A01160"
                     /locus_tag="TDEL_0A01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678611.1"
                     /db_xref="GeneID:11503039"
     CDS             196920..198104
                     /gene="TDEL0A01160"
                     /locus_tag="TDEL_0A01160"
                     /inference="similar to DNA sequence:INSDC:YNL181W"
                     /note="similar to Saccharomyces cerevisiae YNL181W;
                     ancestral locus Anc_2.74"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678659.1"
                     /db_xref="GeneID:11503039"
                     /db_xref="GOA:G8ZLF4"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZLF4"
                     /translation="MPVNIIGTAIVKGTEAIPYYQQIKTAAPYVVAAGAAKYWSRGAT
                     NTWERKLHGKVYLVTGASSQGMGTAVVLEMARLGAQLIILTRNVDEWATDWCNDLREK
                     SQNDLIYMEKCDLSDLWQVRKFATGWLDNAPPRRLDGVVVMSGEMEPWGIPVVSPPTR
                     RSSVDGLELQMATNYVGIFHLLDLLQPSFKAQPPDRDVRIIITTCWLQSMGEINVEDP
                     LWQNAKYDSSLKFFASSKLQLSVCMLELQRRLLNEIKKMQKDGKEVKGTHVTVTLVQP
                     GTMRSHSLRRVLSNGSVFLLIFLYCLLLYPLLFLLTKSGRRGAQSVLYALMTPELEEV
                     NLQDEKVKYVSDCSIVKLARKEFEDEALQTKLYENTLRDINELEKKMASKRNKAKTTK
                     KK"
     gene            complement(<198136..>198957)
                     /gene="TDEL0A01170"
                     /locus_tag="TDEL_0A01170"
                     /db_xref="GeneID:11503261"
     mRNA            complement(<198136..>198957)
                     /gene="TDEL0A01170"
                     /locus_tag="TDEL_0A01170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678612.1"
                     /db_xref="GeneID:11503261"
     CDS             complement(198136..198957)
                     /gene="TDEL0A01170"
                     /locus_tag="TDEL_0A01170"
                     /inference="similar to DNA sequence:INSDC:YNL180C"
                     /note="similar to Saccharomyces cerevisiae RHO5 (YNL180C);
                     ancestral locus Anc_2.75"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678660.1"
                     /db_xref="GeneID:11503261"
                     /db_xref="GOA:G8ZLF5"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLF5"
                     /translation="MRSIKCVVVGDGAVGKTSLLISYTTNTFPREYIPTVFDNYSTTI
                     RLPGAQKDEEPQLYKLNLWDTAGQEEYDRLRPLSYPQTDIFLVCFSISEPCSLKNVVD
                     KWYPEIVQNSSTESSEFHQKLGRYPIFLVGTKADLRDDAEQSRRVQEVNAQFVTPEQV
                     EEVVKQCGFMGYVECSAATQTGVRDVFEKSVSSIVGELEKASQVQKDASAVPVASRGN
                     KSTAETTQQQDHTENRRDKNNSANKPVHRANTARNDKNSTKFVNKMKKKSKCVIL"
     gene            complement(<200029..>200700)
                     /gene="TDEL0A01180"
                     /locus_tag="TDEL_0A01180"
                     /db_xref="GeneID:11502890"
     mRNA            complement(<200029..>200700)
                     /gene="TDEL0A01180"
                     /locus_tag="TDEL_0A01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678613.1"
                     /db_xref="GeneID:11502890"
     CDS             complement(200029..200700)
                     /gene="TDEL0A01180"
                     /locus_tag="TDEL_0A01180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678661.1"
                     /db_xref="GeneID:11502890"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:G8ZLF6"
                     /translation="MKVADYGDCEDASVDIPIKKFRSVFTWGLYESMRSSELFVMVVW
                     YSGLLFGFYNSMSSSHFWRSQIFIDLLLLSILSTPMICLICRQIRREDMVSRNTQALA
                     GTTKEVFGSQQETLALGWDKVACRLNRKFYDAGDWKTLNLFFDGSNCEGFFKMYVLKP
                     IHEVEGPKSREELLAYCNEYLSAGDHQPVQLGQRGFSFGWLRRFFQLTLKVIKICGGE
                     SPRTT"
     gene            complement(<200994..>202103)
                     /gene="TDEL0A01190"
                     /locus_tag="TDEL_0A01190"
                     /db_xref="GeneID:11503032"
     mRNA            complement(<200994..>202103)
                     /gene="TDEL0A01190"
                     /locus_tag="TDEL_0A01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678614.1"
                     /db_xref="GeneID:11503032"
     CDS             complement(200994..202103)
                     /gene="TDEL0A01190"
                     /locus_tag="TDEL_0A01190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678662.1"
                     /db_xref="GeneID:11503032"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:G8ZLF7"
                     /translation="MSTGEMEKTDYRDFEDASVDIPKKRFRSCFTWFCYEVSSFYESY
                     VMLACFGLLLCFPSVMSSLRFIVSLATAMLLLALTTVGMILTAVICITSEMKKAKSLV
                     RRNIKAVAEAIEEVFSSEQETLALGWDNVACRLNRKFYAAGEWKTPYYYFDGQQCEDY
                     FRHNVLQPLYKQKVTKSYDKSDLRAAVSIYEQRLNDQFNQDKEDITVLAKGGLPADSH
                     RSKFIWKLKNSSTQVGLKICFFSALAYTFSHTWCLRLVQIMIILITASAVIFTGYSPE
                     LSKTRIRIRLLATIADVAPGEDMDRWDMVAKRINGYVMQDSNDTCAKMFFDGKDCMKF
                     SKNVLNPLMSKSTSYYQFPAYDLVPLATEAFKPSI"
     gene            <202893..>203630
                     /gene="TDEL0A01200"
                     /locus_tag="TDEL_0A01200"
                     /db_xref="GeneID:11503206"
     mRNA            <202893..>203630
                     /gene="TDEL0A01200"
                     /locus_tag="TDEL_0A01200"
                     /product="40S ribosomal protein S3"
                     /transcript_id="XM_003678615.1"
                     /db_xref="GeneID:11503206"
     CDS             202893..203630
                     /gene="TDEL0A01200"
                     /locus_tag="TDEL_0A01200"
                     /inference="similar to DNA sequence:INSDC:YNL178W"
                     /note="similar to Saccharomyces cerevisiae RPS3 (YNL178W);
                     ancestral locus Anc_2.76"
                     /codon_start=1
                     /product="40S ribosomal protein S3"
                     /protein_id="XP_003678663.1"
                     /db_xref="GeneID:11503206"
                     /db_xref="GOA:G8ZLF8"
                     /db_xref="InterPro:IPR001351"
                     /db_xref="InterPro:IPR004044"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR005703"
                     /db_xref="InterPro:IPR009019"
                     /db_xref="InterPro:IPR018280"
                     /db_xref="UniProtKB/TrEMBL:G8ZLF8"
                     /translation="MVALISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPT
                     KTEIIIRATRTQDVLGENGRRINELTLLVQKRFKYKPGTIVLYAERVQDRGLSAVAQA
                     ESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARAKSMKFADGFLIHS
                     GQPVNDFIDTATRHVLLRQGVLGIKVKIMRDPAQSRTGPKALPDAVKIVEPKEEEPIL
                     AASVKDYRPAAPQQEEPEQVEAVEASA"
     gene            <203733..>204326
                     /gene="TDEL0A01210"
                     /locus_tag="TDEL_0A01210"
                     /db_xref="GeneID:11503215"
     mRNA            <203733..>204326
                     /gene="TDEL0A01210"
                     /locus_tag="TDEL_0A01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678616.1"
                     /db_xref="GeneID:11503215"
     CDS             203733..204326
                     /gene="TDEL0A01210"
                     /locus_tag="TDEL_0A01210"
                     /inference="similar to DNA sequence:INSDC:YDL212W"
                     /note="similar to Saccharomyces cerevisiae SHR3 (YDL212W);
                     ancestral locus Anc_2.77"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678664.1"
                     /db_xref="GeneID:11503215"
                     /db_xref="InterPro:IPR013248"
                     /db_xref="UniProtKB/TrEMBL:G8ZLF9"
                     /translation="MGLSYNDVCTIGTGLILIGTSFIMGVFYANQTYDFPLLFDRDAT
                     QEHFDNALRHYQTLFHTAPTVKYILAGVSLLGLIGGLIRVYKPNPDLQLFEYCSLALY
                     VFGICVFLTNVKTGIDCSITRNWGEVTENQGLAVIASSNIILLLLFVGVIVLQAGLWY
                     SRWELDQRLKVFYANEAAEQTAKVEPETDKKEKKKQK"
     gene            complement(<204372..>205265)
                     /gene="TDEL0A01220"
                     /locus_tag="TDEL_0A01220"
                     /db_xref="GeneID:11503042"
     mRNA            complement(<204372..>205265)
                     /gene="TDEL0A01220"
                     /locus_tag="TDEL_0A01220"
                     /product="mitochondrial 54S ribosomal protein YmL22"
                     /transcript_id="XM_003678617.1"
                     /db_xref="GeneID:11503042"
     CDS             complement(204372..205265)
                     /gene="TDEL0A01220"
                     /locus_tag="TDEL_0A01220"
                     /inference="similar to DNA sequence:INSDC:YNL177C"
                     /note="similar to Saccharomyces cerevisiae MRPL22
                     (YNL177C); ancestral locus Anc_2.78"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL22"
                     /protein_id="XP_003678665.1"
                     /db_xref="GeneID:11503042"
                     /db_xref="GOA:G8ZLG0"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005727"
                     /db_xref="UniProtKB/TrEMBL:G8ZLG0"
                     /translation="MFPLRRVLSCQVPLKSCSVRFLQVGRPLLNDQTSFFGEMTKKAK
                     LDSDDPNKLSNKMTVASDVAETEKTASLDSITIENDTMLQKYIQSQQQPEKLAPHLLL
                     TPFKRKLYMANCELNGFYKNDTIVALPGTSERYKLHLSRQEIEVLEPSVYVKSYRIKS
                     SMKKATMLLRLLNGLDVKKALTQCHFSAKKIARDVAELLERGIEDGKKLGLDSDDLYI
                     SQIWTGSDGMWGKRLECKARGRTGLIHHPHVHVRCILKTKSVTKSRLAYEAQLKDQRR
                     KPWIQLADKPVRGVPGGAYKW"
     gene            complement(<205491..>206672)
                     /gene="TDEL0A01230"
                     /locus_tag="TDEL_0A01230"
                     /db_xref="GeneID:11503213"
     mRNA            complement(<205491..>206672)
                     /gene="TDEL0A01230"
                     /locus_tag="TDEL_0A01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678618.1"
                     /db_xref="GeneID:11503213"
     CDS             complement(205491..206672)
                     /gene="TDEL0A01230"
                     /locus_tag="TDEL_0A01230"
                     /inference="similar to DNA sequence:INSDC:YDL211C,YNL176C"
                     /note="similar to Saccharomyces cerevisiae YDL211C and
                     YNL176C; ancestral locus Anc_2.79"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678666.1"
                     /db_xref="GeneID:11503213"
                     /db_xref="UniProtKB/TrEMBL:G8ZLG1"
                     /translation="MVFNSSSVRQSSETGGWSLTDIAFSSVSTSAEESTSTWGPAIVT
                     PSSSSLASSQSSSKSSSQWSSAIYVSSSVYDVSSSSPTVFSSDQTSVSTLVPSYPWSS
                     VSSSSSKQSFSSDFATTSTSASSPGYTVSSDSKSAFIIYTQQYYITGSSTTFETGLPT
                     TTVRAKTATSSFSVPSATQTRDFEFYQNWLNGSLGESGSPTTPAKNKIIGGVVGGVGG
                     LLLCSIVIWLMFFRRRKNKAEPTVGFTYEIGRRAGYPSQSQSVDIDQEKTQPTRQAPF
                     LARIKNKAIAQISKNRNSVPQNEESDPFQEEFDFRKRPQPPIPPARSRHDTNQEASTR
                     PAYDVPIDHRFSYVSSLTDSSYISSAEGDYSSLSSTSVRLPSDVPNHSESSHGFLREV
                     I"
     gene            <208313..>209041
                     /gene="TDEL0A01240"
                     /locus_tag="TDEL_0A01240"
                     /db_xref="GeneID:11502671"
     mRNA            <208313..>209041
                     /gene="TDEL0A01240"
                     /locus_tag="TDEL_0A01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678619.1"
                     /db_xref="GeneID:11502671"
     CDS             208313..209041
                     /gene="TDEL0A01240"
                     /locus_tag="TDEL_0A01240"
                     /inference="similar to DNA sequence:INSDC:YDR098C,YER174C"
                     /note="similar to Saccharomyces cerevisiae GRX3 (YDR098C)
                     and GRX4 (YER174C); ancestral locus Anc_8.240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678667.1"
                     /db_xref="GeneID:11502671"
                     /db_xref="GOA:G8ZLG2"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR004480"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:G8ZLG2"
                     /translation="MPVIEIKDQDQFTNLTTVEARGQLVALYFHTAWAEPCKVMNEVV
                     SALSDEPSNSGIKFLSIDADENAELAELFEVSAVPYFILVQDGTILKELSGADPKEFV
                     KALSEHKGSKKVEQQPSAQENVAEDDEEREEEEETEEELNDRLTKLTQAAPIMLFMKG
                     SPSEPKCGFSRQMVGILREHQVRFGFFDILKDSCVREGLKKFSDWPTFPQLYVQGEFQ
                     GGLDIIKESLEEDPEFFEHALQSN"
     gene            complement(<209083..>211023)
                     /gene="TDEL0A01250"
                     /locus_tag="TDEL_0A01250"
                     /db_xref="GeneID:11502957"
     mRNA            complement(<209083..>211023)
                     /gene="TDEL0A01250"
                     /locus_tag="TDEL_0A01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678620.1"
                     /db_xref="GeneID:11502957"
     CDS             complement(209083..211023)
                     /gene="TDEL0A01250"
                     /locus_tag="TDEL_0A01250"
                     /inference="similar to DNA sequence:INSDC:YER173W"
                     /note="similar to Saccharomyces cerevisiae RAD24
                     (YER173W); ancestral locus Anc_8.239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678668.1"
                     /db_xref="GeneID:11502957"
                     /db_xref="GOA:G8ZLG3"
                     /db_xref="InterPro:IPR004582"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLG3"
                     /translation="MGSRNLGKNPGLKRSVSSLTSRINTWSSSKPSSPVRKKAKSAKP
                     DVKNLETAIASDLEREEVFSTPWYQLYGPRTVIEVCLHKKKVTEVSEALQKLLQGESD
                     TRILLLTGPSGCCKSTIVRQLANELIPKYRTTGSNSLSVKHHGDCNVIEFENDANANG
                     ISYMTEFQEFLTQAKYRSGPNLSLILVEDLPNIFHPGTRKAFQDQLLQWLYMSSDALP
                     PLVICLTECEIDHEDNKPNAFGVDYSLTAESILGKEILSHSRLKRIKFNPINTTLMKK
                     TLMNLCIKNKATLMSTNKWSEKERVINEVARSTGDIRSGIMILQFWATSSMDTPLPVR
                     ESFVSYFHAMGKVLHGSKDFEDDNEMINTLITNSKGHLSHENFSLGILENYSSFNKGR
                     FTVKDAWEVTNSLSESDVMRTVPESLEYCMRKVRYTMGKARYEERTHGKASFPREWKI
                     ALAQNEFKIKCEDYVNVSMYKYVEPRQFRDISLQYAFYDPLIKKARYYKQKSLLEYIA
                     QVNGAPNQTLRGIQVDPRIDVLGRIGGEISLVNNQDNEIFEDDHRSIARQSIENLKKS
                     RDVKLQELIELHELRMGEDVELESEEIDDDPIIDSDENASTSNILEDDDSIFEILSQK
                     LPKINVNTSINESLSDSDLEHL"
     gene            <211170..>217724
                     /gene="TDEL0A01260"
                     /locus_tag="TDEL_0A01260"
                     /db_xref="GeneID:11502755"
     mRNA            <211170..>217724
                     /gene="TDEL0A01260"
                     /locus_tag="TDEL_0A01260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678621.1"
                     /db_xref="GeneID:11502755"
     CDS             211170..217724
                     /gene="TDEL0A01260"
                     /locus_tag="TDEL_0A01260"
                     /inference="similar to DNA sequence:INSDC:YER172C"
                     /note="similar to Saccharomyces cerevisiae BRR2 (YER172C);
                     ancestral locus Anc_8.238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678669.1"
                     /db_xref="GeneID:11502755"
                     /db_xref="GOA:G8ZLG4"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLG4"
                     /translation="MSFEKFTNNQHFKQVVRGQLVAHLDLIDCLDCLKLHTQMAEEST
                     EDRKKQIREIYRYDEMSNRVLKADRRLQTIQSDPQRDAELSQPKSMSGRISAKEMGAN
                     ARREATVEEREEARREVERRQRDTSLVKSNRSVNATSGTVLDSANLGLKYYPRDKANT
                     EVYEDVLRWVSTQVGNDMPRDVIAGTADLLIYRFKDNEEEADGLVAKKRQEIEQELQR
                     KVEPSEFQELVKLVKQITDYGDQSSGADEKVITTLSEDGYDEEELVEEQAEEDDVEEE
                     EEDQEIIGKNIAEPILQRDDETLLLTGESSTDLQSLAIYDVDEFFIRRKLNEVIENAD
                     AGKIQRLSDRIMNELEKRDDNPRVLEESLMKMLDFEHLQLAEFVIKNRSLLLWGTRLA
                     RASEHSRPQLLQEMREKGLGYLVEQYESKKRLQNKRTVDDADEQKDVNPEKRVRNDVQ
                     TTLPPLIDLESLKFDEGAKLMTVTKVALPKGSYKKVNPHYEEIHIPAPERPEINYDLV
                     SITSLPAWAQEAFPSAETETLNAIQSKVFPATFHDDINLLLCAPTGGGKTNVAMLSIL
                     RVISSLINPETKKLKNKNFKIVYLAPLKALVQEQVREFQRRLAYLDIKVEELTGDSNL
                     SKYQISQTQILVSTPEKWDVITRKAADTSSFIRLVRLIIIDEVHLLHDQRGPVIESIV
                     ARSLQSEVIPSRPRIVGLSATLPNYEDVAKFLQVPPKGLFYFDSAYRPCPLSQEFCGV
                     TEKNSVKRIQAANEACYDKTLQSVTDNHQVIIFVHSRKETARLAKYLVEKFNESGNSE
                     SLRKSDAGSKQVLSTEAENIQDPHLRLVLKYGIGLHHAGLSRSDRSLAEDLFADGVLQ
                     VLVSTATLAWGVNLPAHTVIIKGTDVYSPEKSTWDKLSPQDLLQMLGRAGRPRYDTHG
                     EGIIITNQTDVQYYLAVLNQQLPIESQFISMLMDNLNAEIVSGNIKCRQDAVNWLSYT
                     YLYVRMLVSPQLYKVPNDENDESLIVYRETLVHSALTTLHNENLIVYHPQTGTVLSTE
                     LGLIASYFYIKHTSMVTYSRELSDHSSQMDLFRIIAMSEEFKYLSVRPEERKELKELL
                     DRAPVPVKENADDRLAKVNILLQSYISRLKLEGFALNADMMFITQNAGRISRALYEYS
                     LKRGYSGTTKALLNICKMIDRRLWVANSPLGQMKSCPFEVVRKTEASTLPWQDYLELE
                     SPAQVGQAIRSEKHGKLVYDLLRRFPKLLLKCSIQPITPSLLKFELEILPDWIWDSSL
                     HGLVEPFVVLVEDTDGENILFSSTLLVRKEAVNDPHMIDFTLQLSPAQQKRLPPNFFV
                     SVISERWLNSDAQLALSIEHLRLPKKFPAPTPIIDMALVPTSELGDLEFSNVFNFELF
                     NKFQSQTFQSVYNSNVNIMVGASKGAGKTTIAELALLNHWRQNKGRALYISPHQEKIN
                     NLTKSWDNRFSELAGGKAIGKLGIDTNMNLRIISQSHLVLATPGQFDTVSRRWRQRKT
                     IQNIELIIYDDAHEISSGLTGAIYEAVISRMSFISTQLDKETRIVTLSSCVANGRDFG
                     EWLGVNKSHIFNFSPQERINPIEIHLNFFNHSANTSYNRSMIKSAFDFAHVNSSSTTI
                     VYLPTRLSCLKMSNTFVEMGESCSWDLLKVDDYELEKYLESLQDSQLRVPIKRGTGII
                     HKGMAAKDRKLIQKLYSNGALSVLFVARECCFNSPDADSVVILGTQWYDDKEHRFIDY
                     TANEILEMVGNVHDRNGKSSGRLLLLTSSKTKDYYKKILVEALPLESFMYFHLPDLLV
                     TEISTSVIESKQDCLDWLAYTYFYRRLHANPSFYGVKDITPYGISAYLTELVESTLTD
                     LQNSSMIEIESQKSADEGVVSETISPLTGCMVSSHYNTSFLTMTMLLSSLSGSATLQD
                     ILHILSQASEFDSIPLREDELSMLRKLNERVPLRVTDLAGSNLFANKIFLLLQAHFSR
                     LSLAVDFRSDLKIILEKAVPLVNTVIDVLSGDGKLNAMTAMDISQMIIQGLWDVDSPL
                     KQIPYFDDDVLTKCSERTIETVYDIMALEDAEREEIMPSEDSKLLKIANFVNNYPNVE
                     LEYSIDQGREIKANEATTINLTLTRDELPETLEVFSEKYPLEKLETWWLVLGEVSSKQ
                     LHAIKKVSLRSEVQSYAMEFFLPEGEHELTIWCVCDSYLDVDKEVSFSLKAL"
     gene            complement(<217806..>220133)
                     /gene="TDEL0A01270"
                     /locus_tag="TDEL_0A01270"
                     /db_xref="GeneID:11502593"
     mRNA            complement(<217806..>220133)
                     /gene="TDEL0A01270"
                     /locus_tag="TDEL_0A01270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678622.1"
                     /db_xref="GeneID:11502593"
     CDS             complement(217806..220133)
                     /gene="TDEL0A01270"
                     /locus_tag="TDEL_0A01270"
                     /inference="similar to DNA sequence:INSDC:YER171W"
                     /note="similar to Saccharomyces cerevisiae RAD3 (YER171W);
                     ancestral locus Anc_8.237"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678670.1"
                     /db_xref="GeneID:11502593"
                     /db_xref="GOA:G8ZLG5"
                     /db_xref="InterPro:IPR001945"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR006554"
                     /db_xref="InterPro:IPR006555"
                     /db_xref="InterPro:IPR010614"
                     /db_xref="InterPro:IPR010643"
                     /db_xref="InterPro:IPR013020"
                     /db_xref="InterPro:IPR014013"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLG5"
                     /translation="MKFYIDDLPVLFPYPKIYPEQYKYMCDIKKTLDAGGNSILEMPS
                     GTGKTVSLLSLTIAYQLHYPEHRKIIYCSRTMSEIEKALVELENLMDYRSRELGVHED
                     FRGLGLTSRKNLCLHPIVSKERKGTVVDEKCRRMTNGQAKQKLETDPDSKVELCEYHE
                     NLYNIEVEDYLPKGVYSFERLIKYCEERKLCPYFIVRRMISLCNIIIYSYHYLLDPKI
                     AERVSREMSKDGIVIFDEAHNIDNVCIESLSLDLTNDVLKRATKGANALENRIEEVRR
                     VDAQKLQDEYDKLVQGLHTAEILEPEEESALETPVLSQDLLTEAIPGNIRRAEHFVSF
                     LKRLIEYLKTRMKVLHVISETPKSFLQHLKQLTFIDRKPLRFCSERLSLLVRTLEVSE
                     IEDFMALKDIATFATLISTYETGFLLIIEPYEIENAAVPNPIMRFTCLDASIAIKPVF
                     ERFSSVIITSGTISPLDMYPRMLNFNTVLQKSYAMTLAKKSFLPMIVTKGSDQVAISS
                     RFEIRNDPSIVRNYGSMLVEFSKITPDGMVVFFPSYLYMESIISMWQTMGILDEVWKH
                     KLILVETPDAQETSLALETYRKACSNGRGAILLSVARGKVSEGIDFDHHYGRTVLMIG
                     IPFQYTESRILKARLEFLRENYQIRENDFLSFDAMRHAAQCLGRVLRGKDDYGVMVLA
                     DRRFSRKRNQLPKWISQGLSDADLNLSTDMAIANAKQFLRTMAQPTDPKDQEGVSVWR
                     YEELLQYQEEEKSKKGYQNGNGTVVNELDVDIEMN"
     gene            complement(<220341..>221033)
                     /gene="TDEL0A01280"
                     /locus_tag="TDEL_0A01280"
                     /db_xref="GeneID:11502572"
     mRNA            complement(<220341..>221033)
                     /gene="TDEL0A01280"
                     /locus_tag="TDEL_0A01280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678623.1"
                     /db_xref="GeneID:11502572"
     CDS             complement(220341..221033)
                     /gene="TDEL0A01280"
                     /locus_tag="TDEL_0A01280"
                     /inference="similar to DNA sequence:INSDC:YER170W"
                     /note="similar to Saccharomyces cerevisiae ADK2 (YER170W);
                     ancestral locus Anc_8.236"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678671.1"
                     /db_xref="GeneID:11502572"
                     /db_xref="GOA:G8ZLG6"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR006259"
                     /db_xref="InterPro:IPR007862"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028586"
                     /db_xref="UniProtKB/TrEMBL:G8ZLG6"
                     /translation="MATKLIKPLRLLLLGAPGAGKGTQTSRLLEKFPQLNSVSSGDLL
                     RQQIKDKTPLGSLAASYILEGKLLPDELITRLVKGHLSDAGWLSPQASWLLDGFPRTV
                     EQATMLKSALAKSDTSLTMVVDLDVPESVILERIENRYVHVPSGRVYNLQYKPPKVPG
                     KDDITGEPLTKRPDDTAEVFGKRLAEYHKTAAPLREFYAKRGILKTISGETSDIITPK
                     LFQLIESQYGVN"
     gene            <222024..>225701
                     /gene="TDEL0A01290"
                     /locus_tag="TDEL_0A01290"
                     /db_xref="GeneID:11502994"
     mRNA            <222024..>225701
                     /gene="TDEL0A01290"
                     /locus_tag="TDEL_0A01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678624.1"
                     /db_xref="GeneID:11502994"
     CDS             222024..225701
                     /gene="TDEL0A01290"
                     /locus_tag="TDEL_0A01290"
                     /inference="similar to DNA sequence:INSDC:YDR097C"
                     /note="similar to Saccharomyces cerevisiae MSH6 (YDR097C);
                     ancestral locus Anc_8.235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678672.1"
                     /db_xref="GeneID:11502994"
                     /db_xref="GOA:G8ZLG7"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="InterPro:IPR015536"
                     /db_xref="InterPro:IPR016151"
                     /db_xref="InterPro:IPR017261"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLG7"
                     /translation="MTPKTSNSAQKRMKQSTLLSFFSKQPATSSPRSSNKSANKAGTK
                     ILTNGAVKEQEKPTNKLLFVGMEDEDSDASGFVTANDSVNPVSVRGQNTHSSKSDSVQ
                     TPTVAEDDGDKTLSNVSAVNLDRKQQEIDGDDDEEGNTLSSSGRRLKKNLSYAEDSDN
                     SDNESTPSVSRKKRKMQIELDDEEEEYVPDKKDESEDDLVEEDGDDDLLALAESSSPK
                     PEKTVLKHTPSRPQKPFAVKKSPSIRPLSTPKHQKFGKQNEERYHWLVDERDASGRPI
                     TDPQYDPRTLYIPSSAWNKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDAMLGN
                     HLFDLKIAGGGRANMQLAGIPEMSFDYWASQFIQRGYKVAKVDQRESMLAKEMREGSK
                     GIVKRELQYVLTSGTLTEGNMLQSDLATYCLAVREESGNFYDLENDNQSPGVAPKRLF
                     GVAFIDTATGELNLVEFEDDDECTKLDTIMSQVNPKEVIMEKDNLSSLAHKIIKFNAA
                     PQAIYNYIKPDTEFYGYDKTSKELDDSKYFPDKSQWPAILKQYYEQGKKIGFSAFGGL
                     LYYLQWLKLDESLISMGNVKEYNPTQFQNSLVMDGVTLQNLEIFTNSFDGTDKGTLFK
                     LFNKAISPMGKRMMKKWLMHPLLKQKDINKRLDTVESLMSDGNLRDLLESTFAQLPDL
                     ERTLSRVHSGNLKVKEFDKTIQGFEAVVDLLQKMSSHSLEGSLSDYVSSIPKSLFVDV
                     ENWSNAFDREKAVNEGILLPHRGVEPEFDESVDKIKELEDQLEDLLKAYKKQFKCSNL
                     QYKDCGKEIYTIEVPVSVSKYIPSNWVQMAANKSTKRYYSDEVRVLARSVAEARELHK
                     VLEEELRTRLCKKFDMHYGTSWMPTVQAIASIDCLLALVRTSESLSFPYCRPTLVDEL
                     DHETGAKLNGFLKFKSLRHPCFNLGTTTSKDFIPNDVELGKDCPQLGLLTGANAAGKS
                     TVLRMTCVAVIMAQMGCYVPCESAILTPMDRIMTRLGASDNIMQGKSTFFVELSETKK
                     ILDLATNRSLLVLDELGRGGSSSDGFAIAEGVLHHVATHIQSLGFFATHYASLGQSFK
                     GHPQVRPLKMSIMVDEKTRTVAFLYKLVDGQSEGSFGMHVASMCGIAEEIVDNAQVAA
                     ASMEHTSQLMKLRAKESNALAVGDSSLPLGLESDFVRLVFGDGLKNSKLGTGEAVQVY
                     DSHVKGKTLANLFSMIESLNE"
     gene            complement(<225813..>228326)
                     /gene="TDEL0A01300"
                     /locus_tag="TDEL_0A01300"
                     /db_xref="GeneID:11502871"
     mRNA            complement(<225813..>228326)
                     /gene="TDEL0A01300"
                     /locus_tag="TDEL_0A01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678625.1"
                     /db_xref="GeneID:11502871"
     CDS             complement(225813..228326)
                     /gene="TDEL0A01300"
                     /locus_tag="TDEL_0A01300"
                     /inference="similar to DNA sequence:INSDC:YDR096W,YER169W"
                     /note="similar to Saccharomyces cerevisiae GIS1 (YDR096W)
                     and RPH1 (YER169W); ancestral locus Anc_8.234"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678673.1"
                     /db_xref="GeneID:11502871"
                     /db_xref="GOA:G8ZLG8"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR003349"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8ZLG8"
                     /translation="MSRSSPSEVVDGVPVFRPSFNEFHDFYSYVQSINHHGMQSGIVK
                     IIPPQEWLDMVDSPPRVEILQDIKIRKPIQQHIAGAQGVFMVQNVEKNKVYNIIQWKD
                     LSRDYALPDSHNGDKEARVPSPPIKSSKIKLKKHDDFTEESFQEFKDNYNAENLDQFD
                     DPKRLEFLESYYWKTLNFTTPMYGADTLGSVFSQDLKIWNVSKLPNLLDEMEQKLPGV
                     NNSYLYAGLWKASYAWHLEDQDLYSINYIHFGAPKQWYSIPQEDHEKFYKFMKDQFPL
                     DASKCSEFLRHKMYLVSPKLLRKNGIRCNKIVHRQREFIITFPYGYHAGFNYGYNLAE
                     SVNFALEEWVPIGKRAGKCLCIDDAVGIDVDKLANKWNANKKDVSRPVSQVSDASEQE
                     NRLKSFGELLNHSSQELQQMEENKSLPSLNPGINRTQSSSIRSTTPNSGQYFNMNQTI
                     SRISSPLLSRMMDLSNIVEPTLEDPTLKFKKKLLTPQLPQNISMNSNTGSPNASARMT
                     LPSHDSGNNGNSLTMAPIGVTSSNPPSALLDDNDDNMLALSLASMANSGASSPRLTLP
                     ALNSPIEHANAPMAVNSTMHEQEHAHSSGIVSPKPSYSHNPLSYYSASSKSGNNNVPL
                     APLSPTTSNLPFIKKLKSPNIVTLNISRESSRSPVSFANDYRSNNSLAYSSSVSSTLN
                     QVHTYSSNSMSSSAGGGSPLPKLPEAKRPKLESKTFSPPSASKRKQDYTSTASQSQQP
                     KFTSSEIVMSENGKVYICQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRD
                     HVLQHLNKKIPCTQEGEGLSSTPKKEDGGRMEHPGTVVD"
     gene            <228989..>230635
                     /gene="TDEL0A01310"
                     /locus_tag="TDEL_0A01310"
                     /db_xref="GeneID:11503184"
     mRNA            <228989..>230635
                     /gene="TDEL0A01310"
                     /locus_tag="TDEL_0A01310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678626.1"
                     /db_xref="GeneID:11503184"
     CDS             228989..230635
                     /gene="TDEL0A01310"
                     /locus_tag="TDEL_0A01310"
                     /inference="similar to DNA sequence:INSDC:YER168C"
                     /note="similar to Saccharomyces cerevisiae CCA1 (YER168C);
                     ancestral locus Anc_8.233"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678674.1"
                     /db_xref="GeneID:11503184"
                     /db_xref="GOA:G8ZLG9"
                     /db_xref="InterPro:IPR002646"
                     /db_xref="UniProtKB/TrEMBL:G8ZLG9"
                     /translation="MQVKWPLLKRNLGKVMSRVTGCNVGMGLPPLKLDKVEQNICQLL
                     NDFTQTYNGRITGNSEPLALRISGGWVRDKILGRDSHDLDISINIMSGEQFALQLSRF
                     VTDNFSKYGIKPHSIHKIDINPAKSKHLETATTKLFGVEVDFVNLRSEEYSNHSRIPV
                     TKFGTAEEDALRRDATLNALFYNIQENKVEDFTKMGLRDLKNGILRTPLPPRQTFLDD
                     PLRVLRLIRFASRYSFRIDDEVLNEMRDPEINAAFSTKVSNERIGTEVEKILDGSNPL
                     LGLALIQKTKIENIVFTWHYDADLIAFNKQHCKDLPRIDSILNDGILNTHLFEVVNKF
                     QHFVENIPHLTKCLNGSLEFRRAFILSACLSPMEGLKIIWSAKKKMNNTMPVVESILK
                     DGLKTGKSEACQIARVVDSLTSYDEMITSFSRPGQQPQRSQIGTFLRDLKGDWEIAHF
                     TSLFNKVIKITEQDQLSQYAKNYASFHDYVYGEQLERCHDLRPLINGKEMVKLLNMKG
                     GPWLGKINDRAILWQLDNPQGTREALLEHLKAILPEYVSN"
     gene            complement(<230794..>233022)
                     /gene="TDEL0A01320"
                     /locus_tag="TDEL_0A01320"
                     /db_xref="GeneID:11503060"
     mRNA            complement(<230794..>233022)
                     /gene="TDEL0A01320"
                     /locus_tag="TDEL_0A01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678627.1"
                     /db_xref="GeneID:11503060"
     CDS             complement(230794..233022)
                     /gene="TDEL0A01320"
                     /locus_tag="TDEL_0A01320"
                     /inference="similar to DNA sequence:INSDC:YER167W"
                     /note="similar to Saccharomyces cerevisiae BCK2 (YER167W);
                     ancestral locus Anc_8.232"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678675.1"
                     /db_xref="GeneID:11503060"
                     /db_xref="UniProtKB/TrEMBL:G8ZLH0"
                     /translation="MSRPSSRGSVTPGAESVNKWKIPHYYRRSSGASSHQSSGSEAGT
                     PITPGTNSMSSPKKVLVEDPKKGKKRPAYRSRKIDKKKAGDMVFVNYTVQDTASEENA
                     VDSAPELPPTPAISHKKKSSRSRMLKIFGSSKEPNEADSGAHLAACPENDGLYEHESA
                     QISTKRSCSSFLRYGRFHHGHSKRSENTAEEEVVPKSSQSPNLVKPASNGIFFGNSSR
                     KVKYLGGMVKNEISSQDSMNGKPSDENDASIAFSKMFTRNGANTSGSMSSLISLNQNL
                     QDQQSQSHPSVGVPALKKNMSASSISSLSYRCSPIRTASPARPRSGTRGSYTASLHSV
                     IDTEDANNAIFTGNDTYLDSRVGNRNTSVLRHKKKQDSISDTHRLYSTSASASTFLNN
                     NSNAVTPSSSSLVTPPPFTPGYSLPSNTSASSTPSVMEYAHISQPATYNGLINSANSL
                     GHHSAFNINQPLSERDSSSEILFGDSDIPTPVDNQPALRGVSKATLEEDEEKGRMEQE
                     AISNNTSKNKNLLVRQKVDNLELLLPHGSSTGSSQGGSILTNSTSSIPDSSIMGHWQD
                     SNCYALFDSGTGIKGEHNEKISSGRTLRVASSADLRNGDNGNIINTGAMEKDFYAQFD
                     FDNAAAFFHDQSKILAPEFSHVVEQPARNVSTPIDEQASAVTSIANYSPGAAATISME
                     DTAHRDDRSHHANAMMHSSSNASQATAGNSTGQWKSINNDLDAITNSLGMSDEINDLS
                     FT"
     gene            complement(<233436..>238250)
                     /gene="TDEL0A01330"
                     /locus_tag="TDEL_0A01330"
                     /db_xref="GeneID:11503173"
     mRNA            complement(<233436..>238250)
                     /gene="TDEL0A01330"
                     /locus_tag="TDEL_0A01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678628.1"
                     /db_xref="GeneID:11503173"
     CDS             complement(233436..238250)
                     /gene="TDEL0A01330"
                     /locus_tag="TDEL_0A01330"
                     /inference="similar to DNA sequence:INSDC:YDR093W,YER166W"
                     /note="similar to Saccharomyces cerevisiae DNF2 (YDR093W)
                     and DNF1 (YER166W); ancestral locus Anc_8.231"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678676.1"
                     /db_xref="GeneID:11503173"
                     /db_xref="GOA:G8ZLH1"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="InterPro:IPR026871"
                     /db_xref="UniProtKB/TrEMBL:G8ZLH1"
                     /translation="MPEQPGSPFDGEPPLSPFDDSYEFDQSESDIGRRKGSILKKHGT
                     ARKPRNGNGVVFQEDKQPEEQEIARTFDEDDEYMHEDDDDDDAHSFKATPKMGGPSAV
                     FEDVALDTYASGGNNDKHHGHMKRLRMGTQRNKKGRPNVGRAKTLKWAKKNFHNPFED
                     MMKEEPDENALHNRANELRTIYYNLPLPEEMLDEDGKPIAQYSRNKIRTTKYTPLTFF
                     PKNIFFQFHNFANVYFLILNILGAFEIFGVTNPGLNAVPLIVIVIITAIKDAIEDSRR
                     TVLDLQVNNTRTHILEGVDNENVLADDVSLWRKFKKANTRLMIKFVAYCKGHLTEEGR
                     RQRLQQKRHQLHAKRSSMGDLPRNSLDSMESYRMSTDFGRPSGDYGRPSMDMDNLGHI
                     VTQQDDVNLIDRSIPPAPDCKFAKDYWKNVKVGDVIRIHNNDEIPADVVLLSTSDADG
                     ACYVETKNLDGETNLKVRQSLKCSYRIRNSRDVTRTKFWLDSEGPHANLYSYQGNLKW
                     IDSSDGEMKNEPVTINNTLLRGCTLRNTKWAMGLVVFTGDDTKIMINAGVTPTKKSRI
                     SRDLNFSVIINFCVLFILCFISGVVNGVYYNKNNVSRTYFEFGNAANGGAALNGFVSF
                     WVAVILYMSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQ
                     IEYIFSDKTGTLTQNVMEFKKATINGVSYGRVYTEALAGLRKRQGIDVESEGQREKAE
                     IARDRDVVISELKALGNNSQFNPDDLTFISKEFVRDLQGQSGEVQQNCCEHFMLALAL
                     CHSVLVEPHKTDPSRLELQAQSPDEAALVGTARDMGYSFVGKTKKGLIVVIQGVEKEF
                     QILNILEFNSSRKRMSCIVKIPPANPQDEPKALLICKGADSVIYSRLKQSGAANDETL
                     LEKTALHLEQYATEGLRTLCISQRELSWAEYTEWNERYDIAFAAVTNREEQLDEVADS
                     IERELVLLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNN
                     EMELLVVKHDGEDVREYGSHPLEVVQNLLLKYLNEKFGMSGSERELDEAKKEHDFPKG
                     NFAVIIDGDALKIALSNDDVKRQFLLLCKNCKAVLCCRVSPSQKAGVVNLVKKSLNVM
                     TLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYLSRLILVHGKWSYK
                     RLAEMIPQFFYKNVIFTVALFWYGIYNDSDGSYLFEYTYQMFYNLAFTSLPVIFLGIL
                     DQDVNDTISMIVPQLYRVGILRTEWNQTKFLWYMFDGLYQSIICFFFPYLIYHKTMYV
                     TQNGYGLDHRYYFGIIVTSIAVVSCNLYVLLHQYRWDWFTSLFIAISCLALFGWTGIW
                     TSSLTSHELWKAGARVYNTPAFWAVFFVGVVFCLLPRYTLDNYKRMFQPKDVDIIREM
                     WKRGDFDKYPAGYDPTDPNRPEIPKSARFDSQHLTIGDPSKMQDNYSRDTVLTEEIPM
                     TIMQTENGTGRQIVKEEPWASSPRETQDLLYSPRLEQQQEERQKRMNSSLRPSSEHSR
                     GRTSLDRTRSQMRASNELDTRYSLDRARTSLDLPGVTNAESLMRKRSDNYID"
     gene            complement(<239400..>239952)
                     /gene="TDEL0A01340"
                     /locus_tag="TDEL_0A01340"
                     /db_xref="GeneID:11502717"
     mRNA            complement(join(<239400..239843,239923..>239952))
                     /gene="TDEL0A01340"
                     /locus_tag="TDEL_0A01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678629.1"
                     /db_xref="GeneID:11502717"
     CDS             complement(join(239400..239843,239923..239952))
                     /gene="TDEL0A01340"
                     /locus_tag="TDEL_0A01340"
                     /inference="similar to DNA sequence:INSDC:YDR092W"
                     /note="similar to Saccharomyces cerevisiae UBC13
                     (YDR092W); ancestral locus Anc_8.230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678677.1"
                     /db_xref="GeneID:11502717"
                     /db_xref="GOA:G8ZLH2"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:G8ZLH2"
                     /translation="MASLPKRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQ
                     SPYENGVFNLELFLPDDYPMEAPKVRFLTKIYHPNIDKLGRICLDVLKTNWSPALQIR
                     TVLLSVQALLASPNPNDPLANDVAEDWIKDEEGAIKTAREWTEAYASKKDQKSTN"
     gene            complement(<240288..>242054)
                     /gene="TDEL0A01350"
                     /locus_tag="TDEL_0A01350"
                     /db_xref="GeneID:11503212"
     mRNA            complement(<240288..>242054)
                     /gene="TDEL0A01350"
                     /locus_tag="TDEL_0A01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678630.1"
                     /db_xref="GeneID:11503212"
     CDS             complement(240288..242054)
                     /gene="TDEL0A01350"
                     /locus_tag="TDEL_0A01350"
                     /inference="similar to DNA sequence:INSDC:YER165W"
                     /note="similar to Saccharomyces cerevisiae PAB1 (YER165W);
                     ancestral locus Anc_8.229"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678678.1"
                     /db_xref="GeneID:11503212"
                     /db_xref="GOA:G8ZLH3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR002004"
                     /db_xref="InterPro:IPR006515"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8ZLH3"
                     /translation="MTDITEKTAEQLEQLNIQDEPQQNVAPASNEPESQKVETSSASL
                     YVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGKTAIEK
                     LNYAPIKGVPCRIMWSQRDPSMRKKGSGNIFIKNLHPDIDNKALHDTFSVFGNILSCK
                     IATDEAGNSRGFGFVHFEDDEAAKEAIDAINGMLLNGQEVYVAQHVSKKDRQSKLDEA
                     KANFTNVYVKNIHPDTGDEEFEEFFTKVGPITSAHLEKDNEGKLRGFGFVNYENHNDA
                     AKAVEELNETDFKGQTLHVGRAQKKHERLQELKKQYEAFRLEKLEKYQGVNLFVKNLD
                     DTIDDQKLEEEFAPYGTITSVKVMRSENGKSKGFGFVCFSTPEEATKAITEKNQQIVA
                     GKPLYVAIAQRKDVRRSQLAQQIQARNQMRYQQVTAAAAAAAAGMRGQFMPPMFYGVM
                     PPRGVPFNGPNPQQMAAMGGMPKNGVPPQQFRNGPVYGVPPQGAPQQGQFMRNGAGAN
                     QFYQQKQRQVLGEQLYKKVFAKTSDEEAAGKITGMILDLPSQEVVPLLESDELFDQHF
                     KEAFAAYESFKQEQEQEQQPQN"
     gene            complement(<242552..>246904)
                     /gene="TDEL0A01360"
                     /locus_tag="TDEL_0A01360"
                     /db_xref="GeneID:11503175"
     mRNA            complement(<242552..>246904)
                     /gene="TDEL0A01360"
                     /locus_tag="TDEL_0A01360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678631.1"
                     /db_xref="GeneID:11503175"
     CDS             complement(242552..246904)
                     /gene="TDEL0A01360"
                     /locus_tag="TDEL_0A01360"
                     /inference="similar to DNA sequence:INSDC:YER164W"
                     /note="similar to Saccharomyces cerevisiae CHD1 (YER164W);
                     ancestral locus Anc_8.228"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678679.1"
                     /db_xref="GeneID:11503175"
                     /db_xref="GOA:G8ZLH4"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016197"
                     /db_xref="InterPro:IPR023780"
                     /db_xref="InterPro:IPR025260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLH4"
                     /translation="MASSKEFSSEVLENPELYGLRRSHRSAHTQQTYYTDDSEEDEDT
                     IVSTRRRRRAQGEDSEDADVDDVDEDEEDNDDEADFTADEGDSDFQGSPVKTKVVRKK
                     KRTVVPAKKVMEKELIPTRFSSRNSKSINYNVDYSDDDLLESQDEEGVEGMNSSIEDG
                     EGYEYEYSATPQPEVDHGIDFVVTHKLKEGADEAVLKTVPSLSDCKVNFQFLIKWSDE
                     SHLHNTWESYESLGQVRGIKRLDNYCKQFIIEDLQIRLDPYVTAEVFRSYGYGPREEA
                     RCSLNNLNNQRRIIDSVRVTQEDGTSQLQYLVKWRRLNYDEATWEKATEIAELAPEQV
                     KHFQGRANSKILPQYSSNYTSQRPRFEKLSTQPPFIKGGELRDFQLTGINWMAFLWSK
                     NDNGILADEMGLGKTVQTVAFISWLVFARRQNGPHLIVVPLSTMPAWQETFERWAPDL
                     DCICYMGNQKSRETIRDFEFYTNPQSKGKKNIKFNVLMTTYEYILKDRSELGSIKWQF
                     LAVDEAHRLKNAESSLYESLNSLKVSNRMLITGTPLQNNIKELAALIDFLMPGRFTID
                     QEIDFENQDNAQEEYIRDLHERLQPFILRRLKKDVEKSLPGKTERILRVELSDVQTEY
                     YKNILTKNYSALSAGAKGGHFSLLNVMSELKKASNHPYLFDNAEERVLEKFGDGSRSR
                     GNILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRILDILGDYLQIKGINFQRL
                     DGTVPSAQRRISIEHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADL
                     QAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGKKYSKK
                     NEPSSGELSEILKFGAGNMFAARDNQKKLEDLNLDDVLNHAEDHVTTPELGESHLGGE
                     EFLKQFEVTDYKADVDWDDIIPEEELRKLHDEDQKRKDEEYVQEQLQLMNRRSNALKK
                     IKDTVNGDAGTQYSDDDDDTKSSRKRAKANNLDVIDEREIRALYKAILKYGVLTDQFE
                     AMIADGSLPLKSIERYEEVYADLIASAKEYLQKEETKRNHILESLESDAQAYRAKLKN
                     GEIKADAQPKDNPLTKLAAKRKEKRAVLFEFEIVKNLNAESLLNRIEDLKLLKTFIDK
                     NYKDEPSNFKFHQTLKPVQNWNCEWTKDNDDKLMVGVYKYGYGSWAQIRDDPFLGLTN
                     KIFLNEAQLAAKGGKKDEPSDRTNVPEKRGKGITGSSKKVPGAIHLGRRVDYLISVLR
                     DESNGIVTATATPSGANTPTLESATDRLPSGPAKKKQRKNPISKAGSPDTTKSESSSS
                     SASRRLKALPKGPAAMTNHKPVPAIDRHEKEYESMDEEECMNTMGDMRTSLKRLRRGG
                     KGLDRKEWAKVLKTELTTIGDHIEKQKNTSRKTEPSKFRQHLWSYTANFWPAQVKSTK
                     LLAMYNKITGSDST"
     gene            <248469..>250292
                     /gene="TDEL0A01370"
                     /locus_tag="TDEL_0A01370"
                     /db_xref="GeneID:11502596"
     mRNA            <248469..>250292
                     /gene="TDEL0A01370"
                     /locus_tag="TDEL_0A01370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678632.1"
                     /db_xref="GeneID:11502596"
     CDS             248469..250292
                     /gene="TDEL0A01370"
                     /locus_tag="TDEL_0A01370"
                     /inference="similar to DNA sequence:INSDC:YDR091C"
                     /note="similar to Saccharomyces cerevisiae RLI1 (YDR091C);
                     ancestral locus Anc_8.227"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678680.1"
                     /db_xref="GeneID:11502596"
                     /db_xref="GOA:G8ZLH5"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007209"
                     /db_xref="InterPro:IPR013283"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLH5"
                     /translation="MSDKNARIAIVSADKCKPKKCRQECRRSCPVVKTGKLCIEVTPT
                     SKIAFISEILCIGCGICVKKCPFGAINIINLPTNLEAHVTHRYSANSFKLHRLPTPRP
                     GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQEIIRYFRGSELQNYFTKML
                     EDNIKAIIKPQYVDNIPRAIKGPIQKVGEILKLRMEKPEDLVKYYMKVLDLQNVMHRE
                     ISQLSGGELQRFAIAMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLEPTKYVIS
                     VEHDLSVLDYLSDFVCILYGVPSVYGVVTLPASVREGINIFLDGHIPSENLRFRTEAL
                     QFRLSDANDDMRDDASRAFSYPSMKRTQGDFVLNVEKGEFSDSEILVMMGENGTGKTT
                     LIKLLAGAIAADDGQKVPKLNVSMKPQKIAPKFPGTVRQLFFKKIRGQFLNPQFQTDV
                     VKPLRIDDIIDQEVQHLSGGELQRVAIVLSLGLPADIYLIDEPSAYLDSEQRIICSKV
                     IRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGVPSKNAHSGAPEPLLTGCNRFLKN
                     LNVTFRRDPNSFRPRINKLDSQMDKEQKLSGNYFFLDNTGV"
     gene            <250935..>251948
                     /gene="TDEL0A01380"
                     /locus_tag="TDEL_0A01380"
                     /db_xref="GeneID:11502730"
     mRNA            <250935..>251948
                     /gene="TDEL0A01380"
                     /locus_tag="TDEL_0A01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678633.1"
                     /db_xref="GeneID:11502730"
     CDS             250935..251948
                     /gene="TDEL0A01380"
                     /locus_tag="TDEL_0A01380"
                     /inference="similar to DNA sequence:INSDC:YER161C"
                     /note="similar to Saccharomyces cerevisiae SPT2 (YER161C);
                     ancestral locus Anc_8.224"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678681.1"
                     /db_xref="GeneID:11502730"
                     /db_xref="InterPro:IPR013256"
                     /db_xref="UniProtKB/TrEMBL:G8ZLH6"
                     /translation="MSFLSKISNLRKATPVVPPKQEPVSDKKSNEEEYTILPRNYVRE
                     EDPAVRRLKELRRQELLKSGELSKKVRGQSKPAPTRRRKDDDEGGSMGTKFKRKVRPH
                     SAGSSLPTTNAKKAEPLKKLSFDELMKQAENNAQEKPNAMKEPSPVNSGPHRIPKSQG
                     TTQQYVKKIGFKKGADRRNRNSTSPVPEIPTTKPYRDEPAPIKLKTMVNGFAKPNEKL
                     RRQLEQRKRTIKPRTEYEDDGSDLDDFIEDDTMESENRRQSQRDTGYDRDEIWAMFNR
                     GKRRSDYAFDDMEDDDMEANEMEILEEEEQARRMARLEDKREEQWLKRHEQEKKRRKR
                     MKD"
     gene            complement(<252018..>254468)
                     /gene="TDEL0A01390"
                     /locus_tag="TDEL_0A01390"
                     /db_xref="GeneID:11502622"
     mRNA            complement(<252018..>254468)
                     /gene="TDEL0A01390"
                     /locus_tag="TDEL_0A01390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678634.1"
                     /db_xref="GeneID:11502622"
     CDS             complement(252018..254468)
                     /gene="TDEL0A01390"
                     /locus_tag="TDEL_0A01390"
                     /inference="similar to DNA sequence:INSDC:YDR089W"
                     /note="similar to Saccharomyces cerevisiae YDR089W;
                     ancestral locus Anc_8.223"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678682.1"
                     /db_xref="GeneID:11502622"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="UniProtKB/TrEMBL:G8ZLH7"
                     /translation="MKFGNKILAKSVPEWKLNNIDYEKLKKAIKRATTKSGDGSDGEN
                     LEQCTQLFRDQFNHVNVFTSLKVKEISSRLVGIETSIINYKKRFPQSEGKDVRNKKLQ
                     SRQLKIVGSHLDNCSSELQRLSRYLILQKIALGKLFKKFVKHYPVGAAEAQAYIQKIR
                     DLPEVTAGYDGISFTSVDLDPYLLEISLIVNILNDFQLKLSNDKSYNEDEDIISPSKK
                     KVDSSLAFDRAVLANASLQKFLVSTENIEEFKFMILNHGFHMLDDEIISTSKGIRDTA
                     ESIPSMDAKSIKSARSFMALQQAITCQQAHHPVETPTSNLHGQDSAAKNQPSASSLHR
                     SQPHLSLSILDNKSQPAFLEDNNVNQHPNLIMVSDDDDSHCILMCHVGGLRDHLETTD
                     FGFAELKKLMSGEPIHEESSTMQNSVMSKSAIEWVQSRHLRPVGPRIDFKRSRFICNE
                     ENSIYLLSLDEGVTTGSGSTVPHTFVQLTKLPATTASANKDKKLTELCDALIENKTQS
                     YPLSPHITLWKICFELYRSHNLQADLFKFLLKDEYDIEDAALNSEEFFLLGRDSTLKM
                     CSEKLISGFESEGNNRRQSVIRAKPKVQQAIEKPRVRYWNEFDDDPEFHDTGFYINDN
                     NGSQTDEERNPDFDSGFILFNKHFITSAYILCQRIKGLFGLQDRRALLGHVNNYGSIS
                     SASTTNSFDEMQAYLTATDECGDSDSVYEYKHDQVITFMYLSSLFTGCVTAGISLGIV
                     LALFHKEGSQADLEVADLLVAMIAISLVISLVLICISLLLLFSRFNLAPAWHYITCFI
                     LFLVVIFTVCYGFTEIFF"
     gene            256326..256398
                     /gene="TDEL0Atrna11R"
                     /locus_tag="TDEL_0Atrna11R"
                     /db_xref="GeneID:11502700"
     tRNA            256326..256398
                     /gene="TDEL0Atrna11R"
                     /locus_tag="TDEL_0Atrna11R"
                     /product="tRNA-Arg"
                     /note="codon recognized: CGU"
                     /db_xref="GeneID:11502700"
     gene            <256504..>257505
                     /gene="TDEL0A01400"
                     /locus_tag="TDEL_0A01400"
                     /db_xref="GeneID:11502546"
     mRNA            <256504..>257505
                     /gene="TDEL0A01400"
                     /locus_tag="TDEL_0A01400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678635.1"
                     /db_xref="GeneID:11502546"
     CDS             256504..257505
                     /gene="TDEL0A01400"
                     /locus_tag="TDEL_0A01400"
                     /inference="similar to DNA sequence:INSDC:YDR088C"
                     /note="similar to Saccharomyces cerevisiae SLU7 (YDR088C);
                     ancestral locus Anc_8.222"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678683.1"
                     /db_xref="GeneID:11502546"
                     /db_xref="GOA:G8ZLH8"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR021715"
                     /db_xref="UniProtKB/TrEMBL:G8ZLH8"
                     /translation="MSGSQDSTTENVHIPRYIKNQPWYYRDTKGGEDGKEDYLVHHRQ
                     LKKGGALEIDNNSEPKVGHGISDEFETVKIGKRGGRRCENCGATGHVRRDCLERARKI
                     PKSAEDSGLTVTVRRETSDSSDWDARKDRWFGYTGKEYDELLKKWENRKIASAQPEKE
                     ELWDTDEEVELIKLGLYKDTSGLLKQDDSHNTALHRASVRLREDRAAYLNDVHSQDIK
                     YDPKSRLYKSEELGSIDEESHMFRRHLTGEAQELDQLKKFTLAHAKKMGVRDEVESDS
                     KVSHVLIANPTKYEQMLRQERKKQPPREASITELQAKKTTGTAQSRKAKQDLKDLYG"
     gene            <257635..>258459
                     /gene="TDEL0A01410"
                     /locus_tag="TDEL_0A01410"
                     /db_xref="GeneID:11502984"
     mRNA            <257635..>258459
                     /gene="TDEL0A01410"
                     /locus_tag="TDEL_0A01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678636.1"
                     /db_xref="GeneID:11502984"
     CDS             257635..258459
                     /gene="TDEL0A01410"
                     /locus_tag="TDEL_0A01410"
                     /inference="similar to DNA sequence:INSDC:YDR087C"
                     /note="similar to Saccharomyces cerevisiae RRP1 (YDR087C);
                     ancestral locus Anc_8.221"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678684.1"
                     /db_xref="GeneID:11502984"
                     /db_xref="GOA:G8ZLH9"
                     /db_xref="InterPro:IPR010301"
                     /db_xref="UniProtKB/TrEMBL:G8ZLH9"
                     /translation="METNTFVKQLASNSRNVRENALETLHKYLNTKQFKDAKQLQYNK
                     LWKGLYYAMWFSDRPRPQQRLANELGELNVFYFNERDNKDAEGTLTLNDEAFIKFSKA
                     FWKIICMEWFQIDRYRIDKFLMLVRRVVFNQLKYLKLRNWDEQVVEAYIDKVLKWLPL
                     SASLKVYNGVPLHIIDVLLDEWERLVRPEDEEEDLDLAQLVQETPLAQFLKIFQDIVA
                     NTDNSKVLREAIKKELLADPRLVSWGFSTAKPITQETQNEPEDSDDDEEAEEWHGF"
     gene            <258647..>258877
                     /gene="TDEL0A01420"
                     /locus_tag="TDEL_0A01420"
                     /db_xref="GeneID:11502943"
     mRNA            <258647..>258877
                     /gene="TDEL0A01420"
                     /locus_tag="TDEL_0A01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678637.1"
                     /db_xref="GeneID:11502943"
     CDS             258647..258877
                     /gene="TDEL0A01420"
                     /locus_tag="TDEL_0A01420"
                     /inference="similar to DNA sequence:INSDC:YDR086C"
                     /note="similar to Saccharomyces cerevisiae SSS1 (YDR086C);
                     ancestral locus Anc_8.220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678685.1"
                     /db_xref="GeneID:11502943"
                     /db_xref="GOA:G8ZLI0"
                     /db_xref="InterPro:IPR001901"
                     /db_xref="InterPro:IPR008158"
                     /db_xref="InterPro:IPR022943"
                     /db_xref="InterPro:IPR023391"
                     /db_xref="UniProtKB/TrEMBL:G8ZLI0"
                     /translation="MARINEKSQGASQIEKLTDAPLEFVKEGQQFLAKCKKPDVKEYT
                     KIVRAVGIGFVAVGVIGYAIKLVHIPIRYLIV"
     gene            <259053..>259445
                     /gene="TDEL0A01430"
                     /locus_tag="TDEL_0A01430"
                     /db_xref="GeneID:11502809"
     mRNA            <259053..>259445
                     /gene="TDEL0A01430"
                     /locus_tag="TDEL_0A01430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678638.1"
                     /db_xref="GeneID:11502809"
     CDS             259053..259445
                     /gene="TDEL0A01430"
                     /locus_tag="TDEL_0A01430"
                     /inference="similar to DNA sequence:INSDC:YER159C"
                     /note="similar to Saccharomyces cerevisiae BUR6 (YER159C);
                     ancestral locus Anc_8.219"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678686.1"
                     /db_xref="GeneID:11502809"
                     /db_xref="GOA:G8ZLI1"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G8ZLI1"
                     /translation="MEDLEVKMEGSEPQQTVRTPEPGLQDVFDRIKTQFPTCKVKKIM
                     QTDEDIGKVSQATPVIAGRSLEFFIALLVKRSSEVARQLGCKRISGEVMKETILTDEK
                     FDFLRENVCGEAADHGQEDQEQDSPQED"
     gene            <259665..>261329
                     /gene="TDEL0A01440"
                     /locus_tag="TDEL_0A01440"
                     /db_xref="GeneID:11502751"
     mRNA            <259665..>261329
                     /gene="TDEL0A01440"
                     /locus_tag="TDEL_0A01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678639.1"
                     /db_xref="GeneID:11502751"
     CDS             259665..261329
                     /gene="TDEL0A01440"
                     /locus_tag="TDEL_0A01440"
                     /note="ancestral locus Anc_8.218"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678687.1"
                     /db_xref="GeneID:11502751"
                     /db_xref="GOA:G8ZLI2"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="UniProtKB/TrEMBL:G8ZLI2"
                     /translation="MGSLSFQASNGIIWPTYVVLLLSASAVAYWKRDSKTFLSANGTQ
                     KALPLAFNFVASGLGCGVLSAYPQIANIDGLHGLLVYALAGGLPMFLFAFLGPIIRKK
                     TPNGFVLTEWVFHRFGLLTGWYLGACTILTVFLFMVSEVASLKYAIETIAGIKALPVI
                     IIECVVTTIYTTIGGFHISFITDTLQVSVVFVLLIIVACAMGKYVHIDSSMIEPSGLL
                     KANKLGWQLVYILTFAIFTNDFFMSGFWLRTFASRSNKDLMIGCSIACVILVVFVTVI
                     GVTGFIAVWAGLISVADEENSGAAFFILLAQLPSWVMGFTLVFVVVLSTCTLDSLQSA
                     LVSSVSNDVFRNKIPIMYVRGLVLLVMVPVVVVGLIAEDVLSIYLIVDLLSSSVVPVL
                     VFGLSKRFEKYWTGWEVVGGGLGGILATWIFGTVYYDSPEEGGKLLLITNGLYADDWG
                     TFGAFVVAPFGGIAFGFFIMLIRLDCVKLYSNKDGVFHRSANKVGAVTGITGLHRFYR
                     HWEDRLITRSNVEVVNETESLTLQNTTTLDKKQSAVDTYQSTLFAE"
     gene            <261699..>263570
                     /gene="TDEL0A01450"
                     /locus_tag="TDEL_0A01450"
                     /db_xref="GeneID:11502778"
     mRNA            <261699..>263570
                     /gene="TDEL0A01450"
                     /locus_tag="TDEL_0A01450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678640.1"
                     /db_xref="GeneID:11502778"
     CDS             261699..263570
                     /gene="TDEL0A01450"
                     /locus_tag="TDEL_0A01450"
                     /inference="similar to DNA sequence:INSDC:YDR085C,YER158C"
                     /note="similar to Saccharomyces cerevisiae AFR1 (YDR085C)
                     and YER158C; ancestral locus Anc_8.217"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678688.1"
                     /db_xref="GeneID:11502778"
                     /db_xref="UniProtKB/TrEMBL:G8ZLI3"
                     /translation="MYHTFSSGGLRDNSSVYSGSSNTTSGSAFHSRGIPRSNSTSDLF
                     EIPVQGTGGNCRKPKSGPRASFAANGRSNSLQHVPKGHQLPNGYQIKPRDMHYHRGRF
                     PDQQSLRQGLCKSPSYSSSNYSLEPQNSLNSIPERRQPHYVLTPYQLQRKQMKGAFQF
                     PNGENFTPRNKLPRSSSSIALSKGGNPALQPLSRSQSMNSLPPRPVRLPKPPLTVVTS
                     PSPVESGSSGSSYNSMKDHSSSGSTNQSSRPSTHSSYTNLPSTVGKQRSPLIMKIEPP
                     RDKENLPEMIVEEVPTSTGSQTETNGPVKRKNSNTPNDGKETSNKSVKRGSSMSGFKS
                     FLKKLFHRQSSSRSPSPISESDKNKKRQRITRELTGLSADLPNELAAANSSMDNVDEE
                     TNRTPVSKTEAENDSSAEDEDDGDDTLMDTDLVFDSLLLKADSNRVSCLQKQIELNQK
                     LQKIPSLDSRIPSDLQSPPEASKEESNIDYELISEFSRLGKFIEKAEEIRESKPSNLP
                     TRSPKRPAISSKDSARSFYHPRRRGTGSSHDLIARLYQDWKIVHLDASVQTQKHFLKD
                     KELRFGQDIYVNDTWSATDYERSDKRFIRNRRRLMQLKDKGFIEAVKIELNEFKKTK"
     gene            263860..263931
                     /gene="TDEL0Atrna8E"
                     /locus_tag="TDEL_0Atrna8E"
                     /db_xref="GeneID:11502639"
     tRNA            263860..263931
                     /gene="TDEL0Atrna8E"
                     /locus_tag="TDEL_0Atrna8E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:11502639"
     gene            <264120..>264710
                     /gene="TDEL0A01460"
                     /locus_tag="TDEL_0A01460"
                     /db_xref="GeneID:11503326"
     mRNA            <264120..>264710
                     /gene="TDEL0A01460"
                     /locus_tag="TDEL_0A01460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678641.1"
                     /db_xref="GeneID:11503326"
     CDS             264120..264710
                     /gene="TDEL0A01460"
                     /locus_tag="TDEL_0A01460"
                     /inference="similar to DNA sequence:INSDC:YDR084C"
                     /note="similar to Saccharomyces cerevisiae TVP23
                     (YDR084C); ancestral locus Anc_8.216"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678689.1"
                     /db_xref="GeneID:11503326"
                     /db_xref="GOA:G8ZLI4"
                     /db_xref="InterPro:IPR008564"
                     /db_xref="UniProtKB/TrEMBL:G8ZLI4"
                     /translation="MEHVNNFYQTILKSSHPLMLSLHLGAKAAPLIFYILGSLFLNFT
                     AQFIVVVLLLTVDFYLTKNISGRKLVQLRWWYDPTTENAQTFKFESYKQYAPGPPINP
                     IDAKLFWWSLYLTPIVWAVFAIFCVLRLKVLYLLLVGVAIALTGWNAYGFRNCDKWNP
                     NAQSDTEGSWFQMPTIPVLENLQRFTAVQSFFQNRS"
     gene            complement(<264770..>265969)
                     /gene="TDEL0A01470"
                     /locus_tag="TDEL_0A01470"
                     /db_xref="GeneID:11503117"
     mRNA            complement(<264770..>265969)
                     /gene="TDEL0A01470"
                     /locus_tag="TDEL_0A01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678642.1"
                     /db_xref="GeneID:11503117"
     CDS             complement(264770..265969)
                     /gene="TDEL0A01470"
                     /locus_tag="TDEL_0A01470"
                     /inference="similar to DNA sequence:INSDC:YDR083W"
                     /note="similar to Saccharomyces cerevisiae RRP8 (YDR083W);
                     ancestral locus Anc_8.215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678690.1"
                     /db_xref="GeneID:11503117"
                     /db_xref="GOA:G8ZLI5"
                     /db_xref="InterPro:IPR007823"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZLI5"
                     /translation="MPLFQVDGWDIKSDKVAFFDVSAKKADEKKKERKAKKDKIKKEQ
                     QAKKQRAIEDEIEGVESDEDVEDVADVESLEKVKDEAKEEKVKKQKKRQLSDSEKPEK
                     KPKVSETVNTSQKTLTPLQQKMMAKLTGSRFRWINEQLYTITSDKALELMKEQPQLFD
                     EYHDGFRSQVTSWPENPVDVFVDQIQQRSKKPVNAPGGLPGLQDSKKIVIADMGCGEA
                     QLAADINEFFKKYNKRAKKYQQRKHQVHSFDLKRANPRITVADIRHVPLPDNSCTIVV
                     FCLALMGTNFLDFIKEAYRILAPRGELWIAEIKSRFADEKGDEFVNALKLMGFFHKKT
                     DNENKMFTRFEFFKPPQEIIEERNAKLERRQTFIEVETEKEQLEEKRQKIAEGKWLLK
                     PCIYKRR"
     gene            complement(<266215..>267624)
                     /gene="TDEL0A01480"
                     /locus_tag="TDEL_0A01480"
                     /db_xref="GeneID:11503150"
     mRNA            complement(<266215..>267624)
                     /gene="TDEL0A01480"
                     /locus_tag="TDEL_0A01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678643.1"
                     /db_xref="GeneID:11503150"
     CDS             complement(266215..267624)
                     /gene="TDEL0A01480"
                     /locus_tag="TDEL_0A01480"
                     /inference="similar to DNA sequence:INSDC:YDR082W"
                     /note="similar to Saccharomyces cerevisiae STN1 (YDR082W);
                     ancestral locus Anc_8.214"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678691.1"
                     /db_xref="GeneID:11503150"
                     /db_xref="InterPro:IPR018856"
                     /db_xref="InterPro:IPR024263"
                     /db_xref="UniProtKB/TrEMBL:G8ZLI6"
                     /translation="MGSCHHVAHQEGELIFYVPALFAHGLHNGGSGVPLLMSDLLRCV
                     EESKKVSSIYYSGQVSCIFWKNHPIGRVCVLGVVMGVKWKWINNEDYVFLFMDDFSSQ
                     TSHKTKTLVCKCLEDVLLGQGVSINSMVGERFRLYGQMNLCYGELQVEVVEQCDSLTD
                     EIDHWQSSLEQIIELNVPWQLDEQVLQDVLTQGSSCGIEYEGVTNFTTPIRLKARRDF
                     IEELQVEKYKEELEIVSPYREISNQEMDSLSGSSLESSARLPFEDSLARKETLLVGTQ
                     SSVVDATVEYVVDDQSISVCNENQARAQVLKHLLSCPDRTISIVELYQMSQIYDLISN
                     ISAIRFNRQNIMLVKSLEQLKTETFFRLIDYLVTSGLLKYVNRNVIDLMPLKSLYAYC
                     TKRLRALIKMQCYLGTIEVKIIRQKLSLPSLSQKAIIDTFKEALRVAAYGHPNLFTGW
                     WIEINSEKESAIHLEYKKI"
     gene            <267834..>268298
                     /gene="TDEL0A01490"
                     /locus_tag="TDEL_0A01490"
                     /db_xref="GeneID:11502937"
     mRNA            <267834..>268298
                     /gene="TDEL0A01490"
                     /locus_tag="TDEL_0A01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678644.1"
                     /db_xref="GeneID:11502937"
     CDS             267834..268298
                     /gene="TDEL0A01490"
                     /locus_tag="TDEL_0A01490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678692.1"
                     /db_xref="GeneID:11502937"
                     /db_xref="GOA:G8ZLI7"
                     /db_xref="InterPro:IPR014306"
                     /db_xref="InterPro:IPR023416"
                     /db_xref="UniProtKB/TrEMBL:G8ZLI7"
                     /translation="MSERPPVTCHVLDTTTGKPAANVTCAIYKIDLSNETLAGNYQVF
                     EETDSPKPFAMSRTNEDGRVPSWIFEPSPSKREMLKALGIEQDIETSNLRWGKLVPGT
                     YKIRFQVGKYYRSMGQTNFHPFVDIVFQVEDSRHYHIPLLLSNYGYSTYRGS"
     gene            <268744..>271149
                     /gene="TDEL0A01500"
                     /locus_tag="TDEL_0A01500"
                     /db_xref="GeneID:11503127"
     mRNA            <268744..>271149
                     /gene="TDEL0A01500"
                     /locus_tag="TDEL_0A01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678645.1"
                     /db_xref="GeneID:11503127"
     CDS             268744..271149
                     /gene="TDEL0A01500"
                     /locus_tag="TDEL_0A01500"
                     /inference="similar to DNA sequence:INSDC:YDR081C"
                     /note="similar to Saccharomyces cerevisiae PDC2 (YDR081C);
                     ancestral locus Anc_8.213"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678693.1"
                     /db_xref="GeneID:11503127"
                     /db_xref="GOA:G8ZLI8"
                     /db_xref="InterPro:IPR004875"
                     /db_xref="InterPro:IPR006600"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:G8ZLI8"
                     /translation="MLSIEQRYNICLMAERHPKWTQLELARWAYETFQLPKIPSQGTI
                     SRLLAKRDVYMNCKDNEKAANRVRKPNNVLVRLILQEWVSQSIWNGIPINSPIIQDTA
                     QSIWYRIPAEHREGNGSFSYKWINNFLSKMDINISNLDEELPKPPKVWTFEERNGLKQ
                     LFATIPPQDIFTLDETFLAYNLPLDYAQYETSQIQRAIEVATVMLCCNLDGSEKLKPL
                     VVGKYNSYRSFRNYFPEEPSDPVSQSLLGDKMAQRFGISYHSNRKAWLTSNLFHDWLA
                     RWDKRLMADNRKIWIILDDSCSHRIINPHLKNIQLVYTSANSRFLPFNWGVLDEFKTR
                     YRIQQYQALIDLQKTLEKKTNKRMLITFEQSQLTMSNAFKFIKKAWKGIPVQTIRANW
                     KSSGILPSEMIPLGETVSMAFKKNEALEAELNGLCDKFYCAKKWDHDMLLDLNIENKN
                     TNFLSTEELVESAIVDAVEPDPQVSQRNATPALSSHIGEYYSFDLLNDRNLGINLNQA
                     TGDTDSHSEDDLSRDNMNSNGSDGDNIALLGNSNEAGKVDNNYEINLDRLLGGDYGSE
                     EKGKLYNVSTLIDRPNLFMGENGVLDLRGVGIDASIGPSDYFSDMFPTSVPGTAATSI
                     PGGPPDGMSTQPISASYNTNTVPAPNQRPATAASSTMVPFENPALNHLLENSVSSNKD
                     TTPNSLPEFLPEANPGAALQANINIAKSLGNILKHTETRELNFSEAAINEIKSNYNHI
                     LTRIKMVRKRRHNMKARRGQVQLEKYLSGETPTSSNNSEFSPSHNLQVPVDLQLTDNA
                     SFF"
     gene            complement(<271245..>273947)
                     /gene="TDEL0A01510"
                     /locus_tag="TDEL_0A01510"
                     /db_xref="GeneID:11503124"
     mRNA            complement(<271245..>273947)
                     /gene="TDEL0A01510"
                     /locus_tag="TDEL_0A01510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678646.1"
                     /db_xref="GeneID:11503124"
     CDS             complement(271245..273947)
                     /gene="TDEL0A01510"
                     /locus_tag="TDEL_0A01510"
                     /inference="similar to DNA sequence:INSDC:YDR080W"
                     /note="similar to Saccharomyces cerevisiae VPS41
                     (YDR080W); ancestral locus Anc_8.212"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678694.1"
                     /db_xref="GeneID:11503124"
                     /db_xref="GOA:G8ZLI9"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016902"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZLI9"
                     /translation="MQDNDDKSAAVSPVFNGDKATDGTNREPKANDEVSSKSEETSPS
                     KVIESLDIIAGVSEKRFGRSHSESSDEDEVSGEESDEEEEIPPLLKYTRLNKLPTNFF
                     KRDSISACLFHEDFFAFGTHAGLLHLTLPDFTPIQTVKLHRSSILSIHSDGNYFATGS
                     IDGTVAIGLIEDLSTVTSFDFKRPIQAVVLDSDYKSSATFVSGGMAGEVILSQRNWLG
                     NRIDTVLAKGQGPIMGIFTVDDVILWMNDAGITFCSIHSRAHLLNVPFPTDDKEEARP
                     ALYRPHVHFPESDRIIVGWGDHVWMFKVSLKTNGEYGKNFGSILSSAASSLRAVPDKK
                     VELEHYFRIRIHMAGIASFKDDQIMCLGFEVDDIENKLAAKIPELEIIDTVSGEEIYN
                     DEVVSKNYQNLSLNDYHLGKHIGKTSPEYFFISASDCIHVQVFSLKDHFDWYVQRENY
                     LKAWEVGKYAVSLNDRLAVGFQYVDQLITDKQWKNAASFTAAIISIVNNSEDKQVKNE
                     TLQKSQDVFLNIIENGEVDYVYDTIPTEPQLDKHLYDAILSFFLKELKLKEFFKCIQK
                     WPLRVFSYQKFEEQLEERIEKHDELEGAYRDAIIHLFLVQKLYSKAIPHMIKRKDIRA
                     LSILLTHNLISQFADDILEILLIPYDDTLENLPNLPLDKLAVTFRIPIDLLVKNRHSL
                     EVSKIVKKLESPKQLRVILFLYLKKLSVIDPDATAPLENDMISLYADYQRDQLLNFLK
                     KRVNYDVERAIEFCSKRKGFHNELIYLWGKIGENKKALSLIIDGLNDPKLAIEFVKSW
                     GDSELWEFMVGYSMDKPKFVKALLDSPDEFGKIYLEVIKAMPTEMHINGLQATLVNIC
                     RSNALNLQVSENVFKLIDDESKEYGIEYLKALTKGKVININDEL"
     gene            <274470..>274688
                     /gene="TDEL0A01520"
                     /locus_tag="TDEL_0A01520"
                     /db_xref="GeneID:11503239"
     mRNA            <274470..>274688
                     /gene="TDEL0A01520"
                     /locus_tag="TDEL_0A01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678647.1"
                     /db_xref="GeneID:11503239"
     CDS             274470..274688
                     /gene="TDEL0A01520"
                     /locus_tag="TDEL_0A01520"
                     /inference="similar to DNA sequence:INSDC:YDR079C-A"
                     /note="similar to Saccharomyces cerevisiae TFB5
                     (YDR079C-A); ancestral locus Anc_8.211"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678695.1"
                     /db_xref="GeneID:11503239"
                     /db_xref="GOA:G8ZLJ0"
                     /db_xref="InterPro:IPR009400"
                     /db_xref="UniProtKB/TrEMBL:G8ZLJ0"
                     /translation="MPRARRGALIQCDPSIKALIIQIDAQRSDIILEELDDTHLLVDP
                     SKVEFIKQELNRLLSKNIYNPVDEEENE"
     gene            complement(<274757..>277066)
                     /gene="TDEL0A01530"
                     /locus_tag="TDEL_0A01530"
                     /db_xref="GeneID:11502614"
     mRNA            complement(<274757..>277066)
                     /gene="TDEL0A01530"
                     /locus_tag="TDEL_0A01530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678648.1"
                     /db_xref="GeneID:11502614"
     CDS             complement(274757..277066)
                     /gene="TDEL0A01530"
                     /locus_tag="TDEL_0A01530"
                     /inference="similar to DNA sequence:INSDC:YER157W"
                     /note="similar to Saccharomyces cerevisiae COG3 (YER157W);
                     ancestral locus Anc_8.210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678696.1"
                     /db_xref="GeneID:11502614"
                     /db_xref="GOA:G8ZLJ1"
                     /db_xref="InterPro:IPR007265"
                     /db_xref="UniProtKB/TrEMBL:G8ZLJ1"
                     /translation="MTRARRSSIVSSIASRTGGLDYLELPSLLDDSYLFNKLEKLALV
                     VGEGSKESVTLEKTSAVDESFKIRDEKKYRQYENYLGQLESHVQRYEMVLQQSYKVHD
                     QIEHAIQTFNSISSNSNDFVNKTKNLYEENHQLSALHEKIPAIMQYFTALDPIMRRLN
                     HASSSNVVRKNSFGNMLISIDQSLFFFEEHPNLEEAELYRIKFKRCLIRACELVSNYL
                     SGILRQTYNNIAEKITSSTSSSTASREALVYNKFEQIAEEYNSRVVDIISRVYNNKFQ
                     RYSDELGSILNDCYEQYFQTRLKLLGPMIHQRLDEIITANKELPLVNFIQDTKSQFSQ
                     LCVDEHNLFTKFFGSEHSRSKGSQWLCRLCEPLYDAIRTRILRETDISMLCDAVTLFG
                     QYYQFEENSEEYQLQFQDIQFDKIFEPIVQKLQARLILRVQIYIQQNVVNYTPSKDSF
                     IISHRRKKPEGPEATEKNNDAIYLAYVANIDQHSTEEGNYMTRDKLELYYPPLISSLA
                     LLSKIYEMLNVSVFNDLAHHIVHDCICSLRKAYDIVNSSPGGANNLDIKLSYLGNLLL
                     LRQEIQNFNIQYTVSETYLDFSGVESLLRSFTGSAKGLQSQDKSVLGMAKALVPKVVK
                     NMVDARSELLIELRNLIKDFTEVVTVQIIGSSLDISTTGESDSLLSRNIKLRQNLEEK
                     LPRTYSQIMIFINDSEIAAHLMIAIQESITQCYNVFYEQVSDKAESGELDKSEVSELM
                     YDDVFADFLNNIISKITNGSANDRGDVSM"
     gene            complement(<277332..>277661)
                     /gene="TDEL0A01540"
                     /locus_tag="TDEL_0A01540"
                     /db_xref="GeneID:11503113"
     mRNA            complement(<277332..>277661)
                     /gene="TDEL0A01540"
                     /locus_tag="TDEL_0A01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678649.1"
                     /db_xref="GeneID:11503113"
     CDS             complement(277332..277661)
                     /gene="TDEL0A01540"
                     /locus_tag="TDEL_0A01540"
                     /inference="similar to DNA sequence:INSDC:YDR079W"
                     /note="similar to Saccharomyces cerevisiae PET100
                     (YDR079W); ancestral locus Anc_8.209"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678697.1"
                     /db_xref="GeneID:11503113"
                     /db_xref="UniProtKB/TrEMBL:G8ZLJ2"
                     /translation="MKLPFRYTRSQLEIFRFTFCLLAPVGVMYYIGTDTDKKLNVPGF
                     YPDPETLNKIPKEPYEIKAELARMKKERLEKRLRLEKKLQEELGIDIEAEKNKIREEM
                     AMEKKSA"
     gene            <278013..>279017
                     /gene="TDEL0A01550"
                     /locus_tag="TDEL_0A01550"
                     /db_xref="GeneID:11503118"
     mRNA            <278013..>279017
                     /gene="TDEL0A01550"
                     /locus_tag="TDEL_0A01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678650.1"
                     /db_xref="GeneID:11503118"
     CDS             278013..279017
                     /gene="TDEL0A01550"
                     /locus_tag="TDEL_0A01550"
                     /inference="similar to DNA sequence:INSDC:YER156C"
                     /note="similar to Saccharomyces cerevisiae YER156C;
                     ancestral locus Anc_8.208"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678698.1"
                     /db_xref="GeneID:11503118"
                     /db_xref="InterPro:IPR003226"
                     /db_xref="UniProtKB/TrEMBL:G8ZLJ3"
                     /translation="MSIPKKLKLDNMVKQICTHSGSFHADEALAVYMLRLLPEFKDAK
                     ILRSRVPTDWDQSDIVVDVSGKYDGVKFFDHHQREFFETFDGEHKTKLSSAGLVYKHF
                     GRDIIKSILGGPSKDDVEILYLKVYKQFIEALDANDNGISKFDAEEANIKPKFSDTAI
                     TIPGIISGMNPNWNDDCSAEKFDEQFFKASSFIGGVFVNLVDGYGKSWLPAKELVQEA
                     VKNRKNVDKSGKIIILKQFCPWKEHLFEVEKQLGIKDEIEFVLFEDSSKTWRVSTVPI
                     SASSYKFRKGLPEPFRGLRDEELSKKSGIPDCVFIHAAGFIGGTKTKDGALKMAQMSL
                     "
     gene            complement(<279132..>279665)
                     /gene="TDEL0A01560"
                     /locus_tag="TDEL_0A01560"
                     /db_xref="GeneID:11503250"
     mRNA            complement(<279132..>279665)
                     /gene="TDEL0A01560"
                     /locus_tag="TDEL_0A01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678651.1"
                     /db_xref="GeneID:11503250"
     CDS             complement(279132..279665)
                     /gene="TDEL0A01560"
                     /locus_tag="TDEL_0A01560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678699.1"
                     /db_xref="GeneID:11503250"
                     /db_xref="UniProtKB/TrEMBL:G8ZLJ4"
                     /translation="MNSLLGVFVSSLVLLTGVLAIEVTNNDEYEQWSSTLPSETFENV
                     VQPRSSDTHIIINAHAANETIVSSFQLHVDGNPAEWWSSQVEARYPDGIYTTAEESTS
                     SSTLTTITPTTYPSSVIGIISDIETHTPNLLNKRDANCGWFCGLSVQCSGVMNPCKKC
                     QGFGKRWLKHCVAAWAR"
     gene            <280257..>286448
                     /gene="TDEL0A01570"
                     /locus_tag="TDEL_0A01570"
                     /db_xref="GeneID:11502832"
     mRNA            <280257..>286448
                     /gene="TDEL0A01570"
                     /locus_tag="TDEL_0A01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678652.1"
                     /db_xref="GeneID:11502832"
     CDS             280257..286448
                     /gene="TDEL0A01570"
                     /locus_tag="TDEL_0A01570"
                     /inference="similar to DNA sequence:INSDC:YER155C"
                     /note="similar to Saccharomyces cerevisiae BEM2 (YER155C);
                     ancestral locus Anc_8.207"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678700.1"
                     /db_xref="GeneID:11502832"
                     /db_xref="GOA:G8ZLJ5"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:G8ZLJ5"
                     /translation="MKGLIWPSKNKKNSGHGSNPPTSTSSLGRSKKIASTRSLSPSAS
                     SLLVNKSHAAPSVAQSGPLGGNEYQGDSSNRRKSSANLSLKSYTNSNPSNRRASRSIY
                     MSESHSKSVKSVSSLNHKGEESSIRSNGSGNHGVTSGSDTDVILDEFDNGSQSETFMR
                     ESLNATLVSGTSNSEKRIYNEHSVGTAVKAVESRISLNRDNYDTVVFKTGWINRSQGT
                     SHISASSSTHQLRSGLYSSSGGSHRESRFFHDASEPQITVPEYRIYRAQLKGPILNLY
                     RSGLPTNVKFFDPTIGGSLDETPVLTPASSSTETLTKQINPQEAEPPMIEYLSEKYPH
                     PGLKLNNERKIVAGDVESLCHAILFAHPEAGEDDLKNQKAIINLILVLPLLDHFNKFL
                     RMFNQFGLTFTKHSSKVTSKSLQYHGVSPSIDNLMTERLGLVVKTILDMFPSFLLDDL
                     MFQEIIHLLDVISLHNDEISNNLKMAVADKHNELNRITAFSKPNNFNGSRPKEAKLES
                     KKLLDEILNAEEFLKTDIDSLATEIHEINLKFDRSWAPRFDYSLLYDSKYINTNIVAL
                     NPLTFNNKVNVHFLGRLLVCHLFSDDQKVSSDPKMRAKILTKWVEFGIKFEHLGDMVS
                     WLAVATIICSVPILRLESLWTQIPENILKTIFKDWLPTIAQLDRRHLSSKSTSSVFIL
                     APPNLDNPFIKSNVISYFGDLIIHADDLTAETKLKYLERKINRTKNAFHKWQQRLGTS
                     DTRGNDSGQSINDIKPETSRIYQFWKFHLDQQNLSMEDIMKLSIQSETPKVDQIFYSN
                     IGSQRSPLSTGGYLPLLFNDIYPSYSIFPQKSLIGAAGASEASQQSRESMNQSKSSLR
                     RSTAFAADDLPSRTSSLSVSDPLDLSQITGLANIDAPLIKEISIKQSNRQHMLKCIRD
                     AFNIDSDVFHVSDDLVFKSLNDLEATSRPSSVVIETPKRFSQHSSSNGTMPNPRDSQD
                     ASNRLSRTLENLDFFNNIVTVSDPLKESLIEVALKSGSLDKIYDLLVLTASIFSKLID
                     TKDLERYYYHKRHRNLRQSAPLSDDTIGLLDYAFVKLTMDMDVFTETFFNSYKSFATT
                     TSVIENLAKRYIGAKSCACTISQFLNSDSRKNDGALNDAKFPVWDAKVLHDEVNTIFW
                     AKIQIGAAEAISNLVKHHYADFTDNLTANSTLQDFLKVMEQDVTAEWPIRSIQLKQKN
                     IEDHSEVENLISRLLELFNEIRTSYQKQLYRPLGIDRTSRKVTGLLSSFHKMSLTDFN
                     SYLTSNDYEDPMITHLHTMKVNDYEGIMKWVYSLDSFITKKFEMVSKKDWFATFQILE
                     LFSYESLTSLFCLPLHSTSYNIVTSGTSQLDDLEISNVFSWLVNSVTNTGNSKMPLLD
                     KLPASVKLLIQLHVSLTNFFMVEITDLWKSSEDRIQTCAIVLQMLSYVRWKNSSVDLF
                     QPEEEKGQDITSPHIPCYIETAITNAIVSPESRYYEHAWSACHNVLSSSKSSSPTTIS
                     SILANADDQTIKSFIDLDGAYTARSRNLCPCPGWFISRLLEISQFVPNMSIMNSKLIN
                     FDKRRFVNNIISNTLDLVPSPEDGLVDESRAPFGIALFQTLLDSGKKFKRTTRSHAIS
                     ESKAMKYQERGLFNEILIKEVEKIKRDHKKIEMLGALDRDNKRSAIVQQMIQRKHRSS
                     VVIPNLQMNSQGSAGSSTSFSSMGSSNTISGSAKDKRSSMAIGNVRNSVISNSGHTHM
                     GKKLGGFFKRPFSIGGFNSSASNSSLSSILIPGVQDDGSVSPENLPALDPSVMQDQKS
                     AISIRTFEIKSILEAINHSGSSAHSFSFKILMQDGHEHLFQATSANDLDEWMRMINAS
                     KRYAFHSKKFKGKTHNKMFGVPLEDVCEREGTLIPTIIVKLLDEIEMRGLDEVGLYRI
                     PGSVGSVNALKNAFDEEGAVGNSFTLEDDRWFEINAIAGCFKMYLRELPDCLFSNEKV
                     ADFAELALKLKTSQITMEEYKTRMVEYLQNLPPCYYQTLKRIFHHLHKVHTHMDSNRM
                     DASNLAIVFSMSFINQDDLASSMGPTLGAVQSILQNFIKHPNDYFIA"
     gene            complement(<286747..>287980)
                     /gene="TDEL0A01580"
                     /locus_tag="TDEL_0A01580"
                     /db_xref="GeneID:11502759"
     mRNA            complement(join(<286747..287868,287942..>287980))
                     /gene="TDEL0A01580"
                     /locus_tag="TDEL_0A01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678653.1"
                     /db_xref="GeneID:11502759"
     CDS             complement(join(286747..287868,287942..287980))
                     /gene="TDEL0A01580"
                     /locus_tag="TDEL_0A01580"
                     /inference="similar to DNA sequence:INSDC:YER154W"
                     /note="similar to Saccharomyces cerevisiae OXA1 (YER154W);
                     ancestral locus Anc_8.206"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678701.1"
                     /db_xref="GeneID:11502759"
                     /db_xref="GOA:G8ZLJ6"
                     /db_xref="InterPro:IPR001708"
                     /db_xref="UniProtKB/TrEMBL:G8ZLJ6"
                     /translation="MLKTSILRSTARISWKRAQGPVLGISGLSASRFIAARYNSSNAG
                     KPSIDEIQTQLPSMDDLNSAVTGIAEQAPQVIGEASNHIGYLQSIGLAQSWWWPPDLI
                     QHLLEAVHVYAGLPWWGTICAVTVGVRLLMFPLYVKSSDTIARNSRIKPELDAINSQL
                     MSSSELSEGQKYALKRKKLLNDNGIKNRWLAAPMLQVPVALGFFSGIRAMANHPVDGF
                     VNQGIAWFTDLSQADPYLGLQFITAAVLISFTRLGGETGAQQFSPAMKRFFTILPLVS
                     IPATMSLSAGVVLYFAINGTFSVLQTLTLRNKWVRRKLNIADVVHHPQATNGPPKGML
                     ETFRENMAKAREQAARRQAMQDKEEALQAQSKELKKNSKIKILHKSDLTRKE"
     gene            <288199..>289092
                     /gene="TDEL0A01590"
                     /locus_tag="TDEL_0A01590"
                     /db_xref="GeneID:11503134"
     mRNA            <288199..>289092
                     /gene="TDEL0A01590"
                     /locus_tag="TDEL_0A01590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678654.1"
                     /db_xref="GeneID:11503134"
     CDS             288199..289092
                     /gene="TDEL0A01590"
                     /locus_tag="TDEL_0A01590"
                     /inference="similar to DNA sequence:INSDC:YER153C"
                     /note="similar to Saccharomyces cerevisiae PET122
                     (YER153C); ancestral locus Anc_8.205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678702.1"
                     /db_xref="GeneID:11503134"
                     /db_xref="GOA:G8ZLJ7"
                     /db_xref="InterPro:IPR008732"
                     /db_xref="UniProtKB/TrEMBL:G8ZLJ7"
                     /translation="MPRRFLSEATRNTLYLDCMNRKFDDVLRVVRSTSANEMDYAFLQ
                     LYLSRSCQWGHIASVTHIWDKYVLRLKMMTVHPSLLCEIGNLALNEGKHFLPPQIYHH
                     YVKFFSGTMPIDEEQRIEYELLRIKVESFAKGTMLKTRFREKWKVLLEDMDHHLSSAM
                     EFRVRDFPYLTKSVQLEDNEMLMKLLFDQNKLDIKNRSTAPLLLNIILSQPQQSIESK
                     ISLFEKFYDTHRSLKYDDTLTILFRLCKGDGYRLSKLGQMVEEKGLNPLSSVALRAFT
                     NGIKDTEYSFDQLTNSSPAQH"
     gene            <289263..>290690
                     /gene="TDEL0A01600"
                     /locus_tag="TDEL_0A01600"
                     /db_xref="GeneID:11502840"
     mRNA            <289263..>290690
                     /gene="TDEL0A01600"
                     /locus_tag="TDEL_0A01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678655.1"
                     /db_xref="GeneID:11502840"
     CDS             289263..290690
                     /gene="TDEL0A01600"
                     /locus_tag="TDEL_0A01600"
                     /inference="similar to DNA sequence:INSDC:YER152C"
                     /note="similar to Saccharomyces cerevisiae YER152C;
                     ancestral locus Anc_8.204"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678703.1"
                     /db_xref="GeneID:11502840"
                     /db_xref="GOA:G8ZLJ8"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8ZLJ8"
                     /translation="MDAPAAINFFKGHPSFRLLPNKVVAEAAAQLLVTGDRDYDADTL
                     NRHPLTYGSDEGALWVREAITRFNNDETFRFARDDKARSRPEFLNLSSGASYGVLSIL
                     LQATLAHTGYTRQAFIVSPTYFLINDCFIDAGFGSKITAIDEDGQGSIDLALLERKLQ
                     EFEDKFTEEEDQEKLQAITDPAKAVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIE
                     IARKYDMLIIADDVYDMLDFSPPFDNLPQPKKRFVHLDRETNNDPESYGNTISNATFS
                     KLIAPGLRFGYHETVTDKLAGQLSHGGANTSGGTPSQLNSMIVGTMLKNGSTATLLNQ
                     LRSTYAERAETMYAAVKGYMPKNTKFEKPEGGYFSWLTLPQGYDAHEIGKRLQQEFQV
                     TVANGDHFEVKGDTRGWGKSSMRLSLSFLECNEIEEGIKSMGKICSAYAKERDLVFSF
                     YRRLISNVFISALELDALIKQFGFY"
     gene            <290698..>291453
                     /gene="TDEL0A01610"
                     /locus_tag="TDEL_0A01610"
                     /db_xref="GeneID:11503083"
     mRNA            <290698..>291453
                     /gene="TDEL0A01610"
                     /locus_tag="TDEL_0A01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678656.1"
                     /db_xref="GeneID:11503083"
     CDS             290698..291453
                     /gene="TDEL0A01610"
                     /locus_tag="TDEL_0A01610"
                     /inference="similar to DNA sequence:INSDC:YDR078C"
                     /note="similar to Saccharomyces cerevisiae SHU2 (YDR078C);
                     ancestral locus Anc_8.203"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678704.1"
                     /db_xref="GeneID:11503083"
                     /db_xref="UniProtKB/TrEMBL:G8ZLJ9"
                     /translation="MRFNQSINYTKLFSQLIDKDGQMDDTIASFLYYLFPRELFIRAV
                     SLIESCDMFIYVLDPDNCHLDSRITTSVSTDVDSPTSSNSVGPITPPVADKNPTNKSQ
                     ETDTLVSIVYDSESDTLHRLIVKTDHGGNPPIYVDLQNWFCSCDEYSDLFASETDKIA
                     DESYIDHLSNEVTDLHEFSDDRFAQLDAHSLSKQRYFLHDKVCCAHLIAYSLLLRTSK
                     RVLHYFATEKQQVPMIRVTSMDEWLKLHINIVA"
     gene            <291670..>294057
                     /gene="TDEL0A01620"
                     /locus_tag="TDEL_0A01620"
                     /db_xref="GeneID:11502563"
     mRNA            <291670..>294057
                     /gene="TDEL0A01620"
                     /locus_tag="TDEL_0A01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678657.1"
                     /db_xref="GeneID:11502563"
     CDS             291670..294057
                     /gene="TDEL0A01620"
                     /locus_tag="TDEL_0A01620"
                     /inference="similar to DNA sequence:INSDC:YER151C"
                     /note="similar to Saccharomyces cerevisiae UBP3 (YER151C);
                     ancestral locus Anc_8.202"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678705.1"
                     /db_xref="GeneID:11502563"
                     /db_xref="GOA:G8ZLK0"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G8ZLK0"
                     /translation="MSGVNSHDSGEESYSMYPTTSSPPMPSQGSMHFPTYQPPVPIYA
                     YPQVPYMYAGQTPGYPFSMMNQGQMMYKGSGSGGMPQGSGVNTKKKWNNNGNGSRSNG
                     GISSTKTHNYHHHQGSATFHPSSSISSPVGGSPASNLVNLSSRTDQYKFDVSKLSDTA
                     TSTTDLLLSPFFNTTEDEYVVASGKRHELRVKSFPGLYQQNEEIKEESIKDEPKKEPL
                     KSPAVSKSSSPTPEVTPLLTGASTPSNTTPAPPFTDSETPSATLKTTPKSWSAIASGG
                     IAKGKSSVSGSARSGSLSNVNHTSSAQPPQKKDKKYIPPSTKGIEPLGSVALRMCYDP
                     DFIDYTLKNPVLEKSLSIREVAPRGIINRANICFMSSVMQVLLYCKPFINILNVVGTR
                     NLNARAGTPECTLLDACVNFYKQFDKERLESERKPQLKSKQQQTVNSVASIADAIKPD
                     DFYSALSKIPKFKDLKWGHQEDAEEFLTHLLDQLHEEFISFIDCLTDNEISNLLQSIN
                     DEELKIILHQKSTKIQECRIYKNPSASLKELIIKYGSINDDDNEDGNGWHEVSGTSKK
                     GKKNKTAAKRTVEVEPSPMSCLFGGQFRSVLDIPNNKESQSITLDPFQTIQLDISERS
                     VNDLETAFKKFSEYELLPFKSSSGNDVEAKKQTFIDKLPQVLLIQLKRFQFINNTDKD
                     NSMINYNAYNGRIEKIRKKINYEHELMIPIESISSTNALRDEDRQYSLSGVIYHHGLS
                     SDGGHYTADVYHKETDKWYRIDDINITEVQKDSVLKGGEDGVDSRTAYILMYQKK"
     gene            complement(294230..294303)
                     /gene="TDEL0Atrna10V"
                     /locus_tag="TDEL_0Atrna10V"
                     /db_xref="GeneID:11503354"
     tRNA            complement(294230..294303)
                     /gene="TDEL0Atrna10V"
                     /locus_tag="TDEL_0Atrna10V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:11503354"
     gene            <294729..>296534
                     /gene="TDEL0A01630"
                     /locus_tag="TDEL_0A01630"
                     /db_xref="GeneID:11502634"
     mRNA            <294729..>296534
                     /gene="TDEL0A01630"
                     /locus_tag="TDEL_0A01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678658.1"
                     /db_xref="GeneID:11502634"
     CDS             294729..296534
                     /gene="TDEL0A01630"
                     /locus_tag="TDEL_0A01630"
                     /inference="similar to DNA sequence:INSDC:YGL110C"
                     /note="similar to Saccharomyces cerevisiae CUE3 (YGL110C);
                     ancestral locus Anc_6.145"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678706.1"
                     /db_xref="GeneID:11502634"
                     /db_xref="UniProtKB/TrEMBL:G8ZLK1"
                     /translation="MYKRKVLEINGDYAQISLPIVKFPPFKLRAALIEKDPVVWLHCI
                     ETYVTYMEYLLFENNVEKIDDLTYNNLCIFIRSYLHEMAGERSRLLSLGMNHDVAEQL
                     SILKELILTLIKKCGLLHLQIYGESLWDLVKVYVDDNDTQVRSLLDGSVRPSINTQKV
                     QRNRIPQVQQYLKQLVESGMFNRIDLKSFENLLSEKPLKASKFGKRFLNAAWLETLEV
                     WWAKGQGKFSSIARELETVTLLSASAEDIVEVSKELGISSVDTLSLYPLLGCFLIDEK
                     FQSMSPGLSGLLPHFHLALQDEETNDESSYITEESLVAMGELLPSLSKDQLTHLLQKF
                     EGNAELATNAVFEDPTLIDAIAREISTEGRPSTDEESDGAEELELSGHTAAAFENDSN
                     KVVRKQVPDELRNKTLTWAMQLMYQADEDERDDTYDEAEVSHSVGKISLEDSGESSSI
                     AATSSTLSNYDNIERYLWDLLKQDKTLFERSKRGSKVRKDMKKDTTWSDEQIEGWARM
                     LERSPQRARILEEKYMFRGNVKTGKRAYVKKEQQNDDNSQAKREQKPSRPTNTNSQKP
                     ADKKRQQARNEKKKSSRANHNRKAGHDKKLSKAGV"
     gene            complement(<296607..>297941)
                     /gene="TDEL0A01640"
                     /locus_tag="TDEL_0A01640"
                     /db_xref="GeneID:11503235"
     mRNA            complement(<296607..>297941)
                     /gene="TDEL0A01640"
                     /locus_tag="TDEL_0A01640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678659.1"
                     /db_xref="GeneID:11503235"
     CDS             complement(296607..297941)
                     /gene="TDEL0A01640"
                     /locus_tag="TDEL_0A01640"
                     /inference="similar to DNA sequence:INSDC:YGL111W"
                     /note="similar to Saccharomyces cerevisiae NSA1 (YGL111W);
                     ancestral locus Anc_6.144"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678707.1"
                     /db_xref="GeneID:11503235"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZLK2"
                     /translation="MRLLASCVDSGSLKEILCNVGTDTSKKAEIQPLSIRTSLSEGLK
                     ASIDTLCLCDRYRILLGRNNGTLEMVKIVDVPHTEEEGTQLPTFQVSEFEVLDSISGM
                     LDDSKLAPLYEGSKKRVKLTDGFVTISQLPGLKDSYLVATRSGLISVVKWDAKESKLT
                     KIETFEVKAPLEFAQLYDLGQDNSSGDFVLAYGGEENSVKLVQLKRDYSSLVQVWEAK
                     NVKNDKLDLRVPIWPVALRFLRPLESTDVEKSKLNYQFVVITRWSHLGLYRTQHGRKP
                     LQYKELLPNREPLTQLQLVGKDVSELGNIFATDFKDFEIVTADTKHNVYKFDIKGKLQ
                     LKFGKTDITGASSFLAVHDQKYLLQGGLDRYARIFDLQSGTRLAKVYTGSKVNYLLML
                     DDDQVGIDKPKVTKDKKRKPEPEDEEEQEAQNDELWHHLDKSKQNSVKKARK"
     gene            <298190..>299332
                     /gene="TDEL0A01650"
                     /locus_tag="TDEL_0A01650"
                     /db_xref="GeneID:11503148"
     mRNA            <298190..>299332
                     /gene="TDEL0A01650"
                     /locus_tag="TDEL_0A01650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678660.1"
                     /db_xref="GeneID:11503148"
     CDS             298190..299332
                     /gene="TDEL0A01650"
                     /locus_tag="TDEL_0A01650"
                     /inference="similar to DNA sequence:INSDC:YBR234C"
                     /note="similar to Saccharomyces cerevisiae ARC40
                     (YBR234C); ancestral locus Anc_6.143"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678708.1"
                     /db_xref="GeneID:11503148"
                     /db_xref="GOA:G8ZLK3"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017383"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZLK3"
                     /translation="MSVSHHDKSVVAAFKLVKAPIYSHCYSNDKSLLAITCDTNCLVY
                     RLQGPNSQPKLVATLADHDKTVTAVDISVHGRIVTCSQDRNAYVWEPLSDGTYRATLV
                     LLRINRAATAVCWAPSGYKFAVGSSARIIAVCYYEQENNWWVSKHIRKPIKSTVNCLS
                     WHENGVLLASGGTDGYMRVFSGFIKGLDSKDIMTGSPWGDKFPFGSLVKEWYQGSYIH
                     DVEWRSNIEKVGYVSHDGCLSVADSQGQVQTVDAPEGLPYRSLLWINDHEILCGGYSC
                     HPVMFTEGTGAWKFSQSLDQVNKGAPAASHFAGDNDEDDENPTFGMSALRKFKELDLK
                     GKVTAHEQESAHENAIVQLRTFAESNGQVTQVSSCGLDGKIVIYSV"
     gene            complement(<299385..>299639)
                     /gene="TDEL0A01660"
                     /locus_tag="TDEL_0A01660"
                     /db_xref="GeneID:11503264"
     mRNA            complement(<299385..>299639)
                     /gene="TDEL0A01660"
                     /locus_tag="TDEL_0A01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678661.1"
                     /db_xref="GeneID:11503264"
     CDS             complement(299385..299639)
                     /gene="TDEL0A01660"
                     /locus_tag="TDEL_0A01660"
                     /inference="similar to DNA sequence:INSDC:YBR233W-A"
                     /note="similar to Saccharomyces cerevisiae DAD3
                     (YBR233W-A); ancestral locus Anc_6.142"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678709.1"
                     /db_xref="GeneID:11503264"
                     /db_xref="GOA:G8ZLK4"
                     /db_xref="InterPro:IPR013965"
                     /db_xref="UniProtKB/TrEMBL:G8ZLK4"
                     /translation="MQEELSILQQNVLERYRKLAEVLHSLDDTFKQFNDTDKEHVSSE
                     VVLQQMREIEVKIGLVGTLLKGSVYSLILQRRQELEREGS"
     gene            <299837..>301357
                     /gene="TDEL0A01670"
                     /locus_tag="TDEL_0A01670"
                     /db_xref="GeneID:11502652"
     mRNA            <299837..>301357
                     /gene="TDEL0A01670"
                     /locus_tag="TDEL_0A01670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678662.1"
                     /db_xref="GeneID:11502652"
     CDS             299837..301357
                     /gene="TDEL0A01670"
                     /locus_tag="TDEL_0A01670"
                     /inference="similar to DNA sequence:INSDC:YGL112C"
                     /note="similar to Saccharomyces cerevisiae TAF6 (YGL112C);
                     ancestral locus Anc_6.141"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678710.1"
                     /db_xref="GeneID:11502652"
                     /db_xref="GOA:G8ZLK5"
                     /db_xref="InterPro:IPR004823"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR011442"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZLK5"
                     /translation="MSNQQQSYTIWSPQDTVKDVTESLGIDSISDDVLKALAMDVEYR
                     ILEIIEQAVKFKRHSKRDALTTDDISKALRVLNVEPLYGYHDGSAIDKDVTFSRVNAA
                     GGQTVYYLDDEEVDFDKLINEPLPQVPRLPTFSTHWLAVEGVQPAIIQNPNLNDIRIS
                     QPPIVRGAIVTALNDNSLQTSSAAAISLSEEKHAQHLSTVKPGQNIEVKPLVKHVLSK
                     ELQVYFNKVISALTSKNGNDENGQHMKAAALTSLKTDSGLHQLVPYFIQFIAEQITHN
                     LSDLELLTTILEMIYSLLSNESIFLDPYIHSLMPSILTLLLAKKLGGSPSSDSPEDVS
                     AFLERTNALRDFAASLLDYVLKKFPQVYKSLKPRVTRTLLKTFLDTNRVFGTYYGCLR
                     GVSMFESEFIRFFLGNLNNWARLVFNEQNMTLDTIRENKCVKFSPQEEELLVDTVISA
                     LSILKGDLLDMYEGKGRDITENDKERLASRVGLTIASRILERDDAGELIDAIFFGE"
     gene            complement(<301496..>303445)
                     /gene="TDEL0A01680"
                     /locus_tag="TDEL_0A01680"
                     /db_xref="GeneID:11502964"
     mRNA            complement(<301496..>303445)
                     /gene="TDEL0A01680"
                     /locus_tag="TDEL_0A01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678663.1"
                     /db_xref="GeneID:11502964"
     CDS             complement(301496..303445)
                     /gene="TDEL0A01680"
                     /locus_tag="TDEL_0A01680"
                     /inference="similar to DNA sequence:INSDC:YGL113W"
                     /note="similar to Saccharomyces cerevisiae SLD3 (YGL113W);
                     ancestral locus Anc_6.140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678711.1"
                     /db_xref="GeneID:11502964"
                     /db_xref="InterPro:IPR013948"
                     /db_xref="UniProtKB/TrEMBL:G8ZLK6"
                     /translation="MDSWELVASVRQLPETFDVDLSHPKLLPSSQLPLKIQDHIDNSE
                     SSVKHVVKDQTEMVLLLERYGKSYCICWPVVGCCLTDFSLQDVHHQVTGKPAELDKDW
                     NKLQFKELLNQWRETHADRLSDAPIRLNMRLPESLSSQARNTQIDMTPESYLETKYFE
                     SLFFIHLPLAYFVKSNLERFKSMCRGTSAKDPKKAYKKCLFSKLLANKEFDQRHENNK
                     LLKAPIENDIATERRGIAFSKYLIADEDTLLQDFATILRIREIKLQIILLLENIYIDG
                     LDSNFKDFETKYRSRLKARSLNVTRLVSRRTKKNRSKRLGDNDDEPKFDCCEQLDLYL
                     DKLCILDVLLASEPFKVNNNANVIHEHKQSILNRSKEASSLGFANLVLVPYFTRKAPN
                     AISFIVHKLRGPRLKTKKPTRRKNTVSEHIDNFVENYTSVVNLGSRNSSIVSPTPSSP
                     DGSNTPASLHHMISPTPECINSRTYSNLDSFFEGGPPTKRVPSFISRTSSDLTMNHLE
                     KRQLSVTEFTSQKSVSAGRSHSASAKRASSSFTSPQQSFCRVGKRKIPGKLSRSMSNV
                     VTDQESDSVQVMSTPLKRIEKVSSTRVTLQNIVESPVNTLDASNTQAKEVETSPDPTQ
                     NLLREVVAPTKPTSRKIVRRRLFAP"
     gene            complement(<303728..>305020)
                     /gene="TDEL0A01690"
                     /locus_tag="TDEL_0A01690"
                     /db_xref="GeneID:11502554"
     mRNA            complement(<303728..>305020)
                     /gene="TDEL0A01690"
                     /locus_tag="TDEL_0A01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678664.1"
                     /db_xref="GeneID:11502554"
     CDS             complement(303728..305020)
                     /gene="TDEL0A01690"
                     /locus_tag="TDEL_0A01690"
                     /inference="similar to DNA sequence:INSDC:YBR233W"
                     /note="similar to Saccharomyces cerevisiae PBP2 (YBR233W);
                     ancestral locus Anc_6.139"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678712.1"
                     /db_xref="GeneID:11502554"
                     /db_xref="GOA:G8ZLK7"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:G8ZLK7"
                     /translation="MASTDGNGTMSPNLLKRKKEDCAEEQLEAEIKRVALDDDTELPA
                     VGNEDQRMNGDHSSPQDGEEEHLGSHESIDGMDNSSRHVHLRMLCLVKQASMIVGHKG
                     ENISKIKAVTSTRINVSDNVRGVPERVVYVRGSCENVAKAFGMIVRSINDRHGEEGYD
                     GNSIMSTINLLISHHLMGCIIGKHGSRLREIEELSAARLSASPQQLIMSNDRILSITG
                     VADAIHIATFYIGQTIMKCKEAFKSKKAIFYQPSPVYSVLVNGASHGGYSHQKHHQYH
                     PNDKYTNSRAGKRVVRPAMMATTPTAQPLPQENNGSQVTYTAAAAANATSFTPSFTIP
                     NVRIIDEPAPPAQTMAIIEQEVYIDENYVGNIIGKEGKHINSIKEATGCSIYIADPVE
                     GSLERRLTVKGTSMGSQAAIMLISNKIEIDRANKERNR"
     gene            <305211..>306104
                     /gene="TDEL0A01700"
                     /locus_tag="TDEL_0A01700"
                     /db_xref="GeneID:11502737"
     mRNA            <305211..>306104
                     /gene="TDEL0A01700"
                     /locus_tag="TDEL_0A01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678665.1"
                     /db_xref="GeneID:11502737"
     CDS             305211..306104
                     /gene="TDEL0A01700"
                     /locus_tag="TDEL_0A01700"
                     /inference="similar to DNA sequence:INSDC:YBR231C"
                     /note="similar to Saccharomyces cerevisiae SWC5 (YBR231C);
                     ancestral locus Anc_6.138"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678713.1"
                     /db_xref="GeneID:11502737"
                     /db_xref="InterPro:IPR011421"
                     /db_xref="InterPro:IPR027124"
                     /db_xref="UniProtKB/TrEMBL:G8ZLK8"
                     /translation="MADNTIKLREEEDVFDEEQYNEEEDEDFNPEQGKQSEDEDEEDE
                     SKPTESSKHKDGRNIDYSRIESESGGLVRTRRARLLEDELKSKRKYEGLQAGSISDSV
                     KDIWNELKETTNKRLKDRAFCGSVLADDDGVRAESYQEERILIKRHYKFAGETKHEER
                     LVPISSSEAQEYLRSHKFQNKSDTRSEYLRKPIAEKEVPIRTEEERKRLRRPLKRSPY
                     LEQIIAGSLKPKLTTLEKSSMDWATYVDKEGLNDELTLYNKDGYLAKQDFLNRVEMVK
                     DSRYRELRQKQLAMQLQEQQQ"
     gene            complement(<306168..>308315)
                     /gene="TDEL0A01710"
                     /locus_tag="TDEL_0A01710"
                     /db_xref="GeneID:11503131"
     mRNA            complement(<306168..>308315)
                     /gene="TDEL0A01710"
                     /locus_tag="TDEL_0A01710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678666.1"
                     /db_xref="GeneID:11503131"
     CDS             complement(306168..308315)
                     /gene="TDEL0A01710"
                     /locus_tag="TDEL_0A01710"
                     /inference="similar to DNA sequence:INSDC:YGL114W"
                     /note="similar to Saccharomyces cerevisiae YGL114W;
                     ancestral locus Anc_6.137"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678714.1"
                     /db_xref="GeneID:11503131"
                     /db_xref="GOA:G8ZLK9"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="UniProtKB/TrEMBL:G8ZLK9"
                     /translation="MSEIQSLDDTDEQEFPPPVAWNDKPAIKQITVRATFVGLIIGSL
                     VLISNFQFGLQTGWVSMMSMPSALLACAFFKKIWPAIRPNDGPFTDVETVYVQSMAVA
                     VGTGPLAYGFVGVIPAIEKFLTKEESGFTREQGQLFSFNQLLAWSCALAFFGVFFAVP
                     LRKQVVVREKLPFPSGSATAVLIAVLNDSEILQEVSRREILEMRTRRLDECSEVLMPD
                     SVPSSEGYSSFDPEHTLPESNTYNENINVLSLTFFASSIYTIGCYFLPILRSIPLFGT
                     YLSKTYLWNFQPSPAYIGQGIIMGLSTVSYMLFGCVLGWAILAPMARHAGWVPSDAGV
                     DDWERGVHGWILWCSLSIMVVDSVVGFIVVTVKSIVKFWLIDDKAGLLADVWEDSFES
                     MLLEEERMINSRRNTETSKSHNTVKLVYNDQDHEVAPEHLVQYTTVISGLIFSSIMCV
                     ILIIYLFGIDVIPIYAMISALIIALFLSILGIRALGETDLNPVSGIGKLSQLIFAVIA
                     PRNQPGSVLLNLVAGGVAEAGAQQAGDLMQDLKTGHLLGASPRAQFVAQLLGASWSVI
                     MSSIMYMCYNKVYHIPDKQFRIPTAIVWIDCARLVTGKGLPEKAFECAIILGFVFGVL
                     SLIKNCYRDSDYKWLRYIPSGVAVGVGIYNTPSFTIARFIGGLASSIWLHKHRGDLGA
                     KTKMIVFSSGLILGEGVCSIFDMLFTNLNVPHF"
     gene            complement(<308574..>309542)
                     /gene="TDEL0A01720"
                     /locus_tag="TDEL_0A01720"
                     /db_xref="GeneID:11502980"
     mRNA            complement(<308574..>309542)
                     /gene="TDEL0A01720"
                     /locus_tag="TDEL_0A01720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678667.1"
                     /db_xref="GeneID:11502980"
     CDS             complement(308574..309542)
                     /gene="TDEL0A01720"
                     /locus_tag="TDEL_0A01720"
                     /inference="similar to DNA sequence:INSDC:YGL115W"
                     /note="similar to Saccharomyces cerevisiae SNF4 (YGL115W);
                     ancestral locus Anc_6.136"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678715.1"
                     /db_xref="GeneID:11502980"
                     /db_xref="GOA:G8ZLL0"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="UniProtKB/TrEMBL:G8ZLL0"
                     /translation="MSATPNEREKVIIEQKLAVESIRSFLKSKTSYDVLPVSYRLIVL
                     DTSLLVKKSLNVLLQNNIVSAPLWDAKTSRFAGLLTSSDFINVIQYYFSNPDKFELVD
                     KLQLDGLKDIERAIGVEPLDTASIHPSRPLYEACIRMMDATSRRIPLIDQDEETHREI
                     VVSVLTQYRILTFVALNCRETHFLKRPIGELNIITKKNVASCQMTTPVIDVIQLLSQG
                     NVASIPIVDNEGYLVNVYEAVDVLGLIKGGIYNDLSLSVGEALMRRSDDFEGVYTCTE
                     RDKLSTIMDNIRKSRVHRFFVTDDAGKVVGVLTLSDILRYILLGEN"
     gene            complement(<310640..>312433)
                     /gene="TDEL0A01730"
                     /locus_tag="TDEL_0A01730"
                     /db_xref="GeneID:11502862"
     mRNA            complement(<310640..>312433)
                     /gene="TDEL0A01730"
                     /locus_tag="TDEL_0A01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678668.1"
                     /db_xref="GeneID:11502862"
     CDS             complement(310640..312433)
                     /gene="TDEL0A01730"
                     /locus_tag="TDEL_0A01730"
                     /inference="similar to DNA sequence:INSDC:YGL116W"
                     /note="similar to Saccharomyces cerevisiae CDC20
                     (YGL116W); ancestral locus Anc_6.135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678716.1"
                     /db_xref="GeneID:11502862"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8ZLL1"
                     /translation="MVDVTEKSTLANNANRSVLSLTSPAKLNIMSSDWSRSQGKITKK
                     PLRRTNSLNSRAINNSSGNSIYSRPPISLPPPPLIRRNSSFFADDGDKNDSTRGGRTH
                     SSGSAGGAAQPSSIQETEVITSDRFIPTLQSNQQNKVDPMVLGEEFPPPNASPTAHLR
                     AQTKMVFKQTVAKACGLDMGQRILQYMPQPPVASFKRQSYSMNKRCHYNYQQESQPEL
                     VKLRKINSNPERILDAPGFQDDFYLNLLNWSSKNVLAIALETALYLWNGATGDVTMLV
                     DYETTKITSLIWSDDDCHLSIGKEDGNNEIWDVETMSLVRTMRSGLGVRIGTQSWLET
                     LIATGSRSGEIQINDVRIKQHIVSTWDKHCGEVCGLSYKSDGLQLASGGNDNTVMIWD
                     TRVSMPQWIKRSHTAAVKALSWCPYMPNLLASGGGQTDKHIHFWNTVTGANVGSISTG
                     SQVSSLHWGQSYTSSSGSMNREIVATGGSPSNAISVFNYDTKYKVAEIMQAHESRICC
                     SQLSPDGTTLATVGGDENLKFYKVFEPRRRNRRKTKSVVGDVMSLFSHGTSNDDYDHL
                     KSSQETIDDCNADDESPVRSSKRKTSEFLIR"
     gene            complement(<312865..>313716)
                     /gene="TDEL0A01740"
                     /locus_tag="TDEL_0A01740"
                     /db_xref="GeneID:11502770"
     mRNA            complement(<312865..>313716)
                     /gene="TDEL0A01740"
                     /locus_tag="TDEL_0A01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678669.1"
                     /db_xref="GeneID:11502770"
     CDS             complement(312865..313716)
                     /gene="TDEL0A01740"
                     /locus_tag="TDEL_0A01740"
                     /inference="similar to DNA sequence:INSDC:YGL117W"
                     /note="similar to Saccharomyces cerevisiae YGL117W;
                     ancestral locus Anc_6.134"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678717.1"
                     /db_xref="GeneID:11502770"
                     /db_xref="UniProtKB/TrEMBL:G8ZLL2"
                     /translation="MTGSVEFEGLVKKFEKMINDRKIPSLKNQEVFNDICKNLIISQS
                     KPLLEFIDILLEKLMYPRKSKSLIHLLTLQDPDIQREVDYKIFDLGHPRILEIILIRQ
                     KIVEIKATGNEAWKSSEFTPKLLRKLNQIYLLIVNLLQVLSDHIEVPSHSNFYRQIVT
                     ESISDFQTAFETFNSLNFIFQALLRSVEKFGISDERIFHVDGNLLSKIKTFSDDNLIW
                     YESLMIESIAVREYLLVEKKIYENEHNDQMDEVSALAIKAIYSPKFEQFLAKRKARLN
                     ISNRRIF"
     gene            314530..314630
                     /gene="TDEL0Atrna2W"
                     /locus_tag="TDEL_0Atrna2W"
                     /db_xref="GeneID:11503325"
     tRNA            join(314530..314566,314594..314630)
                     /gene="TDEL0Atrna2W"
                     /locus_tag="TDEL_0Atrna2W"
                     /product="tRNA-Trp"
                     /note="codon recognized: UGG"
                     /db_xref="GeneID:11503325"
     gene            complement(<314870..>316596)
                     /gene="TDEL0A01750"
                     /locus_tag="TDEL_0A01750"
                     /db_xref="GeneID:11503323"
     mRNA            complement(join(<314870..316234,316312..>316596))
                     /gene="TDEL0A01750"
                     /locus_tag="TDEL_0A01750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678670.1"
                     /db_xref="GeneID:11503323"
     CDS             complement(join(314870..316234,316312..316596))
                     /gene="TDEL0A01750"
                     /locus_tag="TDEL_0A01750"
                     /inference="similar to DNA
                     sequence:INSDC:YGL119W,YBR230W-A"
                     /note="similar to Saccharomyces cerevisiae ABC1 (YGL119W)
                     and YBR230W-A; ancestral locus Anc_6.133"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678718.1"
                     /db_xref="GeneID:11503323"
                     /db_xref="GOA:G8ZLL3"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8ZLL3"
                     /translation="MSSRQTLYQAFCLASSAKEVLKGSASIAKESLSQWVNTSHLTRP
                     ILMQYQCYYDPEWEKAKKLSQEVKLKSQSKKHKRRPGIRHYSTSSKPSIEKPTEEVEE
                     DIGRKRQELQSSQVPSSRISRLFHYGSLAAGVSINAASDGLSKVVKGQTPTWKSLIYS
                     DSNIDRIAKKFSQMRGAALKIGQMMSFQDDKVLPKELYVILSRVQNSAHYMPHRQLEK
                     VMKRELGSDWQDNFLSFDRVPIAAASIGQVHNAVLKTGEKVVVKIQYPGVKDSIDSDL
                     NNLLMLLGASRLLPKGLFLDKTVANSRTELKWECDYVRESRALQKFEELLKDDSVFVV
                     PHVYSDLTTTNIITMARMEGTEIMKLPKKTSQEVKNFISENIMRLCLEEIATFQYMQT
                     DPNWANFLYNEKTGKIELLDFGASRPYPSEFITKYRKLLTLATRKDREGVRRVSQDLG
                     YLTGLESQAMVDAHVNSVLTLGEPFCGPLDKPFSFKDQNVSDRIRSNISLMLNERLCP
                     PPEETYSLHRKFSGIFLLCARMGASVHCAKLFHDIFLLDEQ"
     gene            <316853..>319183
                     /gene="TDEL0A01760"
                     /locus_tag="TDEL_0A01760"
                     /db_xref="GeneID:11502948"
     mRNA            <316853..>319183
                     /gene="TDEL0A01760"
                     /locus_tag="TDEL_0A01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678671.1"
                     /db_xref="GeneID:11502948"
     CDS             316853..319183
                     /gene="TDEL0A01760"
                     /locus_tag="TDEL_0A01760"
                     /inference="similar to DNA sequence:INSDC:YGL120C"
                     /note="similar to Saccharomyces cerevisiae PRP43
                     (YGL120C); ancestral locus Anc_6.132"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678719.1"
                     /db_xref="GeneID:11502948"
                     /db_xref="GOA:G8ZLL4"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLL4"
                     /translation="MGSKRRLSEKTEHYDPVETSVPELAAEAAEERTRKHPVPPEEPL
                     THHDAGEFNGMIRHQTTAEQAARLEDSKVNPFTGGDFTPKYFDILKIRRELPVHAQRA
                     EFLKIYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLQNTQIACTQPRRVAAMSVAQ
                     RVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHELKRYSCIILDE
                     AHERTLATDILMGLLKQVVVRRPDLKIIVMSATLDAEKFQKYFLDAPLLAVPGRTFPV
                     EIYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGDQLVR
                     DEGCGPLSVYPLYGSLPPHLQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGVVY
                     VVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFKKE
                     LIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDD
                     DGNLTALGRLTSQFPLDPMLAVMLIGSYEFNCSEEILTIVAMLSVPNVFIRPSKDKKR
                     ADDAKNYFAHPDGDHITLLNVYHGFKSDEAYEYGIHKWCRDHFLNYRSLSAADNIRSQ
                     LERLMVRHNLELNTTDFDSPKYHDNIRRALASGFFMQVAKKRSGGKGYITVKDNQDVL
                     IHPSTVLGHDAEWVIYNEFVLTTKNYIRTVTSIRPEWLIELAPAYYDLDNFQKGDVKL
                     SLERIQERVHTMRQLKSDKNSDKHKKKSKKDKHKIK"
     gene            <319394..>319795
                     /gene="TDEL0A01770"
                     /locus_tag="TDEL_0A01770"
                     /db_xref="GeneID:11502611"
     mRNA            <319394..>319795
                     /gene="TDEL0A01770"
                     /locus_tag="TDEL_0A01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678672.1"
                     /db_xref="GeneID:11502611"
     CDS             319394..319795
                     /gene="TDEL0A01770"
                     /locus_tag="TDEL_0A01770"
                     /inference="similar to DNA sequence:INSDC:YGL121C"
                     /note="similar to Saccharomyces cerevisiae GPG1 (YGL121C);
                     ancestral locus Anc_6.131"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678720.1"
                     /db_xref="GeneID:11502611"
                     /db_xref="UniProtKB/TrEMBL:G8ZLL5"
                     /translation="MCNRTRSAVFIDGMKCVSGRQPNDDDIFQLILYTNAQGSLMEAV
                     KELHGLADQVSFYKTSESVTSTIVAAELPSLMVNVMESRERAKRLYRSALHSRICENC
                     WDFEELFEKLDEELLRTNEILKLYARRGSYH"
     gene            complement(<320341..>321249)
                     /gene="TDEL0A01780"
                     /locus_tag="TDEL_0A01780"
                     /db_xref="GeneID:11502745"
     mRNA            complement(<320341..>321249)
                     /gene="TDEL0A01780"
                     /locus_tag="TDEL_0A01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678673.1"
                     /db_xref="GeneID:11502745"
     CDS             complement(320341..321249)
                     /gene="TDEL0A01780"
                     /locus_tag="TDEL_0A01780"
                     /inference="similar to DNA sequence:INSDC:YMR130W"
                     /note="similar to Saccharomyces cerevisiae YMR130W;
                     ancestral locus Anc_2.404"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678721.1"
                     /db_xref="GeneID:11502745"
                     /db_xref="GOA:G8ZLL6"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR011949"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G8ZLL6"
                     /translation="MAFPKRMSIGSWKQPLKPETPKVITFDAYNTLYATTLPVMEQYS
                     IVAKKYNINTDPEQLKQRFPAVFKALKKEHPSYGKYTNITAIEWWSLLIRNVFHPAEA
                     SKEMIDEILSRFEGEQAYKVYPDVLDFLKEVKMKHPNVVLGIISNTDPIVDILLKNLG
                     LHDFFEDHIYLSYNLGVKKPSKEIFDRAIEDICSKVPGLLESSSLQDLKRRCWHCGDE
                     ATNDLHGAEQAGWNGVLIDRHNKYGYLSKSFEEVERSADLLSIDKIDSNCDASYKLSL
                     KQTDTLFLKERACVVSNFETLKAMLL"
     gene            <321579..>323606
                     /gene="TDEL0A01790"
                     /locus_tag="TDEL_0A01790"
                     /db_xref="GeneID:11502824"
     mRNA            <321579..>323606
                     /gene="TDEL0A01790"
                     /locus_tag="TDEL_0A01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678674.1"
                     /db_xref="GeneID:11502824"
     CDS             321579..323606
                     /gene="TDEL0A01790"
                     /locus_tag="TDEL_0A01790"
                     /inference="similar to DNA sequence:INSDC:YLR035C"
                     /note="similar to Saccharomyces cerevisiae MLH2 (YLR035C);
                     ancestral locus Anc_2.405"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678722.1"
                     /db_xref="GeneID:11502824"
                     /db_xref="GOA:G8ZLL7"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:G8ZLL7"
                     /translation="MAIKEIPDTSKWRIISSSVILDPKYAVKELLDNAIDAGATNIYI
                     DVDARTSGCNYISVRDDGSGVNAEDRALMCSKHSTSKISSLRDLSNLSSLGFRGQALF
                     SLSNLANQKGSMQIITRTNNEKVGEKWLVDKNGHIKENTRKRTSCPSGTNVIIRNLLL
                     GLRARYIQISSRAPKNNDEIHRLINHYALNFRSIRFHFYLVSVEKTGLVTKRQLQGSL
                     GTNLSRVRALSAIAQLKNTASENFLVKNDLTVTNLVHLDVILPSKQSPSDIVSLKRAR
                     KFLSVNNRAMSLRLNFGGSIKKIINKVYRSLNLPEPMAWYINLKCDTKLLDLNVEPGK
                     DDVLIKDTELIMNGIEKCLFSYITDTVGDTEINNIDGFDAEGNDQSTVVRDVDVVRKS
                     ITQGYSLASSRPESHECLDYRAGNPTDQRPTDGITILSPQIDNMTVDSGGRNRKRTST
                     SDLLNSDDNRWKRNLISDECINSQDSRGSDLPSSLTYNYETPQATDEDMVLAKDVSLS
                     NPFMTAKLRKVDHKLNQKRDSNNMNSNFVKHTPNEEFSLKPKVQQRMGINDGIPAKKV
                     ISKKDLEDSECSSPNETTLVDDGSKDDRALITRERIDMFSESTQGLTITMRYNLDRAG
                     KAEYKEELKWLARDEDPTHTISRSLMYFSGAFRNKQISLSRANDEWFKLTV"
     gene            complement(<324120..>328079)
                     /gene="TDEL0A01800"
                     /locus_tag="TDEL_0A01800"
                     /db_xref="GeneID:11503362"
     mRNA            complement(<324120..>328079)
                     /gene="TDEL0A01800"
                     /locus_tag="TDEL_0A01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678675.1"
                     /db_xref="GeneID:11503362"
     CDS             complement(324120..328079)
                     /gene="TDEL0A01800"
                     /locus_tag="TDEL_0A01800"
                     /inference="similar to DNA sequence:INSDC:YMR129W"
                     /note="similar to Saccharomyces cerevisiae POM152
                     (YMR129W); ancestral locus Anc_2.406"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678723.1"
                     /db_xref="GeneID:11503362"
                     /db_xref="UniProtKB/TrEMBL:G8ZLL8"
                     /translation="MDREYMLGSTPRGNHWMGASSTSSAYRPSASSTSQQRRFRQSPS
                     YDGSGPFITQSSRNEQLDSVKYTPSSQRKYSTDPQPLPLISPEVVDISRQRALALLVF
                     AIIQGYKIYDLILLKKGLPVLGLLFNGSRINFIIKYFLIDSMFLYFLPTFKIPKLCFK
                     SWAVFVQLVVMTLLTILISSEQEFVLLSVIASAWRKFNTKEMSLTGSAVNMRKIMDSS
                     SHFKGALTIKILPENTAMLNPLHDSYCLPMDTNLLPEGHIKVPIRINSTADISLVQVE
                     FKDMYTQATELRNLTSKQFRIVNDLSHLLPRDKLMRQKVQDTSTIRYVELPLKEVGFY
                     QIKKIVDSKNFSLKIYQSHLIVSHCPVAAITGLGNFDRCVGDSDKVSIDVQGVPPMKL
                     SYTKSINGKAQTYVDSNLVPEFFETPLQSTRKQIFSATDLQDLRWCRSYPVTINLDTP
                     ASQDGHYTYNIDKLVDGLGNVMDFTKIPSSLQKDYQLSYNFNAHGIPRASLEEKFDSK
                     SSTKRSMVIKFEHAHDWSSSAPYFANVSFIDENQKSQTKTFSTKHHSHQFEAEFPGTY
                     RLESVSSNHCPGVVMGKSSILVTRPVPPQLDIKSVPILDQCVGQVGLNFDLTFTGAPP
                     FHYKAMIYKLEKNGKRKLYDTKRYSSEGTRSQFSYSPSTEGNYEIVFDHLTNQLFHEP
                     IVLEPRSKYTFKTSMRVKPSAQLKRVKEVNLCLGEQTKIPVTFHGEPPFALNYDILET
                     SSNKRSSYRVDKLHSYEHEIEIPRFEVGGDYIISLVSVKDSSGCLVGLSEPDARIKIR
                     RDVPSASFNLLDNSNEAKIKEGSFAEIPIKLSGEAPFVLKYQHLDSSGQVLGTYESQF
                     HSSHKPALKAGKAGRYRLVGIRDASCKGEIETPDAQFQICFLDKPKFTVLDNSRISKL
                     ADTTFAKQSVCQGVEGTVDLALSGSPPFFLKFDLVTPSGKSYTKNIQVATKYATIKLP
                     NDEPGEYVVIIGALHDSNYGEEDFANAGYIAPEVVVKQKVNPLPEVKFSDSGKTYRAC
                     STAVNEENSSLERIGVKFHHGEAPFSVTFNIYHESTSRSEHVTIQDIQPGSFPYRKLY
                     EGLNLGTHLVAIERIVDANGCTNEKIASSNDHISISITDVPKIHLLDSSAECCVGDYV
                     AYQLSGNAPFNIRYEFNGAQLKLKEHTSQFVRLASEPGTISILSIGDATSQCVVDFRK
                     QNMKKEFEKLSLLIHPIPSVTVSQGRNIVEDIHEGDQAEIIFSFEGSPPFSLTYVRTE
                     EAEGTLGKGRPQIVETHKVTDIYSYEYKVVTSLQGTYEAIEISDAFCFAKNDAFFNH"
     gene            <329082..>330482
                     /gene="TDEL0A01810"
                     /locus_tag="TDEL_0A01810"
                     /db_xref="GeneID:11503155"
     mRNA            <329082..>330482
                     /gene="TDEL0A01810"
                     /locus_tag="TDEL_0A01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678676.1"
                     /db_xref="GeneID:11503155"
     CDS             329082..330482
                     /gene="TDEL0A01810"
                     /locus_tag="TDEL_0A01810"
                     /inference="similar to DNA sequence:INSDC:YLR034C"
                     /note="similar to Saccharomyces cerevisiae SMF3 (YLR034C);
                     ancestral locus Anc_2.407"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678724.1"
                     /db_xref="GeneID:11503155"
                     /db_xref="GOA:G8ZLL9"
                     /db_xref="InterPro:IPR001046"
                     /db_xref="UniProtKB/TrEMBL:G8ZLL9"
                     /translation="MVGVLQVLRKFATFIGPGILVSVAYMDPGNYSTSVSGGAQFKYT
                     LLFSVFVSNIFAVLLQCLCVKLGIVTGYDLAENCRRHLPRKLNLMIYFFAELAIIATD
                     LAEVVGTAVALQILFGIPLIYGVLLTVLDVLIILMFYQQNGASMKKVRAFELFVSVLV
                     AATVVCFVLELCEISVPDKLQLLKGFLPSKIIFEDQQALYISLGILGATVMPHSLYLG
                     SSLVKPRLQEFDIKEYGRVDTRPSLKAIKYNLNYTYAELIISLLLIATFVNSAILIVA
                     GATLYGQPDAEDADLLSIYKLLVHYISPAAGLIFALAMIFSGQSAGIICTVAGQIVSE
                     GFLEWSLPPWATRLCTRLLAIIPCLFVTLGMGERGISNVLNLSQVVLSLILPIVSAPL
                     IYFTANKKIMTVHDIHGEAEEEDENTPLTMASKKCVDYTNSTWLTAAAFIVWALIGGL
                     NCYLVVSFMLGAEVHF"
     gene            complement(<330578..>332068)
                     /gene="TDEL0A01820"
                     /locus_tag="TDEL_0A01820"
                     /db_xref="GeneID:11503106"
     mRNA            complement(<330578..>332068)
                     /gene="TDEL0A01820"
                     /locus_tag="TDEL_0A01820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678677.1"
                     /db_xref="GeneID:11503106"
     CDS             complement(330578..332068)
                     /gene="TDEL0A01820"
                     /locus_tag="TDEL_0A01820"
                     /inference="similar to DNA sequence:INSDC:YLR033W"
                     /note="similar to Saccharomyces cerevisiae RSC58
                     (YLR033W); ancestral locus Anc_2.408"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678725.1"
                     /db_xref="GeneID:11503106"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="UniProtKB/TrEMBL:G8ZLM0"
                     /translation="MDLGKLLSNLYSILKDASSKCKVLDESFPSSFHEKDPNKIFSSY
                     CTYIKRRSDANGMIKNEDKLKLTTISQKFEDGFYAADQGGFYRLYHDIRLVCTMLIHY
                     YSQGTRNYQMVDKFYKFATELLLRECYKIGMSLSNNKTSGKESAEPETELDSIIAHDF
                     IKMSTTYKVSIAQTYHINTGDTDLFSSMIAKSNLDNRPPELPNSNFEINKVIPQTNIC
                     EEAPRFGFIAANTSNIPDPTLPPTEMMSRFLHPNWYALPTTVWLKYGDYKQWAPSFNE
                     NGTVVDSTTRGIIWLQRIGYLQLYQDEAKKTEGKEDTEVLSSEEPEGVNGTKTDDMGA
                     ESEDAKNNKAVQNGEGNNMNHEEKIDAVKEDVPDSLSDEAKDDQALPIKLENLLGWKP
                     SNYIDNDEIDEFKSGTQAKLVTSILTKLQKLRKDRVSKKVYRPSVEETQLYNKAQRLL
                     KEVILAKQISKLPMNHCRSFPVLQANYNGSIPVVRLQPTRKRKSKK"
     gene            complement(<332279..>335968)
                     /gene="TDEL0A01830"
                     /locus_tag="TDEL_0A01830"
                     /db_xref="GeneID:11502773"
     mRNA            complement(<332279..>335968)
                     /gene="TDEL0A01830"
                     /locus_tag="TDEL_0A01830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678678.1"
                     /db_xref="GeneID:11502773"
     CDS             complement(332279..335968)
                     /gene="TDEL0A01830"
                     /locus_tag="TDEL_0A01830"
                     /inference="similar to DNA sequence:INSDC:YMR128W"
                     /note="similar to Saccharomyces cerevisiae ECM16
                     (YMR128W); ancestral locus Anc_2.409"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678726.1"
                     /db_xref="GeneID:11502773"
                     /db_xref="GOA:G8ZLM1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLM1"
                     /translation="MGTYRKRFNEKARAGQMAKLKELKKVRNKQFFRHLEDGREDAEA
                     EQEKTLDDTRDTNAEILQPISKEEEQLKKRKMEELFTPKESKISRLKKKRMDKFIEHQ
                     LKREEKKVIIEKLQEYKVDTSLMTSLKTLGQGRQTKKEEFQEALSLEKQGRSNEHTNE
                     VLYEEHETANWDEDHGLDNANSDEEIAATSDTEVKSSFVDMRPTKYGGSGFGFGFANA
                     KVVHRKPPKKKYNWRQQVELAEKRKNGIEDEMDFASSSEDEDLSSEEEEDESQDPQDD
                     QSQSGEESVDESQEEEPETESDKITTASAAEEFKSWADQEIRKIEGRDVEMVTPLLKQ
                     DYQPIIRPEDLEDGLQDSNVPIDETSQRKAFYVDVLRSDEIQQVRTQLPVFAKEHEIM
                     EAIYHNDVVIICGETGSGKTTQVPQFCMNLDSVTHDSPRYSGMIGITQPRRVAAVSMA
                     NRVSAELGNHQDKVGYQIRFDSSLKADTRVKFMTDGVLLREMMQDFKLTKYSSIIIDE
                     AHERNINTDILIGMLSRCVKLRAKEYAKDPSTCKKLKLIIMSATLRVADFSENPKLFP
                     SPPPVLKVEARQFPVAIHFNRRTSYDYQEEAFKKACKIHRRLPPGAILIFLTGQQEIH
                     HMVKRLKREFPFKKGHSAIKEMGDSIADVRVNSKNADLEAEDIDFSVKVIDEEKIDDE
                     LGSDEEAADDSEEEEGFEESLEEGQTENDPLYVLPLYSLLPTKEQMKVFNQPPAGSRL
                     CIVATNVAETSLTIPGVKYVVDCGRSKERKYNESNGVQSFEIGWVSKASAGQRSGRAG
                     RTGPGHCYRLYSSAVFERDFEQFSSPEILRMPVESVVLQMKSMAIQNVLNFPFPTPPE
                     RSAVYKAIQLLQHLGALDTGERITDDGKLMSLFPLSPRFSKLLLISEESKCIPYAVSV
                     VGALSVGDPFLSEQEIGLKDAEEEGDDDERNKMLKSKFFKSKARFSRLDKYSDVFRLL
                     SAVSAFDFIPIVQKSQFLRDNFLRGKVMDEILKLRKQLIYIIKSNTRQENVAANVTES
                     DLKSDLPSEIQLKLLKQMICAGFIDQVAIRADCIYPEEVAITNRTSIINIPYVPVLMT
                     KSPEVSDNFVYIHPSSLLTNVGEIPPKYLVYHSLHLGANGKTRMNSLCDIKSTPLANV
                     AGKGSLLSYSKPLTGQGMKTIDISPTERYCYVVPRFGATVDSDLKIGWDLNPVAVHQI
                     KKNGQWKVDKIVTNKSYSAMQKKHK"
     gene            <336280..>337209
                     /gene="TDEL0A01840"
                     /locus_tag="TDEL_0A01840"
                     /db_xref="GeneID:11503136"
     mRNA            <336280..>337209
                     /gene="TDEL0A01840"
                     /locus_tag="TDEL_0A01840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678679.1"
                     /db_xref="GeneID:11503136"
     CDS             336280..337209
                     /gene="TDEL0A01840"
                     /locus_tag="TDEL_0A01840"
                     /inference="similar to DNA sequence:INSDC:YMR127C"
                     /note="similar to Saccharomyces cerevisiae SAS2 (YMR127C);
                     ancestral locus Anc_2.410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678727.1"
                     /db_xref="GeneID:11503136"
                     /db_xref="GOA:G8ZLM2"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G8ZLM2"
                     /translation="MDDDNKDDDLYGILNERNIKEVQFGIDKRFPTWYGSNAYFSPDT
                     NRLGYEEDFHTPVKNDVKTQYWLDTLYICEYCFKYTDVEADFVSHIPHCKYQFHAPGR
                     IKYKSPSYTIRRVKGSRHRLFCQCLCLFTKLFLDNKSMYFKVDHYEFYVVYRTGEFKP
                     MAFFSKDLVSYHQNNLACILTFPPYQRLRLGTLLLEFSYKLSTFDNLISGPELPLSPF
                     GLISYLKYWSKVICWELVEGELANCEKLTIETIAKVTGIRIPDIILTMEYLKCLGNTH
                     EIHLSVLRRRLKEFEHKSKELFLLKDEYLLLED"
     gene            complement(<337255..>340671)
                     /gene="TDEL0A01850"
                     /locus_tag="TDEL_0A01850"
                     /db_xref="GeneID:11503168"
     mRNA            complement(<337255..>340671)
                     /gene="TDEL0A01850"
                     /locus_tag="TDEL_0A01850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678680.1"
                     /db_xref="GeneID:11503168"
     CDS             complement(337255..340671)
                     /gene="TDEL0A01850"
                     /locus_tag="TDEL_0A01850"
                     /inference="similar to DNA sequence:INSDC:YLR032W"
                     /note="similar to Saccharomyces cerevisiae RAD5 (YLR032W);
                     ancestral locus Anc_2.411"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678728.1"
                     /db_xref="GeneID:11503168"
                     /db_xref="GOA:G8ZLM3"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014905"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLM3"
                     /translation="MESKEPVETEVREEGEKKRFFSDELESSQESLPKFNQMLDSNSS
                     FLFSNGRNDSEIEVPKNVESIDVSSEAEPEECAKHISVEDLRGIIPDIPLNVAKKLCE
                     KYSGQEDGISLAVSQYFEDPPVESKSTNPIKPPEPTQRSLSPKMKKKDYGYRSPKRLK
                     PSIKWRRFIGSLQVNAMATRPTIRPLKYGTELKIASVGGNIKASKLYNSSGSKKAAFA
                     SFVKVFDVQQNREIGRVPEDIAQILYPILTLDDFMFEATMIFCDDKRLSIGDNFIVQL
                     DCFITSAIFHESTSSYRNNSFAKNSRARTWEGSQTIVETEEEIESRSRRMSLLALFDK
                     LRVRPVTNDNKSQQDAEVIDLEDDGNPSELKKLDNEHGSLDDQHPQEDTMNLNQLQLF
                     YKATQSVESLEKLPEMEPPKDTFKLTLRRYQKQGLAWMLKREHEFDKIPLSESDQEID
                     ENMMNPLWNQFEWPKDMSWAAQKIKEGKNDELGHNDRFFYANLHTAEFSTEKPVLKTT
                     MKGGILSDEMGLGKTISTLSLILSAPNDSEYLLNEKGNEGETEYSTKKPYAAKTTLIV
                     VPMSLLAQWSSEFDKANSSSQLHSEVYYGGNVSSLKTLLTRTKNPPTVVLTTYGIVQN
                     EWSKMSRGKSSSQSDGMSGLFSIEFHRIVIDEGHTIRNRMTATSKAVMQLASRCRWVL
                     TGTPIINRLDDLYSLVKFLRLEPWSQIGYWKMFISDPFEKKNFKQAFDVVNAILGPVS
                     LRRTKQMKDASGKKLVELPPKEVVVEKLHFSKGQEKVYKYFLDRAESSVKSGLAHGDL
                     LKKYSTILVHILRLRQICCDAALLGTQDENDEDLRNSNQQFNESIDVANILGESKTNA
                     TKAETDMKAILANVQRKYPSEESFKNLECSICTTEPINLQSIMFIGCGHCFCGPCLEE
                     FMDFQKQKKLELRCPNCRELFDSQCLLSLRLQEEGDPTLVPYNQSSKPAKIHSLVKHL
                     RQLQDKSAGEQIVVFSQFSSYLDVLERELSDVFSKDVSQIYKFDGRLNLKERSGILRD
                     FSIKDLSKQKILLLSLKAGGVGLNLTCASYAFMMDPWWSPSMEDQAIDRIHRIGQTNN
                     VKVIRFIMENSIEEKMLRIQERKRTIGEAMDADEDERRKRRIEEIKMLFE"
     gene            <341309..>342271
                     /gene="TDEL0A01860"
                     /locus_tag="TDEL_0A01860"
                     /db_xref="GeneID:11503114"
     mRNA            <341309..>342271
                     /gene="TDEL0A01860"
                     /locus_tag="TDEL_0A01860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678681.1"
                     /db_xref="GeneID:11503114"
     CDS             341309..342271
                     /gene="TDEL0A01860"
                     /locus_tag="TDEL_0A01860"
                     /inference="similar to DNA sequence:INSDC:YMR126C"
                     /note="similar to Saccharomyces cerevisiae YMR126C;
                     ancestral locus Anc_2.412"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678729.1"
                     /db_xref="GeneID:11503114"
                     /db_xref="UniProtKB/TrEMBL:G8ZLM4"
                     /translation="MHPIERWKRWFYRGSLVFAMLFLIGFSIVLPIDCIAQAAQSSNN
                     ALNTFIVVGALVAFGVACIVIVVGRIIFYKSCRRYIPRRYIPISAADLPHKGSRKLIL
                     ENMDRSKDLSALFKMPKDPVIHAGLEPPARCDNTKEEKFFPEYLNYQSCIKSLADRMR
                     YQGVFLNNMELDMKLDETFSDVVRNQFMKDTDDEVQLQNAQRFIEIYETVRFSGQEVT
                     RKQFVDFVSLAIYLVDVSMTMDKKKHTRRSSSRLQVHSKLDDDPWEKEVSRDPSEYST
                     YPNRNVDYERNEESSYADTCSVLRRMNTGASVSRPLYSRRYSGY"
     gene            complement(<342352..>345230)
                     /gene="TDEL0A01870"
                     /locus_tag="TDEL_0A01870"
                     /db_xref="GeneID:11503236"
     mRNA            complement(join(<342352..344903,345206..>345230))
                     /gene="TDEL0A01870"
                     /locus_tag="TDEL_0A01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678682.1"
                     /db_xref="GeneID:11503236"
     CDS             complement(join(342352..344903,345206..345230))
                     /gene="TDEL0A01870"
                     /locus_tag="TDEL_0A01870"
                     /inference="similar to DNA sequence:INSDC:YMR125W"
                     /note="similar to Saccharomyces cerevisiae STO1 (YMR125W);
                     ancestral locus Anc_2.413"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678730.1"
                     /db_xref="GeneID:11503236"
                     /db_xref="GOA:G8ZLM5"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR015172"
                     /db_xref="InterPro:IPR015174"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR027159"
                     /db_xref="UniProtKB/TrEMBL:G8ZLM5"
                     /translation="MFSKKRRADFDDDDGYRDFKPRIQKRQRLPPVVQLCKEMMPDIR
                     TIGESVKAFEEDIKFLGDAIVNEYGHEDYFNNALLKTFRAVVLEQPHKQPAIALLTIV
                     VNVKNDIAAKSVINFFFEELQNCCKDSINEDFENKSNETGPWNRAKLILRFLSILSPI
                     LLKDDLMGVYRKFFELSIELNKSEEKRNALSEAIYTNTLLNIPYLFLFNRDDQDLQNR
                     VEELLSYVESEHKVKKTEISLLKVFNKNSPYESLELVEVILPNVKKALTNHMEQLSNL
                     FPDYLHLLPETKEDHGFNDALELPPVEVLKPFSALNRGVGSVDGIWKNPRYAFRVYLA
                     NPAGGFETVVPITSYAGQLLNDIIIDITESMEFNRKEVAKQVVTLDLFFKPGIFAEPG
                     ESIAQLAAIYEENPLASTLKIEDLAIETILGLIFKLPNVSQPFAYFYTLLVEICQNSP
                     KAIAPVFGRAFRFFYHSLEDLDLELKLRYLDWFSIQMSNFNFSWKWKEWENDSIKFGK
                     TFYYAKLNFAKNLIRKELRLTSNTLDVEDSLPEEFKQYLDSSYIPKDQLHDYYQSLFT
                     DNHVVDTSKIAKNSLYFNQESVPFSEEVRQVLDYIHKSNDVREVSELETILESIKEKY
                     GALISDFDRFTIVLLVQTVVHSGSRSLSHANKYIGDLRDDLNVIFEKLQISNESKEFI
                     IVEAVVRFWNSNSQNGFLIADAFKHAGLIKPQAILSFSFTEYDNKNYGLVDGTSIEST
                     FRSLSQEADDNDCLKFLFERLLNITNEAIAQLQVQPQEVITIPEISEEMDIDVENELP
                     RLDLLWKYETAVSFFKSILRKYADDFKPILPEIKSGLGAALPHEQTRAQLLTWIEEVD
                     QI"
     gene            complement(<345379..>347871)
                     /gene="TDEL0A01880"
                     /locus_tag="TDEL_0A01880"
                     /db_xref="GeneID:11502560"
     mRNA            complement(<345379..>347871)
                     /gene="TDEL0A01880"
                     /locus_tag="TDEL_0A01880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678683.1"
                     /db_xref="GeneID:11502560"
     CDS             complement(345379..347871)
                     /gene="TDEL0A01880"
                     /locus_tag="TDEL_0A01880"
                     /inference="similar to DNA sequence:INSDC:YLR031W,YMR124W"
                     /note="similar to Saccharomyces cerevisiae YLR031W and
                     YMR124W; ancestral locus Anc_2.414"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678731.1"
                     /db_xref="GeneID:11502560"
                     /db_xref="UniProtKB/TrEMBL:G8ZLM6"
                     /translation="MEAGLSAMNSKAQMRNQLLQSDIGNIDLSHEVPNGQPPQQQYQQ
                     TFNRPVQPQYYANRYPQEEPERRAYSLNQKSISGFFRNRGGKLPHRKGKYDSSKDEEE
                     EVIVDGDMSTMTFNDIRTSQNRGGERYGHGSDTAPIIPTLVTQSHNNMNNVEYRKHMT
                     AQRKYAMNAMARQQKPDARAMSLQGYGNPYRMHPQYQASNAQDPYGNSRANSLVHPPP
                     QFQRGGFPPYGTSGGPAGGPPNGLPNRGPMPNGPRAMSLMTPYSRPPNMRPQNEFHQP
                     SQQMHRQQGLSSESLRSEQPYRQPPENLPGLREQPYREGPPPENLQGPVEHFRQPGPS
                     SEYVPGRSEQPYRQDLSSEHLPGPAEQFRQHGPSSENLAGRTEQPFRQGPTSENLSGR
                     SEPQGQSLDFKAHRPGPSAQLNVLQLSAPQQNDLKEKERSLAEREKELKKKERLIKEQ
                     ETQIKHDLEQKHKQIKPQLLHANVEDVNLDPSPTLQNGLKSLTVNDRDVPGDEVHNRV
                     SMGTFVSAFSASPEKRRNLNPSGMYQLEKHDNSAFVTAQEFPQGTENRSPEKSEDVEE
                     GNSTLTNINVSEANGTSDATSDQRRKRSSLIRAKDFLRKLSSHSLKDNDAQLPPSRAS
                     VASIPSSEALQGTAAKRELSGQVVRKNKAEDELARSTEPNNDPDSFIFDNTVGKPYVP
                     SFATNEEVAETDKFKTITISGEQLNILTENKELMSELTLVSMELAESIKRETILEEQI
                     RTSSDPSQAEAQLSLADFEIELRKKSSKIVELIQQLNNERLKRFIAEEQVLLFENEVK
                     PSSLELVNKISELQSLLETKDNEISKLKDQLL"
     gene            complement(<348012..>348344)
                     /gene="TDEL0A01890"
                     /locus_tag="TDEL_0A01890"
                     /db_xref="GeneID:11502963"
     mRNA            complement(<348012..>348344)
                     /gene="TDEL0A01890"
                     /locus_tag="TDEL_0A01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678684.1"
                     /db_xref="GeneID:11502963"
     CDS             complement(348012..348344)
                     /gene="TDEL0A01890"
                     /locus_tag="TDEL_0A01890"
                     /inference="similar to DNA sequence:INSDC:YMR123W"
                     /note="similar to Saccharomyces cerevisiae PKR1 (YMR123W);
                     ancestral locus Anc_2.415"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678732.1"
                     /db_xref="GeneID:11502963"
                     /db_xref="InterPro:IPR013945"
                     /db_xref="UniProtKB/TrEMBL:G8ZLM7"
                     /translation="MANFFVALWESIFQPGTTPQLIIATHVSFFALLCTLAWLIYATS
                     GNIHFYALFAIASCLWIAVIWFIQELNSANLMDNKQLEEPEKETGEKRKKLRSNQDLR
                     LSDRGKFK"
     gene            complement(<348639..>348935)
                     /gene="TDEL0A01900"
                     /locus_tag="TDEL_0A01900"
                     /db_xref="GeneID:11502806"
     mRNA            complement(<348639..>348935)
                     /gene="TDEL0A01900"
                     /locus_tag="TDEL_0A01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678685.1"
                     /db_xref="GeneID:11502806"
     CDS             complement(348639..348935)
                     /gene="TDEL0A01900"
                     /locus_tag="TDEL_0A01900"
                     /inference="similar to DNA sequence:INSDC:YMR122W-A"
                     /note="similar to Saccharomyces cerevisiae YMR122W-A;
                     ancestral locus Anc_2.416"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678733.1"
                     /db_xref="GeneID:11502806"
                     /db_xref="UniProtKB/TrEMBL:G8ZLM8"
                     /translation="MSSSSVATLSNLVSATNVAGSSVSADSSSASSVSSQMSSVSSKV
                     SSISSSVSSEASVNSSSSSSKNSAANMIAHPISWKLGAALGALMAGSFVLGAGL"
     gene            <349500..>350114
                     /gene="TDEL0A01910"
                     /locus_tag="TDEL_0A01910"
                     /db_xref="GeneID:11503366"
     mRNA            <349500..>350114
                     /gene="TDEL0A01910"
                     /locus_tag="TDEL_0A01910"
                     /product="60S ribosomal protein L15"
                     /transcript_id="XM_003678686.1"
                     /db_xref="GeneID:11503366"
     CDS             349500..350114
                     /gene="TDEL0A01910"
                     /locus_tag="TDEL_0A01910"
                     /inference="similar to DNA sequence:INSDC:YLR029C,YMR121C"
                     /note="similar to Saccharomyces cerevisiae RPL15A
                     (YLR029C) and RPL15B (YMR121C); ancestral locus Anc_2.417"
                     /codon_start=1
                     /product="60S ribosomal protein L15"
                     /protein_id="XP_003678734.1"
                     /db_xref="GeneID:11503366"
                     /db_xref="GOA:G8ZLM9"
                     /db_xref="InterPro:IPR000439"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR024794"
                     /db_xref="UniProtKB/TrEMBL:G8ZLM9"
                     /translation="MGAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRATRPSR
                     PDKARRMGYKAKQGFVIYRVRVRRGNRKRPVPKGATYGKPTNQGVNELKYQRALRATA
                     EERVGRRASNLRVLNSYWVNQDSTYKYFEVILVDPSHKAIRRDARYNWICNPVHKHRE
                     ARGLTATGKKSRGINKGHRFNNTKAGRRKTWKKNNTLSLWRYRK"
     gene            <350390..>352168
                     /gene="TDEL0A01920"
                     /locus_tag="TDEL_0A01920"
                     /db_xref="GeneID:11503343"
     mRNA            <350390..>352168
                     /gene="TDEL0A01920"
                     /locus_tag="TDEL_0A01920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678687.1"
                     /db_xref="GeneID:11503343"
     CDS             350390..352168
                     /gene="TDEL0A01920"
                     /locus_tag="TDEL_0A01920"
                     /inference="similar to DNA sequence:INSDC:YLR028C,YMR120C"
                     /note="similar to Saccharomyces cerevisiae ADE16 (YLR028C)
                     and ADE17 (YMR120C); ancestral locus Anc_2.418"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678735.1"
                     /db_xref="GeneID:11503343"
                     /db_xref="GOA:G8ZLN0"
                     /db_xref="InterPro:IPR002695"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="InterPro:IPR024050"
                     /db_xref="InterPro:IPR024051"
                     /db_xref="UniProtKB/TrEMBL:G8ZLN0"
                     /translation="MTDFKKTAILSVYDKTGLLDLAKGLSEKNVRILASGGTARMVRE
                     AGFPVDDVSSITHAPEMLGGRVKTLHPAVHGGILARNLESDEEDLKKQGIDKVDYVVC
                     NLYPFKETVAKVGVTVAEAVEEIDIGGVTLLRAAAKNHARVTILSDPNDYSTFLSELT
                     ADGEVSQELRNNLALKAFEHTADYDAAISDFFRKQYSEGKAQLPLRYGANPHQKPAQA
                     FVTQQNELPFKVLSGSPGYINLLDALNSWPLVKELSASLNLPAAASFKHVSPAGAAVG
                     VPLTDVEKQVYFVSDIENLSPLAAAYARARGADRMSSFGDWIALSNIVDIPTAKIISR
                     EVSDGIIAPGFEPEALEILKKKKGGKYCVLQIDPNYIPESMETRQVYGVSLQQKRNDA
                     IINQSSFREIVSENKSLTEQAVVDLTVATIALKYTQSNSVCYAKSGMVIGLGAGQQSR
                     IHCTRLAGDKADNWWFRQHPRVLGIKWAKGVKRPEKSNAIDLLVTGQIPTEEPEKSEY
                     ESKFEEIPAPFTEQERKEWSSKLTNVSLSSDAFFPFPDNVYRAVRSGVKYIAAPSGSV
                     MDKAVFGAADSFDLVYVENPIRLFHH"
     gene            complement(<352916..>354823)
                     /gene="TDEL0A01930"
                     /locus_tag="TDEL_0A01930"
                     /db_xref="GeneID:11503349"
     mRNA            complement(<352916..>354823)
                     /gene="TDEL0A01930"
                     /locus_tag="TDEL_0A01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678688.1"
                     /db_xref="GeneID:11503349"
     CDS             complement(352916..354823)
                     /gene="TDEL0A01930"
                     /locus_tag="TDEL_0A01930"
                     /inference="similar to DNA sequence:INSDC:YMR119W,YNL008C"
                     /note="similar to Saccharomyces cerevisiae ASI1 (YMR119W)
                     and ASI3 (YNL008C); ancestral locus Anc_2.419"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678736.1"
                     /db_xref="GeneID:11503349"
                     /db_xref="UniProtKB/TrEMBL:G8ZLN1"
                     /translation="MNSTVNQGSLPAVFSYLNQSAYSLVPDGSVFSPVINYPYRIALS
                     VINATKLQYEQALASEELIPSLQSLLDTIGYFFSSYAVASFVTAVILDRFVIMASLRS
                     NTTRVSLPIWSRFVLHLSAIIPLLYNVLQTLSQVKLISVFPIMNFPLYLARTFTIFAW
                     SHCVETLVTTTTNSKPLEESDYTIFELSVQFYYLSQRSYYVTMAPEYLSDCLMALLGR
                     VWIHIVEMLNIRKYRLAGSTLLNFFNIAFLIYQMKTYGFESIPVSTRYRHFPKIFSIF
                     LIVVSVMSYALACLVRKNPFGSQQSDTKDLQFYSFMHNWWNHLNCTGEEEFSHVVNKL
                     ALLLCNGKESQNKGIHREFSPLNHPASLHHSYMLSGYLNKVHTIPEDINSEGSVTEKP
                     GQRLGTPALISKFKITWSLLVAGFTFFVKRKWQIKGPKDQESQASRKARKARDFNRFV
                     TEKNYAKFLTKAETDNKDDREPSLLPEEDYSADYQPELDEIESDSDITSRDDKEEVED
                     ELLGITAPNDMNWFMSMWPILKLHVLKDSRLTRSQYATSNAQEILADVIVQRTASGTA
                     TDHILEDSDEDETRSNCVVCKINPRNVVLWPCTCFALCEDCRVSLGLRGFNSCVCCRT
                     ETHGYSRLNNV"
     gene            complement(355027..355157)
                     /gene="TDEL0Atrna11L"
                     /locus_tag="TDEL_0Atrna11L"
                     /db_xref="GeneID:11503163"
     tRNA            complement(join(355027..355071,355119..355157))
                     /gene="TDEL0Atrna11L"
                     /locus_tag="TDEL_0Atrna11L"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUG"
                     /db_xref="GeneID:11503163"
     gene            <355974..>357236
                     /gene="TDEL0A01940"
                     /locus_tag="TDEL_0A01940"
                     /db_xref="GeneID:11502545"
     mRNA            <355974..>357236
                     /gene="TDEL0A01940"
                     /locus_tag="TDEL_0A01940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678689.1"
                     /db_xref="GeneID:11502545"
     CDS             355974..357236
                     /gene="TDEL0A01940"
                     /locus_tag="TDEL_0A01940"
                     /inference="similar to DNA sequence:INSDC:YLR027C"
                     /note="similar to Saccharomyces cerevisiae AAT2 (YLR027C);
                     ancestral locus Anc_2.420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678737.1"
                     /db_xref="GeneID:11502545"
                     /db_xref="GOA:G8ZLN2"
                     /db_xref="InterPro:IPR000796"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8ZLN2"
                     /translation="MSLTLLNNIQQLPPDALFGIKQRYTQDSRANKVDLGIGAYRDDK
                     GKPWVLPSVRSAEKLIHEDPNYNHEYLGINGSPELSSAAAKIVFGEDSKALQQGRIAS
                     VQSLSGTGALHIAAKFISSFLPGRSLYISEPTWANHNAIFKSQGVQTATYPYWQASTK
                     TLDMEGFLKTIKDAPTGSVILLHACAHNPTGLDPTQDQWSDIIDAVASKDHIVLFDSA
                     YQGFASGDLDRDAYAIRLGVEKLARVSPIFVCQSFAKNVGMYGERAGCFHLVLPEQEN
                     IDTAKVKGAITSQLSSLIRSEVSNPPAYGAKIVAKILNSPELTKQWHQDMITMSSRIT
                     EMRHELRDRLVAQGTPGTWDHIVEQCGMFSYTGLSPEMVKRLETQHAVYLVSSGRASI
                     AGLNHGNIEHVAKAIDEVVRHFTGNSKF"
     gene            <357415..>358344
                     /gene="TDEL0A01950"
                     /locus_tag="TDEL_0A01950"
                     /db_xref="GeneID:11503254"
     mRNA            <357415..>358344
                     /gene="TDEL0A01950"
                     /locus_tag="TDEL_0A01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678690.1"
                     /db_xref="GeneID:11503254"
     CDS             357415..358344
                     /gene="TDEL0A01950"
                     /locus_tag="TDEL_0A01950"
                     /inference="similar to DNA sequence:INSDC:YLR026C"
                     /note="similar to Saccharomyces cerevisiae SED5 (YLR026C);
                     ancestral locus Anc_2.421"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678738.1"
                     /db_xref="GeneID:11503254"
                     /db_xref="GOA:G8ZLN3"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006011"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="InterPro:IPR021538"
                     /db_xref="UniProtKB/TrEMBL:G8ZLN3"
                     /translation="MDIRDRSAEFQKSVLVYKKRNKANLRQQEPQSNGVQGKSSEFQK
                     RASGIAHEISSTAQLLSKLAILARKKPMFNDNPVEIAELSFLIKRKIYAIEQNLIELS
                     KIQRSRQQPQEKINDGTHSKNVMTLLNTKVRNISGNFKDVLEERQKLEMNNRDRWEKI
                     SSGKSNEESNDTSMYNSSNPFMSSVIADGDGKPTADGELTIPKDSQLLLMEEGQMSSN
                     QYLQERNRAVETIESTIQEVGNLFQQLASMVQEQGEVIQRIDANVDDIDMNITGAQRQ
                     LLKYFDRVKSNRWLAVKIFFVIFVFFLIWVLVN"
     gene            complement(<358370..>359059)
                     /gene="TDEL0A01960"
                     /locus_tag="TDEL_0A01960"
                     /db_xref="GeneID:11503135"
     mRNA            complement(<358370..>359059)
                     /gene="TDEL0A01960"
                     /locus_tag="TDEL_0A01960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678691.1"
                     /db_xref="GeneID:11503135"
     CDS             complement(358370..359059)
                     /gene="TDEL0A01960"
                     /locus_tag="TDEL_0A01960"
                     /inference="similar to DNA sequence:INSDC:YLR025W"
                     /note="similar to Saccharomyces cerevisiae SNF7 (YLR025W);
                     ancestral locus Anc_2.422"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678739.1"
                     /db_xref="GeneID:11503135"
                     /db_xref="GOA:G8ZLN4"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:G8ZLN4"
                     /translation="MLSYFFGGSSSGGGGKNRDLPKLAIVELREQINLLSKKQSHLQT
                     QILKQENDARSFLAKNNKNLAKNSLKKKKIYEAQLGKLEGQMDTLEQQLFSIESANLN
                     LETMRAMKQGAKAMKSMHNGLDIDKVDETMDEIREQVELGEEISDAISRPMYTGANEV
                     DEDELDEELDMLAQEATLNEPAQPVKEDRVALPNAPQDKIQPSTKEEAPQEEEDEDER
                     ALRELQAEMGL"
     gene            <360004..>360519
                     /gene="TDEL0A01970"
                     /locus_tag="TDEL_0A01970"
                     /db_xref="GeneID:11502829"
     mRNA            <360004..>360519
                     /gene="TDEL0A01970"
                     /locus_tag="TDEL_0A01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678692.1"
                     /db_xref="GeneID:11502829"
     CDS             360004..360519
                     /gene="TDEL0A01970"
                     /locus_tag="TDEL_0A01970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678740.1"
                     /db_xref="GeneID:11502829"
                     /db_xref="UniProtKB/TrEMBL:G8ZLN5"
                     /translation="MTSPTDAAHVVPTHQRITSSKQWVIDRKEPARQINIRPKNHTTS
                     SHSTTQSAAAERESRKKQKELETAKLQIEYDSVKQENDKLKKVILRLKQEIDVYAGLI
                     DNGQQQQQQRLTERVPDPKVKDLLINTSKRRKRSEPTVVTQPVQDQSEPVSKDDIVLM
                     NTLSDVLAQME"
     gene            <360689..>361222
                     /gene="TDEL0A01980"
                     /locus_tag="TDEL_0A01980"
                     /db_xref="GeneID:11503147"
     mRNA            <360689..>361222
                     /gene="TDEL0A01980"
                     /locus_tag="TDEL_0A01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678693.1"
                     /db_xref="GeneID:11503147"
     CDS             360689..361222
                     /gene="TDEL0A01980"
                     /locus_tag="TDEL_0A01980"
                     /inference="similar to DNA sequence:INSDC:YKL141W,YMR118C"
                     /note="similar to Saccharomyces cerevisiae SDH3 (YKL141W)
                     and YMR118C; ancestral locus Anc_2.423"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678741.1"
                     /db_xref="GeneID:11503147"
                     /db_xref="GOA:G8ZLN6"
                     /db_xref="InterPro:IPR000701"
                     /db_xref="InterPro:IPR014314"
                     /db_xref="InterPro:IPR014361"
                     /db_xref="InterPro:IPR018495"
                     /db_xref="UniProtKB/TrEMBL:G8ZLN6"
                     /translation="MLLQLGLNGCYRGVVRPSVIARASRTLGKRFNSQAVKTTFEKEH
                     EILVAQRGNRPVSPHLTIYQPQLTWYLSSLHRITGVILGSGFFAVTIAFGISTLFGLG
                     LNTENLKNYYKEKVPAWADWTAKGTAAYFFAFHFGNGIRHLIWDTGKELTIKGVNRTG
                     IVVLALTAIGGTALLFK"
     gene            complement(<361273..>362382)
                     /gene="TDEL0A01990"
                     /locus_tag="TDEL_0A01990"
                     /db_xref="GeneID:11503084"
     mRNA            complement(<361273..>362382)
                     /gene="TDEL0A01990"
                     /locus_tag="TDEL_0A01990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678694.1"
                     /db_xref="GeneID:11503084"
     CDS             complement(361273..362382)
                     /gene="TDEL0A01990"
                     /locus_tag="TDEL_0A01990"
                     /inference="similar to DNA sequence:INSDC:YGR041W,YLR353W"
                     /note="similar to Saccharomyces cerevisiae BUD9 (YGR041W)
                     and BUD8 (YLR353W); ancestral locus Anc_4.186"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678742.1"
                     /db_xref="GeneID:11503084"
                     /db_xref="UniProtKB/TrEMBL:G8ZLN7"
                     /translation="MSPQDADNSSDILSSSLEESDESRQERGVSESYFLERFDEDPAV
                     EDSAVEDSVAENRRSNASIGTVSTAMLVDPEAVNSSREKSSSSNVYSEEKEPNIEEAM
                     RLLKREAASANPRVSYVGISSADGFEPHAYNMPRKVSQSSIESANRGKVPRSPSLLSN
                     ILVPSPNDEGAKSIPALRSVSGSHQVLWKPRRLSIQPVVELKTESLTSPERARITKIS
                     DSQMELTIDTLRSYQRDIEATAGRGTDTHIDSIPVQHIDSSSIRSFDSKKHGFFDIYS
                     IPRIIGVILFCIVIPPLFFMIASGEGVSNYRLMRMIMNSNHRIKLMKGFIWDIDISWF
                     RYMCLILGVLETLGILACIGSGIGVGITREIGSHS"
     gene            <363501..>365003
                     /gene="TDEL0A02000"
                     /locus_tag="TDEL_0A02000"
                     /db_xref="GeneID:11502538"
     mRNA            <363501..>365003
                     /gene="TDEL0A02000"
                     /locus_tag="TDEL_0A02000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678695.1"
                     /db_xref="GeneID:11502538"
     CDS             363501..365003
                     /gene="TDEL0A02000"
                     /locus_tag="TDEL_0A02000"
                     /inference="similar to DNA sequence:INSDC:YKL140W"
                     /note="similar to Saccharomyces cerevisiae TGL1 (YKL140W);
                     ancestral locus Anc_2.424"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678743.1"
                     /db_xref="GeneID:11502538"
                     /db_xref="GOA:G8ZLN8"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR006693"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8ZLN8"
                     /translation="MALGGRVSITDSVIIVLVYIETVLALSLRLVPQPIKTLLSWLIN
                     LRGGYDDSSIEQRIRRAPTIHEMCAVFDIKVEDHLVRTEDDYILTLHHIRPKMGKFNG
                     KVAYLHHGLLMCSDVWVCNIEKQKNLPFVLHELGFDVWLGNNRGNKYSTAHLNLLPKD
                     KKFWDFSIDEFAFFDIPNSIQFVLDRTRVDQLICIGFSQGSAQMFAAFSISEELNMKV
                     SQFIAIAPAMTPKGLHNRIVDTLVKASPGLMYLFFGSRIVLPTAVLWQRTLHPKLFNF
                     MVDFGNRFLFNWKALNITTRQKLASYSKLYSTTSVKSIVHWFQILQSQKFQVFEASDD
                     IINSFYRPYQIATFPTRTNIRIPILLIYGGTDSLVDINVMKQNLPANTVFDIKVEDHD
                     HLDLLWGHNVDALVIARVIKFIQFFDEPFELPLVDYDKDIIRLDSPPNAVTSSLTMND
                     EDRGLPPFKKDDYSDDESIYLESSEQLEDERQHKKDRKLLSELFLNSFRA"
     gene            <365325..>366782
                     /gene="TDEL0A02010"
                     /locus_tag="TDEL_0A02010"
                     /db_xref="GeneID:11502687"
     mRNA            <365325..>366782
                     /gene="TDEL0A02010"
                     /locus_tag="TDEL_0A02010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678696.1"
                     /db_xref="GeneID:11502687"
     CDS             365325..366782
                     /gene="TDEL0A02010"
                     /locus_tag="TDEL_0A02010"
                     /inference="similar to DNA sequence:INSDC:YKL139W"
                     /note="similar to Saccharomyces cerevisiae CTK1 (YKL139W);
                     ancestral locus Anc_2.425"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678744.1"
                     /db_xref="GeneID:11502687"
                     /db_xref="GOA:G8ZLN9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZLN9"
                     /translation="MTDRPNFKRRVGNPPPYRPAPKRLRANNRPTTPLPLSPASNASH
                     NRSGQNSRYDSGGQSRYEGSRYDNTSSKPSERHNNRASPSRGHYSTGQRADDERNRNG
                     FLSKLPKGPKVAMSRYNDGKSSSVTKQAIEEKKVPPPSLLTQIRDSSVYERILQVGEG
                     TYGKVYKARSTVTGKIVALKRLRLEGEREGFPITSIREIKLLQSFDHPNVSTLNEIMV
                     ESQKTVYMIFEYADNDLSGLLLNKQIDIDAAQCKHIFEQLLRGMEYLHGNGILHRDIK
                     GSNILIDNKGQLRITDFGLARKVKAESDYTNRVITLWYRPPELLLGTTNYGPEVDMWG
                     CGCVLVELFNKVAIFQGQNELEQLDSIFKIMGTPNTDSWPTIFDMPWFFMVMPQQSHK
                     YPNTFREKFSSIIPSEACLRLSEGLLSYNKNRRLTASQALQSAYFKELPKPAPLVLEG
                     YEGCHEYEVKLARKQKRAKLQEEQASKRESSEKQA"
     gene            complement(<366873..>367088)
                     /gene="TDEL0A02020"
                     /locus_tag="TDEL_0A02020"
                     /db_xref="GeneID:11503333"
     mRNA            complement(<366873..>367088)
                     /gene="TDEL0A02020"
                     /locus_tag="TDEL_0A02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678697.1"
                     /db_xref="GeneID:11503333"
     CDS             complement(366873..367088)
                     /gene="TDEL0A02020"
                     /locus_tag="TDEL_0A02020"
                     /inference="similar to DNA sequence:INSDC:YKL138C-A"
                     /note="similar to Saccharomyces cerevisiae HSK3
                     (YKL138C-A); ancestral locus Anc_2.426"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678745.1"
                     /db_xref="GeneID:11503333"
                     /db_xref="InterPro:IPR013183"
                     /db_xref="UniProtKB/TrEMBL:G8ZLP0"
                     /translation="MSNPSKERQYAHMAQQLQLLQANLVKTSEQLEIMSQHCNKNLVG
                     QLGKVHASWFIGSNRFFEEEMLGKQKK"
     gene            <367215..>367853
                     /gene="TDEL0A02030"
                     /locus_tag="TDEL_0A02030"
                     /db_xref="GeneID:11503094"
     mRNA            <367215..>367853
                     /gene="TDEL0A02030"
                     /locus_tag="TDEL_0A02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678698.1"
                     /db_xref="GeneID:11503094"
     CDS             367215..367853
                     /gene="TDEL0A02030"
                     /locus_tag="TDEL_0A02030"
                     /inference="similar to DNA sequence:INSDC:YMR117C"
                     /note="similar to Saccharomyces cerevisiae SPC24
                     (YMR117C); ancestral locus Anc_2.427"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678746.1"
                     /db_xref="GeneID:11503094"
                     /db_xref="InterPro:IPR013252"
                     /db_xref="UniProtKB/TrEMBL:G8ZLP1"
                     /translation="MSNNGLLENPAELLREVRESFIIDQDVESLLTIDGKIEQIRTRS
                     QEKLRDKKLEISRLEIQLKNSESRVNSLSKDLNQIKDESQDLVSNNDVVDFVKELDEL
                     EQSIVDLRSNLGEKVAKFVQGSEVSSNGQSLISEEALNKEVQSDILQDPEARADLLKL
                     KLYRSLRIFIDDVNHQVMIEGNDNEINTLPLDDDLSDYFRTKYIWDRMKASR"
     gene            complement(<367941..>368336)
                     /gene="TDEL0A02040"
                     /locus_tag="TDEL_0A02040"
                     /db_xref="GeneID:11503080"
     mRNA            complement(<367941..>368336)
                     /gene="TDEL0A02040"
                     /locus_tag="TDEL_0A02040"
                     /product="mitochondrial 54S ribosomal protein YmL31"
                     /transcript_id="XM_003678699.1"
                     /db_xref="GeneID:11503080"
     CDS             complement(367941..368336)
                     /gene="TDEL0A02040"
                     /locus_tag="TDEL_0A02040"
                     /inference="similar to DNA sequence:INSDC:YKL138C"
                     /note="similar to Saccharomyces cerevisiae MRPL31
                     (YKL138C); ancestral locus Anc_2.428"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL31"
                     /protein_id="XP_003678747.1"
                     /db_xref="GeneID:11503080"
                     /db_xref="InterPro:IPR016340"
                     /db_xref="UniProtKB/TrEMBL:G8ZLP2"
                     /translation="MFGPFKASNTLLGGLLWKIPWRMSSHQKQRVRHRLRDVDEVLKQ
                     VNLGLHVERCQQKGMQFQEALETPKMFKPRIKSLRLLNKPSIFPKENQMSPKDKYTVF
                     NRKSKDYRKSVHKVPKWTKLSLRRNPKFF"
     gene            <368497..>368820
                     /gene="TDEL0A02050"
                     /locus_tag="TDEL_0A02050"
                     /db_xref="GeneID:11502651"
     mRNA            <368497..>368820
                     /gene="TDEL0A02050"
                     /locus_tag="TDEL_0A02050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678700.1"
                     /db_xref="GeneID:11502651"
     CDS             368497..368820
                     /gene="TDEL0A02050"
                     /locus_tag="TDEL_0A02050"
                     /inference="similar to DNA sequence:INSDC:YKL137W"
                     /note="similar to Saccharomyces cerevisiae YKL137W;
                     ancestral locus Anc_2.429"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678748.1"
                     /db_xref="GeneID:11502651"
                     /db_xref="InterPro:IPR013892"
                     /db_xref="UniProtKB/TrEMBL:G8ZLP3"
                     /translation="MSEESNVKKRSSRLPIWVLAPREEKEARQNLKKFAYKKCDDYVQ
                     AMATCAKNHGIKLFPACDAQRDKMVECLLFYQVDTKYLDEQRDLIVQRKIAALEEQVR
                     KSKEK"
     gene            complement(<368929..>371046)
                     /gene="TDEL0A02060"
                     /locus_tag="TDEL_0A02060"
                     /db_xref="GeneID:11503073"
     mRNA            complement(<368929..>371046)
                     /gene="TDEL0A02060"
                     /locus_tag="TDEL_0A02060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678701.1"
                     /db_xref="GeneID:11503073"
     CDS             complement(368929..371046)
                     /gene="TDEL0A02060"
                     /locus_tag="TDEL_0A02060"
                     /inference="similar to DNA sequence:INSDC:YKL135C"
                     /note="similar to Saccharomyces cerevisiae APL2 (YKL135C);
                     ancestral locus Anc_2.430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678749.1"
                     /db_xref="GeneID:11503073"
                     /db_xref="GOA:G8ZLP4"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016342"
                     /db_xref="InterPro:IPR026739"
                     /db_xref="UniProtKB/TrEMBL:G8ZLP4"
                     /translation="MPPLDKRIKKFIKNSLRVAPRVSNKGELAELRAALVSQYPQTRK
                     DAIKKTIQQMTLSKDVSSLFPDVLKNIATNDVEQKKLVYLYVMNYAETHPELCILAVN
                     TFVTDAQDPNPLIRCMSIRTMSMIRVDKILEYVETPLRRTLQDDNAYVRKTAVICVAK
                     LFQLNKELCIELGVLEDLVSALDDANPMVVANATAALTEINAMDSSVVNLAELINSHV
                     SQFLLALNECTEWARITILGALAEYNARDSLEAQDIIDRVSAHLQHVNPAVVLATIQV
                     VIKNYSRTEQQNPKAFMNRLSSALVSIMSTPPEMQYVALRNIRIILEKYPEVLTKELR
                     IFYVKFNDPLYIKIEKIDILVRLIDSTNFKQCNMLLVELKEYAMEFEPEFVSRAIQGL
                     AQLGIKYSEEKFVAKTLDVLLELLEGHENLKDDCCVAVCDLLRHSVGNDTMANNVCSV
                     LNSWSSVESTLTSDAAKCNYIWLMGQYPDKFTSLESKLEAFVQEFPQEEPLTQTSILM
                     TVVRLHSKLSGNILQNVLELATNSIHELDVRDMAILYWRCLSVSDSEKLIEELCSSVS
                     PRIENTLDQFSADVLEKLLTELSTISSILFKPKSDRNTSYVQRQYVVRGKQMDELKDI
                     AKTEIAKTMNDDVLLDFDDDDDESNPQISGNNNALDDLDELFDFGSVPSNSANVDQGM
                     KNLNIQTQPAKKTSNTQDLLDLF"
     gene            <372046..>373220
                     /gene="TDEL0A02070"
                     /locus_tag="TDEL_0A02070"
                     /db_xref="GeneID:11503263"
     mRNA            join(<372046..372582,372798..>373220)
                     /gene="TDEL0A02070"
                     /locus_tag="TDEL_0A02070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678702.1"
                     /db_xref="GeneID:11503263"
     CDS             join(372046..372582,372798..373220)
                     /gene="TDEL0A02070"
                     /locus_tag="TDEL_0A02070"
                     /inference="similar to DNA sequence:INSDC:YMR116C"
                     /note="similar to Saccharomyces cerevisiae ASC1 (YMR116C);
                     ancestral locus Anc_2.431"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678750.1"
                     /db_xref="GeneID:11503263"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8ZLP5"
                     /translation="MSNAEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLIS
                     WKLTGDDQQYGVPVRSFKGHSHIVQDCALTADGAYALSASWDKTLRLWDVATGETYQR
                     FVGHKSDVMSVAIDRKASMIISGSRDKTVKVWTIKGQCLATMLGHNDWVSQVRIVPTE
                     DVNDDTVTVISAGMDKMVKAWNVNQFQIEADFIGHNNYVNTVTASPDGSLIASAGKDG
                     EIMLWNLADKSAMYTLSAQDEVFALAFSPNRYWLSAATASGIKIFCLDPKSLVDELKP
                     EFAGYTKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN"
     gene            complement(<373425..>375788)
                     /gene="TDEL0A02080"
                     /locus_tag="TDEL_0A02080"
                     /db_xref="GeneID:11503265"
     mRNA            complement(<373425..>375788)
                     /gene="TDEL0A02080"
                     /locus_tag="TDEL_0A02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678703.1"
                     /db_xref="GeneID:11503265"
     CDS             complement(373425..375788)
                     /gene="TDEL0A02080"
                     /locus_tag="TDEL_0A02080"
                     /inference="similar to DNA sequence:INSDC:YKL134C"
                     /note="similar to Saccharomyces cerevisiae OCT1 (YKL134C);
                     ancestral locus Anc_2.432"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678751.1"
                     /db_xref="GeneID:11503265"
                     /db_xref="GOA:G8ZLP6"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="InterPro:IPR024077"
                     /db_xref="InterPro:IPR024079"
                     /db_xref="UniProtKB/TrEMBL:G8ZLP6"
                     /translation="MLKSVSLQRNSVAKASQIAWRCLKQFKAGTAELSTQAFQKENVS
                     GSLERTFDDVDYWHEVNKRNYVLGKGVGRGIKGFGFNIPSKTETGLFENPYLTSPEGL
                     RKFSRRSLTHAQGLLDDMRNNKSFEGLTAYVMRLDQLSDTLCRVIDLCEFIRSSHPDS
                     SFIEAAQACHEEMFEFMNILNTDVELCDTLRQVLTDPEIKGKLSNEEITVGKILLEDF
                     EKSGIYMNPEVRDQFIALSQEISLVGQEFINNTDYVRSNYIKIKCEEVDNSGINKLLI
                     SQLPKDVRGKYYKIPTHGYIAYSILRSCPDEEIRMNLWTAMHRCSDKQINRLDQLLRL
                     RAILAKLMGKESFAQYQLEGKMAQTPQQVRDFIGTLVNYMRPKTIEELKFIYELKSKQ
                     EKREIQPSPSEQDIASMVRPWDREYYTSMYSLQQRRDAIDDEQISSYFTLGNVIQGLS
                     DLFESIYGIRLEPVVPKTGETFSPEVRRLNVVCEQEGVIGVVYCDLFERAGKTSNPSH
                     FTVCCSRQIYPKETEFSTIQTGFNSEGLMFQLPVIALVCNFSSSTDSEGKSICLLQLN
                     EVETLFHEMGHAMHSMLGRTRLQNISGTRCATDFVELPSILMEHFARDVRVLERIGKH
                     HRTGAPISEKLLLNYLEETKFMQHCETFSQAKMAMLDQDLHGEKVIKDFDHFDVTAAY
                     QQLERDMKVLVDDKSNWCGKFGHLFGYGATYYSYLFDRAIASKVWDSLFSSDPYSRVN
                     GEKFKECVLKWGGSRNPWRCIADVLNKPELSEGGTEAMRYIGQSEDL"
     gene            complement(<376093..>377529)
                     /gene="TDEL0A02090"
                     /locus_tag="TDEL_0A02090"
                     /db_xref="GeneID:11502543"
     mRNA            complement(<376093..>377529)
                     /gene="TDEL0A02090"
                     /locus_tag="TDEL_0A02090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678704.1"
                     /db_xref="GeneID:11502543"
     CDS             complement(376093..377529)
                     /gene="TDEL0A02090"
                     /locus_tag="TDEL_0A02090"
                     /inference="similar to DNA sequence:INSDC:YKL133C,YMR115W"
                     /note="similar to Saccharomyces cerevisiae YKL133C and
                     YMR115W; ancestral locus Anc_2.433"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678752.1"
                     /db_xref="GeneID:11502543"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G8ZLP7"
                     /translation="MLRVFPKFSIVNRPLFGLTRQSLKSFHCSSLIRNAANAYQQQQS
                     KQQKNDKIQRIVLSLTGLSALSYGIWYYYWPHHTFPRPVAQVLRKGLWAESDKEQFDY
                     QKALRFYIEALDECKKLKVDTISDEYTGIELKVAEMYEKLNMFEEATGVYLEILYRYF
                     DALHTPDKVPEDKRPDMIRRDLRILIKSLETNKDVSVGKRNLLAHLLMAQEEVLSRSP
                     ELKEFFERRKQKAKNLFQGKALEASDFKTFVNEETIKLDDEGYMILDLQKNSSAWEPF
                     KEEFFTARDLYTAFCLSSKDIAAALSCKMTTVEWMVMADMPPGQILLSQANLGSLLYL
                     QGEKFEAEIYQLEKKREEDPSLQNAETLIKSLRHLHRNRDTCLEMATQCYDSVIQFAK
                     KNSKLRFNMKDQLDPSVPQAIALSTYGMGVLNLHQGLLAKSEKLLKDSISMAREIDFQ
                     ELLKEARSELDKAESLRLEKKDKQETKA"
     gene            <377755..>379119
                     /gene="TDEL0A02100"
                     /locus_tag="TDEL_0A02100"
                     /db_xref="GeneID:11502741"
     mRNA            <377755..>379119
                     /gene="TDEL0A02100"
                     /locus_tag="TDEL_0A02100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678705.1"
                     /db_xref="GeneID:11502741"
     CDS             377755..379119
                     /gene="TDEL0A02100"
                     /locus_tag="TDEL_0A02100"
                     /inference="similar to DNA sequence:INSDC:YMR114C"
                     /note="similar to Saccharomyces cerevisiae YMR114C;
                     ancestral locus Anc_2.434"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678753.1"
                     /db_xref="GeneID:11502741"
                     /db_xref="InterPro:IPR003738"
                     /db_xref="UniProtKB/TrEMBL:G8ZLP8"
                     /translation="MCGRYAIAYNSEELPSHFKGFDLEVHPKINKGDHFDRSFNVAPT
                     TSGAVLRAKDRELRYMKWGLVPNWTKNAEDFNTYKTFNARLENLQESKMWMACCNRKR
                     CVIPVSGYYEWKTKGKEKIPYYVVRKDGKLCFLAGLYDYLESEDLWTYTIITGKAPKE
                     LSWLHHRMPVILEPGTDAWDTWMDPDKTKWTQEELDDLLAAHYDDEVLAVYQVGTDVN
                     KVANNNQSLVKPILKQDQGKFNVELSATEKRHMKQEAAKEEGNSQSGQTKKRKTKTED
                     VKEEEQSVAHRTKRTKKDVDQEEEPSEKDDEAVEEEVMKEEEGSDVGDEPYDEENDAE
                     VDQDVMEDEVGEEVDEEYIKGDENDVEGSMDEMEDDAVMEEPMVKGAKQTGQKKGGQS
                     IGERVRKEVGGSSAVKDEEQSDPTPKRRGKGRSTSGKGSDEGDVVNMMSSGKKASKKR
                     KQHN"
     gene            complement(<379168..>380442)
                     /gene="TDEL0A02110"
                     /locus_tag="TDEL_0A02110"
                     /db_xref="GeneID:11502838"
     mRNA            complement(<379168..>380442)
                     /gene="TDEL0A02110"
                     /locus_tag="TDEL_0A02110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678706.1"
                     /db_xref="GeneID:11502838"
     CDS             complement(379168..380442)
                     /gene="TDEL0A02110"
                     /locus_tag="TDEL_0A02110"
                     /inference="similar to DNA sequence:INSDC:YKL132C,YMR113W"
                     /note="similar to Saccharomyces cerevisiae RMA1 (YKL132C)
                     and FOL3 (YMR113W); ancestral locus Anc_2.435"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678754.1"
                     /db_xref="GeneID:11502838"
                     /db_xref="GOA:G8ZLP9"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="InterPro:IPR018109"
                     /db_xref="UniProtKB/TrEMBL:G8ZLP9"
                     /translation="MSISLGLSRVTKLLGLLGNPQERLQVLHVAGTNGKGSVCSYLSS
                     LLQNRSNHVGKFTTPHLVQITDSITINNDSIPWDTYHRIRGDLDLLNTKHRLDCTEFE
                     LLTCTALKYFHDVKCEWCVLEVGLGGRLDATNVIPGHQKAACGITKISLDHEAFLGNT
                     LSQIAFEKAGIITKGVKFAVIDGSNDQSILQVVKQRCDEIGCKLEVTNPDLKDLAMET
                     KTWGRIVLDKFPLNGGYQICNLRVALGILDTLQERALVNLSTDAIVARLRNVSWPGRL
                     QKLDYCSDSVTKTRIPILLDGAHNGSAAIELSKFLRSEYGEQPLTFVIAITSGKKLEP
                     LLAPLLRSQDRVLVTAYAPVDGMPWVHAMDVQELASEIGKDYTKNVEAQQSLHNIFSS
                     LAHDEQATPIVICGSLYLCGELLRMHKKNLGR"
     gene            <380542..>380928
                     /gene="TDEL0A02120"
                     /locus_tag="TDEL_0A02120"
                     /db_xref="GeneID:11502913"
     mRNA            <380542..>380928
                     /gene="TDEL0A02120"
                     /locus_tag="TDEL_0A02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678707.1"
                     /db_xref="GeneID:11502913"
     CDS             380542..380928
                     /gene="TDEL0A02120"
                     /locus_tag="TDEL_0A02120"
                     /inference="similar to DNA sequence:INSDC:YMR112C"
                     /note="similar to Saccharomyces cerevisiae MED11
                     (YMR112C); ancestral locus Anc_2.436"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678755.1"
                     /db_xref="GeneID:11502913"
                     /db_xref="GOA:G8ZLQ0"
                     /db_xref="InterPro:IPR019404"
                     /db_xref="UniProtKB/TrEMBL:G8ZLQ0"
                     /translation="MLNRQSKKYNKPETEMQPQYVQDRLESLAEVDNKLCSLLKTASQ
                     IVFTFSELKQGNHELKPQFEQHVKQFYTDLESSTVQLRQEIKLLDENVGTRLLPINVN
                     KKATGQDDDKMREQVAILKDILGENN"
     gene            complement(<381611..>382324)
                     /gene="TDEL0A02130"
                     /locus_tag="TDEL_0A02130"
                     /db_xref="GeneID:11502797"
     mRNA            complement(<381611..>382324)
                     /gene="TDEL0A02130"
                     /locus_tag="TDEL_0A02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678708.1"
                     /db_xref="GeneID:11502797"
     CDS             complement(381611..382324)
                     /gene="TDEL0A02130"
                     /locus_tag="TDEL_0A02130"
                     /inference="similar to DNA sequence:INSDC:YKL130C"
                     /note="similar to Saccharomyces cerevisiae SHE2 (YKL130C);
                     ancestral locus Anc_2.438"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678756.1"
                     /db_xref="GeneID:11502797"
                     /db_xref="GOA:G8ZLQ1"
                     /db_xref="InterPro:IPR024261"
                     /db_xref="UniProtKB/TrEMBL:G8ZLQ1"
                     /translation="MTVVEGISTNLAETSELFSSYISSYVHFLNKFIGHLRRVASLRY
                     ERTTLIKFVKKLRFLNESLTSYDVSSNMAKFNEKNFGVAVIPLASFYLKCIELFDMLD
                     FYLTKPLQNEIVSKTLNKDLCLSEECIIAIDDTHNHFVKFTQWMVESLENADPLLQIE
                     VVQFARKCAVADNVDIEETSDILLQEVEPVADAAEYEELSSKWASVLEAKLQALQVIF
                     DDEMAAWHDKFDKKKEKVN"
     gene            <382676..>384283
                     /gene="TDEL0A02140"
                     /locus_tag="TDEL_0A02140"
                     /db_xref="GeneID:11503371"
     mRNA            <382676..>384283
                     /gene="TDEL0A02140"
                     /locus_tag="TDEL_0A02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678709.1"
                     /db_xref="GeneID:11503371"
     CDS             382676..384283
                     /gene="TDEL0A02140"
                     /locus_tag="TDEL_0A02140"
                     /inference="similar to DNA sequence:INSDC:YMR110C"
                     /note="similar to Saccharomyces cerevisiae HFD1 (YMR110C);
                     ancestral locus Anc_2.439"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678757.1"
                     /db_xref="GeneID:11503371"
                     /db_xref="GOA:G8ZLQ2"
                     /db_xref="InterPro:IPR012394"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:G8ZLQ2"
                     /translation="MTEETGDKVDYTPLAEIDACIDLCNKYYYDKQLTLSQERSPRKS
                     DLKARSRQLKKLYYAIKDNTDELVQALYTDFHRSKQESITLEVAQLCNNILHMIESLP
                     KWMEPSKIKDRAPPFLFSNTAVERIARGSVLVIGPFNFPLMSSLSPAAAALAAGNTVV
                     VKPSELTPATASCIERIINEANFPNGLIQIVKGSKPESQRLVESGKFDMIFFTGSTAV
                     GSAIAQEAAKTVTPCVLELGGKSPVFITQNLATKNLRTALKRIFYSAFGNSGQICISP
                     DYVLVHESIYSLVVKEAKSVLAELFPEVNPATEYTHMVDQNAYNKVSEKLANTNGEKF
                     TVGKQISDEGELLIPPTLVFDIYWDDTLMKAENFGPVLPFVKYSDLDRTLDLVISNHD
                     TPLVQYIFSQKDAEIQHILYRLRSGDCIVGDTLLHVALTDAPFGGIGTSGYGNFGGIW
                     GFNTFTHQRIVMKQPYWQDSLLSMRYPPFSSWKTDSFKFFMEQKPWFDRDGNDRISLA
                     KWFGISLVVALAVMLPNFFNTSWTQCN"
     gene            complement(<384458..>388207)
                     /gene="TDEL0A02150"
                     /locus_tag="TDEL_0A02150"
                     /db_xref="GeneID:11503056"
     mRNA            complement(<384458..>388207)
                     /gene="TDEL0A02150"
                     /locus_tag="TDEL_0A02150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678710.1"
                     /db_xref="GeneID:11503056"
     CDS             complement(384458..388207)
                     /gene="TDEL0A02150"
                     /locus_tag="TDEL_0A02150"
                     /inference="similar to DNA sequence:INSDC:YKL129C,YMR109W"
                     /note="similar to Saccharomyces cerevisiae MYO3 (YKL129C)
                     and MYO5 (YMR109W); ancestral locus Anc_2.440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678758.1"
                     /db_xref="GeneID:11503056"
                     /db_xref="GOA:G8ZLQ3"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR010926"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLQ3"
                     /translation="MAIIKRGARSKATAAPAKRSAQIKKATYDSSKKNEVGVSDLTLL
                     TTISDQSINENLKKRFLNGSIYTYIGHVLISVNPFRDLGIYTDAILESYKGKNRLEVP
                     PHVFAIAESMYYNMKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASTNHSESIGKI
                     KDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGNITNYLLEKQRVV
                     SQIKNERNFHIFYQFTKGASENYRQTFGVQKPEQYIYTSASGCTSVDTVDDLKDYQAT
                     LKAMQVIGLSQEEQDQIFRLLAAILWIGNITFVEDEEGNAKIRDTSVTDFVAYLLQVE
                     SELLIKSLVERVLETNHGMRRGSVYHVPLNAVQATAVKDALAKGIYNNLFDWIVDRVN
                     ISLQAFPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQETYD
                     RERIQWTPIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSNAADQAFAQRLNLF
                     SSNPHFELRSSKFIIKHYAGDVTYDVNGITDKNKDQLQKDLVELIGTTTNTFLSTIFP
                     DAIDRESKKRPPTAGDKIIKSANELVETLSKAQPSYIRTIKPNQTKSPNDYDDAQVLH
                     QVKYLGLQENVRIRRAGFAYRQLFDKFVERFYLLSPRCSYAGDYTWQGDTLEAVKMIL
                     VDASIPEKEYQLGVTQVFIKTPETLFALEHMRDRYWYNMAARIQRAWRRFRQRRIDAA
                     VRIQRAIKEKKGGNKYEQLRDYGTKLLGGRKERRSMSLLGYRAFMGDYLSCNERKSKG
                     AFIAKQVGVTERVVFSIHGEALHSKFGRSAQRMRKTFILTSTYFYIIGQVMIQNTLSY
                     NPEYKINVKNISSVSLTNLQDDWVGINVLNATQPDPLINTYFKTELITQLKKLNNKLQ
                     IKIGPSIEYQKKPNKLHAVKCQISETAPKRGDLYKSSTIFVRRGHPANSHSHEKPRKG
                     AYSGSTSTSSNGAQRTAPSAASTRTRKPVPVPAQHRPAAPVSRTASKKPVPPPPAAKK
                     PAASNLAATAAQAAYHPNGVSRAAAPSQNATPASKPAVSQNTTPSVSRPQEENRGSQT
                     TTFPVQTKNIPPPPPPPPPMAKQPDPKFEAAYDFPGSGAPSELPLKKGDVVFITRQEP
                     SGWSLGKLLDGSKEGWVPTAYMTEYHEAHEAQPTPSTNSAFSTPVVHTQVATSTVVET
                     EQVPSQQASFSDGLASALAARANKMRVESDDEAASDADEDDDDDW"
     gene            complement(<389068..>391116)
                     /gene="TDEL0A02160"
                     /locus_tag="TDEL_0A02160"
                     /db_xref="GeneID:11502629"
     mRNA            complement(<389068..>391116)
                     /gene="TDEL0A02160"
                     /locus_tag="TDEL_0A02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678711.1"
                     /db_xref="GeneID:11502629"
     CDS             complement(389068..391116)
                     /gene="TDEL0A02160"
                     /locus_tag="TDEL_0A02160"
                     /inference="similar to DNA sequence:INSDC:YMR108W"
                     /note="similar to Saccharomyces cerevisiae ILV2 (YMR108W);
                     ancestral locus Anc_2.441"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678759.1"
                     /db_xref="GeneID:11502629"
                     /db_xref="GOA:G8ZLQ4"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012846"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G8ZLQ4"
                     /translation="MIRQATIKQFAAKRCFREIASRSAVYGTVRYYGSASRNYSATVA
                     SAVASGRPEPAPSFNVDPAAGKPSKLNQKLRTDPQMDSSFIGLTGGQIFHEMMIRHNV
                     DTVFGYPGGAILPVYDAIHDSKSFNFVLPRHEQGAGHMAEGYARASGKPGVVLVTSGP
                     GATNVVTPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVVGISRSCTKWNVMVRSI
                     EELPLRINEAFEIAVSGRPGPVLVDLPKDVTAAILKNPIPTKTTLPSNSLAQLTKRAM
                     DESTNENIVRTADLLNKAKTPVLYVGAGILNNPAGPKLLKELSERAQIPVTTTIQALG
                     AFDQQDPKSLDMLGMHGCATANMAIQNADLILAVGSRFDDRVTLNISKFAPEARRAAL
                     ENRGGIVHFEICPKNISKVVETQVAVEGDAASNIEKLLPLVVPVKERTEWFAQIEEWK
                     EKYPYAYQKETPGSKIKPQTVISKLSDLANKSDKEVIVTTGVGQHQMWAAQYWTWKSP
                     RSFITSGGLGTMGYGLPAAIGAQVAKPDALVIDIDGDASFNMTLMELSSAVQAKTPVK
                     ILLLNNEEQGMVTQWQSLFYEHRYSHTHQLNPDFLKLADAMGLKGLRLSKQEDVDATL
                     KEFIETEGPVLLEVKVEPKVPVLPMVPAGKGLDEFIVFDPKVEMEQNALRHKRTGGKH
                     "
     gene            complement(<391545..>392438)
                     /gene="TDEL0A02170"
                     /locus_tag="TDEL_0A02170"
                     /db_xref="GeneID:11503197"
     mRNA            complement(<391545..>392438)
                     /gene="TDEL0A02170"
                     /locus_tag="TDEL_0A02170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678712.1"
                     /db_xref="GeneID:11503197"
     CDS             complement(391545..392438)
                     /gene="TDEL0A02170"
                     /locus_tag="TDEL_0A02170"
                     /inference="similar to DNA sequence:INSDC:YKL128C"
                     /note="similar to Saccharomyces cerevisiae PMU1 (YKL128C);
                     ancestral locus Anc_2.442"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678760.1"
                     /db_xref="GeneID:11503197"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G8ZLQ5"
                     /translation="MPFAALPGFFRAFESQDSQGVDSSIVDHLELVSHDSWANLYEQI
                     PPDTDTEHYKLVVLARHGQGYHNAAILRYGMEAWDAHWSFLDGDEHGKWLDSKLTDLG
                     KGQVQETGLEVLSPIIEELQMLPHVFFSSPMRRCLETFIGSWGGIFAKNNHHLREQTI
                     PVRVVENIRETLGEHTCDKRVPHSESVKEYQNYKTHAGHTIDWLYDSNYPEQDQLWLE
                     DHRETISELDQRLHAGLSQIFSQLSSDQRFVSITCHSGVIGSALRNFKHPPVQNLNTG
                     KVVCAVVKIDVKKLQENGTSL"
     gene            complement(<392553..>392906)
                     /gene="TDEL0A02180"
                     /locus_tag="TDEL_0A02180"
                     /db_xref="GeneID:11502727"
     mRNA            complement(<392553..>392906)
                     /gene="TDEL0A02180"
                     /locus_tag="TDEL_0A02180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678713.1"
                     /db_xref="GeneID:11502727"
     CDS             complement(392553..392906)
                     /gene="TDEL0A02180"
                     /locus_tag="TDEL_0A02180"
                     /inference="similar to DNA sequence:INSDC:YMR107W"
                     /note="similar to Saccharomyces cerevisiae SPG4 (YMR107W);
                     ancestral locus Anc_2.443"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678761.1"
                     /db_xref="GeneID:11502727"
                     /db_xref="InterPro:IPR020485"
                     /db_xref="UniProtKB/TrEMBL:G8ZLQ6"
                     /translation="MGIWDAFQVYNRSKHSSNPDKSGASHSNMSEGNTTYLYSHEVSE
                     HSKKKKLTDDQLIAAGQDRKSSVSSDTSDDNNMMVMGSDGNPHMVDVSKLSQNEFKRL
                     YEGMRKGEPDNRVNF"
     gene            393856..393928
                     /gene="TDEL0Atrna5K"
                     /locus_tag="TDEL_0Atrna5K"
                     /db_xref="GeneID:11502733"
     tRNA            393856..393928
                     /gene="TDEL0Atrna5K"
                     /locus_tag="TDEL_0Atrna5K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:11502733"
     gene            <394031..>395911
                     /gene="TDEL0A02190"
                     /locus_tag="TDEL_0A02190"
                     /db_xref="GeneID:11502559"
     mRNA            <394031..>395911
                     /gene="TDEL0A02190"
                     /locus_tag="TDEL_0A02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678714.1"
                     /db_xref="GeneID:11502559"
     CDS             394031..395911
                     /gene="TDEL0A02190"
                     /locus_tag="TDEL_0A02190"
                     /inference="similar to DNA sequence:INSDC:YMR106C"
                     /note="similar to Saccharomyces cerevisiae YKU80
                     (YMR106C); ancestral locus Anc_2.444"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678762.1"
                     /db_xref="GeneID:11502559"
                     /db_xref="GOA:G8ZLQ7"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR005161"
                     /db_xref="InterPro:IPR006164"
                     /db_xref="InterPro:IPR016194"
                     /db_xref="InterPro:IPR024193"
                     /db_xref="UniProtKB/TrEMBL:G8ZLQ7"
                     /translation="MSAESNSFIVDVSPSMVHEGHLSKVLAYLEYTLLDKCKRRRKTD
                     WVTIYMANCAHTNNSQSIPNVCQVQQFLAPVTSSETIESLRILRNYSKNVEDNTLPKN
                     ENGEADLEQFQSMVQCLLVASLDIREEFKSRKILRQIIIFTADIDGLDLDEEEIEILK
                     EELNSRLILIDCRTKLKSDPNDEDFQKSKWGQLLKAIPGSMIFNIYDLLLETTLPKPN
                     MVKPVRVFSGELRLGADIGTLGRVDDEKSVSSPDDKNCLCIKVEGYPATKPVSSLNRK
                     LVLKDDTAQYEMVKTVIEYEVYDQKADKRVSVAPESIAKAYRYGSDYVVLPSTLDEQR
                     FYRTTPGIDIRGFLERKRLPRYFLNSESRFILADTRSGSVADIVSFNVLVDSLSEQDK
                     LIVARFVAKPNAEVQMCMMCPMLVNDEHGDKIRTLILNRLPFAEDERVASFPRLTVRT
                     TTSGKELKDEQEGEKSRIDTLMSDYIDSLDMDSSANDEKDNATSYYLPLGQNVKDTTL
                     PLPEDDDEKKRLQGSSPQRVPAIHLHRQKQVLLEWVHQKLISGSETFQIPEVPDVLRE
                     KISPHFNDMRDDKKLIELVKLLNIKENEKRSAATDEHFDEDEDEEANIPSLESILARG
                     ER"
     gene            <396941..>397567
                     /gene="TDEL0A02200"
                     /locus_tag="TDEL_0A02200"
                     /db_xref="GeneID:11502972"
     mRNA            <396941..>397567
                     /gene="TDEL0A02200"
                     /locus_tag="TDEL_0A02200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678715.1"
                     /db_xref="GeneID:11502972"
     CDS             396941..397567
                     /gene="TDEL0A02200"
                     /locus_tag="TDEL_0A02200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678763.1"
                     /db_xref="GeneID:11502972"
                     /db_xref="InterPro:IPR019435"
                     /db_xref="UniProtKB/TrEMBL:G8ZLQ8"
                     /translation="MQFHPIWTFISLTFSVAAAVRFDLTNVTCTDLHGVHCGTYALKV
                     ADVDGAFLGQKTFVGADVLATGAEDAWGRFLSQETRFLPRLTTVGTNETKNFSPFYFT
                     TNHETCNPQSIEDSMIPFVNTITNEIQFDAWAYTAMNVSVPTGLANQLFNATDYGVQV
                     AQCYNGIASELLDAPTVNIFDKDEVLPSYCSPIKLEAVCPIYVTPLFE"
     gene            <400375..>402093
                     /gene="TDEL0A02210"
                     /locus_tag="TDEL_0A02210"
                     /db_xref="GeneID:11502599"
     mRNA            <400375..>402093
                     /gene="TDEL0A02210"
                     /locus_tag="TDEL_0A02210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678716.1"
                     /db_xref="GeneID:11502599"
     CDS             400375..402093
                     /gene="TDEL0A02210"
                     /locus_tag="TDEL_0A02210"
                     /inference="similar to DNA sequence:INSDC:YKL127W,YMR105C"
                     /note="similar to Saccharomyces cerevisiae PGM1 (YKL127W)
                     and PGM2 (YMR105C); ancestral locus Anc_2.445"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678764.1"
                     /db_xref="GeneID:11502599"
                     /db_xref="GOA:G8ZLQ9"
                     /db_xref="InterPro:IPR005841"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="UniProtKB/TrEMBL:G8ZLQ9"
                     /translation="MSLSVETVATKPYGDQKPGTSGLRKKTKVFMEKPHYTENFIQSI
                     LDAIPEGSKDATLVVGGDGRYYNDKILQIIASISAANGVGKLVIGQHGLLSTPAASHI
                     IRTYQDKSGKKVTGGIILTASHNPGGPDNDIGIKYNLSNGGPAPESVTNAIWEISKKL
                     TSYKIIKNLPQLDLSTKGEKKLGNLEIDVVDVTQAYVEFLKEIFDFDLIKKFVDTQRS
                     TKHWKLLFDGLNGVTGPYGKAIFVDELGLPENEVLQNCHPKPDFGGIHPDPNLTYART
                     LVERVDKEKIEFGAASDGDGDRNMIYGYGPAFVSPGDSVAIIAEYAKEIPYFAKQGIY
                     GLARSFPTSSAIDRVAAEQGLNCYEVPTGWKFFCALFDAKKLSICGEESFGTGSNHVR
                     EKDGVWAIIAWLNILAIYNKHHPQKEASIKTIQDEFWLKYGRTFFTRYDFEHVTTEKA
                     NEIVKHLDSFVNSPNVVGSKFPSDNSVTVAEAGDFQYTDLDGSVSSNQGLYVKLSSGA
                     RFVLRLSGTGSSGATIRLYIEKYSDDKTKYGLTAEEYLRPIIDSVIDFLKFKEVLGTT
                     EPTVKT"
     gene            <402496..>404565
                     /gene="TDEL0A02220"
                     /locus_tag="TDEL_0A02220"
                     /db_xref="GeneID:11503211"
     mRNA            <402496..>404565
                     /gene="TDEL0A02220"
                     /locus_tag="TDEL_0A02220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678717.1"
                     /db_xref="GeneID:11503211"
     CDS             402496..404565
                     /gene="TDEL0A02220"
                     /locus_tag="TDEL_0A02220"
                     /inference="similar to DNA sequence:INSDC:YKL126W,YMR104C"
                     /note="similar to Saccharomyces cerevisiae YPK1 (YKL126W)
                     and YPK2 (YMR104C); ancestral locus Anc_2.446"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678765.1"
                     /db_xref="GeneID:11503211"
                     /db_xref="GOA:G8ZLR0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:G8ZLR0"
                     /translation="MERKKEKEKKDSGIGGKLFHFDHDSSGSNGDLHLSVNDADLGRP
                     SMDRKETIVPSSASIAPVRLSRDTSSTASTVREEFDAGIAEISSPRASHSKEPDTDFP
                     VPSVTDDTPAAPSPVHANNSTSTAGMMTIKVYNGEGFSLPFPITSNEQILGKLLSSGI
                     TASRTNLASEIDSLSSQLSRIQLGSQGPADENLLPGDQCTKFIPATIVLPGPETLNPL
                     LYFTIEYDNTVATIEPEYGTMVNPVFNKISTFDVTRKLPYLKIDVFARIPSILLPSKT
                     WQQEMGPHDEALQAMLDKINSNQDIHLDSFHLPVNLKIDSAANIRLFNHHWISLDNGW
                     GRINMSVDYKPAKNKALSIDDFDLLKVIGKGSFGKVMQVRKKDTQKVYALKALRKAYI
                     VSKSEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQKEGR
                     FDLSRSRFYTAELLCALETLHSLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDK
                     EKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI
                     LQEPLRFPDGFDRDAKDLLIGLLSRDPKRRLGYNGAHEIKRHPFFSQLSWKRLLMKGY
                     IPPYKPPVTSAIDTSNFDQEFTREKPIDSVVDEFLSESVQKQFGGWTYVGNEQLGSSM
                     VQGRSIR"
     gene            <404802..>406727
                     /gene="TDEL0A02230"
                     /locus_tag="TDEL_0A02230"
                     /db_xref="GeneID:11503382"
     mRNA            join(<404802..405008,405084..>406727)
                     /gene="TDEL0A02230"
                     /locus_tag="TDEL_0A02230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678718.1"
                     /db_xref="GeneID:11503382"
     CDS             join(404802..405008,405084..406727)
                     /gene="TDEL0A02230"
                     /locus_tag="TDEL_0A02230"
                     /inference="similar to DNA sequence:INSDC:YKL125W"
                     /note="similar to Saccharomyces cerevisiae RRN3 (YKL125W);
                     ancestral locus Anc_2.447"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678766.1"
                     /db_xref="GeneID:11503382"
                     /db_xref="InterPro:IPR007991"
                     /db_xref="UniProtKB/TrEMBL:G8ZLR1"
                     /translation="MMAFENTSKRPAQDMGLTSIEPKKRKVKFSDQVMMHSAESHGIT
                     NHDDSDVSIEMYKKFVRSALDELESKSCTQLSLIANQVALPKKSENQISITNLGVLLD
                     VLSDNINRIDTSRASPLIQAIINFEKWWELPSQTLGKYIFFIRVLCSSIPKWWQDVSM
                     VLISGFHLPLEKTVSHHDMLRYLLKMIPSSMGFIDIYMPKLFPNNNDSCKKLVNYISN
                     LLKFTGYCKELQFQAWSLIIERVISLDVELQNELDELDDDIDDDDLNDDEDDEDEDEE
                     QDDDQDKEIDGNETKYDSDASDDDEVMEGQEEYNVQSSQNIKELSTKLDAILTLITDC
                     LGDKVTPESLESGEGVSIFNTITTLFKTHVLPTYFTKSIQYIMFHISQQQIELMDSFL
                     VTLIDISFSPTETAETRIKSLQYLGSYIARAKKLSRTQIIFVASYLTSWLNRYVLERE
                     EEVDQPGGMDRFKHFYAAFQSLCYIFCFRYQLFRDGDGNWECELEKFFQRMVISKFNP
                     LKYCNENVMLMFARISQHEDVAYCFSIIENNNNQRLRGIIGRGDTDRKGAYSSAAMTW
                     SLATRQQFIDLQSYFPYDPLILERYKIMMKEYYIEWNEVSGEYESDEFEE"
     gene            <406941..>408608
                     /gene="TDEL0A02240"
                     /locus_tag="TDEL_0A02240"
                     /db_xref="GeneID:11503038"
     mRNA            <406941..>408608
                     /gene="TDEL0A02240"
                     /locus_tag="TDEL_0A02240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678719.1"
                     /db_xref="GeneID:11503038"
     CDS             406941..408608
                     /gene="TDEL0A02240"
                     /locus_tag="TDEL_0A02240"
                     /inference="similar to DNA sequence:INSDC:YKL124W"
                     /note="similar to Saccharomyces cerevisiae SSH4 (YKL124W);
                     ancestral locus Anc_2.448"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678767.1"
                     /db_xref="GeneID:11503038"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:G8ZLR2"
                     /translation="MGIISLSSEMGQEFLKSTVSGAIDDPYPVPPNVDDSETISLAFL
                     ISLSVTFALLMVVLVVIAVYVTFCGADEAEYDEEAGAGGGFHSLFNKKRDSILLDASF
                     TSAGQFDDEALLQEQESVELPKMSPFELDMYNRAKEFQKVNEPNVKEFGTFVNGSDLQ
                     FIKDRGIQSYSFLPSINDNTDEEGNFLPSFLIQDKLDVSFTKYNKSSSTIMNYPLPFN
                     KKDAVYFEVKIFRHSKTSNAVFSIGLMTFPYPYFRIPGMSLFSIGYESTGKLRINNPF
                     MASTLLPKLQEGDVVGFGYRYRTGTIFITHNGKKMMDVTQNVGIDLFIGIGSLNAAFT
                     RTYTKDGLLEDPDNVALRESLSEGREVELPPDLLSVHEITAENGLESDEVELHVNLGQ
                     VGFVFIEANVKKYGFGSVYGEIGIPPSYTGNEIKTDTILQRGEDIPPKYCDDRDTDDF
                     FGNISINRGRAVEGSSSNWRPMAQRALSVIPEAAESDLERYERLSSAYDRENNPSNTS
                     LENMDPNAQAHVTELELTDTRHNESSSSVGNSGDKRKKRKKKKRSKK"
     gene            complement(<408683..>409150)
                     /gene="TDEL0A02250"
                     /locus_tag="TDEL_0A02250"
                     /db_xref="GeneID:11503092"
     mRNA            complement(<408683..>409150)
                     /gene="TDEL0A02250"
                     /locus_tag="TDEL_0A02250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678720.1"
                     /db_xref="GeneID:11503092"
     CDS             complement(408683..409150)
                     /gene="TDEL0A02250"
                     /locus_tag="TDEL_0A02250"
                     /inference="similar to DNA sequence:INSDC:YKL122C"
                     /note="similar to Saccharomyces cerevisiae SRP21
                     (YKL122C); ancestral locus Anc_2.449"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678768.1"
                     /db_xref="GeneID:11503092"
                     /db_xref="UniProtKB/TrEMBL:G8ZLR3"
                     /translation="MSVKPIDTFITNSVQLFEANPSQTIFSISYKCKSKSTQKKPVVS
                     FKTHNSHLSNHYKFKTNKSKDVSRLLSALGPRGVSITRGKIEKRAMKPVTKKLGKKNK
                     KKAHVKDVVGLSTLMVNTDVKEYVPVVEETTKQTEATSSKKKKQNKNRGKKKR"
     gene            <409508..>412027
                     /gene="TDEL0A02260"
                     /locus_tag="TDEL_0A02260"
                     /db_xref="GeneID:11503034"
     mRNA            <409508..>412027
                     /gene="TDEL0A02260"
                     /locus_tag="TDEL_0A02260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678721.1"
                     /db_xref="GeneID:11503034"
     CDS             409508..412027
                     /gene="TDEL0A02260"
                     /locus_tag="TDEL_0A02260"
                     /inference="similar to DNA sequence:INSDC:YKL121W,YMR102C"
                     /note="similar to Saccharomyces cerevisiae YKL121W and
                     YMR102C; ancestral locus Anc_2.450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678769.1"
                     /db_xref="GeneID:11503034"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZLR4"
                     /translation="MFRNKHHHKEGSKSRESISKSEDDPFSSDEGDQTDIVDSTAIPV
                     AADNDNKSTSGSSSQASADFQPLTFNVKISQEEANARSAAQPIPETLLKVKEKLSKGP
                     GRNHDSTLRNFLGSIDRDQFESYLKEPHYIKVEKKGKHLRQFRRLFLAQQMKSYEDDD
                     DNNEKSSKGKSNSSRREPSSRAIWVTKFSLDGKYMATGSKDGSLCIWKVIGSPAERWE
                     LDFSQESQKAFKMKSLMVRQQLLGGSPKGSLSGDSKSNLTNEKPNSKVSTSSLYAPVF
                     HPNPIRRFNEHTSDILDMDWSKNNFLVTSSMDKSVRLWHPERSSSLTAFYHPDFVTCV
                     LFHPSDDRFIITGCLDHKCRLWSILDNEVTFEFDCQDLVTSITVSPGDGEYTIVGTFN
                     GYVIVLTTRGLEFVSSFHVTDKDTQVEDNQDLLGPGSKTHHGPRLTCLQCFKPTSYGS
                     LRLVVTSNDCRIRVFDLKTKKCLEILRGFESGVSQHRAQLTYWKNQPLVVCGSDDHWV
                     YSWKLQSSDSHEPSKETSKPHKTGEGLRRLISNSLHHNSETKNRHHNPGSLHLSDLLP
                     RPHGIASSQPIKNTRSISFHAHHAPVTTANLAPPETSKSLSMSNDLICDTSLEFYKET
                     DTLEVIGRKDDYSDADRESVSTDTEPLGSAIGSDYEARTTPGVVEAIGTIMVTTDTKG
                     LIRVFRADMPRNIRERVLERLRDVKHAKFNSSDSLNSYSQASVGSQGPIGRFNTASLI
                     CPVKSCNTQQADETPVGRLRGSSVFKNSLFNSSNGSLNSANTSRDTKRSASMGKNGPA
                     AGLRCEVCNGTKFTALSNSAASAREAGYYCADCGTMLNNFR"
     gene            <412289..>413257
                     /gene="TDEL0A02270"
                     /locus_tag="TDEL_0A02270"
                     /db_xref="GeneID:11503242"
     mRNA            <412289..>413257
                     /gene="TDEL0A02270"
                     /locus_tag="TDEL_0A02270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678722.1"
                     /db_xref="GeneID:11503242"
     CDS             412289..413257
                     /gene="TDEL0A02270"
                     /locus_tag="TDEL_0A02270"
                     /inference="similar to DNA sequence:INSDC:YKL120W"
                     /note="similar to Saccharomyces cerevisiae OAC1 (YKL120W);
                     ancestral locus Anc_2.451"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678770.1"
                     /db_xref="GeneID:11503242"
                     /db_xref="GOA:G8ZLR5"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8ZLR5"
                     /translation="MSEKANEGKVIEKSAAQKISKFGSFTAGGLAACIAVTVTNPIEL
                     VKIRMQLQGELSSSLQRTYKNPVQGMGVIFKNEGIRGLQKGLVAAYIYQICLNGSRLG
                     FYEPLRGVMNKTFYPEEEPHKVQNVTINVVSGAASGIIGAVLGSPLFLVKTRLQSYSD
                     VVKIGEQTHYTGVWNGLKTIFQKEGFMGLYRGVDAAILRTGAGSSVQLPIYNTAKHFL
                     LNHDIMKDGTGLHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPLDCFIKTVR
                     IEGVSALYKGFEAQVFRIAPHTIICLTMMEQTMKLVYSIERQVLGH"
     gene            <413475..>414512
                     /gene="TDEL0A02280"
                     /locus_tag="TDEL_0A02280"
                     /db_xref="GeneID:11502742"
     mRNA            <413475..>414512
                     /gene="TDEL0A02280"
                     /locus_tag="TDEL_0A02280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678723.1"
                     /db_xref="GeneID:11502742"
     CDS             413475..414512
                     /gene="TDEL0A02280"
                     /locus_tag="TDEL_0A02280"
                     /inference="similar to DNA sequence:INSDC:YMR101C"
                     /note="similar to Saccharomyces cerevisiae SRT1 (YMR101C);
                     ancestral locus Anc_2.452"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678771.1"
                     /db_xref="GeneID:11502742"
                     /db_xref="GOA:G8ZLR6"
                     /db_xref="InterPro:IPR001441"
                     /db_xref="InterPro:IPR018520"
                     /db_xref="UniProtKB/TrEMBL:G8ZLR6"
                     /translation="MRIPKGIRNRLTGPRAERSELTRVEACFKFIKDELMVILIWIAS
                     IKLFVILYRQLQNVLIGVVRVGPVPRHVSFIMDGNRRYAKGRGMSVKRGHEAGGLALL
                     NLCYACKNIGIKCVSAYAFSIENFNRPKEEVDNLYNMFAVKLDEFAQRANSFKDPLYG
                     ARIRIVGDHSLVSQEMRDKIKNVEKLTKDGADFTLYICFPYTSRNDIYHTVHDSIEKS
                     LKEKSDLGKFTVSAFTERMYLDDFSNKCDLLIRTSGHMRLSDYMLWQSHENSDIQFTS
                     TLWPDFGFIKFYLMLLRWSFFTSIQRYADAGFSIREKVISFIPFLANKKIALDSLPTA
                     PLAVSITGEHD"
     gene            complement(<414523..>415164)
                     /gene="TDEL0A02290"
                     /locus_tag="TDEL_0A02290"
                     /db_xref="GeneID:11503111"
     mRNA            complement(<414523..>415164)
                     /gene="TDEL0A02290"
                     /locus_tag="TDEL_0A02290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678724.1"
                     /db_xref="GeneID:11503111"
     CDS             complement(414523..415164)
                     /gene="TDEL0A02290"
                     /locus_tag="TDEL_0A02290"
                     /inference="similar to DNA sequence:INSDC:YKL119C"
                     /note="similar to Saccharomyces cerevisiae VPH2 (YKL119C);
                     ancestral locus Anc_2.453"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678772.1"
                     /db_xref="GeneID:11503111"
                     /db_xref="InterPro:IPR021013"
                     /db_xref="UniProtKB/TrEMBL:G8ZLR7"
                     /translation="MFEIELNDIIKSSLKSAKESESRKERCSEIESILDSGCISINAM
                     IEYYDEYWKSRISLKHLLSPLQFKFKTKHVPGSRYSPEFKRELEKLDLRQQESSYQEL
                     VKKSNLNGSAYGADTDSLTPSQMAKEIREQITTVFNVLVSVVSVVFAVWYWSGSSTWL
                     PLHYRVILCLFFGILILVAELVVYNSYLRKISDAKEKERAKIEKKKVVKEIVI"
     gene            complement(<415319..>417280)
                     /gene="TDEL0A02300"
                     /locus_tag="TDEL_0A02300"
                     /db_xref="GeneID:11503099"
     mRNA            complement(<415319..>417280)
                     /gene="TDEL0A02300"
                     /locus_tag="TDEL_0A02300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678725.1"
                     /db_xref="GeneID:11503099"
     CDS             complement(415319..417280)
                     /gene="TDEL0A02300"
                     /locus_tag="TDEL_0A02300"
                     /inference="similar to DNA sequence:INSDC:YMR100W"
                     /note="similar to Saccharomyces cerevisiae MUB1 (YMR100W);
                     ancestral locus Anc_2.454"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678773.1"
                     /db_xref="GeneID:11503099"
                     /db_xref="GOA:G8ZLR8"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="UniProtKB/TrEMBL:G8ZLR8"
                     /translation="MRDSNHKSILTNRPVVTITSTVYDRRALDINSDIPLINSLNHLT
                     YLTSNSGKVRETVAGDGALERLVAILHDCYIPLFVLVGFDLKHVSKHKRAQNIWKQKN
                     RAMCAWKWTLAFQCLVLTGTRGTEQIRKKVVLSGVIPVLATVLDNYLIYHKNYDHLRG
                     TAIEVSLKPLESEESYLLLRKDENETYEQYIAYLSGVTLSHGENFVSEEMLRPNTTIP
                     SDFADIWSTSTTEVEKEVNLETRVDEKDVGDREHIVDSFATDDDQTFNISIPREFFLG
                     KIVPKQDDVIWSLQLLAFISKYTYMKQQLQNVELVESLSFRSILSRVRKRVKSEFSSN
                     HSSNECSTISTADTTMEDAYPEEPKAKGDAFLVELQNLVESCKQTDLPTEDEGHIQNY
                     RHFNFSISQEHKQSRIVQERQLVENFKEKWDYSELATDLDDETWSFINSKERVDLFPL
                     VERCTVNHENPHDMVYWSSVIMRNSCRKNEVTGVRQCANFSCGKWEDYPRQFAKCRRC
                     KRTKYCSRDCQLNAWTYHRYWCHEVGSSMSTTANTTGANTPSATYSSHHPTGQAHGTT
                     VNFNTNANATEEVTGIGLGVTLPTTDTDLNVGTNNTAAATESANNTDRLSIVEGANVI
                     GRPQRIINEAIEQRNGMMLTDETGNDSLA"
     gene            418113..418185
                     /gene="TDEL0Atrna9A"
                     /locus_tag="TDEL_0Atrna9A"
                     /db_xref="GeneID:11503262"
     tRNA            418113..418185
                     /gene="TDEL0Atrna9A"
                     /locus_tag="TDEL_0Atrna9A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:11503262"
     gene            <418475..>419062
                     /gene="TDEL0A02310"
                     /locus_tag="TDEL_0A02310"
                     /db_xref="GeneID:11503153"
     mRNA            <418475..>419062
                     /gene="TDEL0A02310"
                     /locus_tag="TDEL_0A02310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678726.1"
                     /db_xref="GeneID:11503153"
     CDS             418475..419062
                     /gene="TDEL0A02310"
                     /locus_tag="TDEL_0A02310"
                     /inference="similar to DNA sequence:INSDC:YKL117W"
                     /note="similar to Saccharomyces cerevisiae SBA1 (YKL117W);
                     ancestral locus Anc_2.455"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678774.1"
                     /db_xref="GeneID:11503153"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:G8ZLR9"
                     /translation="MSASKTLTPEVLWAQRSSETDADENYLMITIGIPDCENPSVKIE
                     SDSLEFTAKSKGHVGDESSHQYHLHIDFFKEIIPDKTLHKIANGQHYFLKIFKKDLGL
                     EYWPRLTKEKVKYSYIKTDFNKWVDEDEQQDAPPPAGFDMNDMMMNGNPDMEALKQQL
                     AQGAGGMDLGAAGFPEELDDVGDEEEVLEEIEASK"
     gene            complement(<419106..>419999)
                     /gene="TDEL0A02320"
                     /locus_tag="TDEL_0A02320"
                     /db_xref="GeneID:11502602"
     mRNA            complement(<419106..>419999)
                     /gene="TDEL0A02320"
                     /locus_tag="TDEL_0A02320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678727.1"
                     /db_xref="GeneID:11502602"
     CDS             complement(419106..419999)
                     /gene="TDEL0A02320"
                     /locus_tag="TDEL_0A02320"
                     /inference="similar to DNA sequence:INSDC:YMR099C"
                     /note="similar to Saccharomyces cerevisiae YMR099C;
                     ancestral locus Anc_2.456"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678775.1"
                     /db_xref="GeneID:11502602"
                     /db_xref="GOA:G8ZLS0"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="InterPro:IPR025532"
                     /db_xref="UniProtKB/TrEMBL:G8ZLS0"
                     /translation="MSVTTDGSKVVLTHPDDKTSCVTILNYGATVTSWKLKGQEQLWL
                     SEAAKLDGSKPVRGGIPLVFPIFGKSKTDDALGKLPQHGLARNSTWEFLGQTKSNPPT
                     VQFALSPEIANQELTKLWPSDFSLVLTIELGLDFLKTAIEVNNPSKTEELKFNWLFHT
                     YLKIEDIEDTFVSNLVGMKLYDQLLQETYVDKHPVVTFHEEKDLVYKNIADERVIQVV
                     RRGEPVHTLKRHNLPDAVVWNPWINKSKSMADFEPKTGYEKMLCVEPGHVHDLITLAP
                     GESWDAYQLLYRDELKYQAIE"
     gene            complement(<420205..>421662)
                     /gene="TDEL0A02330"
                     /locus_tag="TDEL_0A02330"
                     /db_xref="GeneID:11502998"
     mRNA            complement(<420205..>421662)
                     /gene="TDEL0A02330"
                     /locus_tag="TDEL_0A02330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678728.1"
                     /db_xref="GeneID:11502998"
     CDS             complement(420205..421662)
                     /gene="TDEL0A02330"
                     /locus_tag="TDEL_0A02330"
                     /inference="similar to DNA sequence:INSDC:YKL116C"
                     /note="similar to Saccharomyces cerevisiae PRR1 (YKL116C);
                     ancestral locus Anc_2.457"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678776.1"
                     /db_xref="GeneID:11502998"
                     /db_xref="GOA:G8ZLS1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:G8ZLS1"
                     /translation="MSTQGQENNPPAPRIRQEEFINGSAVENDQNDVPQEEQVTPLSL
                     MIPSFESVAMLPTPMTYTPPASLPKSPKQMLVNPKRRGESNQAQRVDAGLQHRVISEL
                     FPLPDNAQQRVSSLPTVSETSSSNNFSLPAKSETVGPESADDESILTGYALDNLDVPL
                     RWRKVRQIGSGNFSNVFLYKSIDKVTNPELRQVSVKRVKYPEELTNKRSVNEQLAKEL
                     LSRLESSLTRELAILRSLDHPCIVKLFGVNNPIFIKSKKPLRDLMLHDDRLPLCDMIM
                     SYCSGGDLLMAATSCNGKLKLPLIQRLFAELVMAVQYLHDNNVIHRDIKLENVLLKFP
                     LEVIIDMSDSPVYMKHNFIELADFGLCKKIEPGELCTARCGSEDYVSPEILMGVPYDG
                     RLSDTWALGVILYGLLEDRLPFDPPPNASARQRNRATSHRIARYEWKWFRLHDKDLSA
                     KEIVEHTLTRKSERWTINQIRESAFIKTTADILPF"
     gene            complement(<421990..>423060)
                     /gene="TDEL0A02340"
                     /locus_tag="TDEL_0A02340"
                     /db_xref="GeneID:11503005"
     mRNA            complement(<421990..>423060)
                     /gene="TDEL0A02340"
                     /locus_tag="TDEL_0A02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678729.1"
                     /db_xref="GeneID:11503005"
     CDS             complement(421990..423060)
                     /gene="TDEL0A02340"
                     /locus_tag="TDEL_0A02340"
                     /inference="similar to DNA sequence:INSDC:YKL114C"
                     /note="similar to Saccharomyces cerevisiae APN1 (YKL114C);
                     ancestral locus Anc_2.458"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678777.1"
                     /db_xref="GeneID:11503005"
                     /db_xref="GOA:G8ZLS2"
                     /db_xref="InterPro:IPR001719"
                     /db_xref="InterPro:IPR013022"
                     /db_xref="InterPro:IPR018246"
                     /db_xref="UniProtKB/TrEMBL:G8ZLS2"
                     /translation="MSQFVRSTTSKYKFGAHISGAGGISNSVSNAFGIGCNSFAMFLK
                     SPRKWVSPQYTDEEIQKFKDNCKQYNYNPLTDVLPHGQYFINLANPDIEKAEKAYASL
                     IDDLNRCEQLGVGLYNLHPGSSLKADHQVQLKQLANYLNKALKETKFVKIVLENMAGT
                     GSLVGSDLQDLHEVIELIEDKSRIGVCIDTCHTYAAGYDISTKESFEKFWKMFDEIVG
                     FKYLSAIHLNDSKAPLGANRDLHELLGEGFLGLEVFRLIAHSDHLVNIPIILETPQPK
                     EEGYGEEIKLLEWLEDKSEDDKEVIEKNDKLQAKGAKSRKEHEEKFATKQKKATAKKR
                     KAEVKPEDDITHKVRRTRRKEE"
     gene            complement(<423170..>424312)
                     /gene="TDEL0A02350"
                     /locus_tag="TDEL_0A02350"
                     /db_xref="GeneID:11503048"
     mRNA            complement(<423170..>424312)
                     /gene="TDEL0A02350"
                     /locus_tag="TDEL_0A02350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678730.1"
                     /db_xref="GeneID:11503048"
     CDS             complement(423170..424312)
                     /gene="TDEL0A02350"
                     /locus_tag="TDEL_0A02350"
                     /inference="similar to DNA sequence:INSDC:YKL113C"
                     /note="similar to Saccharomyces cerevisiae RAD27
                     (YKL113C); ancestral locus Anc_2.459"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678778.1"
                     /db_xref="GeneID:11503048"
                     /db_xref="GOA:G8ZLS3"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR019974"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR023426"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:G8ZLS3"
                     /translation="MGIKGLNAIISEHVPTAVRKSDIKSFFGRKVAIDASMSLYQFLI
                     AVRQQDGAQLSTETGETTSHLMGIFYRTLRMIDNGIKPCYVFDGKPPVMKSHELGKRS
                     SRREETEKKLAEAIDQAEKMKQERRLVRVSKEHNDEAKQLLELMGVPYLTAPTEAEAQ
                     CAELAKKGKVYAAASEDMDTLCYRTPYLLRHLTFSEAKKEPIHEIDTETVLNGLGLTI
                     EQFVDLGIMLGCDYCESIRGVGPVTALKLIKEHGSLEKIIEFVESDESNSKWKIPEDW
                     PYKEARELFLNPDVIDGNEVNLKWSPPKEDELIDFLCNQKKFSEERVRSGIVRLKKGL
                     KSGVQVRLDGFFQVVPKTKEQLAAAAAKAKASKANGKGKGKVNKRR"
     gene            <425918..>427213
                     /gene="TDEL0A02360"
                     /locus_tag="TDEL_0A02360"
                     /db_xref="GeneID:11502884"
     mRNA            <425918..>427213
                     /gene="TDEL0A02360"
                     /locus_tag="TDEL_0A02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678731.1"
                     /db_xref="GeneID:11502884"
     CDS             425918..427213
                     /gene="TDEL0A02360"
                     /locus_tag="TDEL_0A02360"
                     /inference="similar to DNA sequence:INSDC:YKL112W"
                     /note="similar to Saccharomyces cerevisiae ABF1 (YKL112W);
                     ancestral locus Anc_2.460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678779.1"
                     /db_xref="GeneID:11502884"
                     /db_xref="GOA:G8ZLS4"
                     /db_xref="InterPro:IPR006774"
                     /db_xref="UniProtKB/TrEMBL:G8ZLS4"
                     /translation="MTSLYEYKHPVINKQLASGADDQSGRKFPTLSAWYNVVNDYEFQ
                     ARCPIILKNSHRNKHFTFACHLKNCPFKVLLSYCGNQRGIDGEESQIHQDLNHSLVNL
                     DKPKLEEGKEDDDVSAAIAAAVAAVQDVRHGEEYLGASTGTARSSNDSVRGPFVVTKI
                     EPYHNHPLESNLTLSMFVLTKVPRILQHDLNFDQILESLCNEDDNTVSKFRVSQYVEE
                     SGLLDILKERYGLTDAEIDKKLLSQISRRVTTYKARFVLKKKKNGDYGTPVNRGDSGS
                     AQSYTRHTRNAAIDSNSRHLALEDPNLNPELNDSEVQAAQAAAQAAIGEAVALKRSVQ
                     QMVDDEDDEGSRKRQMMKLSMGNNMVNDDGSLVALDDTPDDKLPRDVAEQLRLLSSHF
                     KDVEAHNLNNHNGDADEEGKIVVKDDIPDENIQPELRGQ"
     gene            <427312..>429003
                     /gene="TDEL0A02370"
                     /locus_tag="TDEL_0A02370"
                     /db_xref="GeneID:11503016"
     mRNA            <427312..>429003
                     /gene="TDEL0A02370"
                     /locus_tag="TDEL_0A02370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678732.1"
                     /db_xref="GeneID:11503016"
     CDS             427312..429003
                     /gene="TDEL0A02370"
                     /locus_tag="TDEL_0A02370"
                     /inference="similar to DNA sequence:INSDC:YMR098C"
                     /note="similar to Saccharomyces cerevisiae YMR098C;
                     ancestral locus Anc_2.461"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678780.1"
                     /db_xref="GeneID:11503016"
                     /db_xref="GOA:G8ZLS5"
                     /db_xref="InterPro:IPR025210"
                     /db_xref="InterPro:IPR025656"
                     /db_xref="UniProtKB/TrEMBL:G8ZLS5"
                     /translation="MLRLISRCVLRRRIVSTTCLRQYSKKEGVTPWYLTMVDREPKQS
                     IFQAQQVVLPQESPQSLATITDQLKERLGLSDIIVFDLRGSDFTTAVAKVSDFMIIGT
                     AKSAKHCQSCFVELNGFLKQEYNSVAYVEGNVNAREEKKRLRRIARKSNLGKSWGANS
                     SPYAQGFQNNSEAWFMIDCHVDNIFVNILTEDRRKELNLEELYAPENERHKYQHPKDA
                     AETEQNVEEGDDVLAGLRRLAYQRRQYSTISPTLESSKKLADLLSNEDFNATQAIAQS
                     KNDHSLHLLQTVVDSFANQTVPVADPKKIEQWKAVFDSFWPLVLPQATASLYWSSRLR
                     FLKMLNIANKTAYPVRRIITDYLLLKRSTGFPLVQDDFLQFLQLVIINLSVNPKANYW
                     DLVESNSDIEKALKLFDDLNDETLLKDELVVTMLLRTMVLNDEKRTHLHALYEVVDYL
                     MKTRDLTPTMMASILEILGGIKDWNKFFQFWELGARDLLPGQDYRPWAEFIKIIVNSN
                     DTALMNKIVNEGHLLWLKRNEVEMTRSIGSQLDKLFEKLDPQGIAFKTLKDYLCS"
     gene            complement(<429000..>429932)
                     /gene="TDEL0A02380"
                     /locus_tag="TDEL_0A02380"
                     /db_xref="GeneID:11502875"
     mRNA            complement(<429000..>429932)
                     /gene="TDEL0A02380"
                     /locus_tag="TDEL_0A02380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678733.1"
                     /db_xref="GeneID:11502875"
     CDS             complement(429000..429932)
                     /gene="TDEL0A02380"
                     /locus_tag="TDEL_0A02380"
                     /inference="similar to DNA sequence:INSDC:YKL110C"
                     /note="similar to Saccharomyces cerevisiae KTI12
                     (YKL110C); ancestral locus Anc_2.462"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678781.1"
                     /db_xref="GeneID:11502875"
                     /db_xref="InterPro:IPR013641"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLS6"
                     /translation="MPLILLSGYPSSGKTTVAKELVSLLNDKLQKDEVLAKKNYSVKY
                     HSDQTLGIEHSNYITSKDERKLRSEIISAVKRDLSRNNIVIVDSLNYIKGFRYQLHCE
                     VKNVSTTFCLIYTMCPLDTIRSWNQSEGHEPWDDELLTQLVQRYEEPNPKNRWDSPLF
                     ELLTTQDSIKDCFENICAAIFHTDVKNNRDPLAKALQRPNSATILKPASQSNFIQILD
                     SETTMVVKKIMDHIKIQQSIGGSSSSARIIVSENTDINDDNCCFIDLPSSGVTLPHLQ
                     RLKRQFVNLNKLRDMEKSRIVPLFTDYLNKNLND"
     gene            <430021..>431040
                     /gene="TDEL0A02390"
                     /locus_tag="TDEL_0A02390"
                     /db_xref="GeneID:11502883"
     mRNA            <430021..>431040
                     /gene="TDEL0A02390"
                     /locus_tag="TDEL_0A02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678734.1"
                     /db_xref="GeneID:11502883"
     CDS             430021..431040
                     /gene="TDEL0A02390"
                     /locus_tag="TDEL_0A02390"
                     /inference="similar to DNA sequence:INSDC:YMR097C"
                     /note="similar to Saccharomyces cerevisiae MTG1 (YMR097C);
                     ancestral locus Anc_2.463"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678782.1"
                     /db_xref="GeneID:11502883"
                     /db_xref="GOA:G8ZLS7"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLS7"
                     /translation="MNKFIPRYEFPNYNIPKTDFKGHQLKALKKYNSLRPQLNLILEL
                     RDIRAPLSTRNVLIDQLIDPRIHRRLVIYTKKDLVQHNDDYLERLTRWHQEIDEDFIL
                     INGKQRQTVKNVLKCIKWYKKQLESRNNGLPLPTGYKVLVTGMPNVGKSTLINSLKAS
                     RKKVARTGAEAGITRSTSECIRITDEDNIYLIDTPGIGLPGRLHGATHRMLTLSLCGC
                     VKSNLIDPVIQADYLLYLMNLQEGRFYPGAPTNDIYKLLNRIRISPTDKETSTAVKWL
                     AQQRSGLIYDPEMLLDNTTFSLRNYLDKQRDLLGDFQPATSPSSPYAKMLQNVNQLFP
                     KPNNS"
     gene            <431728..>433044
                     /gene="TDEL0A02400"
                     /locus_tag="TDEL_0A02400"
                     /db_xref="GeneID:11502702"
     mRNA            <431728..>433044
                     /gene="TDEL0A02400"
                     /locus_tag="TDEL_0A02400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678735.1"
                     /db_xref="GeneID:11502702"
     CDS             431728..433044
                     /gene="TDEL0A02400"
                     /locus_tag="TDEL_0A02400"
                     /inference="similar to DNA sequence:INSDC:YKL109W"
                     /note="similar to Saccharomyces cerevisiae HAP4 (YKL109W);
                     ancestral locus Anc_2.464"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678783.1"
                     /db_xref="GeneID:11502702"
                     /db_xref="GOA:G8ZLS8"
                     /db_xref="InterPro:IPR018287"
                     /db_xref="UniProtKB/TrEMBL:G8ZLS8"
                     /translation="MSSAKHLPIQPYPAAIAPSIGAMNHVGTGGARKSSTGLTIRTSR
                     HWVLPPRPKPGRKPNHYDSKRGSKSASPPPPKKIASPISAKKEANKLPIRNLSVPLKT
                     PAQLQQQQQQQQQQQQPVTVKKQTKTALKKEIQHIKVENSKLKQELGQLVGNLQALKK
                     QYTPPLETGTRKRHHLDDSTSAFLKFEDDEEECRMQESVAFPPLLVTNAKMNLTSSMS
                     SCKTIATDDEDILTMSSSTPNSLVSSDLQHSSSLSSASSLNLNHAQHPPLKQSSNDSQ
                     LKFLDDYEQMEFYDKYMRMDLNLPSQQVDDSYLVALDSIKEEETDFKFTQTNQDHLSF
                     LGNQSVTVDDQSDNLFFAVKEEPNDDAKLFQEFNDESQPTTTTTTTTNSTLTNFYMPP
                     SLEELMDEQDGGLKNFSNVTNNLANDEINDYRDDFDMLKVEVFDMI"
     gene            complement(<433152..>434036)
                     /gene="TDEL0A02410"
                     /locus_tag="TDEL_0A02410"
                     /db_xref="GeneID:11502944"
     mRNA            complement(<433152..>434036)
                     /gene="TDEL0A02410"
                     /locus_tag="TDEL_0A02410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678736.1"
                     /db_xref="GeneID:11502944"
     CDS             complement(433152..434036)
                     /gene="TDEL0A02410"
                     /locus_tag="TDEL_0A02410"
                     /inference="similar to DNA sequence:INSDC:YMR096W"
                     /note="similar to Saccharomyces cerevisiae SNZ1 (YMR096W);
                     ancestral locus Anc_2.465"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678784.1"
                     /db_xref="GeneID:11502944"
                     /db_xref="GOA:G8ZLS9"
                     /db_xref="InterPro:IPR001852"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G8ZLS9"
                     /translation="MSEFKIKSGLAQMLKGGVIMDVVTPEQAIIAEKAGACAVMALER
                     IPADMRKSGQVCRMSDPKMIKEIMAAVSIPVMAKVRIGHFVEAQILEALEVDYIDESE
                     VLTPADWTNHIKKHDFKVPYVCGAKDLGEALRRINEGAAMIRTKGEAGTGDVSEAVQH
                     INKIRGEIALYKETLKTDEELAEKAKELRVPKELLKEVLDLGKLPVVNFAAGGVATPA
                     DAALLMQLGCEGVFVGSGIFKSSNPERLARAIVEATTHYQDPKKLLEVSSDLGEMMGG
                     VAVESIKQTDKRLAEIGW"
     gene            <434531..>435160
                     /gene="TDEL0A02420"
                     /locus_tag="TDEL_0A02420"
                     /db_xref="GeneID:11503072"
     mRNA            <434531..>435160
                     /gene="TDEL0A02420"
                     /locus_tag="TDEL_0A02420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678737.1"
                     /db_xref="GeneID:11503072"
     CDS             434531..435160
                     /gene="TDEL0A02420"
                     /locus_tag="TDEL_0A02420"
                     /inference="similar to DNA sequence:INSDC:YMR095C"
                     /note="similar to Saccharomyces cerevisiae SNO1 (YMR095C);
                     ancestral locus Anc_2.466"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678785.1"
                     /db_xref="GeneID:11503072"
                     /db_xref="GOA:G8ZLT0"
                     /db_xref="InterPro:IPR002161"
                     /db_xref="InterPro:IPR021196"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:G8ZLT0"
                     /translation="MVKCVGVLALQGAFLEHVQHLERCVLEKEYDLKVITVKTPEELS
                     RCDALIIPGGESTAMSLIAQRTGMFPHLRKFVHDPTKATWGTCAGLIYISKELANEKE
                     LVQPLELLQVRVRRNAFGRQAQSFIQSCNFSQFIPGCHDFPAVFIRAPVIEKILDEEA
                     VKPLFTLDDGFIVAAAQGNNILATSFHPELAENDSRFHDWFLQQFVLKQ"
     gene            complement(<435150..>436439)
                     /gene="TDEL0A02430"
                     /locus_tag="TDEL_0A02430"
                     /db_xref="GeneID:11503068"
     mRNA            complement(<435150..>436439)
                     /gene="TDEL0A02430"
                     /locus_tag="TDEL_0A02430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678738.1"
                     /db_xref="GeneID:11503068"
     CDS             complement(435150..436439)
                     /gene="TDEL0A02430"
                     /locus_tag="TDEL_0A02430"
                     /inference="similar to DNA sequence:INSDC:YMR094W"
                     /note="similar to Saccharomyces cerevisiae CTF13
                     (YMR094W); ancestral locus Anc_2.467"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678786.1"
                     /db_xref="GeneID:11503068"
                     /db_xref="UniProtKB/TrEMBL:G8ZLT1"
                     /translation="MDVSLFFGLPIDIRRQVYYHLDGNFCKIAPAPVQHLYVDEVIQL
                     SPKTEARSKRQELLFKRYYELFSPYLNIFDYSPSLFDQWLEYSLWLRYDAIVLDCMRI
                     NHSYGGSLIGHLDWIYLDDRPRLAYFKNCMLMVWYTLREYARWIIKEEIDDEEADNLN
                     LFGLNLEYLNLDMVKKILNSMKFNDYVMLLSEVFFDQEDEDESDLGEDKMDIDEMSYP
                     MNDLKGIEVIKDLDTMKNLAKISVRGAPLFEALINFHGVRDNPGKTISYMVKKRIMQL
                     ELWQISDPSKTGLADFTRWENLRDLRLIKVRSVDLNKFVLPKLCQILILKQVTVMRWW
                     DVESKINELIEGKTTITKLNDFTNERRLDQKTMDPSEIMQCRSIVWQSLKNLNFLKLQ
                     NVSEIYGGKIVVPNALYNNSRIQIFPSTSMVNEIIIV"
     gene            <436566..>437648
                     /gene="TDEL0A02440"
                     /locus_tag="TDEL_0A02440"
                     /db_xref="GeneID:11503059"
     mRNA            <436566..>437648
                     /gene="TDEL0A02440"
                     /locus_tag="TDEL_0A02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678739.1"
                     /db_xref="GeneID:11503059"
     CDS             436566..437648
                     /gene="TDEL0A02440"
                     /locus_tag="TDEL_0A02440"
                     /inference="similar to DNA sequence:INSDC:YKL108W"
                     /note="similar to Saccharomyces cerevisiae SLD2 (YKL108W);
                     ancestral locus Anc_2.468"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678787.1"
                     /db_xref="GeneID:11503059"
                     /db_xref="InterPro:IPR021110"
                     /db_xref="UniProtKB/TrEMBL:G8ZLT2"
                     /translation="MLRDQLKVELKRWEHQFIDQNGRAPGKEDIKKLPEVRKMYKNYA
                     ILRKEIAIKPKPVEENSSPIKSATQSSMSANLELGPTPQIHGKAMSIFEMTISPTKTP
                     QVEQPEEVEQSSPTSTIPEDETEHTVLMETSAVRRQLTFDSTAGFLSPTKDSNNHYYG
                     PNSPLKWDREDLKITIRHQSPLKRTPNKRLSATTSFSPSPLVKRPLTRSLMELMKEHE
                     AIVEEFKNNDDAFVVSQEPDNIFTQDDDPIEAGDTKTVKTKRRRILRRQVDPAKDNSV
                     KKDISQELEKLKRQRVNEFLGIDKAEPEPEPSIEDEKQETEEAKAPKKSTKKRNKKYN
                     LVSNNFRRLKLPRKSAANRRWNNRRR"
     gene            complement(<437732..>439264)
                     /gene="TDEL0A02450"
                     /locus_tag="TDEL_0A02450"
                     /db_xref="GeneID:11503137"
     mRNA            complement(<437732..>439264)
                     /gene="TDEL0A02450"
                     /locus_tag="TDEL_0A02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678740.1"
                     /db_xref="GeneID:11503137"
     CDS             complement(437732..439264)
                     /gene="TDEL0A02450"
                     /locus_tag="TDEL_0A02450"
                     /inference="similar to DNA sequence:INSDC:YMR093W"
                     /note="similar to Saccharomyces cerevisiae UTP15
                     (YMR093W); ancestral locus Anc_2.469"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678788.1"
                     /db_xref="GeneID:11503137"
                     /db_xref="GOA:G8ZLT3"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR018983"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8ZLT3"
                     /translation="MSSSRQRIVTSKAPLLPQQTTPEQRYWRQYSSAQLVKEHNSVTH
                     ISFNPQHPHDFAVTSSTRVQLFSSSTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDAT
                     GLVSVYDSYNPRTLLLSINASSHPTHVTKFHTQDSKTLVTASDDRITRVWDISHAYEP
                     QLKLSGASDYVRTACFVPSAPHLVMTGSYDGFLRLYDTRASGATPVYSLNHDQPVENV
                     TSISPTQVVSCGGSNFKVWDLTSNKKLHERGNFNKTVTCLDYVENFDCPSESALIASS
                     LDGHVKVFDPLDNYKVKFGWKFSGAVLSCALSPGGAQGNRHLIAGLSSGLLAIRTKTK
                     EKKTAKAEPSMPISKKSNNFERMMRGSEYQGDQEHIIHNDKMKQQRRVRAFERNINQF
                     KWSEALDSAFVPGMAKELTLTALQELGKRGKIRVALYGKDESSLEPLLNWCLKGLEDV
                     RAAPVIADWIVVVIELYGDLLENSPVLQEMVLDLRNKVRQEVYKAKEAQKIEGMLQLL
                     TS"
     gene            <439489..>441321
                     /gene="TDEL0A02460"
                     /locus_tag="TDEL_0A02460"
                     /db_xref="GeneID:11502917"
     mRNA            <439489..>441321
                     /gene="TDEL0A02460"
                     /locus_tag="TDEL_0A02460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678741.1"
                     /db_xref="GeneID:11502917"
     CDS             439489..441321
                     /gene="TDEL0A02460"
                     /locus_tag="TDEL_0A02460"
                     /inference="similar to DNA sequence:INSDC:YMR092C"
                     /note="similar to Saccharomyces cerevisiae AIP1 (YMR092C);
                     ancestral locus Anc_2.470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678789.1"
                     /db_xref="GeneID:11502917"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZLT4"
                     /translation="MSLIELRSIQPPQPATLRNFTTHLSYDENTNSIAYPCGKSAYVR
                     YLDDSGIVVQFTGHGTANVTVVKFSPIKGSQYVCSGDESGKVIVWGWTYDTDTHAVET
                     IVKSEFQVLAGPITDVSWDFEGRRLCVVGEGRDKFGAFISWDSGNSLGEISGHSQRIN
                     ACHMKQSRPMRCITVGDDGSVVFYQGPPFKFSASDRTHHDQGKFVRDVQFSPGSGGYA
                     VTVGYDRKIVCFDGKTGEFIKYIEDESEKVEGGIFAVSWVDETRFVTASADATIRLWC
                     AKENKFLQKWVVSGDSVGSQQVGVVSSKNEQIISLSLDGSLNFFKIGENDIIKSMKGH
                     NKGITALAVRPLITGSYDGRIMEWDNIPETMHQDHSNLVVAIDNSEAPKYASISWDDT
                     LKVSDITKYQFEGQPKVASSANNGGTVAVVTDNDYLLIMNSYTGEVLQKKALSEPASA
                     VGITSGLVAVGLERTNAVEVFKASDLEVSYKLPIPLRATPSCISVSPSEGYLAAGDVM
                     GKILLYDLSTKDVKTSRWAFHTSRITAIAWRPSTEDDDEEDLVATASLDTNVFVYSVK
                     RPMRTIKRLNAHKDGVSVVRWEDASTLVSCGSDACIKRWNVIIE"
     gene            <442063..>443451
                     /gene="TDEL0A02470"
                     /locus_tag="TDEL_0A02470"
                     /db_xref="GeneID:11503047"
     mRNA            <442063..>443451
                     /gene="TDEL0A02470"
                     /locus_tag="TDEL_0A02470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678742.1"
                     /db_xref="GeneID:11503047"
     CDS             442063..443451
                     /gene="TDEL0A02470"
                     /locus_tag="TDEL_0A02470"
                     /inference="similar to DNA sequence:INSDC:YMR091C"
                     /note="similar to Saccharomyces cerevisiae NPL6 (YMR091C);
                     ancestral locus Anc_2.471"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678790.1"
                     /db_xref="GeneID:11503047"
                     /db_xref="InterPro:IPR013933"
                     /db_xref="UniProtKB/TrEMBL:G8ZLT5"
                     /translation="MSEGLEGSPELDARESGHSRSGSERPNYQIDTEGLDLKEEEDDG
                     DEYHEEDELEEEEEEEEEGNQRETVTRGTNEIPKIARRGRPSKRKNREMSQDDNRSET
                     DESRSGSTVPGFMNLKRPRLSYPVDESGAPLPIVNEEYDLPDDPEGETKITKDGDLLG
                     GRQFLVRSFTVSDKGKRKFMLSTEPARAVGFRDSYLFFQYHPNLYKFILSQEQKNDLI
                     DRGVLPYSYRSRQIALVTARSVFKEFGAKIIIGGKNITDDYYSTKLRQEGRVIEGSYA
                     REPLKKNGTRAYEGIEYSVQSVNPAKNAVEFFDRRNPNYINGATATASASKISATNWL
                     YQHAAACSRFNSDMYYDRVRILLIENQGLRDPYTNTLHIPQSTQSSKVLRRNRKPLTE
                     TDIRNDCAVLYETKISDPDLTRNKTGLSEVPLDIFDDLVSEEIKTAIIEQQNFEKGIR
                     PQEPKADATPDK"
     gene            <443736..>446186
                     /gene="TDEL0A02480"
                     /locus_tag="TDEL_0A02480"
                     /db_xref="GeneID:11502927"
     mRNA            <443736..>446186
                     /gene="TDEL0A02480"
                     /locus_tag="TDEL_0A02480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678743.1"
                     /db_xref="GeneID:11502927"
     CDS             443736..446186
                     /gene="TDEL0A02480"
                     /locus_tag="TDEL_0A02480"
                     /inference="similar to DNA sequence:INSDC:YMR089C"
                     /note="similar to Saccharomyces cerevisiae YTA12
                     (YMR089C); ancestral locus Anc_2.472"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678791.1"
                     /db_xref="GeneID:11502927"
                     /db_xref="GOA:G8ZLT6"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR011546"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLT6"
                     /translation="MLIAFRPCKRVLTKSWPLATRSGILVRSPLKYRSFHTFRPLLLN
                     KDNTSNGHDDKRNDKKDDNEDATDRDVEALRDEMKKYIEEAKNNKSDTDWEERKLRID
                     REIKRLEDTIARQEARKANGGKTEESGPFSFHSRQAEEQHKKMNEARKAQEEEMKKKL
                     NDPNASASENIGLFQLGLTFLLLSFVLNIFNTTEEQREITWQDFRSKLLARGYVSKLV
                     VVNRSFVKVMLNDTGKNQPENNGHDFYFFTIGSVDNFEHKLQKSQDELDIANDFRVPV
                     VYVQEGNWARAMFQILPTALMIAGIIWLTRRSASAAGGGRGGIFGMGRSKAKRFNTET
                     DVKVKFKDVAGCDEAKEEIMEFVSFLKEPKRYEKMGAKIPRGAILSGPPGTGKTLLAK
                     ATAGEAGVPFFFVSGSEFVEMFVGVGASRVRDLFKTARENAPSMVFIDEIDAIGKARQ
                     KGNISGANDERENTLNQLLVEMDGFTPADHVVVLAGTNRPDVLDKALLRPGRFDRHVN
                     IDKPELSGRQAIFEVHMKKIKLASDIFDLKNRLAALTPGFSGADIANVCNEAALIAAR
                     NDAKSVRLEHFEQAVERVIGGVERKSKLLSAEEKRVVAYHEAGHAICGWYLEFADPLL
                     KVSIIPRGQGALGYAQYLPGDIYLLSEQQLKDRMTMSLAGRVSEELHFSSVTSGASDD
                     FKKVTRMATAMVTELGMSAKIGWINYKKRDDTDLTKPFSEETANIIDEEVYRIIQECH
                     ERCTKLLQEKAEELEKVAQLLLKKEVLTREDMISMLGKRPFPERNDAFDKYLNDSETE
                     KIRKSEQENKDNDGDQRT"
     gene            <446429..>448093
                     /gene="TDEL0A02490"
                     /locus_tag="TDEL_0A02490"
                     /db_xref="GeneID:11502934"
     mRNA            <446429..>448093
                     /gene="TDEL0A02490"
                     /locus_tag="TDEL_0A02490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678744.1"
                     /db_xref="GeneID:11502934"
     CDS             446429..448093
                     /gene="TDEL0A02490"
                     /locus_tag="TDEL_0A02490"
                     /inference="similar to DNA sequence:INSDC:YMR088C"
                     /note="similar to Saccharomyces cerevisiae VBA1 (YMR088C);
                     ancestral locus Anc_2.473"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678792.1"
                     /db_xref="GeneID:11502934"
                     /db_xref="GOA:G8ZLT7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZLT7"
                     /translation="MNALDETTNLLPIPEEEGGDLELEYHKHNLSLPKLPILTSLWLG
                     SFVSSLDGTIVANIMNRVAEEFSESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKFA
                     LLMAYFFLVIGCLLTCLARNVTEFAVARAICGIGGGGINACSSITVSDICTAKERGIY
                     QGYANIVFGMGQMLGAPLGGLFIDTIGWRAIFGIQVPVVMVSAFLAYRNVNIKLSHVP
                     PISERFTRKNLSRIDFLGSVTLASTICGVLVLCSTDLNKLVVSLATAASFVLFLWVEL
                     FYAAERILPFELLKGPFGLSSVVTVCSSFVIFGDIFRSPIYLQLIHDLSVTNTGLFMI
                     FPSVSVAVGSLVTGAVLRRTSKSLELCSYLFVLAGIALQLTGLVISYYLVGVVEPALS
                     TQMASTLTFQFASQSTLWKLVFVFASVLVGFGYACLLVSTLVSIVFSIDKSQQATMTG
                     IFYLWRSIGNVLGASLTLVVFQNSLTTSLRKYMLESHRSFTKKQYYKLLTDSSYLRTH
                     FSGDTLLGLLKVYRGAFLTSYLPNLGLAALGVALSLALIRSYNKTK"
     gene            complement(<448097..>448864)
                     /gene="TDEL0A02500"
                     /locus_tag="TDEL_0A02500"
                     /db_xref="GeneID:11502728"
     mRNA            complement(<448097..>448864)
                     /gene="TDEL0A02500"
                     /locus_tag="TDEL_0A02500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678745.1"
                     /db_xref="GeneID:11502728"
     CDS             complement(448097..448864)
                     /gene="TDEL0A02500"
                     /locus_tag="TDEL_0A02500"
                     /inference="similar to DNA sequence:INSDC:YMR087W"
                     /note="similar to Saccharomyces cerevisiae YMR087W;
                     ancestral locus Anc_2.474"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678793.1"
                     /db_xref="GeneID:11502728"
                     /db_xref="InterPro:IPR002589"
                     /db_xref="InterPro:IPR028071"
                     /db_xref="UniProtKB/TrEMBL:G8ZLT8"
                     /translation="MLIYSDLYNKIYETETSMYSILVCDTSPDVCECLVKQLGNFSNS
                     VGTVCGPLATLLTRLQPCEKVAIVSPGNSFGFLGGGFDLAICEQLGGAPFEAWFRAQL
                     PGLYQPVGSCNVVDLTKGPYAHRNVRYIVHVPTVVTPMMDVCEGSRLAFDGMWNVLER
                     CPRDVDVVVVPGLATGYGGVPVAVSCKSMAFAMIVHQLDVSEELRILLVMYYLGCGYD
                     GFFSKNCRKECEEVGIDLKALKNFDARYDSIKSILPK"
     gene            <449069..>450349
                     /gene="TDEL0A02510"
                     /locus_tag="TDEL_0A02510"
                     /db_xref="GeneID:11502746"
     mRNA            <449069..>450349
                     /gene="TDEL0A02510"
                     /locus_tag="TDEL_0A02510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678746.1"
                     /db_xref="GeneID:11502746"
     CDS             449069..450349
                     /gene="TDEL0A02510"
                     /locus_tag="TDEL_0A02510"
                     /inference="similar to DNA sequence:INSDC:YKL106W"
                     /note="similar to Saccharomyces cerevisiae AAT1 (YKL106W);
                     ancestral locus Anc_2.475"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678794.1"
                     /db_xref="GeneID:11502746"
                     /db_xref="GOA:G8ZLT9"
                     /db_xref="InterPro:IPR000796"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8ZLT9"
                     /translation="MVVLRRSLISSLEQIPRAAPDRILGLTEQFARDTRRQKVNLTVG
                     VYKDGWGQVTTFPSVARAQKLIDSDFELNTDLSYLPITGCPEYSSAVLSFLFGESCPQ
                     VGPRLLEEGRVSFAQTLSGTGALAVASKLLALFLSRTVWISEPSWPNHQNIFRSNGFT
                     DLRTYPYYQNGRLVVDEWLEKLKTEVRKDPETRHSIILHACCHNPTGLDPTREEWVRI
                     LDTVHELGMIPILDMAYQGLESGNPPADAYVLRMALDEKRYKCWPNGLFVCQSFAKNM
                     GLYGERVGSLSVVTPPAKPHVREHVDSQLKQIVRSIYSSPPGYGSRVATMVLSKSFLR
                     MQWYKDVAFMTERLSQVRHNMHNLLKWPGLMNFQQQHGMFYYTGLSPKQVDVLRDKYS
                     IYMTMDGRLSLSGVNDHNIDYVCEALDAVSKIPR"
     gene            complement(<450370..>452805)
                     /gene="TDEL0A02520"
                     /locus_tag="TDEL_0A02520"
                     /db_xref="GeneID:11503255"
     mRNA            complement(<450370..>452805)
                     /gene="TDEL0A02520"
                     /locus_tag="TDEL_0A02520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678747.1"
                     /db_xref="GeneID:11503255"
     CDS             complement(450370..452805)
                     /gene="TDEL0A02520"
                     /locus_tag="TDEL_0A02520"
                     /inference="similar to DNA sequence:INSDC:YKL105C,YMR086W"
                     /note="similar to Saccharomyces cerevisiae YKL105C and
                     YMR086W; ancestral locus Anc_2.476"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678795.1"
                     /db_xref="GeneID:11503255"
                     /db_xref="UniProtKB/TrEMBL:G8ZLU0"
                     /translation="MFSRQRVSRGPEQPTSSNALAAASAIGRALDSNGKTVDRTRLPE
                     YNGAPVSSRPSSVVVSRRNSMMSNMSSGSRKGSLTRGSTPSIEDIRKRTSVGSYIGAK
                     NGSGRSYSFQYSRGPSSRNNSLTNRAQNQSADPKATFQEFGGQQAVGIIHKPLSDGPK
                     MIKKYIPTSHGLVAVDVPIEEIEHQQRKASSLRRSSSTNSLSLSRNSSLVRRSAPQPH
                     QPNRRHSSLTSHSGTSSKSRQATDRSLIQTYVEEETEQELSQDVVRPMRIPQDKLSEK
                     ITKVFGAAPDGKREEREPTTETEKEPAQVAPVTHADVSTKVENTTPNPAEEIAGNEGG
                     TKNEEGTKSEEKTQNPTISVEEKTEVIIHTDEPALVKQMTSSKDEGSDDEMVDASDIV
                     ESEVTKTPTKSTDLPAPSLAQHLRAVNPYLNQRDTDDTQELSTDDNKNLFKVPSPMKS
                     ALKKTNTQSSESSSMYSAKSPANQAYLSLTTAENTRLNAQLSSSETSVHRQNSKHLSR
                     PQSMANPRSASPSPREKARTKRLSNAPKQPPASKSAQVKSPEQTPAVAAARTSNMVNR
                     SRQDSVKRKAQEQVKTIVQANSGSKQLPDSILYPKEPPQKRSSFEKTRNQDSGLGFKK
                     LSLRDELARETPPDTSNIRQHSSHDSSHNFLQNSGWKSRFHDSDSEEENAPFSTGTSR
                     STQPTSVGTNGDTAGGSFALFKGKSKPHTVTNLAPPQPAFVEQEAVSANSTPSKVNKK
                     WSKLSLRSSSTSDTPRAETGQTSTPEKRYHSNSKLEGFSYDTMRAAEPQEADPGKKKN
                     KFGKKLKKLFGRS"
     gene            complement(<453117..>455294)
                     /gene="TDEL0A02530"
                     /locus_tag="TDEL_0A02530"
                     /db_xref="GeneID:11503145"
     mRNA            complement(<453117..>455294)
                     /gene="TDEL0A02530"
                     /locus_tag="TDEL_0A02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678748.1"
                     /db_xref="GeneID:11503145"
     CDS             complement(453117..455294)
                     /gene="TDEL0A02530"
                     /locus_tag="TDEL_0A02530"
                     /inference="similar to DNA sequence:INSDC:YKL104C,YMR085W"
                     /note="similar to Saccharomyces cerevisiae GFA1 (YKL104C)
                     and YMR085W; ancestral locus Anc_2.477"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678796.1"
                     /db_xref="GeneID:11503145"
                     /db_xref="GOA:G8ZLU1"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR001347"
                     /db_xref="InterPro:IPR005855"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8ZLU1"
                     /translation="MCGIFGYCNYLVEKSRGEIIDTLVDGLQRLEYRGYDSTGIAIDG
                     DEPDSTLVYKQIGKVSALKEEIAEHHPKRDVTFVSHCGIAHTRWATHGEPKQVNCHPQ
                     KSDPTGEFVIVHNGIITNFRELKTLLSNKGYSFESDTDTECIAKLFKHLYDTNIQNGN
                     ELDFHELTKLVLLELEGSYGLLCRSSHYPDEVMATRKGSPLLIGVKSEKKLKVDFVDV
                     EFPDDNAQPETPLVSERSNGLASSRNLTVNGGRKVRLFDHEDRGNSNLLPIAANEFNL
                     RHSQSRAFLSEDGTPNPVEFFLSSDASSVIKHTKKVLFLEDNDIAHIYDGEIHIHRSR
                     REVGASMTRSIQTLEMELAQIMKGPYKHFMQKEIFEQPESTLNTMRGRIDFENNSVML
                     GGLQAWLPAIRRARRLIMIACGTSYHSCLATRAIFEELSEIPVSVELASDFLDRKSPV
                     FRDDICVFVSQSGETADTMLALNYCLERGALTVGIVNSVGSSISRITHCGVHINAGPE
                     IGVASTKAYTSQYIALVMVALSLSDDRVSKIERRGDIMQGLKKIPQQIKEVLQLEGKI
                     KQLCEKDLKDQKSLLLLGRGYQFASALEGALKIKEISYMHSEGVLAGELKHGVLALVD
                     EDLPIIAFGTRDSLFPKVVSSIEQVTARKGHPIVICNKNDEVWEKKAATTKMVTLEVP
                     QTVDCLQGLLNIIPLQLISYWLAVNKGIDVDFPRNLAKSVTVE"
     gene            complement(<455699..>457216)
                     /gene="TDEL0A02540"
                     /locus_tag="TDEL_0A02540"
                     /db_xref="GeneID:11503231"
     mRNA            complement(<455699..>457216)
                     /gene="TDEL0A02540"
                     /locus_tag="TDEL_0A02540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678749.1"
                     /db_xref="GeneID:11503231"
     CDS             complement(455699..457216)
                     /gene="TDEL0A02540"
                     /locus_tag="TDEL_0A02540"
                     /inference="similar to DNA sequence:INSDC:YKL103C"
                     /note="similar to Saccharomyces cerevisiae LAP4 (YKL103C);
                     ancestral locus Anc_2.478"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678797.1"
                     /db_xref="GeneID:11503231"
                     /db_xref="GOA:G8ZLU2"
                     /db_xref="InterPro:IPR001948"
                     /db_xref="InterPro:IPR023358"
                     /db_xref="UniProtKB/TrEMBL:G8ZLU2"
                     /translation="MTDQREIIEHLKKTLQLLDLEKSKKPDAPVLVKAPAPVEKKLEQ
                     YSHDYIEFTYENPTTYHIVNYFSKLLEKAGFEYLSEKENWNDKIKESSDRKFYTVRNG
                     TNLSAFVVGKKWEWSKGVGAIGAHADALTAKLKPSSLKDKVEGFDLLGVAPYGGTLNE
                     LWFDRDLGVGGRVLYRDDDHGIQSKLVNSTPHPIAKIPTLAPHFGEPAVGPFDKEDQA
                     VPVVGYVSEEDTPPSEDEKKSPLFGKHCINLLRYIASLAGVKVSQLVQLDLDLFDVQK
                     GVIGGIKNDFLFAPRLDDRLCSYASIIALIEGSHDLDVDSMETFINVTLFDNEEVGSL
                     SRQGAKGGLLESVVSRVSTALYQHDPVDLRTLFANSIILSADVNHMFNPNFANVYMKH
                     HSPKPNVGVTLSLDSNVHMATDVVGTAFIEELARLNGDQVQYFQIKNNSRSGGTIGPS
                     ISAQTGARTVDLGIPQLAMHSIRATTGSRDIGLGVKLFKNFLQNWRPVYDKFGDL"
     gene            <457841..>461950
                     /gene="TDEL0A02550"
                     /locus_tag="TDEL_0A02550"
                     /db_xref="GeneID:11503331"
     mRNA            <457841..>461950
                     /gene="TDEL0A02550"
                     /locus_tag="TDEL_0A02550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678750.1"
                     /db_xref="GeneID:11503331"
     CDS             457841..461950
                     /gene="TDEL0A02550"
                     /locus_tag="TDEL_0A02550"
                     /inference="similar to DNA sequence:INSDC:YKL101W"
                     /note="similar to Saccharomyces cerevisiae HSL1 (YKL101W);
                     ancestral locus Anc_2.479"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678798.1"
                     /db_xref="GeneID:11503331"
                     /db_xref="GOA:G8ZLU3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZLU3"
                     /translation="MPVATSHKRTTGSTVAKKAARNAMLKVAGTTKVSPTQLERVVQS
                     VNDATKRLSQPDSILSTSTTTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNMETG
                     QLAAIKIVPKKNNVLGKNDACSTSSASYTSNSSQTSTMMNTTANNYTTAGHSNVATNP
                     YGIEREIVIMKLISHANVLGLYEVWENKSELYLVLEYVDGGELFDYLVSRGRLCEREA
                     VHYFKQIIQGVSYCHAFNICHRDLKPENLLLDKKNSTIKIADFGMAALEVSNKLLQTS
                     CGSPHYASPEIVMGKQYHGGPSDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKY
                     QMPQNLSKEAQDLIAKILTVNPAKRLTTEEILRHPLIVKYDSMMKTKKYKALYKNMGQ
                     GKSNADLHLLNNYEATTINLNSRKDIDDTILNNLQILWHGASRELIVAKLLQPRMSEE
                     KVFYSLLLKYKENHSSHPSAEVQAEEAAIAEEHPNESRDSNDEEDNDAGAPKLLQKSQ
                     FSVPAIKLEEAGVPSLPSNSIPPAIPVFAASSSRVFKKSGSTLSLQTQKSQRATLPKS
                     TSGKSLSRSSSKKTLQNSASKRSLYSLNSISKRSLNLNDYVTVGADNEEFNQLPPLPS
                     LESTNGFENLCEQILFGNALDKILEEEEEEDKRNDLGGFKGTTSSSDATLTKEAVGKE
                     YTPSEIAIKPAFELNKQKSQRSLEPSDDQKSTVQMPLRDITNNHQPLKNRRSQLKREA
                     SQKSNLSAILDQKPIKKEYPPPSNFGMRSSSTAQTQERVHSLDPRRNASQPANSNMVE
                     SLLNSFRSKSGSLKRNKSRDWAYSRGSIFLSTRDSTNDTSTSRNESTVKDIAEQTLPS
                     ENVLDFDNSALDILAHSSTVHNDNDKESIPNITFNASTTFKDLNEILRDGNESYVLNG
                     KRPSQPTTRNNTMRKPSTKLSLTPKSALTVGLSNKTTHSHNCSVMSNDFDLMSDMSFA
                     MDIPTNTFMAQAISISNRASGDHVVSDGDYSSKAFTQDETTNNSSHTPATTYEENKVN
                     IFEDAPADSESIDITSSESDSSPNVHRKAVSIDTLNTTNVLPPTTNVRVSLYNNHNST
                     AGLPRETTEQIISKFNLTPEKPTAPFLQKRFSMIPGNKGLEAPGKSQSMLAMFKDLEE
                     DDECDEASESKIHASSTNNGVDNQSEPQPNRVTMLFDGEEAENEPKSTEPAAQDEEFV
                     LTHKKETAPRSNLGTSKKPKPAIRVRTANPEVSNKSNKPKRNWFSRLFNGFKTKSGGD
                     KLTGYHKTFMPFDDVHLLALHEFDKNAIDYQLKASERRQDKEKVEYDCKFVSGNFKFK
                     IKIESGAGTTLTIRRKVGNKGEASEEAFETFNQNIAEVIKQAESKKQAC"
     gene            complement(<462053..>463174)
                     /gene="TDEL0A02560"
                     /locus_tag="TDEL_0A02560"
                     /db_xref="GeneID:11503357"
     mRNA            complement(<462053..>463174)
                     /gene="TDEL0A02560"
                     /locus_tag="TDEL_0A02560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678751.1"
                     /db_xref="GeneID:11503357"
     CDS             complement(462053..463174)
                     /gene="TDEL0A02560"
                     /locus_tag="TDEL_0A02560"
                     /inference="similar to DNA sequence:INSDC:YMR083W"
                     /note="similar to Saccharomyces cerevisiae ADH3 (YMR083W);
                     ancestral locus Anc_2.480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678799.1"
                     /db_xref="GeneID:11503357"
                     /db_xref="GOA:G8ZLU4"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZLU4"
                     /translation="MLRTTSTRLPRSVSLFGRLTRLNSSFTIPATQKGVIFYENGGEL
                     HYKDIAVPKPKPNEILINIKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGAGVVVAKG
                     KDVTNFEIGDLAGVKWLNSSCMACEYCELGHESNCAKADLSGYTHDGSFQQYATADAI
                     QAAPIPKDTDLAEVAPILCAGVTVYKALKTSGAKPGQWVAISGAAGGLGSLAVQYATA
                     MGLRVLGIDGGEGKEELFKSLGGEVFVDFTKTKDMVSAIQEATNGGPHAVVNVSVSEA
                     AIQQSTEYVRPTGTVVLVGLPAHAYVKSEIFSHVVKSISIKGSYVGNRADTREAIDFF
                     SRNLVKSPIKIIGLSELPKVYELMEEGKILGRYVVDTSR"
     gene            complement(<463688..>465538)
                     /gene="TDEL0A02570"
                     /locus_tag="TDEL_0A02570"
                     /db_xref="GeneID:11503353"
     mRNA            complement(<463688..>465538)
                     /gene="TDEL0A02570"
                     /locus_tag="TDEL_0A02570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678752.1"
                     /db_xref="GeneID:11503353"
     CDS             complement(463688..465538)
                     /gene="TDEL0A02570"
                     /locus_tag="TDEL_0A02570"
                     /inference="similar to DNA sequence:INSDC:YKL100C"
                     /note="similar to Saccharomyces cerevisiae YKL100C;
                     ancestral locus Anc_2.481"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678800.1"
                     /db_xref="GeneID:11503353"
                     /db_xref="GOA:G8ZLU5"
                     /db_xref="InterPro:IPR006639"
                     /db_xref="InterPro:IPR007369"
                     /db_xref="UniProtKB/TrEMBL:G8ZLU5"
                     /translation="MNHTLYKAIADQVAKMSSKFLKHPTASAADLPDYDELEQVFEQI
                     SSMVQTNQSQIVNSIDKISNSTAHALVNLFEHRPKVIDYAALIVLATSLVTIGCFASI
                     TSIPYTALPPTQLHPLFDPSDLDLSQDCRIIHADEKKKSFTDSLDERQAIILPLTSGV
                     TLVSLYFVITKLRIEWRTYLLKLLNFNIIVMTFPAGVLVYHYFASTVTRYLAHWSSWN
                     PLLISPRYRVTISDDNEDINRAGWFISNFQYRDALTNELGYKNVIEKVKEDSSERQFY
                     LREFSRPKDVKSVRQFANMYLSNGMILASILSLISTVCYLYFPNDWLIKNVISMNFAI
                     WAISQLKLKNLKSGVLILTALFFYDIYFVFGTKVMTTVALNLDLPIKLSMPSKFDNVL
                     NRFEFSMLGLGDIVLPSLFIALCYKYDIWKWHYVNTDTEFHLLNWGYLGRYFSTAILS
                     YVTALAGCMFALATSGKAQPALLYIVPLLLISTITVAWLSGDLAQFWTFQYDTIELGE
                     NKLDADEDQDEAPMTYSDYLKSDLLTTDNDDNEEYTNQDAIIDYESDDDDEANDADPI
                     PQVDAVAYRPTDIMGLLDEATKASEDEDEDFVLEEDDDDASDSSTVVLAD"
     gene            complement(<465661..>466404)
                     /gene="TDEL0A02580"
                     /locus_tag="TDEL_0A02580"
                     /db_xref="GeneID:11503202"
     mRNA            complement(<465661..>466404)
                     /gene="TDEL0A02580"
                     /locus_tag="TDEL_0A02580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678753.1"
                     /db_xref="GeneID:11503202"
     CDS             complement(465661..466404)
                     /gene="TDEL0A02580"
                     /locus_tag="TDEL_0A02580"
                     /inference="similar to DNA sequence:INSDC:YKL099C"
                     /note="similar to Saccharomyces cerevisiae UTP11
                     (YKL099C); ancestral locus Anc_2.482"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678801.1"
                     /db_xref="GeneID:11503202"
                     /db_xref="GOA:G8ZLU6"
                     /db_xref="InterPro:IPR007144"
                     /db_xref="UniProtKB/TrEMBL:G8ZLU6"
                     /translation="MAKLVHNVQKKQHRERSQLAGRSRLGFLEKHKDYTKRAQDYHKK
                     QNTLKILRGKAKERNPDEYYHEMTSRKVDARGLLHTSRHGDEDPTLNMDQVKLLKTQD
                     SNYVRTLRQLEKKKMERKSNELLFESNGKHTVFVDNRTDMEDFTPEKYFNTTTDMVNR
                     RENRLTKDQLMSNNIFDSPTTLHTESLNKKKLKKYKAVKSHLDRESQLSAVQQRMDLQ
                     REVMKKGSKKKVADVSGKVSFKWKKQRKR"
     gene            <466579..>467520
                     /gene="TDEL0A02590"
                     /locus_tag="TDEL_0A02590"
                     /db_xref="GeneID:11502786"
     mRNA            <466579..>467520
                     /gene="TDEL0A02590"
                     /locus_tag="TDEL_0A02590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678754.1"
                     /db_xref="GeneID:11502786"
     CDS             466579..467520
                     /gene="TDEL0A02590"
                     /locus_tag="TDEL_0A02590"
                     /inference="similar to DNA sequence:INSDC:YKL098W"
                     /note="similar to Saccharomyces cerevisiae YKL098W;
                     ancestral locus Anc_2.483"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678802.1"
                     /db_xref="GeneID:11502786"
                     /db_xref="UniProtKB/TrEMBL:G8ZLU7"
                     /translation="MTRDELPDLFTCLEFCLSVQKNLLYFYEQESQEANEIDIERRVN
                     ALKSTIEHNFSESAVVCRVTKQILPIEPGNSDQLEIHIIPKIDSLDRDQQNLLVKNMN
                     GNPHRIYIGMIAWKSISHNNVARDLDTRDTLSSSVKLRDWLKHRFWLSFSERPEPIPP
                     SPMQSKSQVENYLSIDGHVTCKPAIRRYILDIMVHLRMHRMLDITKGGGVHTGSLEDV
                     VQLAKLLSYKKYNKNFVIPEHVKLACQWYFPLHLELVRDSSMDVSVLYGSKPEMVDGF
                     LDKIAQLKLAQSSMAHNPLFLEALIVRDVLKRVVPPA"
     gene            <467862..>468752
                     /gene="TDEL0A02600"
                     /locus_tag="TDEL_0A02600"
                     /db_xref="GeneID:11503309"
     mRNA            <467862..>468752
                     /gene="TDEL0A02600"
                     /locus_tag="TDEL_0A02600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678755.1"
                     /db_xref="GeneID:11503309"
     CDS             467862..468752
                     /gene="TDEL0A02600"
                     /locus_tag="TDEL_0A02600"
                     /inference="similar to DNA sequence:INSDC:YKL096W-A"
                     /note="similar to Saccharomyces cerevisiae CWP2
                     (YKL096W-A); ancestral locus Anc_2.484"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678803.1"
                     /db_xref="GeneID:11503309"
                     /db_xref="GOA:G8ZLU8"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:G8ZLU8"
                     /translation="MKFSTAFSVTLLALAKLIVADSEQFGLVSIRSGSNLQYASVYYQ
                     DDKLYVGSGSDSLGGTVTDAGKLKLTDDKFAVVNSDGSIGEGSEDDGTAKFSIKNGHL
                     AYNNIDGFYAIPTDSKYVLSVTRSDDSTGIALKAMGSGGQSVADFIPSGDDDTTTTTL
                     SSETSTSTEAPTSTEATTSTEAPTSTEASSSNADAISQIDDGQIQAATTTTAEAASQI
                     DDGQVQATTATTAEAASQIDDGQVQATTATTAEAVSQIEDGQIQATSSDVQVVESNGA
                     QKGAIGLGAGVFAAAAAFLL"
     gene            <469180..>470343
                     /gene="TDEL0A02610"
                     /locus_tag="TDEL_0A02610"
                     /db_xref="GeneID:11503098"
     mRNA            <469180..>470343
                     /gene="TDEL0A02610"
                     /locus_tag="TDEL_0A02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678756.1"
                     /db_xref="GeneID:11503098"
     CDS             469180..470343
                     /gene="TDEL0A02610"
                     /locus_tag="TDEL_0A02610"
                     /inference="similar to DNA sequence:INSDC:YKL096W"
                     /note="similar to Saccharomyces cerevisiae CWP1 (YKL096W);
                     ancestral locus Anc_2.485"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678804.1"
                     /db_xref="GeneID:11503098"
                     /db_xref="UniProtKB/TrEMBL:G8ZLU9"
                     /translation="MKFSSAYLASLFALAQLVVAKSEEFGLVAIKPSTDLHYSTIHEK
                     EGALYFGHDSKKPLTGWITDCGYLKFSDESYAGLTKYGTLEETSKCYASAGFYVKDGK
                     LYYNSKKDFWALPKDYKYFVSIEDGKDAVGVFIRAQGSSGYPVKDFYPNKEKCYEEEK
                     KKKEECKKEYEKGDKEYKKGKDYKKDKKYDNDDEKDDDKDDDKYDDKYDDKYDDKYDD
                     KHDDKHDDKYDDKDDYEKEYKKEYKKGKNYKKEKEYKKEKGHNKEKEYKKEKEYKDYD
                     DEDYDDDDYDEYKKHKEYKHYQGHKKHGDFKDHKDDKDKYDGDYDDDYDEKDYEKEYK
                     DKEYNHKKGKEYDYEWEKKSKVHKAPEKNDAMAISYGNTFGVGAFAALAALIM"
     gene            complement(470655..470728)
                     /gene="TDEL0Atrna11V"
                     /locus_tag="TDEL_0Atrna11V"
                     /db_xref="GeneID:11502973"
     tRNA            complement(470655..470728)
                     /gene="TDEL0Atrna11V"
                     /locus_tag="TDEL_0Atrna11V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:11502973"
     gene            complement(<472868..>473512)
                     /gene="TDEL0A02620"
                     /locus_tag="TDEL_0A02620"
                     /db_xref="GeneID:11503322"
     mRNA            complement(<472868..>473512)
                     /gene="TDEL0A02620"
                     /locus_tag="TDEL_0A02620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678757.1"
                     /db_xref="GeneID:11503322"
     CDS             complement(472868..473512)
                     /gene="TDEL0A02620"
                     /locus_tag="TDEL_0A02620"
                     /inference="similar to DNA sequence:INSDC:YMR077C"
                     /note="similar to Saccharomyces cerevisiae VPS20
                     (YMR077C); ancestral locus Anc_2.492a"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678805.1"
                     /db_xref="GeneID:11503322"
                     /db_xref="GOA:G8ZLV0"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:G8ZLV0"
                     /translation="MGQRSSKVQITDNDRAILQLKRSKDEIHKFTRKTDQLITAERAK
                     LKQMIKENPEKYKKDVKVRFLLKRIHYQDHLLQQAMEQLINLENLVSTLEFKLVEIQF
                     IKGLERGNEILTKLNKEFKNVDELMDNVQEQISYQNEIDDVLAHSVVGVDNFEAELDK
                     ELEQLDREINPQPVVHMPSTDKLPELKSEPVGIPEDSSKLENDRANVEEPIIAE"
     gene            complement(<473764..>476034)
                     /gene="TDEL0A02630"
                     /locus_tag="TDEL_0A02630"
                     /db_xref="GeneID:11503385"
     mRNA            complement(<473764..>476034)
                     /gene="TDEL0A02630"
                     /locus_tag="TDEL_0A02630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678758.1"
                     /db_xref="GeneID:11503385"
     CDS             complement(473764..476034)
                     /gene="TDEL0A02630"
                     /locus_tag="TDEL_0A02630"
                     /inference="similar to DNA sequence:INSDC:YMR078C"
                     /note="similar to Saccharomyces cerevisiae CTF18
                     (YMR078C); ancestral locus Anc_2.492"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678806.1"
                     /db_xref="GeneID:11503385"
                     /db_xref="GOA:G8ZLV1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLV1"
                     /translation="MDGVPEFGNLLGKSSLFNSGDGEADHDNDESGGIGVDDDSRGCS
                     FITSKGKVVKLRKKRSQKLLQPIEHQLFGLDASKVAWREDESYGININALLDRIECQS
                     PGYKDVKEPEKETEKDIEKEIEKKSETESKKKAKTTEADNCGTELWVEKWCPRNFLDL
                     VGNEKTNRRVLRWIRQWSPCVFDEQLPEVYGQRNETEVLDPLLRPTKKILLIHGPPGI
                     GKTSVAHVAAKQAGYSVAEINASDERAGTLVRDKVHNTLFNHTFNERPVCLVADEIDG
                     SIESGFIKILTDLINKDAQATQRRMLGPNMKSRTKKQRKSAKLLLRPIIAICNNLYAP
                     ALEKLKPHCEIIAFKRPSDSSLLERLEHICKVEGLKVPVKFLKELMDVAQGDVRNCVT
                     NLQFIASHQKPNQDPKSNPLDSISKDFSQSWFRICNQVFRRDPRRELTAQLREKTRQV
                     ELNGNYERIVQGCHSLYPNVKYSDNGIQKPATIADWLFFHDLMFKSLFEHNGELLRYS
                     SVVPLAFFNLFGDVANREDMRIQNSEFELREQQKSNQDILKLVLHRISMEVPAMVPFT
                     SYESLILTVLPHVDYMISSDLSKCRDPKLKQSIFDSLIGLLKCFQLDIVEKYFEQVTS
                     KKLLCIEPPIDKVVLLDPQRQRDVLVKRPATFHLLLAKLEESKARKRHIKQISDNRER
                     NEEIKDKRARTVKSGVNMADFFKTQYRRNDKGESEPNHKSKEGNNDNKVRIWVKYKEG
                     FSDAVRKNVSWNNLWD"
     gene            <476285..>477289
                     /gene="TDEL0A02640"
                     /locus_tag="TDEL_0A02640"
                     /db_xref="GeneID:11502565"
     mRNA            join(<476285..476293,476381..>477289)
                     /gene="TDEL0A02640"
                     /locus_tag="TDEL_0A02640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678759.1"
                     /db_xref="GeneID:11502565"
     CDS             join(476285..476293,476381..477289)
                     /gene="TDEL0A02640"
                     /locus_tag="TDEL_0A02640"
                     /inference="similar to DNA sequence:INSDC:YKL091C,YMR079W"
                     /note="similar to Saccharomyces cerevisiae YKL091C and
                     SEC14 (YMR079W); ancestral locus Anc_2.491"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678807.1"
                     /db_xref="GeneID:11502565"
                     /db_xref="GOA:G8ZLV2"
                     /db_xref="InterPro:IPR001071"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:G8ZLV2"
                     /translation="MATPEEQKILSTYPQVCEPGSVSGCPGNVDEAQKKAMLQLREEL
                     TKAGFVQRLDDSTLLRFLRARKFDVALAKEMYEACEKWRKEYGTDTILEDFHYEEKPL
                     VAKYYPQYYHKTDKDGRPVYFEELGAVNLTEMYKITTQERMLKNLVWEYESFVKYRLP
                     ACSRYCGHLVETSCTIMDLKGISVSSAYQVLSYVREASYVGQNYYPERMGKFYLINAP
                     FGFSTAFKLFKPFLDPVTVSKIFILGSSYKKDLLKQIPAENLPVKFGGKSEVSEADGG
                     LYLSDIGPWRDPKYIGPEGEAPQVFSTKK"
     gene            <477606..>480689
                     /gene="TDEL0A02650"
                     /locus_tag="TDEL_0A02650"
                     /db_xref="GeneID:11502597"
     mRNA            <477606..>480689
                     /gene="TDEL0A02650"
                     /locus_tag="TDEL_0A02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678760.1"
                     /db_xref="GeneID:11502597"
     CDS             477606..480689
                     /gene="TDEL0A02650"
                     /locus_tag="TDEL_0A02650"
                     /inference="similar to DNA sequence:INSDC:YKL092C"
                     /note="similar to Saccharomyces cerevisiae BUD2 (YKL092C);
                     ancestral locus Anc_2.490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678808.1"
                     /db_xref="GeneID:11502597"
                     /db_xref="GOA:G8ZLV3"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001936"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR023152"
                     /db_xref="UniProtKB/TrEMBL:G8ZLV3"
                     /translation="MESDRLSSPTASTLSSLSHSFDVSKFLMKMRELKGTFSGRVKWS
                     DSLEPANWKSCHLEITEEGSLRPILRSTDSTELGSSDTSNNVIINHLQDCKLKLVEEP
                     SIGLPVIKVATETSTDYFCVSDKAKFESLLCSLIWWSALRPKGIFNKISFESPPLRNN
                     DEEPTNLLVSQLIIFGPLPPKRRIPVFKQLTRPNFLEKSSSDEGWFPAMGVLKSNGTL
                     DLLLQSDGSLIYTLDITILTRSEIRLLDTSLQNDNYLFIGKLPVLRQEFDLPCERKLI
                     LNGPLIKHLPGIILKFSLPIDVEDWLVSLKSFALAESLSLTGAHNSNKLRVSNRFRIS
                     IVEGDFKGIRKSLIGGPPSLYVELSMWGHTWGRTAMVRDTETPFWREEFSFNENVKVS
                     NVRITLKQRNANPNKEDETVGFLNITQELINDTSLNKETRLPVMDAKTGRFKIGTICI
                     RIISSLKFILPASNFGKFESALTQVCPGQVLSFINDLPLGADMKFEDISSVFLDVFQI
                     LGREDDWFSALIDKELADVDGSIARNTKNNKSSTHIYGTLFRGNSILTRSMESFFIRV
                     GKEYLDKSIGPPLRQIIGSGEDCEVDPNRIREDDPEKKKLILEANHVKLLYWVEKIWS
                     AIYNTSNDIPMPIKNQMRTLRKKLELMCIEDDVTRILNCVSGMLFLRFFCPVILNPKL
                     FNFVRSHLNERSRRTVTLISKVLLNLSNLTVFANKEPYMAGMNCFIEDHREEMLDYTD
                     KVTQKKLDFSSKKLKLASSVARPKLLMDANVLAELPTNPYLIDSYLRETQIFVAFANY
                     TINKEGNKGVPISGSLDHISKNITNIEISLEEKRAEIGDLEFEKITTNNVEVFGNDLL
                     KYLEQDSDQGNENTTPVLQSDGPVDAIEQLERESILLLHKVERLKRALVDYEHPTENM
                     EEKIKYGQFLADNTYYTKTMDIVVDTQRQFGEDEALSKLFSSNDGYSHLLDTVVPRLS
                     TQSSGSTNISFSDGSGGLGRKLSFFRTNKTTRVAIRDGEERETKTSFTKWFKRVK"
     gene            complement(<480727..>483453)
                     /gene="TDEL0A02660"
                     /locus_tag="TDEL_0A02660"
                     /db_xref="GeneID:11503159"
     mRNA            complement(<480727..>483453)
                     /gene="TDEL0A02660"
                     /locus_tag="TDEL_0A02660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678761.1"
                     /db_xref="GeneID:11503159"
     CDS             complement(480727..483453)
                     /gene="TDEL0A02660"
                     /locus_tag="TDEL_0A02660"
                     /inference="similar to DNA sequence:INSDC:YMR080C"
                     /note="similar to Saccharomyces cerevisiae NAM7 (YMR080C);
                     ancestral locus Anc_2.489"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678809.1"
                     /db_xref="GeneID:11503159"
                     /db_xref="GOA:G8ZLV4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018999"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLV4"
                     /translation="MHRRTMNADEELLEDEVAVLPTSQHACAYCGIDSPVSVIRCNGC
                     SRWFCNSKHGTASSHIVNHLVLSHHNVVSLHPDSDLGDTVLECYNCGCKNVFLLGFVS
                     ARGEAVVVLLCRVPCAQNKNANWDTDQWQPLIEDRQFLNWVAEEPTEEQKLSARLITP
                     SQMSKLEAKWKSNKDATINDIDAPEEQEEIPPVLLKYQDAYEYQRSYGPLIKLEADYD
                     KQLKESQALEHISVTWSLALNNRHLASFALSTFESNELKVAVGDEMVLRYSGLQHPEW
                     EGRGYIVRLPNSMQDEFTLELKPSKQPPPTHLGTGFTAEFIWKGTSYDRMQDALKKFA
                     LDKKSISGFLYYKILGHQIVDIQFEVNLPKEFSIKHFAQLNASQSHAVEHVLQRPLSL
                     IQGPPGTGKTVTSATIVYHLSKMHNERILVCAPSNVAVDHLAAKLRDLGLKVVRLTAK
                     SREDVESSVSNLALHNLVARSSKGELKKLLRLKEEVGELSIGDTKKFVKLVRKTESEI
                     LKKADVVCCTCVGAGDKRLDTRFRTVLIDESTQASEPECLIPIVKGAKQIILVGDHQQ
                     LGPVILERKAGDAGLKQSLFERLIALGHVPLRLEVQYRMNPYLSDFPSNVFYEGSLQN
                     GVTIEQRTVTNSTFPWPIHGVPMMFWANYGREEISANGTSYLNRIEAMNCERIITRLF
                     KDGVKPEQIGVITPYEGQRAFILQYMQMNGSLDRDLYLSVEVASVDAFQGREKDYIIL
                     SCVRANEQQIIGFLSDPRRLNVGLTRAKYGLVILGNPRALSTNALWNNLLIHFREKGC
                     LVEGSLNNLQLCTVQLTRNRPNKNNTNKFPFTVDTAGFSSVQDFDTQSLMSFGGEVDP
                     FKGTGLAPENELSSFLNNQMWNADNFASYEGRASTQENDTERLSKGIHSLNI"
     gene            complement(<483889..>484824)
                     /gene="TDEL0A02670"
                     /locus_tag="TDEL_0A02670"
                     /db_xref="GeneID:11502749"
     mRNA            complement(<483889..>484824)
                     /gene="TDEL0A02670"
                     /locus_tag="TDEL_0A02670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678762.1"
                     /db_xref="GeneID:11502749"
     CDS             complement(483889..484824)
                     /gene="TDEL0A02670"
                     /locus_tag="TDEL_0A02670"
                     /inference="similar to DNA sequence:INSDC:YKL094W"
                     /note="similar to Saccharomyces cerevisiae YJU3 (YKL094W);
                     ancestral locus Anc_2.487"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678810.1"
                     /db_xref="GeneID:11502749"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR029059"
                     /db_xref="UniProtKB/TrEMBL:G8ZLV5"
                     /translation="MAYPYKCTTQIPPLEYTEFDGAKFAHVTWPSSTTAATTHGRVLI
                     VHGFCEYTQLNHRFMDMLAQRGYESFMFDQRGSGRTSPGKLRGHTDDQHVFSDLEYFV
                     SLNLEQCSERRIPLIMFGHSMGGAITLAYAFKGKRREEIAAYVASAPLLRLHPHSQPS
                     WIVQKMAPLLARMLPGFAIDTKLDLEGVTSDPAYRKFLQQDKPLSTPLVGTFRQIYDF
                     LERGRVLLEDPEGQVASGFVRDKPILLIHGDGDTINDPKASKQFVENCKAGDKTLRVA
                     KGARHSVLSLERDEIMQREIEWLVEWLQSHVSASS"
     gene            complement(<484904..>485680)
                     /gene="TDEL0A02680"
                     /locus_tag="TDEL_0A02680"
                     /db_xref="GeneID:11502654"
     mRNA            complement(<484904..>485680)
                     /gene="TDEL0A02680"
                     /locus_tag="TDEL_0A02680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678763.1"
                     /db_xref="GeneID:11502654"
     CDS             complement(484904..485680)
                     /gene="TDEL0A02680"
                     /locus_tag="TDEL_0A02680"
                     /inference="similar to DNA sequence:INSDC:YKL095W"
                     /note="similar to Saccharomyces cerevisiae YJU2 (YKL095W);
                     ancestral locus Anc_2.486"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678811.1"
                     /db_xref="GeneID:11502654"
                     /db_xref="InterPro:IPR007590"
                     /db_xref="UniProtKB/TrEMBL:G8ZLV6"
                     /translation="MSERKAINKYYPPDYDPIAAEKALKKSAKTLKTRQKDVVTIRLM
                     TPFSMRCLKCSEYIPQSRKFNGKKQLLPERYLNTIKVFRLSIRCPRCNHVISFRTDPK
                     TADYVMEGGAERNGGKTVQEQGQVESAEQTLERLVRERKAADHAALGGNSGDRHEQLE
                     ARLAQTQREQQQEEELERLLLQRKRVRSSQGDSGRDSSENESDLEQAAEAALQKQSRP
                     FRALLPPPAPVQSSRGTREPRRRTHLGCGGGRDHRVRREQ"
     gene            <485785..>487953
                     /gene="TDEL0A02690"
                     /locus_tag="TDEL_0A02690"
                     /db_xref="GeneID:11502776"
     mRNA            <485785..>487953
                     /gene="TDEL0A02690"
                     /locus_tag="TDEL_0A02690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678764.1"
                     /db_xref="GeneID:11502776"
     CDS             485785..487953
                     /gene="TDEL0A02690"
                     /locus_tag="TDEL_0A02690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678812.1"
                     /db_xref="GeneID:11502776"
                     /db_xref="GOA:G8ZLV7"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8ZLV7"
                     /translation="MEKRKRRKAIKSCAFCRRRKLRCDQKKPRCSTCVARNLAECVYS
                     QGLQHNASTETRELVPLPGFGESTTTYNVTIEPLAGASRNQLDTFFTLQCKESGRKVY
                     YGPTSARTLMAKNDWGLLERFRQATTKIKTARIDFKKKNGVSMLRELQTIDTPQSIQQ
                     IVPVLPTYETILRCVHDFFDNPCLYPQNSGLDKRKVFQDLEEGLVVGQQLVPGVERAV
                     VELKPGPKCNYYRLGVIFSILALTHYYEDLPLPLESFFVYLAGCNTAKAMYVERCQTF
                     LLRFTYRLAHGYNGGDNSHLMLLVDNMINTAIYLGLNKDICILYRGQEATAGSLDSLQ
                     ALWYWILLADFDIALNIGRPLRISPYDYDGPLVDHTDALYGVMGRFLKIARHIICDIH
                     NKKRTPELDVHCETIITFIEHEFSPFELYTDPALMQIHKLPHMHILCNALSLLSTCYG
                     LRWTALKCSTPSVKNGAVKAMLLSYSVISSISKFCFEQDRVKYSHMLVPECKNITPYL
                     TGGISIWCTLFVRILMFFYGFAHSEMTLFESGPVFTQNSSPTDECDLSNLRGPEDRAI
                     SFSTYFNIACEKLDTLAATNDPHMKMVLRRSRFYVLLMGKDKILRVLTKTAVECRTNA
                     ETSWLTNSKGNQVITNLQSPEDSVEPILAPGKSVEQTGDGISTDFSLSQMQVNLMASP
                     AADPGTAQMIADEFWQSYNLGWQEILDSAEGLDLISDFMV"
     gene            <488090..>489478
                     /gene="TDEL0A02700"
                     /locus_tag="TDEL_0A02700"
                     /db_xref="GeneID:11502586"
     mRNA            <488090..>489478
                     /gene="TDEL0A02700"
                     /locus_tag="TDEL_0A02700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678765.1"
                     /db_xref="GeneID:11502586"
     CDS             488090..489478
                     /gene="TDEL0A02700"
                     /locus_tag="TDEL_0A02700"
                     /inference="similar to DNA sequence:INSDC:YKL090W"
                     /note="similar to Saccharomyces cerevisiae CUE2 (YKL090W);
                     ancestral locus Anc_2.494"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678813.1"
                     /db_xref="GeneID:11502586"
                     /db_xref="InterPro:IPR002625"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="UniProtKB/TrEMBL:G8ZLV8"
                     /translation="MNSDASTDSKLDELALIFPDKRPAQILRALESANGDSHEACAIL
                     LSESSSEPVQASDPLDELKAMFPNVDSKTIEDVYQRSKSIEAATSELLSLPMLSLVDD
                     EEQKHAERQLKDGQCDKTANNQNAWQKTSWKMNSDKIRTIRNYTAVSDSKARQAYHKN
                     SFSAVKSIIQLIWDQDYFSNSSSKHNEPAPRVKKSRGGRVQAATGFAHATSFADESKS
                     SFKVLENNDDDADVADKEVEGTYVYSDNSKEAQELKDVLQSNAELRTINLTFLKRALT
                     FYRGDLQLTMSLALFILEANGAKATYRSVPDPKEMFNFTIAQSKSQKNKAAAVPAIDT
                     THLTPQAFLNDEHYHEGRRMIQNVLTTTRFDFHGFVPKDAIQVLRECLDKWWNQEIRE
                     REMNSQKLSISKALNVAPIEIVTGRGIHSAGGISTLKIKVRKFLNDNHYVYWEEPAYF
                     IVQGRKSSRIGT"
     gene            <489627..>491402
                     /gene="TDEL0A02710"
                     /locus_tag="TDEL_0A02710"
                     /db_xref="GeneID:11502922"
     mRNA            <489627..>491402
                     /gene="TDEL0A02710"
                     /locus_tag="TDEL_0A02710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678766.1"
                     /db_xref="GeneID:11502922"
     CDS             489627..491402
                     /gene="TDEL0A02710"
                     /locus_tag="TDEL_0A02710"
                     /inference="similar to DNA sequence:INSDC:YKL089W"
                     /note="similar to Saccharomyces cerevisiae MIF2 (YKL089W);
                     ancestral locus Anc_2.495"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678814.1"
                     /db_xref="GeneID:11502922"
                     /db_xref="GOA:G8ZLV9"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="InterPro:IPR025974"
                     /db_xref="InterPro:IPR028386"
                     /db_xref="InterPro:IPR028929"
                     /db_xref="UniProtKB/TrEMBL:G8ZLV9"
                     /translation="MDYMHLGVRSRKTGLNAKENIKKDEYSMESIDDFFKDDESSVVS
                     SRGRNRRSTILSLMSNTEGPVFESRRDSLTTETKGFKVPNAVVNSSRRSTRLPQQYQN
                     DFTPPANDGLGTISENELQYDDFTGDAGHRTPSPAPLSYTEGLDSLHDSPSVRLTPRS
                     KSNIVYKQVPDLIEDDEDTRDFTSLNTSENALLEDELEDDYMVESEEDHDYVDGASSL
                     EDEQTDDSAGSGDSDDIGASDGDSDSADGGETAVSRHRAGYHLGHDSPTEVYDSDEEY
                     IQSQAANLIGNDASRHPDGIRRSTRVKIAPLEYWRNEKVVYKKKSDKPVLEIDRIITY
                     DHNDDDDEEEEEGLKRRKKRNKSTVRTRPYNYIPTGKPRGRPRKSKASIIDDANPNSD
                     LLQEIKSGNVPNAEWLKFGILEAKVNVTKEHMSDEIIAFAPNLAQSEQTKESDEESFS
                     LEIMFDKHKNQFASGMLKLPTKGNKKLSDSYNAFINFYVIQGVIEVTLTGKSFIITEG
                     STFQVPAFNKYSFENRGNNDAKMFFVQVTVSNESLEHKMVDGSIEMTDDDKSRKDDVS
                     DATNSAADNALFENTSSSNMSISEI"
     gene            complement(<491618..>494365)
                     /gene="TDEL0A02720"
                     /locus_tag="TDEL_0A02720"
                     /db_xref="GeneID:11502792"
     mRNA            complement(<491618..>494365)
                     /gene="TDEL0A02720"
                     /locus_tag="TDEL_0A02720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678767.1"
                     /db_xref="GeneID:11502792"
     CDS             complement(491618..494365)
                     /gene="TDEL0A02720"
                     /locus_tag="TDEL_0A02720"
                     /inference="similar to DNA sequence:INSDC:YHL007C"
                     /note="similar to Saccharomyces cerevisiae STE20
                     (YHL007C); ancestral locus Anc_2.496"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678815.1"
                     /db_xref="GeneID:11502792"
                     /db_xref="GOA:G8ZLW0"
                     /db_xref="InterPro:IPR000095"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZLW0"
                     /translation="MAEELASRMSQSRDEGDDTGQVTGGDHEKIYQTVEQPSLSPIIN
                     QDDLSNNFDLPRAAGTLNVNAYHEESETDSKAIGGYRSMDPKAQSNDDNELTNSATLD
                     DPIQFTRVSSSSAISGASSFEYDGNNQEDDILRGDGKVQIGGKGINKERGEVDSKNHY
                     NNISTGRTQGNDGSTVGDKTNSTIRGSGAEQQVNGTPNDTFTASESLFDTSSGNLSSV
                     SKTILPSMFATEPRQQSHTPVSTPVIPQEPSSSVSEQSTASKGMNSPFRPFTNKAGAT
                     SSPKITHVSTPSPSSTAGKSDSSKRKSSGSSRMKGVFTSFVQNIKRNSQSERSRSGSS
                     VKISTPYNAKHVHHVGVDAKTGEYTGLPEEWERMLTSSGISKKEQQQNMQAVVDIVKF
                     YQDVAESSGEDKVFKTFNVNGSNIHNISTPSLRTPSNSSVSRFEGKDGSSTPELVRQT
                     PKFQQPFSTTSHGDNTKNSPAAIGALETQNATSNGKFIPSRPAPKPPGQSAPNNIISP
                     LAASGKPSTPPIQKSSSLVSLPSRKGTIKKDEQPLPPLPPVEVDKIDTKTENKDEKSM
                     PQVPKSSGTQTAPSREASKKAHAALAEKKAEERERRTKQLYAKLAEICTDGDPSKMYL
                     NLTKIGQGASGGVYTAYEVGTNASVAIKQMNLEKQPKKELIINEILVMKGSKHQNIVN
                     FIDSYVLKGDLWVVMEYMEGGSLTDVVTHCILTEAQIGAVCRETLRGLQFLHSKGVIH
                     RDIKSDNILLSMNGEIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVVSRKEYGPKV
                     DIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPEVLSPELKSFLAWCLN
                     VNPDTRASATELLRDVFITQCADENESLAPLVKLARMKKIAEKMDSGDEESGGNGSRE
                     D"
     gene            complement(<494852..>499192)
                     /gene="TDEL0A02730"
                     /locus_tag="TDEL_0A02730"
                     /db_xref="GeneID:11503143"
     mRNA            complement(<494852..>499192)
                     /gene="TDEL0A02730"
                     /locus_tag="TDEL_0A02730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678768.1"
                     /db_xref="GeneID:11503143"
     CDS             complement(494852..499192)
                     /gene="TDEL0A02730"
                     /locus_tag="TDEL_0A02730"
                     /inference="similar to DNA sequence:INSDC:YKL010C"
                     /note="similar to Saccharomyces cerevisiae UFD4 (YKL010C);
                     ancestral locus Anc_2.497"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678816.1"
                     /db_xref="GeneID:11503143"
                     /db_xref="GOA:G8ZLW1"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZLW1"
                     /translation="MEGTQDHDDRHSDNSDYMMEDHSPDENQYGSSDDDYERSSSRYY
                     DEEGDGEDEDEVEEDAYIDDDDDDDNDVEEFVGGTGRSERSYTAHGILGSLAQSLNEN
                     AGEGGDRTRARQGLMNLSEVFPEILSILNDGGHGIGGGRGGRSERIYRLVNNVSNATE
                     DPYMAMESLRELSEHLLMMDQVIIERMLPIEKLLASIVELLSNPLLKGELELQLLSCR
                     CLYNLFEANPESISVAVDHNIITALQDILQEISYIDLAEQVLETLELISRVNARDILR
                     SGGLSTSLQYLDFFTIHAQRKAVGIVSNACSRVQLEDFNIIKELSVILKPVFINAEDQ
                     IMLSKLVNALYGICGAFRHDYMLETLFTIDIVMRISQLIASSETQLDMKLKCLEIISV
                     LVNVSGHISKEFIETGKVANMLSDSFSCYCKSPDAALHETLMFVPKPLLHSVARTIAL
                     LFPAEYEQILSIDIPKDAALKYDDEKLDKLLKELTPLMVEIYMNAVDFEVRRYVLIAL
                     ARISTCLTKSTIKSVDSSIIRLVGSTLAQNESIIDKEQGQAWVASGLVVGVLSLIDIL
                     TMRFAPDVLPQLKREGIFSLLQTLNSTLQRIKDEDGETFDAESLDKSDDLISSGDPES
                     NDEEGDEETELQFGLMDIPDQVEPKKIKFNVLRRLPFKYTCNKMSELSKDLLAMLEEN
                     EETVIEELRDIEELVKFLDAVDIKNFSADSWLQLWTSVKSCTFNGAFEISSFEFVSTG
                     LAAALCRLVEKCGLMNIVAKRTFNEVFGPKIVDLIGILQTALTRLESFRIVECGLPGD
                     EGRVASLGKQVKIKLVYNGDPRKDNISEQLTTITLSIHCISSFNALNEFLRHRIAQTR
                     FLHSLFPGLSTPAGNETDGQSIDEVKNWAFEFSSEDEVFKLSDTIFEAMYTAFKNSGK
                     PLSEVWHTPQVINFKRIDAHESGETKGFSSIYNHDQEFEGKCLKPAGDILILLKFMKV
                     NQLPDDLFINPKLSAKLSRQLEEPLVVASGVLPNWSLQLTKDYFFLFPLETRLFFLQC
                     TSFGYGRLVQLWKNKVGSTKESNTDDPLQHLGRITRHKLRVSRETLFLSGLKILDKYG
                     STASVLEIEYQGEVGTGLGPTLEFYACISREFTRRNLNMWRCENFKSSADVEVPDYVE
                     TSLFPTPLDPSKDNKRVIELFRYLGIFVARSMLDNRILDFYFSRVFFQLTHRRYRTKG
                     KDILVEDIEGGLELLALVDEHLASSLCYLYENREKASELEQMTLTFTLPGLELDLIEN
                     GKDINVTSKNVEEYIKLVLNYTLDVGIRQQLDSFIEGFSVVFPYSSLLILTPEELVEM
                     HGRVEEDWSSSTLYASINADHGYSMGSNSIHELVSIMSSFERQDRRLFLQFLTGSPKL
                     PIGGFKSLKPRLTVVLKHPEDGLGPDAYLPSVMTCANYFKLPKYSSGEMMRSRIVQAM
                     NEGSQAFLLS"
     gene            <499488..>500204
                     /gene="TDEL0A02740"
                     /locus_tag="TDEL_0A02740"
                     /db_xref="GeneID:11503076"
     mRNA            <499488..>500204
                     /gene="TDEL0A02740"
                     /locus_tag="TDEL_0A02740"
                     /product="mRNA turnover protein MRT4"
                     /transcript_id="XM_003678769.1"
                     /db_xref="GeneID:11503076"
     CDS             499488..500204
                     /gene="TDEL0A02740"
                     /locus_tag="TDEL_0A02740"
                     /inference="similar to DNA sequence:INSDC:YKL009W"
                     /note="similar to Saccharomyces cerevisiae MRT4 (YKL009W);
                     ancestral locus Anc_2.498"
                     /codon_start=1
                     /product="mRNA turnover protein MRT4"
                     /protein_id="XP_003678817.1"
                     /db_xref="GeneID:11503076"
                     /db_xref="GOA:G8ZLW2"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="UniProtKB/TrEMBL:G8ZLW2"
                     /translation="MPRSKRSKLVTLANTEKKGRENKERIFDEVREALDTYRYVWVLH
                     LDDVRTPVLQEIRTGWAGSKLILGKRKVLEKALGLNREDEYSENLHKLTRHCGGVTGL
                     LFTDEDVNVVKEYFQSYTRSDYSRPNSRAPLTFTIPAGIIYSRGGQIPTEEDVPMVHS
                     LEPTLRNKFQIPTKIKAGKITIESPYTVCEEGEKLDVRKALILKQFGIADAQFKVKVA
                     AYYDKESSDVKKVGINMDQA"
     gene            complement(<500267..>500743)
                     /gene="TDEL0A02750"
                     /locus_tag="TDEL_0A02750"
                     /db_xref="GeneID:11503062"
     mRNA            complement(<500267..>500743)
                     /gene="TDEL0A02750"
                     /locus_tag="TDEL_0A02750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678770.1"
                     /db_xref="GeneID:11503062"
     CDS             complement(500267..500743)
                     /gene="TDEL0A02750"
                     /locus_tag="TDEL_0A02750"
                     /inference="similar to DNA sequence:INSDC:YHL006C"
                     /note="similar to Saccharomyces cerevisiae SHU1 (YHL006C);
                     ancestral locus Anc_2.499"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678818.1"
                     /db_xref="GeneID:11503062"
                     /db_xref="UniProtKB/TrEMBL:G8ZLW3"
                     /translation="MSIDQQISQLLSQERCGESRKQTLIFVMGENARTHIEKGLSSEP
                     GKLSSVMAVSRSRQDIDVLFLSRLQYLFMYLMKFEAVETANGIKYNHFVIYGLDDGIM
                     SMERPMQLRLANLICNAAFRIKRKHDLLDVIMIPWDEQSATAKELAKVEEYWRHIC"
     gene            <500918..>502132
                     /gene="TDEL0A02760"
                     /locus_tag="TDEL_0A02760"
                     /db_xref="GeneID:11503142"
     mRNA            <500918..>502132
                     /gene="TDEL0A02760"
                     /locus_tag="TDEL_0A02760"
                     /product="mitochondrial 37S ribosomal protein MRP4"
                     /transcript_id="XM_003678771.1"
                     /db_xref="GeneID:11503142"
     CDS             500918..502132
                     /gene="TDEL0A02760"
                     /locus_tag="TDEL_0A02760"
                     /inference="similar to DNA sequence:INSDC:YHL004W"
                     /note="similar to Saccharomyces cerevisiae MRP4 (YHL004W);
                     ancestral locus Anc_2.500"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRP4"
                     /protein_id="XP_003678819.1"
                     /db_xref="GeneID:11503142"
                     /db_xref="GOA:G8ZLW4"
                     /db_xref="InterPro:IPR001865"
                     /db_xref="InterPro:IPR005706"
                     /db_xref="InterPro:IPR018130"
                     /db_xref="InterPro:IPR023591"
                     /db_xref="UniProtKB/TrEMBL:G8ZLW4"
                     /translation="MSVVIPSRRLLSARTFTRFLTRSQSTATNGPLVSKTIEKQPEAE
                     KPIGDEVLSLRQRQFNDQIVEQLKALSETPLDEIDKLGVDVNGTLTEREKQLDEELTD
                     FLRKYSQLNRLINTEENSEGEAQRSFQAAAAQNKRYPYLVPSARDKPYTSQELFLRQM
                     KHAQHTAKLGANIEKVYFPHKDVQSPPSAEKVSINKLLAAGVHLGQSTSLWRSTTQPF
                     IYGEYRGIHIIDLNKTLAYLKRAAKVVEGVAERGGIILFLGTREGQKRALEEAAKKTH
                     GFYICTRWIPGTLTNSTEISGVWERHEVDFADKPTGRVLTTDEIAAIVKPDLLVILNP
                     TENRNALNEAMQVRIPTIGIIDTDSEPSIVTYPIPGNDDSPRSVNLLLGVLAKAGERG
                     LQNRLQKVAQIK"
     gene            complement(<502295..>503608)
                     /gene="TDEL0A02770"
                     /locus_tag="TDEL_0A02770"
                     /db_xref="GeneID:11502724"
     mRNA            complement(<502295..>503608)
                     /gene="TDEL0A02770"
                     /locus_tag="TDEL_0A02770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678772.1"
                     /db_xref="GeneID:11502724"
     CDS             complement(502295..503608)
                     /gene="TDEL0A02770"
                     /locus_tag="TDEL_0A02770"
                     /inference="similar to DNA sequence:INSDC:YHL003C,YKL008C"
                     /note="similar to Saccharomyces cerevisiae LAG1 (YHL003C)
                     and LAC1 (YKL008C); ancestral locus Anc_2.501"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678820.1"
                     /db_xref="GeneID:11502724"
                     /db_xref="GOA:G8ZLW5"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="InterPro:IPR013599"
                     /db_xref="InterPro:IPR016439"
                     /db_xref="UniProtKB/TrEMBL:G8ZLW5"
                     /translation="MSAPPPLKPMTSANRLTVKTRSRRTSSVGKIDLGDTVPGIGTMS
                     ETRESRDDSNKRMKALAEAKENDMALLQKFWLTYRELSYRHAWLTPLMIMAIVYTAYF
                     TSGNRTEKNPLHMFVAVSYRIRDTDMYGKGIKDLCFVFFYMIFFTFLREFLMECVIRP
                     ITIALGVTSHHKVKRMMEQVYAIIYYGFSGPAGLYIMYHSDLWLFKTAPMYRTYPDLL
                     NHYHFKVFYLAQAAFWAQQACVLVLQLEKPRKDYKELVFHHIITLLLIWSSYVFHFTK
                     IGLEIYITMDVSDFFLSLSKTCNYLDSALTAPVFMTFVASWVYLRHYVNLRILWSVLT
                     EFRTEGNYVLNFATQQYKCWISLPIVFVLIAALQLVNLYWLGCIGRILYRLLWKGIQK
                     DERSDSESDDEEEVDNEQKNSKPITETDNINIQDIPRDVKHEKAH"
     gene            <504696..>506051
                     /gene="TDEL0A02780"
                     /locus_tag="TDEL_0A02780"
                     /db_xref="GeneID:11502688"
     mRNA            <504696..>506051
                     /gene="TDEL0A02780"
                     /locus_tag="TDEL_0A02780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678773.1"
                     /db_xref="GeneID:11502688"
     CDS             504696..506051
                     /gene="TDEL0A02780"
                     /locus_tag="TDEL_0A02780"
                     /inference="similar to DNA sequence:INSDC:YHL002W"
                     /note="similar to Saccharomyces cerevisiae HSE1 (YHL002W);
                     ancestral locus Anc_2.502"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678821.1"
                     /db_xref="GeneID:11502688"
                     /db_xref="GOA:G8ZLW6"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="UniProtKB/TrEMBL:G8ZLW6"
                     /translation="MSITRSILRATDGNLRTDNWQYILDVCDRVREDPEDGGEEAIEV
                     IEERLEQKDANVILRTLTLIVSLAENCGSRLKQLISSKHFTRQLYSLIESKSIHVTVK
                     RETAKMVKQLSLSFKDDPSLRCMGDLLSRISSVAPHLVETEQPNVPSKKEMSADSKQK
                     EDQDFEEALKLSLAEYERQQQHEQQQQQQQQRNQQPVVAANIQPEQPVQTISNQGEAK
                     SSAPAVIRKVRAMYDLSSEEPDELSFRKGDVIVVLEQVYRDWWRGTLCGKVGIFPLNY
                     VTPIEEPSAEELEAEKRKEDALFSQKANIDQLYYTLENSKACGNGDLTQNPTINDMYG
                     SITPLRPQVAKTIGKYARKREDLASLRQVLATAEATYNQLLDRATNAYTSPVPQQYAS
                     LAGRGPTMAPYGGERPQGQFYGRVPTQPATRPEFAQSNYVQPQQSPYAPQDQHRGQYM
                     Q"
     gene            <506257..>507048
                     /gene="TDEL0A02790"
                     /locus_tag="TDEL_0A02790"
                     /db_xref="GeneID:11502949"
     mRNA            <506257..>507048
                     /gene="TDEL0A02790"
                     /locus_tag="TDEL_0A02790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678774.1"
                     /db_xref="GeneID:11502949"
     CDS             506257..507048
                     /gene="TDEL0A02790"
                     /locus_tag="TDEL_0A02790"
                     /inference="similar to DNA sequence:INSDC:YKL007W"
                     /note="similar to Saccharomyces cerevisiae CAP1 (YKL007W);
                     ancestral locus Anc_2.503"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678822.1"
                     /db_xref="GeneID:11502949"
                     /db_xref="GOA:G8ZLW7"
                     /db_xref="InterPro:IPR002189"
                     /db_xref="InterPro:IPR017865"
                     /db_xref="UniProtKB/TrEMBL:G8ZLW7"
                     /translation="MSSTAFDSIIEQIVSDSPSGEILEVYNDLLAIVGESAKESILDA
                     IEQYNVKNTVAVDVDGNSVLLSKYNKEGTKFYDPANGISFSVDHLNRKGLDVGPYSVK
                     LTEEQQSLLESLQKYASTNFSGDVTLAVYPIADSNKVVIILISTRNNPSNFYNGNWKS
                     EYIYDIDSTELTGTIDVHVHYYEDGNVSFRSNKEVEIIKTKDVVKTIQEIEKDFEDLL
                     DVSFSELNEKKFKTLRRRLPITRSKVNWGKAIGTYRLGKDAAQGN"
     gene            complement(<507060..>507408)
                     /gene="TDEL0A02800"
                     /locus_tag="TDEL_0A02800"
                     /db_xref="GeneID:11503329"
     mRNA            complement(join(<507060..507317,507373..>507408))
                     /gene="TDEL0A02800"
                     /locus_tag="TDEL_0A02800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678775.1"
                     /db_xref="GeneID:11503329"
     CDS             complement(join(507060..507317,507373..507408))
                     /gene="TDEL0A02800"
                     /locus_tag="TDEL_0A02800"
                     /inference="similar to DNA sequence:INSDC:YKL006C-A"
                     /note="similar to Saccharomyces cerevisiae SFT1
                     (YKL006C-A); ancestral locus Anc_2.504"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678823.1"
                     /db_xref="GeneID:11503329"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:G8ZLW8"
                     /translation="MSSSRYTQVENRNDQKLESLAGKLATFRGINQEIGDEAAADSSV
                     MNQISNSFDSMLNNVRHSSQRLTRSMNAGNNVWRMVGLAMLLFFIIYTLYKLF"
     gene            <508428..>508844
                     /gene="TDEL0A02810"
                     /locus_tag="TDEL_0A02810"
                     /db_xref="GeneID:11502805"
     mRNA            <508428..>508844
                     /gene="TDEL0A02810"
                     /locus_tag="TDEL_0A02810"
                     /product="60S ribosomal protein L14"
                     /transcript_id="XM_003678776.1"
                     /db_xref="GeneID:11502805"
     CDS             508428..508844
                     /gene="TDEL0A02810"
                     /locus_tag="TDEL_0A02810"
                     /inference="similar to DNA sequence:INSDC:YHL001W,YKL006W"
                     /note="similar to Saccharomyces cerevisiae RPL14B
                     (YHL001W) and RPL14A (YKL006W); ancestral locus Anc_2.505"
                     /codon_start=1
                     /product="60S ribosomal protein L14"
                     /protein_id="XP_003678824.1"
                     /db_xref="GeneID:11502805"
                     /db_xref="GOA:G8ZLW9"
                     /db_xref="InterPro:IPR002784"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:G8ZLW9"
                     /translation="MSTDSTVKTSNWRLVEVGRVVLVTKGQAAGKLAAIVEIIDQKKV
                     LIDGPQSGVPRQAINLGQVVLTPLTFTLPRGARTSTVSKKWTSANVTEKWNATSWAKK
                     IAQRERRSALSDFERFQVMVLRKQKRYTVKKALAKA"
     gene            complement(<509035..>510741)
                     /gene="TDEL0A02820"
                     /locus_tag="TDEL_0A02820"
                     /db_xref="GeneID:11503121"
     mRNA            complement(<509035..>510741)
                     /gene="TDEL0A02820"
                     /locus_tag="TDEL_0A02820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678777.1"
                     /db_xref="GeneID:11503121"
     CDS             complement(509035..510741)
                     /gene="TDEL0A02820"
                     /locus_tag="TDEL_0A02820"
                     /inference="similar to DNA sequence:INSDC:YKL005C"
                     /note="similar to Saccharomyces cerevisiae BYE1 (YKL005C);
                     ancestral locus Anc_2.506"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678825.1"
                     /db_xref="GeneID:11503121"
                     /db_xref="GOA:G8ZLX0"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003618"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:G8ZLX0"
                     /translation="MSIRTSSRSTKGQNKYLQSMLEEEPEPYYKGQQNGAEKANEDDD
                     NEDGDEGIVRCPVCGTNDDNYDAENDAYGDMVQCDGCNSWQHIRCMTNGQDSVNCLLD
                     KDGKYHCDQCDPSRYSQLSEHEDQEFKLNNEDTRFMDDNFDDHNDEDDDEPVGGKRRR
                     SRQQSRRSVSNGEGDHSVKRKKSLAASDDREGEARLRQNALKMFNDLFSKYIIPDTIE
                     AEVYQLPNDIEENQDLADNMSKNLESELYEACLDKENNRLGKFYPEKVRSIFSNLKDK
                     KNLTLKTHVVNGSLPLSKLATMSAQELANPDLQAFKEKVDSQSLDQLIIEQPNKPRWV
                     KTHKGEELIEDENEFQENDMVYAKHVVTHHEEPDINIRNVSIPPGDPLATADQPDTKQ
                     EPEKVVQKEVLPDNNEVRVSYPEIDNEFLGNVTYLGSSKELENNPYKTAFGDAQLFVE
                     GRLSRGKVLSYLHETQSSRTLLLYELIPKDDWNMEEYESAANFKKMHSFLINNDKIIG
                     IKNKRRYEKNIYLIPSEGNESCFAIESILEKNNSRSSLSDNEKKLYLLVLVKPELLSQ
                     AR"
     gene            <511642..>512889
                     /gene="TDEL0A02830"
                     /locus_tag="TDEL_0A02830"
                     /db_xref="GeneID:11502752"
     mRNA            <511642..>512889
                     /gene="TDEL0A02830"
                     /locus_tag="TDEL_0A02830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678778.1"
                     /db_xref="GeneID:11502752"
     CDS             511642..512889
                     /gene="TDEL0A02830"
                     /locus_tag="TDEL_0A02830"
                     /inference="similar to DNA sequence:INSDC:YKL004W"
                     /note="similar to Saccharomyces cerevisiae AUR1 (YKL004W);
                     ancestral locus Anc_2.507"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678826.1"
                     /db_xref="GeneID:11502752"
                     /db_xref="GOA:G8ZLX1"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:G8ZLX1"
                     /translation="MADALRRFFLSDKPSYSHVADLETRFNPKITFAKLQRYKPTVKD
                     VCHYSFLGSVFLFVFVANPAPWTYKILFYCFLALLFIIPVTSQFFFNALPILTWLALY
                     FTSSYFPASHRPKITVKVLPAVETILYGDNLSDILATSTNTFLDILAWIPYGLFHFGA
                     PFVVAAILFLFGPPTVLRGYAFAFGYMNLFGVIIQNAFPAAPPWYKILYGLESAHYGM
                     HGSPGGLARIDHLLGINLYTSGFSNSSVIFGAFPSLHSGCATMEALFFSYCFPKLRPI
                     FIGYVCWLWWSTMYLTHHYFVDLVAGSVLSYIIFQYTKYTHLPVDTSLFSRWSYASVE
                     TYDMDKMNPLRADANDVENVPLSNLELDFELNSMDEASRTPSIFDGPTSTSRSSATSN
                     TSLAEFQHDYAGASPRLNKPRFE"
     gene            complement(<513249..>513638)
                     /gene="TDEL0A02840"
                     /locus_tag="TDEL_0A02840"
                     /db_xref="GeneID:11503132"
     mRNA            complement(<513249..>513638)
                     /gene="TDEL0A02840"
                     /locus_tag="TDEL_0A02840"
                     /product="mitochondrial 37S ribosomal protein YmS16"
                     /transcript_id="XM_003678779.1"
                     /db_xref="GeneID:11503132"
     CDS             complement(513249..513638)
                     /gene="TDEL0A02840"
                     /locus_tag="TDEL_0A02840"
                     /inference="similar to DNA sequence:INSDC:YKL003C"
                     /note="similar to Saccharomyces cerevisiae MRP17
                     (YKL003C); ancestral locus Anc_2.508"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein YmS16"
                     /protein_id="XP_003678827.1"
                     /db_xref="GeneID:11503132"
                     /db_xref="GOA:G8ZLX2"
                     /db_xref="InterPro:IPR000529"
                     /db_xref="InterPro:IPR014717"
                     /db_xref="UniProtKB/TrEMBL:G8ZLX2"
                     /translation="MLYELVGIVRVVNPSAVNKEAKDLATTIGKLVIQNRGVVRKILP
                     MGSKLLPKIMRKDQEQHFQGYHFLMLFDSSAAVQSEILRTLKNDPRVIRSSIVRVNYD
                     KQLDVASSLERSSGYNSILEKVSRDFM"
     gene            <513904..>514668
                     /gene="TDEL0A02850"
                     /locus_tag="TDEL_0A02850"
                     /db_xref="GeneID:11502762"
     mRNA            join(<513904..513963,514033..>514668)
                     /gene="TDEL0A02850"
                     /locus_tag="TDEL_0A02850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678780.1"
                     /db_xref="GeneID:11502762"
     CDS             join(513904..513963,514033..514668)
                     /gene="TDEL0A02850"
                     /locus_tag="TDEL_0A02850"
                     /inference="similar to DNA sequence:INSDC:YKL002W"
                     /note="similar to Saccharomyces cerevisiae DID4 (YKL002W);
                     ancestral locus Anc_2.509"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678828.1"
                     /db_xref="GeneID:11502762"
                     /db_xref="GOA:G8ZLX3"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:G8ZLX3"
                     /translation="MNLFEWAFGKSITPQERLKKNQRALERTQRELDREKRKLETQEK
                     KLIADIKRSAKNGQVTAAKVQARDLVRTKNYIQKFDNMKTQLQAISLRIQAVRSSDQM
                     TRSMREATVLLAGMNRSMNLPQLQRISMEFEKQNDLMDQRQEFMDESIDNVMGDELDE
                     DEEAEEIVNKVLDEIGVDLNAQLQNTPQNVVASSNLSESGHRVAEPVGAGAEGQSANL
                     DDDLQARLNSLKR"
     gene            complement(<514765..>515373)
                     /gene="TDEL0A02860"
                     /locus_tag="TDEL_0A02860"
                     /db_xref="GeneID:11503086"
     mRNA            complement(<514765..>515373)
                     /gene="TDEL0A02860"
                     /locus_tag="TDEL_0A02860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678781.1"
                     /db_xref="GeneID:11503086"
     CDS             complement(514765..515373)
                     /gene="TDEL0A02860"
                     /locus_tag="TDEL_0A02860"
                     /inference="similar to DNA sequence:INSDC:YKL001C"
                     /note="similar to Saccharomyces cerevisiae MET14
                     (YKL001C); ancestral locus Anc_2.510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678829.1"
                     /db_xref="GeneID:11503086"
                     /db_xref="GOA:G8ZLX4"
                     /db_xref="InterPro:IPR002891"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLX4"
                     /translation="MATNITWHHNLVYDERKALRKQEGCTIWLTGLSASGKSTIACAL
                     EQLLLQKDIAAYRLDGDNIRFGLNKDLGFSEKDRNENIRRISEVSKLFADSCTISITS
                     FISPYRVDRERARELHKESGLKFIEVFVDVPLEVAEKRDPKGLYKKAREGVIKEFTGI
                     SAPYEAPQSPEIHLRTDLKSVEECAAVIYEYLVREKLVDQDA"
     gene            complement(<516179..>518272)
                     /gene="TDEL0A02870"
                     /locus_tag="TDEL_0A02870"
                     /db_xref="GeneID:11503088"
     mRNA            complement(<516179..>518272)
                     /gene="TDEL0A02870"
                     /locus_tag="TDEL_0A02870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678782.1"
                     /db_xref="GeneID:11503088"
     CDS             complement(516179..518272)
                     /gene="TDEL0A02870"
                     /locus_tag="TDEL_0A02870"
                     /inference="similar to DNA sequence:INSDC:YKR001C"
                     /note="similar to Saccharomyces cerevisiae VPS1 (YKR001C);
                     ancestral locus Anc_2.511"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678830.1"
                     /db_xref="GeneID:11503088"
                     /db_xref="GOA:G8ZLX5"
                     /db_xref="InterPro:IPR000375"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR003130"
                     /db_xref="InterPro:IPR019762"
                     /db_xref="InterPro:IPR020850"
                     /db_xref="InterPro:IPR022812"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZLX5"
                     /translation="MDEHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSS
                     VLENIVGRDFLPRGTGIVTRRPLVLQLINRRVKKEDHSVKSAANELIDLHVNDDKNQI
                     NHKGQSEDNAEEWGEFLHLPGKKFYNFDEIRQEIVKETDKLTGANSGISSIPINLRIY
                     SPHILTLTLVDLPGLTKVPVGDQPPDIEKQIKDMLLKYISKPNSIILSVNAANTDLAN
                     SDGLKLAREVDPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKD
                     IEKKKTIREALQDEKRFFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKAK
                     IEATLKKYQNELYNLGPENMDSPNSVVLSMITDFSNEYAGILDGEAKELSSQELSGGA
                     RVSFVFHEVFKNGVDALDPFDQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIK
                     RFEEPSLRLVSLIFDELVRMLKQIISQTKYGRYPALREAISNQFIEFLKEAIVDTNSF
                     VVDIINAEQTYINTAHPDLLKGSQAMATVEEKLHPRQVAVDPKTGKPIPGQPATAKPP
                     AIEEKSGFFGGFFSTKNKKKLAALESPPPVLKATGQMTERETLETEVIKLLISSYFGI
                     VKRTVADVIPKALMLKLIVKSKRDIQKVLLEKLYGNQDISELTKENDITIQRRKECKR
                     MVEILRHASDIVSSV"
     gene            <518875..>520623
                     /gene="TDEL0A02880"
                     /locus_tag="TDEL_0A02880"
                     /db_xref="GeneID:11502924"
     mRNA            <518875..>520623
                     /gene="TDEL0A02880"
                     /locus_tag="TDEL_0A02880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678783.1"
                     /db_xref="GeneID:11502924"
     CDS             518875..520623
                     /gene="TDEL0A02880"
                     /locus_tag="TDEL_0A02880"
                     /inference="similar to DNA sequence:INSDC:YKR002W"
                     /note="similar to Saccharomyces cerevisiae PAP1 (YKR002W);
                     ancestral locus Anc_2.512"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678831.1"
                     /db_xref="GeneID:11502924"
                     /db_xref="GOA:G8ZLX6"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="InterPro:IPR007010"
                     /db_xref="InterPro:IPR007012"
                     /db_xref="InterPro:IPR011068"
                     /db_xref="InterPro:IPR014492"
                     /db_xref="UniProtKB/TrEMBL:G8ZLX6"
                     /translation="MNYQKVYGITGPVSTAGSTAAENKLNDGLIQELKKEGSFESEQE
                     TENRVKVLKTLQELTQEFVYRVSKKKNMSDGMARDAGGKVFPYGSYRLGVHGPGSDID
                     TLVVVPKHVTREDFFTVFDELLRGRQELEEIAAVPDAFVPIIKMKFSGISIDLICAHL
                     DLAQIPQSLTLADKNLLRNLDEKDLRALNGTRVTDEILELVPKPIVFRIALRAIKLWA
                     QRRAIYANVFGFPGGVAWAMLVARICQLYPNACSAVILNRFFKILSEWKWPQPVVLKP
                     IEDGPLQVRVWNPKIYAQDRSHRMPVITPAYPSMCATHNITESTKKVILGELGRGIRI
                     TNDIFTNKKTWADLFQRHTFFHEYKFYLTVMAATNGDSEQHLKWSGMVESKVRLLVLK
                     LEALTGIKIAHPYTKPFETAYYYHNEEERKKIVDNYGTYKTEDVLKEFKKVTDENKDD
                     PDVKDLPKVYITTMYIGLDVNVEDKKEKIDIHVPCNEFFNLCRNFSEEYQDSNTYSLV
                     IKYVKQYDLPSDVYEEGEARPVKKKSKRKKLEKATANTKRPKSELSDTKEPSGSVATD
                     ERDANQSSSVAEATQA"
     gene            <520977..>522287
                     /gene="TDEL0A02890"
                     /locus_tag="TDEL_0A02890"
                     /db_xref="GeneID:11502902"
     mRNA            <520977..>522287
                     /gene="TDEL0A02890"
                     /locus_tag="TDEL_0A02890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678784.1"
                     /db_xref="GeneID:11502902"
     CDS             520977..522287
                     /gene="TDEL0A02890"
                     /locus_tag="TDEL_0A02890"
                     /inference="similar to DNA sequence:INSDC:YHR001W,YKR003W"
                     /note="similar to Saccharomyces cerevisiae OSH7 (YHR001W)
                     and OSH6 (YKR003W); ancestral locus Anc_2.513"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678832.1"
                     /db_xref="GeneID:11502902"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR018494"
                     /db_xref="UniProtKB/TrEMBL:G8ZLX7"
                     /translation="MPLNKLRPKSLNDSSVSSISESTYADDPVDTDDLDENDESGQNI
                     LLNIISQLKPGCDLSRITLPTFILEKKSMLERITNQLQFPDLVLDAHQEKDELQRFVK
                     VVKWYLAGWHIAPKAVKKPLNPVLGEHFTCYWDLPNKQQAYYISEQTSHHPPESAYFY
                     MIPESSIRVDGVCIPKSKFLGNSTAAMMAGLTVLQFLDMMNSNGKPEKYTLSQPNMYA
                     RGILFGKMRLELGDHMIIKGPKYKIDIEFKTKGFISGTYDAIAGVVKDLNGKEYYEIT
                     GKWNDIMYIKDLRDKHSKKIVLFDAHKSKVSKPSVRPLEEQGEFESRRLWKKVTDALA
                     ARDHEVATDEKFKIENYQRELAKKRVQDGVEFYPKLFRRAKPGEDLDYYIYKHIPEGN
                     DYEEQIKSILEIAPILPGQHFTEKFAIPAFKKSEIQEKELSQTP"
     gene            complement(<522358..>523561)
                     /gene="TDEL0A02900"
                     /locus_tag="TDEL_0A02900"
                     /db_xref="GeneID:11503033"
     mRNA            complement(join(<522358..523259,523336..>523561))
                     /gene="TDEL0A02900"
                     /locus_tag="TDEL_0A02900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678785.1"
                     /db_xref="GeneID:11503033"
     CDS             complement(join(522358..523259,523336..523561))
                     /gene="TDEL0A02900"
                     /locus_tag="TDEL_0A02900"
                     /inference="similar to DNA sequence:INSDC:YKR004C"
                     /note="similar to Saccharomyces cerevisiae ECM9 (YKR004C);
                     ancestral locus Anc_2.514"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678833.1"
                     /db_xref="GeneID:11503033"
                     /db_xref="UniProtKB/TrEMBL:G8ZLX8"
                     /translation="MSFETPLCEELYQVLLYKPEVSDYRLTFVPGKADGNHHFLIHEE
                     EGQVEAICFKYTLLAVFEESHRILAQIQNGNFNNRSQSDVYISTLGFFLATPENRSAL
                     NLHEKAFYELLRRSNDFESLKLLKQELAIVERLLTSTNNRLNKSSSLWCLYRKLSVIS
                     KVLNFENPNLISVFIHSGNRHISNYYCWNSVRWFFDVVSLTEKDRLFEATQMFCFKNI
                     KDASSWSTFSYMVCQQSRKSCFNLTDCERLGKHIGLKESHVGNPGWLVLNVETVAKRI
                     LNLIDTASAADWPPYHCLLAIYNEFPKAVTPVIPPSWSEDIIIFEKKHKAICLLRNNP
                     LIPKEFADDLLISSNFRHLGYKKLLIQKLHKLNQNNITLTS"
     gene            complement(<523812..>524594)
                     /gene="TDEL0A02910"
                     /locus_tag="TDEL_0A02910"
                     /db_xref="GeneID:11503321"
     mRNA            complement(<523812..>524594)
                     /gene="TDEL0A02910"
                     /locus_tag="TDEL_0A02910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678786.1"
                     /db_xref="GeneID:11503321"
     CDS             complement(523812..524594)
                     /gene="TDEL0A02910"
                     /locus_tag="TDEL_0A02910"
                     /inference="similar to DNA sequence:INSDC:YKR006C"
                     /note="similar to Saccharomyces cerevisiae MRPL13
                     (YKR006C); ancestral locus Anc_2.516"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678834.1"
                     /db_xref="GeneID:11503321"
                     /db_xref="GOA:G8ZLX9"
                     /db_xref="InterPro:IPR018305"
                     /db_xref="UniProtKB/TrEMBL:G8ZLX9"
                     /translation="MIRYTRIPRLNYLGAGSLLPSARQLHTTKVSSDFFSWFKSKKNQ
                     DQEPTVPTKGTQELISDIEAGKTSKISNKQKLELIPENFIGEEEGELAEKARAKQIKG
                     VPFNRWLSAKKVANEAQLDALLIESYNNAWNGSKITSATDSKLEGTFPDLVIKFNFTK
                     SLQASSGYLIPDYQLTILNTPAQFKNYICKEILSGKQARYKESEPNAIHLSSAQFTSP
                     NIYIVPDVKPKAQKNTYRKIIREVNILEAESARRAIEQARQS"
     gene            <524813..>525310
                     /gene="TDEL0A02920"
                     /locus_tag="TDEL_0A02920"
                     /db_xref="GeneID:11502965"
     mRNA            <524813..>525310
                     /gene="TDEL0A02920"
                     /locus_tag="TDEL_0A02920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678787.1"
                     /db_xref="GeneID:11502965"
     CDS             524813..525310
                     /gene="TDEL0A02920"
                     /locus_tag="TDEL_0A02920"
                     /inference="similar to DNA sequence:INSDC:YKR007W"
                     /note="similar to Saccharomyces cerevisiae MEH1 (YKR007W);
                     ancestral locus Anc_2.517"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678835.1"
                     /db_xref="GeneID:11502965"
                     /db_xref="GOA:G8ZLY0"
                     /db_xref="InterPro:IPR028209"
                     /db_xref="UniProtKB/TrEMBL:G8ZLY0"
                     /translation="MGVIASCCRDSDADENEALLASQNGHGDHNDDYNAVQRQMKEQE
                     EQLRARENMLKEIVANTNDKLIDISMISNSGIVIQGTDLKNPESSYEPEASHGSITDN
                     ANAEHDEDGHKIHTRPRFVTLETNTAMSDEMKSKLKQLHETIFTTLDEQLRVEPTGKL
                     TVTLK"
     gene            <525470..>527140
                     /gene="TDEL0A02930"
                     /locus_tag="TDEL_0A02930"
                     /db_xref="GeneID:11502567"
     mRNA            <525470..>527140
                     /gene="TDEL0A02930"
                     /locus_tag="TDEL_0A02930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678788.1"
                     /db_xref="GeneID:11502567"
     CDS             525470..527140
                     /gene="TDEL0A02930"
                     /locus_tag="TDEL_0A02930"
                     /inference="similar to DNA sequence:INSDC:YKR008W"
                     /note="similar to Saccharomyces cerevisiae RSC4 (YKR008W);
                     ancestral locus Anc_2.518"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678836.1"
                     /db_xref="GeneID:11502567"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="UniProtKB/TrEMBL:G8ZLY1"
                     /translation="MAIKPKRKAPEEEEPEKPAKVVAGKQPRMGDLPNVDYNIPLFPE
                     SELHQDEWSIPKFNLFISFTINYLLESYKSVFKDFIKLPSRKFHPQYYYRVQQPISIN
                     EIKSRDYEFPDGPHTFLLDVELLAKNCASYNESGSLIVKNSLQMVQYIEYEVLKAKNV
                     TRNYLVSDDVRPRLLSHLNRVIDATDREIEIEYGATKTDADDTMKISEPFMELVSKEE
                     LPDYYEVIHRPCALSLVKQNLEVGYYSKIYDFIIDTQSVFQNALVFNDSSTLIYQDAQ
                     KLLNYFNHLIQDKFFPELRDASERGEIKLEYDKIEYEQYLADGGNDHTEDVQEEDDEA
                     DYDFNHFEGLGNGYNRSVLSEDYLLGPNRAETTNKIQKLSTPIEEPPRVPKYNIITSM
                     QREFISEEHTMEKVPYHLIDQVCIFSSKSLYRQATTPVVGGKPSCNQNWVEYIFNGDQ
                     LSQNENMFSLTLQPVQTFLTLTAKVSDRKTDVSLSLNKEDIKSQRATSSGPKPESPQE
                     KVEQGKDLSEPEKFDIRLNEGLNYAELKCQNTASEKRELMRFWINVLP"
     gene            <527335..>528543
                     /gene="TDEL0A02940"
                     /locus_tag="TDEL_0A02940"
                     /db_xref="GeneID:11502881"
     mRNA            <527335..>528543
                     /gene="TDEL0A02940"
                     /locus_tag="TDEL_0A02940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678789.1"
                     /db_xref="GeneID:11502881"
     CDS             527335..528543
                     /gene="TDEL0A02940"
                     /locus_tag="TDEL_0A02940"
                     /note="ancestral locus Anc_2.519"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678837.1"
                     /db_xref="GeneID:11502881"
                     /db_xref="GOA:G8ZLY2"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8ZLY2"
                     /translation="MKLLANIRRLLHRRYIRATVGLLIVTPIVLLCIHGSNKILLNGP
                     DTAQHDLQIITTDGPRIYADDHSKGNDILLTLVRNSELTDMIDTIERFEKSFNSKYHY
                     QWWFMNDEEFTDEFKEAVELKVSGGARFIRVPTEMWSYPPNIDQKKAAASRENYKKQK
                     INYGSSESYRFMCRFNSGLFYKLPELVDIEYYWRIEPSVHFDCEITYDVFKYMRANKK
                     LYAFNMALQEDIRTIPSLWNATMNFFRQNSQYVASKNNAKFITDDDGSTYNLCHFWSN
                     FEIASLGFYRSQAYEDFFKFLDSEGGFFYERWGDAPVHTLAASYMIPAESLHFVANTG
                     YMHSPNQDCPPDAEIRDVLHCECSPKRDFTWHEWSCVNKFFEVNGYVKPNTMANLKKA
                     YPYIFNSMVA"
     gene            <528919..>529229
                     /gene="TDEL0A02950"
                     /locus_tag="TDEL_0A02950"
                     /db_xref="GeneID:11503268"
     mRNA            join(<528919..528927,529002..>529229)
                     /gene="TDEL0A02950"
                     /locus_tag="TDEL_0A02950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678790.1"
                     /db_xref="GeneID:11503268"
     CDS             join(528919..528927,529002..529229)
                     /gene="TDEL0A02950"
                     /locus_tag="TDEL_0A02950"
                     /inference="similar to DNA sequence:INSDC:YHR001W-A"
                     /note="similar to Saccharomyces cerevisiae QCR10
                     (YHR001W-A); ancestral locus Anc_2.520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678838.1"
                     /db_xref="GeneID:11503268"
                     /db_xref="InterPro:IPR019182"
                     /db_xref="UniProtKB/TrEMBL:G8ZLY3"
                     /translation="MVSYVSKLATKTYPYMGKMNSSNLLSYLPNLAIWGAASTAGTFV
                     FTAGWPKFQDTFYKKIPVLGSYWDKEIPPEDRIN"
     gene            complement(<529484..>532192)
                     /gene="TDEL0A02960"
                     /locus_tag="TDEL_0A02960"
                     /db_xref="GeneID:11503167"
     mRNA            complement(<529484..>532192)
                     /gene="TDEL0A02960"
                     /locus_tag="TDEL_0A02960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678791.1"
                     /db_xref="GeneID:11503167"
     CDS             complement(529484..532192)
                     /gene="TDEL0A02960"
                     /locus_tag="TDEL_0A02960"
                     /inference="similar to DNA sequence:INSDC:YKR009C"
                     /note="similar to Saccharomyces cerevisiae FOX2 (YKR009C);
                     ancestral locus Anc_2.521"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678839.1"
                     /db_xref="GeneID:11503167"
                     /db_xref="GOA:G8ZLY4"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:G8ZLY4"
                     /translation="MSERLLFKDRVVVITGAGGGLGKVYALEYAKRGAKVVVNDLGGT
                     LGGSGSNSRAADVVVDEIKNAGGEAVANYDSVNDNGERIIKTAIDNFGRVDILINNAG
                     ILRDVSFARMSEKEFGSVVDVHLNGGYKLCKAAWPYMLSQKFGRIINTASPAGLFGNF
                     GQANYSAAKLGLVGLAETLAKEGYKYNIRVNSIAPLARSRMTENVLPPHILKQLGPEK
                     IVPLILFLTHETTQVTNSIFELAAGFYGQLRWERSAGQIFNPNPETFTPEAILNKWKC
                     IVDFKDKPFNKVQHPIQLSDYNDLITKAKKLPAQNDQGSIKVDSLRGKVVIITGAASG
                     LGKSHALWFARYGAKVVINDIRNANGAVEEINQKFGDGTAVADNHDIVTQAPQIIEEA
                     LKKFGRVDVLVNNAGILRDRSFKKMTDDEWFAVLKVHLYATFAMSKAVWPVFLKQKSG
                     YIINTTSTSGIYGNFGQANYAAAKAAILGFSKTIALEGAKKGIRVNIIAPHAETAMTK
                     TIFTEKELVNHFDASQVSPFVVLLASEELQQNCGKKGVNGQLFEIGGGWCGQTRWQRS
                     EGFASVADPVEPEAIRDNWNLITNFKSGTVNPSTTEESSMAILQAVQMAQSSKSSKDI
                     FNYTERDCILYNLGLGATSKELSLTYENDPNFHVLPSFAVIPFMTSITALNMNKLVEN
                     FNYAMLLHGEQYFKLGQYPLPTKGSLKTIAKPLQILDKNGKAAVIVGGFETYDTKTKK
                     LLAYNEGSFFIRGARTPGGKQIIKGERAKFATQKFKAPTDKEPDFEIEVLTNKDQAAL
                     YRLSGDYNPLHIDPNLAKAVKFPRPILHGLCTLGVSAKALLEKFGPYVELKVRFTNVV
                     FPGEKLRIKAWKQLNGIVIFQTLDVDRDVVVLDNCAIKLSGSESKL"
     gene            complement(<532395..>533885)
                     /gene="TDEL0A02970"
                     /locus_tag="TDEL_0A02970"
                     /db_xref="GeneID:11503082"
     mRNA            complement(<532395..>533885)
                     /gene="TDEL0A02970"
                     /locus_tag="TDEL_0A02970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678792.1"
                     /db_xref="GeneID:11503082"
     CDS             complement(532395..533885)
                     /gene="TDEL0A02970"
                     /locus_tag="TDEL_0A02970"
                     /inference="similar to DNA sequence:INSDC:YBR288C"
                     /note="similar to Saccharomyces cerevisiae APM3 (YBR288C);
                     ancestral locus Anc_2.522"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678840.1"
                     /db_xref="GeneID:11503082"
                     /db_xref="GOA:G8ZLY5"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR018240"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:G8ZLY5"
                     /translation="MFISFYITDSKYSLVFQYLLSSNSPPFAHLWSKVQDVCPELAND
                     DVANRNWEAKDDMGNLKSVCGSVSKNLELYKYYSSKNKLYYFCLTSGSGSTSSISPFV
                     FLESMDRSLLEYFDKDRLTVNKITNNYDRITMIFYVCVNGGGPAAGRLYGNRIKKVVP
                     ARSDLSKIINSTAHGLQVAVQRQGQQHNQTFVSDSLNRLENDTSSREDDVVPWRTAGL
                     KYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSGNPTVDL
                     QLDLAGNDLGVPAFHECVELDNHQNPSNCDLRFIPPDGRFNLMQYSIDLDTPRIQQTR
                     RFNHTVGLVTIDFADQLGNKTDEFEITVNISNSREVANIEDLRIDVQLQSNTDEDSET
                     DFKIKVLRNTHGRFDNSVVPGQGSWIFDKDTPTGTLPVLRGCVESTEPRLLRVQRVTA
                     SYSLSGQLASGIRVKAINIGQLTTKSNRPFKGVKYATKTGDFEIRS"
     gene            <534395..>536818
                     /gene="TDEL0A02980"
                     /locus_tag="TDEL_0A02980"
                     /db_xref="GeneID:11503003"
     mRNA            <534395..>536818
                     /gene="TDEL0A02980"
                     /locus_tag="TDEL_0A02980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678793.1"
                     /db_xref="GeneID:11503003"
     CDS             534395..536818
                     /gene="TDEL0A02980"
                     /locus_tag="TDEL_0A02980"
                     /inference="similar to DNA sequence:INSDC:YBR289W"
                     /note="similar to Saccharomyces cerevisiae SNF5 (YBR289W);
                     ancestral locus Anc_2.523"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678841.1"
                     /db_xref="GeneID:11503003"
                     /db_xref="GOA:G8ZLY6"
                     /db_xref="InterPro:IPR006939"
                     /db_xref="UniProtKB/TrEMBL:G8ZLY6"
                     /translation="MNGGNGGNGQDEPSLDNPGEAANANPFSNIGTPSFNLSQIPRNV
                     LQNLTPAQVQMIQQRHRQLLMNRFQQQQVQNRQQSLNSHGHQQLQQTQAQARAQAQAR
                     AQAQARAMAQAQAQAQANRQSAPQQQMHMGQQSMQSPGMSMGQQSDARTPGMTQAGID
                     QTASTASARQAGMQPQQVRNPAASQAPINLPPQIARLPLPMQQQVLNTLKQQAIAKNN
                     PAAVAAITMAQQHLQQQLQQQEQSQGSPIQPGVESPMNMQAPQSQNIPVQHGASPQIP
                     SQSMPIPPQQSQQQQQPMRVPSNLMQVPRPKFDLPKYQTIKFEPPEDKLPYPTYWSDQ
                     KPTTDILLYEQITQRDKTNKSDLAKETNGYEPFSIYGFSNKEYLGKLWHTLKYYQELK
                     ATRMKSITNASQNIPSASIWGNGYSGYGNGVTNSVRQVIAESPIDGRKHVYQDRLKIY
                     EQAMHEESEELVPIRLEFDYERDKFFLRDTLLWNKNDSILKIEDFVEDMMKDYRYAPL
                     IRDQFNETICQSMKEQILEFQSNPYLDLDEERRGGDDMRIMIKIDIVVGQHQLLDNFE
                     WDISNPENCPEEFAESMCRELSLPGEFVTAVAHSIREQVHMYHKTLALLGHNFDGSVV
                     DDDEVRSRVLPVITVDDVFRAPSDAKIYTPNLFQISAAELERLDKDKDRDTRRKRRQG
                     RSGRRGVVVHNGSTSNLAGTQASIGGPNANALTGANAAVEVSVPDIADVPRTFRTPIP
                     STILPGGIDLGPPVGSYELRTTTEHKIRPALPIGNQAPCQVIDHIPGSSLLICIKLKP
                     KEKGRMSKR"
     gene            <537280..>538176
                     /gene="TDEL0A02990"
                     /locus_tag="TDEL_0A02990"
                     /db_xref="GeneID:11502886"
     mRNA            <537280..>538176
                     /gene="TDEL0A02990"
                     /locus_tag="TDEL_0A02990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678794.1"
                     /db_xref="GeneID:11502886"
     CDS             537280..538176
                     /gene="TDEL0A02990"
                     /locus_tag="TDEL_0A02990"
                     /inference="similar to DNA sequence:INSDC:YBR290W"
                     /note="similar to Saccharomyces cerevisiae BSD2 (YBR290W);
                     ancestral locus Anc_2.524"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678842.1"
                     /db_xref="GeneID:11502886"
                     /db_xref="InterPro:IPR019325"
                     /db_xref="UniProtKB/TrEMBL:G8ZLY7"
                     /translation="MTTGSSSHDQIVGSSRNTTDIENNMVSSDDAADGTTIDQEDSEQ
                     ERRIGDRIFPTSLRERASRQIRAAGRHFNILDRLFQRNTQDASHLQQGANYDGVFSNL
                     SAKPDGEEDQQAGDSDNPPTYDEAAVDMAPSYYGVDDSGAGMYYNEICIEGLPVGNIA
                     NLIWNLLVSSSFQFIGFLVTYILHTSHAAKQGSRLGLGITFLGYAYSMIPNDVQSKVG
                     RDKDVDRVQLSDPNEHDDLHLYSSPATQDEFTSHLSTGITEEKQSVPAVAVFTGILGF
                     CIAVKSLYDYVQIKRMERKYMS"
     gene            complement(<538281..>539174)
                     /gene="TDEL0A03000"
                     /locus_tag="TDEL_0A03000"
                     /db_xref="GeneID:11502779"
     mRNA            complement(<538281..>539174)
                     /gene="TDEL0A03000"
                     /locus_tag="TDEL_0A03000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678795.1"
                     /db_xref="GeneID:11502779"
     CDS             complement(538281..539174)
                     /gene="TDEL0A03000"
                     /locus_tag="TDEL_0A03000"
                     /inference="similar to DNA sequence:INSDC:YBR291C"
                     /note="similar to Saccharomyces cerevisiae CTP1 (YBR291C);
                     ancestral locus Anc_2.525"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678843.1"
                     /db_xref="GeneID:11502779"
                     /db_xref="GOA:G8ZLY8"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8ZLY8"
                     /translation="MSQEKKKVDPAKSFVAGALAGAVEASITYPFEFAKTRLQLVDKS
                     SKASRNPLVLLFNTAKTQGVGSIYVGCPAFIVGNTAKAGVRFLGYDTIRNFLKDPRTG
                     ELSGPRGVIAGLGAGLLESVVAVTPFEAIKTGLIDDKQSANPRYHNNGRGIVRNYGSL
                     IRDKGFRGLYNGVLPVSMRQAANQAVRLGCYNKIKVMVQNYTNSPKDQALSSGLTFVV
                     GAFSGVVTVYTTMPIDTVKTRMQSLNASQYSSTFNCFSRILKEEGLKTFWKGTTPRLG
                     RLILSGGIVFTIYEKVLTVLG"
     gene            <539739..>540824
                     /gene="TDEL0A03010"
                     /locus_tag="TDEL_0A03010"
                     /db_xref="GeneID:11503064"
     mRNA            <539739..>540824
                     /gene="TDEL0A03010"
                     /locus_tag="TDEL_0A03010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678796.1"
                     /db_xref="GeneID:11503064"
     CDS             539739..540824
                     /gene="TDEL0A03010"
                     /locus_tag="TDEL_0A03010"
                     /inference="similar to DNA sequence:INSDC:YHR002W"
                     /note="similar to Saccharomyces cerevisiae LEU5 (YHR002W);
                     ancestral locus Anc_2.526"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678844.1"
                     /db_xref="GeneID:11503064"
                     /db_xref="GOA:G8ZLY9"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR002167"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8ZLY9"
                     /translation="MGTADQTACQSRSVVSGKPKSRQRHIMAIDKNSMDYILRSAIAG
                     GISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLMGLVEAAKHIRINDGIRGFFQGH
                     SVTLIRIFPYAAVKFVAYEQIRSVLIPSKEYETHWRRLMSGSLAGLCSVFLTYPLDLI
                     RVRLAYVTDHHRVKLGRVVRNIWAEPVSTTLSTKSYIPKWFGHWSNFYRGYIPTVLGM
                     IPYAGVSFFAHDLICDILRVPFLAPYSVVALSEDDEAIRRQKHQRVPLKTWAELVAGG
                     LAGMASQTAAYPFEIIRRRLQVSSLAPQGSHERKFQSINGIAKIIYKERGWRGFFVGL
                     SIGYIKVTPMVACSFYVYERMKWHLGI"
     gene            complement(<540937..>542256)
                     /gene="TDEL0A03020"
                     /locus_tag="TDEL_0A03020"
                     /db_xref="GeneID:11502865"
     mRNA            complement(<540937..>542256)
                     /gene="TDEL0A03020"
                     /locus_tag="TDEL_0A03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678797.1"
                     /db_xref="GeneID:11502865"
     CDS             complement(540937..542256)
                     /gene="TDEL0A03020"
                     /locus_tag="TDEL_0A03020"
                     /inference="similar to DNA sequence:INSDC:YHR003C,YKL027W"
                     /note="similar to Saccharomyces cerevisiae YHR003C and
                     YKL027W; ancestral locus Anc_2.527"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678845.1"
                     /db_xref="GeneID:11502865"
                     /db_xref="GOA:G8ZLZ0"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZLZ0"
                     /translation="MGSIKDNWRLIAATALCTVAATKCVDLALKARLENDTKQKSRIT
                     KALETHEYDDNLFREQLARNYAFLGEEGMEKLKQQYFVVVGAGGVGSWVVTMLVRSGC
                     QRIRIIDFDQVSLSSLNRHSCAQLSDVGTPKVDCLKRHLLKIAPWCQIEAINELWDKE
                     NAERLLFDAGEPTMVVDCIDNIDTKVDLLEFAYKRKIEVISSMGASTKSDPTRINVGD
                     LTTTEEDPLARSVRRRLKKRGIVKGIPVVFSAEKPDPRKARLLPLPDEEYEKGQVDEL
                     SAMRDFRVRILPVLGTMPGIFGLTIATWILTKVSGYPMDPIEGKNRVKIYDGIYHSLA
                     GQMTRIGMPDQRVPIAVKEVSYIVEEVFRGKSPVSGYSTRLTLSKWDPNKPVTIQNVV
                     ILTKEEQKEHEDNVLNGGKSLEDVYSKDILDLVAKRFKEEEYYSQYR"
     gene            complement(<542420..>543766)
                     /gene="TDEL0A03030"
                     /locus_tag="TDEL_0A03030"
                     /db_xref="GeneID:11503036"
     mRNA            complement(<542420..>543766)
                     /gene="TDEL0A03030"
                     /locus_tag="TDEL_0A03030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678798.1"
                     /db_xref="GeneID:11503036"
     CDS             complement(542420..543766)
                     /gene="TDEL0A03030"
                     /locus_tag="TDEL_0A03030"
                     /inference="similar to DNA sequence:INSDC:YKL028W"
                     /note="similar to Saccharomyces cerevisiae TFA1 (YKL028W);
                     ancestral locus Anc_2.528"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678846.1"
                     /db_xref="GeneID:11503036"
                     /db_xref="GOA:G8ZLZ1"
                     /db_xref="InterPro:IPR002853"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013137"
                     /db_xref="InterPro:IPR017919"
                     /db_xref="InterPro:IPR024550"
                     /db_xref="UniProtKB/TrEMBL:G8ZLZ1"
                     /translation="MDRPIDEIVKNLLKFVVRGFYGGSYVLVLDAILFHSVLAEEDLK
                     QLLGINKTDLGPLVARLRSDGLLSMHKQREYPPNSKSVERAYFYIKFPHAIDAIKWKV
                     HQVVQRLKDDLDKNSAPNGYMCPICSTKYTQLEAVQLLNFDRTEFLCSLCDEPLVEDD
                     SGKKNKEKQDRLNRLMDQVQPIIDYLKKIDDSRIEENTFEIALARLIPPQNQSRAAYT
                     YNPKKGSTMFRPGEDGSSLNNDSSRRAGANSQATLHVNITTQSDEMAQRALQERQVEE
                     KRKQNAVPEWHKQSTIGKSALGRLDEDEEFDPRTTAQANMSLEETGAANNQETEMDEF
                     YHKHRSLTDRDLEERENERTLNEYYASLAKKQAEAKDEEDEDEEDEEGGFLDDDEGAF
                     DEEFEDVVEPAKNEEGETKKDAVKEENGTTNNGFHETTKPSNDDDDGDMDIEFEDV"
     gene            <544917..>546878
                     /gene="TDEL0A03040"
                     /locus_tag="TDEL_0A03040"
                     /db_xref="GeneID:11502668"
     mRNA            <544917..>546878
                     /gene="TDEL0A03040"
                     /locus_tag="TDEL_0A03040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678799.1"
                     /db_xref="GeneID:11502668"
     CDS             544917..546878
                     /gene="TDEL0A03040"
                     /locus_tag="TDEL_0A03040"
                     /inference="similar to DNA sequence:INSDC:YKL029C"
                     /note="similar to Saccharomyces cerevisiae MAE1 (YKL029C);
                     ancestral locus Anc_2.529"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678847.1"
                     /db_xref="GeneID:11502668"
                     /db_xref="GOA:G8ZLZ2"
                     /db_xref="InterPro:IPR001891"
                     /db_xref="InterPro:IPR012301"
                     /db_xref="InterPro:IPR012302"
                     /db_xref="InterPro:IPR015884"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZLZ2"
                     /translation="MMMMRYRASSRIAQCAARSSCARFYSSSTKPNLATTTRDTTFNQ
                     QTYGDSNIQKIPVGSTAKKLFGKPKKTRLSVDGPIECPLESFQLLNSPLFNKGSAFTQ
                     EERQAFNLDALLPPQVNTLDEQVERAYKQLCYLKTPLAKNDFMTSMRVQNKVLYFALV
                     REHIRELVPIIYTPTEGDAIAAYSHRFRRPEGIFLDITEPESVERRMAVYGGDKDVDY
                     IVVSDSEGILGIGDQGIGGIRIAISKLALMTLCGGIHPGRVMPVCLDVGTNNKKLARD
                     ELYMGNRFARIRGKQYDYLIEKFIQSIKKRFPNAVLHFEDFGVKNARRILDKYRNELA
                     CFNDDIQGTGAVVMASLIAALKHTKRDLKDITVLVYGAGSAGLGIADQIVNHMVTHGL
                     SKEEARTKIYLMDRRGLILSSMESGSTQAQHVYAKSDEEWSDVNCKSLLDVVSRVKPT
                     CLIGCSTQAGAFNKSIVQEMYKHNPRPIIFPLSNPTRLHEAVPEDLLNWTDNNALVAT
                     GSPFPPVNGYRISENNNCFSFPGIGLGAVLSRAKVISDTMISAAVDQLAALSPLEEGN
                     SKPGLLPPLEVIQDTSSKVATAVILQALKEGSARIEEEDVPGETGKKVKVPRDFDQCL
                     AWVKNQMWEPRYRPMIKVDHDPTFHSHQI"
     gene            complement(<546922..>547989)
                     /gene="TDEL0A03050"
                     /locus_tag="TDEL_0A03050"
                     /db_xref="GeneID:11503125"
     mRNA            complement(<546922..>547989)
                     /gene="TDEL0A03050"
                     /locus_tag="TDEL_0A03050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678800.1"
                     /db_xref="GeneID:11503125"
     CDS             complement(546922..547989)
                     /gene="TDEL0A03050"
                     /locus_tag="TDEL_0A03050"
                     /inference="similar to DNA sequence:INSDC:YHR004C"
                     /note="similar to Saccharomyces cerevisiae NEM1 (YHR004C);
                     ancestral locus Anc_2.530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678848.1"
                     /db_xref="GeneID:11503125"
                     /db_xref="GOA:G8ZLZ3"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR011948"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G8ZLZ3"
                     /translation="MNAVSYISDQLSKRDKNGKTEDVEDKVAVQKREKIVRRRSKFTS
                     YAWAVILFFPQWLIIKPTQLIWWIISLPLLLIEYGLKSRLQRKSTKRSTGTLQSISEL
                     EEDDLAGGDEIFLQRDAVKGSLAPAKYRRSRSGSRSSTVMLGTKRMGRFLFPKKLIPR
                     SVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPH
                     CDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYI
                     KDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWISDPSDTDLLTLLPFLEAL
                     RYTTDVRDILALKNSEQAFLS"
     gene            <548200..>548934
                     /gene="TDEL0A03060"
                     /locus_tag="TDEL_0A03060"
                     /db_xref="GeneID:11502767"
     mRNA            <548200..>548934
                     /gene="TDEL0A03060"
                     /locus_tag="TDEL_0A03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678801.1"
                     /db_xref="GeneID:11502767"
     CDS             548200..548934
                     /gene="TDEL0A03060"
                     /locus_tag="TDEL_0A03060"
                     /inference="similar to DNA sequence:INSDC:YMR069W"
                     /note="similar to Saccharomyces cerevisiae NAT4 (YMR069W);
                     ancestral locus Anc_2.532"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678849.1"
                     /db_xref="GeneID:11502767"
                     /db_xref="GOA:G8ZLZ4"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G8ZLZ4"
                     /translation="MEQESLNDVVKYANQNFPTTINAAGIQLTRKLLAIDTEEYPVET
                     DQCISYVHSPREAEKLLWQLLEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPG
                     LVYVIYSTAATTTATQRRNAPFSPLLFLSFMLTEEDGLVADDPTEVWTVLYLYELQLL
                     PRVRRLGLAARLLGDHLAQCGRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYES
                     LGMQLAADSPTVLDTDSLYRLYVLQL"
     gene            <549360..>550079
                     /gene="TDEL0A03070"
                     /locus_tag="TDEL_0A03070"
                     /db_xref="GeneID:11503318"
     mRNA            <549360..>550079
                     /gene="TDEL0A03070"
                     /locus_tag="TDEL_0A03070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678802.1"
                     /db_xref="GeneID:11503318"
     CDS             549360..550079
                     /gene="TDEL0A03070"
                     /locus_tag="TDEL_0A03070"
                     /inference="similar to DNA sequence:INSDC:YMR070W"
                     /note="similar to Saccharomyces cerevisiae MOT3 (YMR070W);
                     ancestral locus Anc_2.533"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678850.1"
                     /db_xref="GeneID:11503318"
                     /db_xref="GOA:G8ZLZ5"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8ZLZ5"
                     /translation="MNNWPHQQGRRSGEQDERSQRPMPLNLPPRYSYTQYPHAFPVVN
                     ATVPQQYLYVPGSVPPPPQAQLQFPIYPYYPQPAAGGGAAAPPPRMRLKLEQPPMPMP
                     MSIPGQRAVAVASLSSNSADDEEQREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPAR
                     HFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELRLNNVYVSTEGSCKNNIRTLLYEGR
                     LNKDEVKKVLNSLIDRHNNNQ"
     gene            complement(<550148..>550651)
                     /gene="TDEL0A03080"
                     /locus_tag="TDEL_0A03080"
                     /db_xref="GeneID:11503209"
     mRNA            complement(<550148..>550651)
                     /gene="TDEL0A03080"
                     /locus_tag="TDEL_0A03080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678803.1"
                     /db_xref="GeneID:11503209"
     CDS             complement(550148..550651)
                     /gene="TDEL0A03080"
                     /locus_tag="TDEL_0A03080"
                     /inference="similar to DNA sequence:INSDC:YMR071C"
                     /note="similar to Saccharomyces cerevisiae TVP18
                     (YMR071C); ancestral locus Anc_2.534"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678851.1"
                     /db_xref="GeneID:11503209"
                     /db_xref="GOA:G8ZLZ6"
                     /db_xref="InterPro:IPR019365"
                     /db_xref="UniProtKB/TrEMBL:G8ZLZ6"
                     /translation="MALGVRQFINVAGIVKDLKSFNFSLYGRWFGYINIFLCIALGIA
                     NLFHVSAVIAFGIVAIVQGLIILFVEIPFLLKICPLSDNFIEFIKRFETNGYRTLFYV
                     VMAVIQWCSIAVQATSLIVVAVGLTISACSYAVALTKHQEFQNTHILKDPTSDDFPHE
                     AVVREML"
     gene            <550834..>552594
                     /gene="TDEL0A03090"
                     /locus_tag="TDEL_0A03090"
                     /db_xref="GeneID:11502939"
     mRNA            <550834..>552594
                     /gene="TDEL0A03090"
                     /locus_tag="TDEL_0A03090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678804.1"
                     /db_xref="GeneID:11502939"
     CDS             550834..552594
                     /gene="TDEL0A03090"
                     /locus_tag="TDEL_0A03090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678852.1"
                     /db_xref="GeneID:11502939"
                     /db_xref="GOA:G8ZLZ7"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR004039"
                     /db_xref="InterPro:IPR008913"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017921"
                     /db_xref="UniProtKB/TrEMBL:G8ZLZ7"
                     /translation="MHPMSSKDNNEGEDLGHLSRTLQSSAFISDLQHGLSLSNALTRL
                     QTMKALMEQLVSEAIDNNVESDDEYQDCATMGDEEPLGVTPVTAPRMIPTYNDVVIPQ
                     DKYPNEPEPRDLEPLTTITSKEKSDHGLLRQRIKQINELELEPRQKALMIQKLMMGDY
                     NANEQVEEHGDNDDYESAIASITQEDYEPVFQKPGVLGCPHYQRACKLQCDTCRKWVP
                     CRLCHDELQSEKMHLFERDKTQWIMCMRCQNVQRPSRACEKCQEEFAAYCCEICKLYD
                     NDEAKDIYHCDKCGICRLGLGLGIDFFHCDKCQACLSIELQDNHKCIERATMSNCPIC
                     GDYMFTSVKPVVYMSPCGHAIHQHCFDEYTRHSYKCPHCQVTVLNMDAQFRVLDKEIE
                     EQPLPEPYCHWMCIVSCNDCKGRSRCNYHILGLKCGHCLSYNTTQIKLIKPENDKSQG
                     DNVDLAALEEFSHSMNHSVSENLLRDHFQTEDVSPLINMDNSMLSNFDHYMNDYFKDA
                     RSDKNKESHHVNDFINTKNLFRKDDEEIESQSMNRVSSLTEKFKQLIGDSLPVQRSLS
                     DVFQRWRQDSNEAESFNDKN"
     gene            <553394..>554710
                     /gene="TDEL0A03100"
                     /locus_tag="TDEL_0A03100"
                     /db_xref="GeneID:11502782"
     mRNA            <553394..>554710
                     /gene="TDEL0A03100"
                     /locus_tag="TDEL_0A03100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678805.1"
                     /db_xref="GeneID:11502782"
     CDS             553394..554710
                     /gene="TDEL0A03100"
                     /locus_tag="TDEL_0A03100"
                     /inference="similar to DNA sequence:INSDC:YKL032C,YMR072W"
                     /note="similar to Saccharomyces cerevisiae IXR1 (YKL032C)
                     and ABF2 (YMR072W); ancestral locus Anc_2.535"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678853.1"
                     /db_xref="GeneID:11502782"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:G8ZLZ8"
                     /translation="MSSTIHVPGLNPGNSPKQEESTNGTNNLLALASEHLQYQPIDNS
                     DTQYRDIHHSQNLSHYPAQVFQPQYQPSQSQVQQQHQQQQQQQQQQQQQQHRQQQQQP
                     HALYQQQFQQQYQQQYINQPNQHLQQNQQRQPQYSNQQSQSLPQAQQQQPSSTSLSPE
                     FAYIQGNSGLQAFNQQQLSQQQISELMYNSFLSHLAQKQVTGALSSALGTASHLSPAA
                     AAAAGTSFLTQPTQRYFHNNLNTSPAMMEATHPAMMQPSQQIQLQNAQPVAKKMSSTQ
                     SRIEKRKQLKKQGPKRPSSAYFLFSMSIRNDLLQQYPEAKVPELSKLASAKWKELSDD
                     DKKPYYEEFRTNWEKYRVLRDEYEKTLPPKRPSGPFIQFTQEIRSTVVKENPDKNLIE
                     ITKMIGEKWRNLDPLKKAEYTETYKKRLKEWESCYPDEAEVKEDKK"
     gene            complement(<554890..>555492)
                     /gene="TDEL0A03110"
                     /locus_tag="TDEL_0A03110"
                     /db_xref="GeneID:11502705"
     mRNA            complement(<554890..>555492)
                     /gene="TDEL0A03110"
                     /locus_tag="TDEL_0A03110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678806.1"
                     /db_xref="GeneID:11502705"
     CDS             complement(554890..555492)
                     /gene="TDEL0A03110"
                     /locus_tag="TDEL_0A03110"
                     /inference="similar to DNA sequence:INSDC:YMR073C"
                     /note="similar to Saccharomyces cerevisiae YMR073C;
                     ancestral locus Anc_2.536"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678854.1"
                     /db_xref="GeneID:11502705"
                     /db_xref="GOA:G8ZLZ9"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:G8ZLZ9"
                     /translation="MAQQIETAKDNLRKPAASKSSLAPPSNQFNPRLGQSLRDGIPTQ
                     AGCSTLGAGGYRNKVRLKPGHSALDWHALASGKGKSQGLVVGIDRLLSEDMEKLQQLN
                     HPHTLIQLQRGVPPYLIRPLLNIDRELLQKHKTLDDCWCVIKGRVYCLTYYFDFHPGG
                     VDILFKTCAGKDGTEMFNKYHRWVSFDKLLETCLVGVFVS"
     gene            complement(<555633..>556124)
                     /gene="TDEL0A03120"
                     /locus_tag="TDEL_0A03120"
                     /db_xref="GeneID:11503012"
     mRNA            complement(<555633..>556124)
                     /gene="TDEL0A03120"
                     /locus_tag="TDEL_0A03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678807.1"
                     /db_xref="GeneID:11503012"
     CDS             complement(555633..556124)
                     /gene="TDEL0A03120"
                     /locus_tag="TDEL_0A03120"
                     /inference="similar to DNA sequence:INSDC:YMR074C"
                     /note="similar to Saccharomyces cerevisiae YMR074C;
                     ancestral locus Anc_2.537"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678855.1"
                     /db_xref="GeneID:11503012"
                     /db_xref="GOA:G8ZM00"
                     /db_xref="InterPro:IPR002836"
                     /db_xref="UniProtKB/TrEMBL:G8ZM00"
                     /translation="MDPELQALREARLAELKRGTQGPSSGGESGKGAGSNGLETVIAA
                     YLQPQALERLSRVSLVRPDRAQAVEQYLAKMVSQGALSHKVTEDEIVQILHGVAREQN
                     KKMTPRSYSIDERWLFMISCPARMVMTTRMISLTSRDPRLYAHILYPKACCIYQASGR
                     HLY"
     gene            <556516..>558585
                     /gene="TDEL0A03130"
                     /locus_tag="TDEL_0A03130"
                     /db_xref="GeneID:11502988"
     mRNA            <556516..>558585
                     /gene="TDEL0A03130"
                     /locus_tag="TDEL_0A03130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678808.1"
                     /db_xref="GeneID:11502988"
     CDS             556516..558585
                     /gene="TDEL0A03130"
                     /locus_tag="TDEL_0A03130"
                     /inference="similar to DNA sequence:INSDC:YMR075W"
                     /note="similar to Saccharomyces cerevisiae RCO1 (YMR075W);
                     ancestral locus Anc_2.538"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678856.1"
                     /db_xref="GeneID:11502988"
                     /db_xref="GOA:G8ZM01"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:G8ZM01"
                     /translation="MKRKLTSGIPDKGSNDEKKDDSVSTNLFKAPSNVGISESWNDSS
                     RSNSPGAQGVRRPRRATSQNVDYDLKKRRIIPSEDYFRKEKTRKDVLAGKGEDNFNYR
                     DEETQEEGEPVHKEVIEHDENGDAVYMNEPEELNDAVNGATGLPLSQGPPEKVKKESL
                     WNYKKNLSSPESYMSLSTSEGKKNLELKIYRPMLKTGKSESITRSSSLRERLHPKDIH
                     DDERDELIKPEPKKGHDHHGPSHIKIKATVSKETKSKLFGQNSLAHLVNTATRSSPRN
                     LTPTQEVENDDFCSSCLQSGSFLCCDTCPKSFHFLCLNPPLDADNLPEGDWSCPQCTF
                     KQKHQNLTQIRKSEKEFIRTELPPSARLFGKLLFQLEASNPKQFSLPPSIKDSFQHVR
                     SGSRGQYCDEREKEPLTEKQLFGSAYGQCISKLDRYNPDIHLDPDTGKILICYKCGTT
                     KMGTWDDPDTSRLIMRCDYCKTPWHLDCLPNVPRASLKNLGTNWKCPLHAPARKEPHS
                     QRRLAKHQKFIEPYQSCGFRNNGEVDIILDEITAPASRGMIESLKKSGDFPPISLLRE
                     RSVKLDFLDKVFQAKKVQRENEFKCQERLIDRLILSSNQSINEKSNLQEIMSLVYFTM
                     GAANPPWKKLWDFKELCSVAQQELDQQEFARENITDDELRQLSLLEKLLESRPKEDIC
                     KILNIKQ"
     gene            complement(<558695..>562486)
                     /gene="TDEL0A03140"
                     /locus_tag="TDEL_0A03140"
                     /db_xref="GeneID:11502932"
     mRNA            complement(<558695..>562486)
                     /gene="TDEL0A03140"
                     /locus_tag="TDEL_0A03140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678809.1"
                     /db_xref="GeneID:11502932"
     CDS             complement(558695..562486)
                     /gene="TDEL0A03140"
                     /locus_tag="TDEL_0A03140"
                     /inference="similar to DNA sequence:INSDC:YMR076C"
                     /note="similar to Saccharomyces cerevisiae PDS5 (YMR076C);
                     ancestral locus Anc_2.539"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678857.1"
                     /db_xref="GeneID:11502932"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZM02"
                     /translation="MAKVKLKFNKSIISTAESLVPTDEILSRLVSLHEELSTLEQGQV
                     DLRTLDRYRTDLNNKKLLKHKDNGVRAFVACCLSDILRLYAPDAPYTETQLTDIFRLI
                     LSQFDLLGNPDNGYFIQQTYLITRMLEYRSIVLLTDLPNSNKLLEDLFQVFYDDDKKF
                     PFKLYKVIAGILGEVISEFDNVPTPVLKLIFNKFLTYNPGNVPQGLEIASNCGYQVSL
                     ILCDAYSSRMSRHLTKYYSEILYHITSEEHSNAYESKYSASRTVEKLHKLDVRLWETV
                     PDLLSAVIGFIYHELLSDDEMLRKQATKLVGELLAAESTLNFVVTHQESFNAWLSKIA
                     DPVAEVRLLWTQSIPTILSMRDDIAQELNKGIAKTLIDSDYKVRKASVLIFDKLSVAD
                     IWKSITNTSVYECLLPLTREKNREVRELCISTVADFFAESLANIKRTTQNSGIWEIVD
                     TIPSVLFDLYYINDLHINEQVDLTIFKSILPLEVDDRKRVDSLLNVVSQLDEKALSSF
                     LAFNRRQMQMAVALSKFIEFCELQNDQDNFPNDSVAIKLQKTIAWLSSGLSDQIKATA
                     ALEALKDINDKRILYLIKTCITNDVSLMTLKNSMEEVITKLRDPALFRKHGVKSISNI
                     MPKDIAAQVEVLLYRSSPFIYNFSNIPVLLDTGNTSQDGTTWKRRLLDEISKVNPALF
                     KDHVRTLKRIIEDESCLESQRETLTLGEALKTVYKISKTLTDQVNLEDSIFFSKLKNL
                     ALEGDPATAKYAVKLIALSPFAEESLTEIKNGVLPLDMKHDRNFASHILVLAEIYKYC
                     PHVLDRDSTDIVSFLIQEVLLANQVVGDSNQELDWIPDSELNDRKYYALSSKVFALKL
                     FTNKLKAVSADSSNDELATVFTEKQVKLFFYLIASGGELISEHNKEFFPTPNSYQTKL
                     RCCAGLQALKLSCIPFFNDFIKPSDVITLINIVEDESLPVRKEFLDHLKNYISKESIS
                     IKFLPLIFFTAYEPDVELKTSTKTWINNTFGKTSFRKNTTFERALPRLIHAIAHHPDI
                     VERLEVEGDPYLEALTTAVDYLVFYFDSIAIQENFSLLYYLAERVKNYRDLTIDVNDN
                     NDDQQSETEPCARMYVIGELAQMILLAIKEKKGWQHSAYPGKLNLPADLFTPFSTIEE
                     AQASFKSYLPEKYTEKLQMNIRAKVARNLHSSQTQKQKIQKRMLDNENHEVSNKKRKQ
                     TKKAEPETSDDDSESDNAYVPGTKTRTGRSDRSKLKKSLRERKKVDYRDEDDDDDDDD
                     E"
     gene            complement(<562717..>564729)
                     /gene="TDEL0A03150"
                     /locus_tag="TDEL_0A03150"
                     /db_xref="GeneID:11502849"
     mRNA            complement(<562717..>564729)
                     /gene="TDEL0A03150"
                     /locus_tag="TDEL_0A03150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678810.1"
                     /db_xref="GeneID:11502849"
     CDS             complement(562717..564729)
                     /gene="TDEL0A03150"
                     /locus_tag="TDEL_0A03150"
                     /inference="similar to DNA sequence:INSDC:YHL008C"
                     /note="similar to Saccharomyces cerevisiae YHL008C;
                     ancestral locus Anc_2.540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678858.1"
                     /db_xref="GeneID:11502849"
                     /db_xref="GOA:G8ZM03"
                     /db_xref="InterPro:IPR000292"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="InterPro:IPR024002"
                     /db_xref="UniProtKB/TrEMBL:G8ZM03"
                     /translation="MVADDTLYNTPHETALAVVATAMKKARLQIPTLVINSIVGGVLF
                     SSGSILTIAAHADNPGLWQSNPGVLSAYSSITYGIGLFYVVIMGADLFNSNILFFSVG
                     VLRQAVTIYDLLISWFISLLGNLGGSLFVSYLFVHLSGISSSELWIAGSRKLVEDKAS
                     FSFIKTLLKGIAGNFYVCLAIYLQLMAKPLHVRLMVIVLPIFTFVSCGFTHAVADMTY
                     CYIGMLNGGAVTVAEYIWKLLIPACVGNIIGGFSFSLVIPFYLHLVVVEQDRKRLSLP
                     EYDARDEQPELNTDSRVVRISPQQERQDEQEAEETEEYDGEPSEKVDMDDSNSASSHL
                     SREATRPRNLSSARTSQVALSDFQPQIYEANTEDYNPTLSEMHTLKSTCSRRSNPSSR
                     RRSVIRSPPGVFPVRGMGEPLRKERTIENPNYALNQLPYRDGNETPRYNSNTTSRTVS
                     RRGTDTPNTLENQSTYEKEANNDDEYTVLEEKPGAKLERALTKLVEHRSKTVGHLPRT
                     TQDTFPYNKPGVLAYNEADAGHLWHNKENGLLKSLTKEFSHAESPHNAADLEKQLQDA
                     GITHRAALAANSVAGVSNYNNLDLQRAHTSTFDGRQPLHSARSHARDSHPIRRMQTAS
                     VGTLLNGYNQPERRRTNAMTGLSDSASQSVNDSVNDSINESEASRD"
     gene            complement(<565100..>568213)
                     /gene="TDEL0A03160"
                     /locus_tag="TDEL_0A03160"
                     /db_xref="GeneID:11503310"
     mRNA            complement(<565100..>568213)
                     /gene="TDEL0A03160"
                     /locus_tag="TDEL_0A03160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678811.1"
                     /db_xref="GeneID:11503310"
     CDS             complement(565100..568213)
                     /gene="TDEL0A03160"
                     /locus_tag="TDEL_0A03160"
                     /inference="similar to DNA sequence:INSDC:YKL033W"
                     /note="similar to Saccharomyces cerevisiae YKL033W;
                     ancestral locus Anc_2.541"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678859.1"
                     /db_xref="GeneID:11503310"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZM04"
                     /translation="MSMSRESFVFGELRPLCIDVSRLSFQPKETFDPQSTPLQDALKN
                     LENKLASYTDELSTKLADYVFVPISSLLKQDSLGKSQTNYVLLIIAHLLRLAWRSDGT
                     LGKTLAQQLLPLITFLINPDKDNESLIGSSEDDKKAACSALFQFITSLSHQSYCHEFF
                     SASDPNRLNALGHSVSILLAILKQSSQDMKTQLIAIGALQILYREIIHDGEMLSFILP
                     GNISTFCKVLTMPGMNTNYKVVLSTLDVMGDLLLLIYDDTSLNAVQHELKDLKQLNSI
                     ADGKGDSTFGLVKINNSGGAEPRQHRSTSWLRGTSSQVKLALEKILPKLLKRNNWEIS
                     AALVKFASAMLERCHNSLQNCENLFVKVLVEVRTDPKFQLASHVACLRNIVRDGFDQL
                     NQWVHIEDGNALKSLNFALISLRDVAPKDDVLFIENVCSTLIETLETTTEVSALKKRE
                     YSIIEQSSQVILNDALNQELIRADGMPTVLTNIPKKVEVSLGRILSTLGSLAHKHGQL
                     TSLIDAVLSTQTCEGSSRKTIALWVSSWLVSGISETSLKLETDYLNIDSDEILDKEAC
                     YDVLEFGSDLAQTVVMQTEGVGLTASSERSLIVVLQSIELVCNSLKEEFSSELMDYLY
                     IVVENLGSSSPKVRHFAQSCALTISHVLYNDSLQQLILSNVDYLADSISSRLNSGMTE
                     RVSTVFMVICRIAGYETIESFKDIIETIFKLLDYYHGYSEMCLQFFQLFEVIALEIQK
                     KYLSTNDEESRLTQEHKSNCGDAPWGMTSLNQVLAVMDKQSTKDDEIESLEADKPKNF
                     QEYFDSKLRELDSDDEEESEQENIGDEPELVEGEAKEDQWVSPIPRKSYKILLQILGY
                     GDRLLTHRSKSLRVQILCCTKLILPMLATQYDSLLPQVAQIWNTLALCSLDNDFSIVK
                     PACDCLQEVILCAGDFVTTRFLELWKTWKDKSGLLKELKLNNQDYAEAFTSLVPHRKF
                     PTITEMALTSLSKVLLEGILAAGLMLPDTTAREMVTCCIQILPTESIASRSLMLGDMV
                     FAITHEV"
     gene            complement(<568564..>569112)
                     /gene="TDEL0A03170"
                     /locus_tag="TDEL_0A03170"
                     /db_xref="GeneID:11502990"
     mRNA            complement(<568564..>569112)
                     /gene="TDEL0A03170"
                     /locus_tag="TDEL_0A03170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678812.1"
                     /db_xref="GeneID:11502990"
     CDS             complement(568564..569112)
                     /gene="TDEL0A03170"
                     /locus_tag="TDEL_0A03170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678860.1"
                     /db_xref="GeneID:11502990"
                     /db_xref="GOA:G8ZM05"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:G8ZM05"
                     /translation="MFRRSVIGQSRLFSSTRSILGKKVYFEPSVNGNKIGRIEFELYD
                     DVVPKTAENFRALCTGENGFGYKGVPFHRIIPQFMLQGGDTDLTDGFGGQSIYGSKFA
                     DENFTKKHDKAGLLSMANAGPNTNGSQFFITTVECPWLDGKHVVFGEVTKGMDLVKQI
                     EGYGTMSGKPKAKIVVEEAGEL"
     gene            <569298..>571001
                     /gene="TDEL0A03180"
                     /locus_tag="TDEL_0A03180"
                     /db_xref="GeneID:11503015"
     mRNA            <569298..>571001
                     /gene="TDEL0A03180"
                     /locus_tag="TDEL_0A03180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678813.1"
                     /db_xref="GeneID:11503015"
     CDS             569298..571001
                     /gene="TDEL0A03180"
                     /locus_tag="TDEL_0A03180"
                     /inference="similar to DNA sequence:INSDC:YHL010C"
                     /note="similar to Saccharomyces cerevisiae YHL010C;
                     ancestral locus Anc_2.542"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678861.1"
                     /db_xref="GeneID:11503015"
                     /db_xref="GOA:G8ZM06"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR011422"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G8ZM06"
                     /translation="MESKFVVVLEFGAEEQVNLAYRSFTERLTVQDCLPVGGKDLKTD
                     WRVCELSIDTLHDMGLPVDSQDNDLLLSQYVGHGIIRLFRLNDKDIEVTSNSDLLTVP
                     GDDTMVSILFVPTYFTVHDLLHFYIGDDIVNNQVSNFRILRNKKGELGFNFMVLIKFK
                     DPLNAKKFKDEFNGKRFSKMDPETCHVVSIKEVVFNKAVFNGKERAKIPYLLTDPFTT
                     KKHEKSQSLEVELPTCPVCLERMDSDTTGLITIPCQHTFHCQCLDKWKNSRCPVCRYS
                     SIRLSRNSAVRQTGEISGCSTCGCHENLWICLVCGNIGCGRYNSKHAIQHYDDTSHCF
                     AMDMQTQRVWDYAGDNYVHRLVQNEVDGKIVEVEADRLTSDGPNNSSQRSASSSLDKD
                     SNMAANFMRNKEYHLEYVQVLVSQLESQREYFEMKLEQVQAAESRSDEIEPLRREIEE
                     LKISFKDCQLDFKQEREVTRKQLDEDKLVIRGLQENLDHLTEEKAQILKENDDLQREK
                     QDLQEQVQDLMFYLQSQEKFKDADDSVKEGTIIIPGSNQTSQRSSKNAKKKSKTKRKP
                     K"
     gene            <571886..>572848
                     /gene="TDEL0A03190"
                     /locus_tag="TDEL_0A03190"
                     /db_xref="GeneID:11503007"
     mRNA            <571886..>572848
                     /gene="TDEL0A03190"
                     /locus_tag="TDEL_0A03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678814.1"
                     /db_xref="GeneID:11503007"
     CDS             571886..572848
                     /gene="TDEL0A03190"
                     /locus_tag="TDEL_0A03190"
                     /inference="similar to DNA sequence:INSDC:YHL011C"
                     /note="similar to Saccharomyces cerevisiae PRS3 (YHL011C);
                     ancestral locus Anc_2.543"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678862.1"
                     /db_xref="GeneID:11503007"
                     /db_xref="GOA:G8ZM07"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:G8ZM07"
                     /translation="MATNSIKLLAPDVHRGLAELVSKRLGLPLIDTVLTRDPTGEVSF
                     SIGESVRDQDIFIITQIGSGVVNDRVLELLIMINASKTASARRITAVIPNFPYARQDR
                     KDKSRAPITAKLMADMLTTAGCDHVITMDLHASQIQGFFDSPVDNLYAEPSVVRYIKE
                     NVNFKEAIIVSPDAGGAKRAATLADRLDLNFALIHKERARANEVSRMVLVGDVTDKIC
                     IIVDDMADTCGTLAKAADVLLDNNAKSVIAIVTHGVLSGKAIQNINSSRLDRVVCTNT
                     VPFEEKMKVCPKLDVIDISSVLAESIRRLHNGESISYLFKHSPL"
     gene            complement(<572932..>573660)
                     /gene="TDEL0A03200"
                     /locus_tag="TDEL_0A03200"
                     /db_xref="GeneID:11503067"
     mRNA            complement(<572932..>573660)
                     /gene="TDEL0A03200"
                     /locus_tag="TDEL_0A03200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678815.1"
                     /db_xref="GeneID:11503067"
     CDS             complement(572932..573660)
                     /gene="TDEL0A03200"
                     /locus_tag="TDEL_0A03200"
                     /inference="similar to DNA sequence:INSDC:YKL033W-A"
                     /note="similar to Saccharomyces cerevisiae YKL033W-A;
                     ancestral locus Anc_2.544"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678863.1"
                     /db_xref="GeneID:11503067"
                     /db_xref="GOA:G8ZM08"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G8ZM08"
                     /translation="MPIDDVLTLDRKIRACLFDMDGLLINTEDIYTATLNEILAHHGK
                     GPLTWDVKIHLQGLPGPVAAEKVIKTYDLPLTWEEYERLNVEVQSNKWGDCAFLPGAL
                     ELIKHLKSKNIPIALCTSSGKYKFENKTKHLQHGFELFDAVVTGDDKRIPEGRGKPFP
                     DIWQVGLKQLNEADGTDIKPEDCLVFEDGIPGVKAGLAFGAYVIWVPHPGAVEYLGDT
                     VQLLNGNGEILKSLEDLEKSKYGL"
     gene            <574153..>575907
                     /gene="TDEL0A03210"
                     /locus_tag="TDEL_0A03210"
                     /db_xref="GeneID:11503040"
     mRNA            <574153..>575907
                     /gene="TDEL0A03210"
                     /locus_tag="TDEL_0A03210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678816.1"
                     /db_xref="GeneID:11503040"
     CDS             574153..575907
                     /gene="TDEL0A03210"
                     /locus_tag="TDEL_0A03210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678864.1"
                     /db_xref="GeneID:11503040"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G8ZM09"
                     /translation="MPAPWKSVVGVKSSKPAQVSEKTVSSEAEDNVLPSSDDEVINEE
                     LQKGVQKAQAMTQLWKKRDLIAIFIIIWVIQFVLAFSSGIIGTLTPYVTSSFEQHSLT
                     AFDWCYFNSYCWSDQIALCQSIDIWGRAQGFAFMVLSITIGTIMMAGCNNVKTYCAAQ
                     VFYWVGYNGIDFTITIFIADTTKLKNRAFILAYTSSCYIATVWAYGPAAESILNTIGF
                     RWGFGIWAIIIPVVCSPLFGLLYYYQQKAVKVGLIPKREKSGRTFWQSVVFYGKEFDV
                     IGIFILALGLALFLLGFNLYSYQKNEWRSPLIICFLIIGGLLIISFGIWEYFAPVSFI
                     PWELLTNRTVIFTYSMAAAMYCSFYIWDSYFFRHHCRFNLSTARATYITNIYSIGSCF
                     CALVVGVIIRCYGRLKSIALFWGVPITMLGCGLMIKYRSPDSNLGLIVMCQLFIAFGG
                     GALVICEQMTVMAVSAQQHIPAVLAMEAMVIAIGEAVGQTIAGAMWTGIFPKKLAEYL
                     PADVQDQLLSIYGSLTVQISYPRGTAAREAIDRSYGDTQRLMCIAATCIYATCIFSTL
                     LWKEVNVKEIKQVKGLTL"
     gene            <576288..>577476
                     /gene="TDEL0A03220"
                     /locus_tag="TDEL_0A03220"
                     /db_xref="GeneID:11503052"
     mRNA            join(<576288..576542,577078..>577476)
                     /gene="TDEL0A03220"
                     /locus_tag="TDEL_0A03220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678817.1"
                     /db_xref="GeneID:11503052"
     CDS             join(576288..576542,577078..577476)
                     /gene="TDEL0A03220"
                     /locus_tag="TDEL_0A03220"
                     /inference="similar to DNA sequence:INSDC:YDR381W"
                     /note="similar to Saccharomyces cerevisiae YRA1 (YDR381W);
                     ancestral locus Anc_5.458"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678865.1"
                     /db_xref="GeneID:11503052"
                     /db_xref="GOA:G8ZM10"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8ZM10"
                     /translation="MSANLDKSLDEIIGANKKPVRARINKRTQVPRKAPKQIRRSAQG
                     ANVRAPVAGAASRVARLLDSTREAKVNVEGLPRDIKQDAVKEFFASQVGGVARVLLSY
                     NERGQSTGMANITFKNGEMAKKAVAKFNGAPIDGGRSRLRLNLIIDPSQAPARSLSER
                     IRAIPSKNVRQGANLPKGPNKKAAMAKKPKPQRAPKQPKKSLEDLDKEMADYFEEKQ"
     gene            complement(<577599..>577990)
                     /gene="TDEL0A03230"
                     /locus_tag="TDEL_0A03230"
                     /db_xref="GeneID:11502579"
     mRNA            complement(join(<577599..577902,577962..>577990))
                     /gene="TDEL0A03230"
                     /locus_tag="TDEL_0A03230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678818.1"
                     /db_xref="GeneID:11502579"
     CDS             complement(join(577599..577902,577962..577990))
                     /gene="TDEL0A03230"
                     /locus_tag="TDEL_0A03230"
                     /inference="similar to DNA sequence:INSDC:YDR381C-A"
                     /note="similar to Saccharomyces cerevisiae YDR381C-A;
                     ancestral locus Anc_5.459"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678866.1"
                     /db_xref="GeneID:11502579"
                     /db_xref="UniProtKB/TrEMBL:G8ZM11"
                     /translation="MSANPFQNLGKNIIYVSIGAVASVLVVKGVVKARREAKYSSTGM
                     ASSDSSKQSAAYYDNLAHVKPGFPLPNSEQGEDERQRKSEFEGPGMSVLSRRSGDRLG
                     LFNWGKDK"
     gene            <578122..>579105
                     /gene="TDEL0A03240"
                     /locus_tag="TDEL_0A03240"
                     /db_xref="GeneID:11502715"
     mRNA            <578122..>579105
                     /gene="TDEL0A03240"
                     /locus_tag="TDEL_0A03240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678819.1"
                     /db_xref="GeneID:11502715"
     CDS             578122..579105
                     /gene="TDEL0A03240"
                     /locus_tag="TDEL_0A03240"
                     /note="ancestral locus Anc_5.460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678867.1"
                     /db_xref="GeneID:11502715"
                     /db_xref="GOA:G8ZM12"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8ZM12"
                     /translation="MSTSLEEEFNPQEAEELAHALAGAGGGALSMALTYPLVTISTKL
                     QAEAKSEKEEKRSPWRVIEDIWQKEGLAGYYSGLESAIYGMAVANFIYYYFYESTGRS
                     IQRLRRKTQLNALESIVTGAIAGSATAIASNPIWVANTRMTITKSEKSTLAMMLQIVK
                     DDGVLALFKGLKPALILVTNPIIQYTVFEQLKNMILGLQGNQNAILAPSWAFLLGAVG
                     KLIATGVTYPYITLKTRKHMEGDKNLKTKAETAGKSEAKVSAIEIIKKEGISGLYRGI
                     GYKLVQSILTAAFLFYFKEGLVLWAIKALRLLRQFNQSSLRQRRIIVSKLG"
     gene            complement(<579158..>580051)
                     /gene="TDEL0A03250"
                     /locus_tag="TDEL_0A03250"
                     /db_xref="GeneID:11503078"
     mRNA            complement(<579158..>580051)
                     /gene="TDEL0A03250"
                     /locus_tag="TDEL_0A03250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678820.1"
                     /db_xref="GeneID:11503078"
     CDS             complement(579158..580051)
                     /gene="TDEL0A03250"
                     /locus_tag="TDEL_0A03250"
                     /inference="similar to DNA sequence:INSDC:YOR130C"
                     /note="similar to Saccharomyces cerevisiae ORT1 (YOR130C);
                     ancestral locus Anc_5.461"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678868.1"
                     /db_xref="GeneID:11503078"
                     /db_xref="GOA:G8ZM13"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8ZM13"
                     /translation="MESEGVAIAEQKDRGLKSKALRDIINGSIAGAFGKTIEYPFDTV
                     KVRLQTQDAKVFPTTWSCIKYTYKNEGILRGFFQGIGSPVFGASLENAVLFVSYNQCS
                     QLLERHSKVSPLQQILLSGALAGSCASLVLTPVELVKCKLQVSNLQNSINGVKKPTKI
                     IPTIKTVLQERGFLGLWQGQSGTFIRESFGGVAWFSTYEILKNYLKDRHEDGRDSDTW
                     ELLLSGATAGLAYNASIFPADTLKSMMQTENIGLLQCAKRVIATSGIAGFYRGLGITL
                     IRAVPANAAVFYTYESLSKLI"
     gene            <580648..>580980
                     /gene="TDEL0A03260"
                     /locus_tag="TDEL_0A03260"
                     /db_xref="GeneID:11502955"
     mRNA            <580648..>580980
                     /gene="TDEL0A03260"
                     /locus_tag="TDEL_0A03260"
                     /product="60S acidic ribosomal protein P2"
                     /transcript_id="XM_003678821.1"
                     /db_xref="GeneID:11502955"
     CDS             580648..580980
                     /gene="TDEL0A03260"
                     /locus_tag="TDEL_0A03260"
                     /inference="similar to DNA sequence:INSDC:YDR382W"
                     /note="similar to Saccharomyces cerevisiae RPP2B
                     (YDR382W); ancestral locus Anc_5.462"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P2"
                     /protein_id="XP_003678869.1"
                     /db_xref="GeneID:11502955"
                     /db_xref="GOA:G8ZM14"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:G8ZM14"
                     /translation="MKYLAAYLLLVQGGNASPSAADIKSVIESVGVEAEESRINELLS
                     SLEGKGSLEEIIAEGQQKFASVPAGGAAVSGGAASGAAAGGEEAAEEEKEEEKEESDD
                     DMGFGLFD"
     STS             580784..581656
                     /standard_name="D1S3694"
                     /db_xref="UniSTS:474272"
     gene            complement(<581050..>581703)
                     /gene="TDEL0A03270"
                     /locus_tag="TDEL_0A03270"
                     /db_xref="GeneID:11503079"
     mRNA            complement(<581050..>581703)
                     /gene="TDEL0A03270"
                     /locus_tag="TDEL_0A03270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678822.1"
                     /db_xref="GeneID:11503079"
     CDS             complement(581050..581703)
                     /gene="TDEL0A03270"
                     /locus_tag="TDEL_0A03270"
                     /inference="similar to DNA sequence:INSDC:YDR383C"
                     /note="similar to Saccharomyces cerevisiae NKP1 (YDR383C);
                     ancestral locus Anc_5.463"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678870.1"
                     /db_xref="GeneID:11503079"
                     /db_xref="UniProtKB/TrEMBL:G8ZM15"
                     /translation="MYEELVRFVRDECARRSQLSDLQGQIPSAVLKGLKTKINEEDQL
                     NVIKQDAVCKRIYDLESEWRKSKIKEITELIGDIPKYSIGTQIQDTDSGISIDKLVED
                     VSKLPNMGMFNPGADEADKSSKVLTEYTNLREDLIEKCQAITLGKQTVLDLENQARMI
                     RYLINSTVEENSEYFETYHSKVSSSLEELRLFLEEAIKSSDSQPEKRLKLRKVLDNF"
     gene            581834..581905
                     /gene="TDEL0Atrna6D"
                     /locus_tag="TDEL_0Atrna6D"
                     /db_xref="GeneID:11502911"
     tRNA            581834..581905
                     /gene="TDEL0Atrna6D"
                     /locus_tag="TDEL_0Atrna6D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:11502911"
     gene            582562..582633
                     /gene="TDEL0Atrna7D"
                     /locus_tag="TDEL_0Atrna7D"
                     /db_xref="GeneID:11503181"
     tRNA            582562..582633
                     /gene="TDEL0Atrna7D"
                     /locus_tag="TDEL_0Atrna7D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:11503181"
     gene            complement(<582754..>583578)
                     /gene="TDEL0A03280"
                     /locus_tag="TDEL_0A03280"
                     /db_xref="GeneID:11502691"
     mRNA            complement(<582754..>583578)
                     /gene="TDEL0A03280"
                     /locus_tag="TDEL_0A03280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678823.1"
                     /db_xref="GeneID:11502691"
     CDS             complement(582754..583578)
                     /gene="TDEL0A03280"
                     /locus_tag="TDEL_0A03280"
                     /inference="similar to DNA sequence:INSDC:YDR384C"
                     /note="similar to Saccharomyces cerevisiae ATO3 (YDR384C);
                     ancestral locus Anc_5.464"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678871.1"
                     /db_xref="GeneID:11502691"
                     /db_xref="GOA:G8ZM16"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="UniProtKB/TrEMBL:G8ZM16"
                     /translation="MSNPSSPSASSSISAHEANAQHKTGSDQVLGAPRVVHQVTADGE
                     YVTIGAQTFRRQDLANIFVNDLDSETYRRRPKLQRLANPVPLGLASFSFCALTLSLVN
                     ARVRGVTIPSLLVAPFLFFGGAIELFAGLLCFVTGDTYAMTVFSAFGGFWISWGCINT
                     EAFGVTAAYADDPQMFANITGFFLAGWVVFTFLVWLCSMKSTWGLFLLLGFLDMTFLL
                     LCIGTFIGNVNVTMAGGYFGILSSICGWYSLYCGISNDDNGYLPLRAYAMPNAATV"
     gene            complement(<583715..>584368)
                     /gene="TDEL0A03290"
                     /locus_tag="TDEL_0A03290"
                     /db_xref="GeneID:11503221"
     mRNA            complement(<583715..>584368)
                     /gene="TDEL0A03290"
                     /locus_tag="TDEL_0A03290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678824.1"
                     /db_xref="GeneID:11503221"
     CDS             complement(583715..584368)
                     /gene="TDEL0A03290"
                     /locus_tag="TDEL_0A03290"
                     /inference="similar to DNA sequence:INSDC:YOR131C"
                     /note="similar to Saccharomyces cerevisiae YOR131C;
                     ancestral locus Anc_5.465"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678872.1"
                     /db_xref="GeneID:11503221"
                     /db_xref="GOA:G8ZM17"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G8ZM17"
                     /translation="MKNYLSLTTSKMLKGFKAIVFDMDGTLCLPQPWMFPAMRQAVGL
                     TDPSRDILEYIGSLSPAQQRKALRAVEQVEHKAMVQMEPQPGLQQVLKWLTHARISKN
                     VCTRNLRAPFDHLIASFVPAQYSQFDHILTREFCPTKPFAGPLLHIAKQLNLDPRSIV
                     MVGDSLDDMLSGRSAGCRTVLIVNEHNRSLLQSHRDLVDCTVSDLSELAVLLARCTA"
     gene            <584442..>585779
                     /gene="TDEL0A03300"
                     /locus_tag="TDEL_0A03300"
                     /db_xref="GeneID:11502926"
     mRNA            <584442..>585779
                     /gene="TDEL0A03300"
                     /locus_tag="TDEL_0A03300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678825.1"
                     /db_xref="GeneID:11502926"
     CDS             584442..585779
                     /gene="TDEL0A03300"
                     /locus_tag="TDEL_0A03300"
                     /inference="similar to DNA sequence:INSDC:YOR132W"
                     /note="similar to Saccharomyces cerevisiae VPS17
                     (YOR132W); ancestral locus Anc_5.466"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678873.1"
                     /db_xref="GeneID:11502926"
                     /db_xref="GOA:G8ZM18"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR014461"
                     /db_xref="UniProtKB/TrEMBL:G8ZM18"
                     /translation="MDRKYRLVVKVTGLERVGPIGNKRENPTVVFDVSSNVPTFRKSN
                     HTKVQKCADEFRQLFKYLNGALQESFIPALPPTFTNFGINSNDDYAKTVANFQQWFDR
                     VCENPLVVRNEEMAFFIESDFNTYSPTNSFKLPASGLKRKTLKQLSPPYDEVVELAEF
                     RPQVKALHWGSQEVQSKLMKVCRARKILAQEQNTFGQRFATLNDTQVLYKKFGKILTA
                     TGDINSVMATLDYATLYDGLEWIVKDTYVVKEALTNRHLVMRELVQAQQLSKTRQENA
                     RKLRAKRDISPLKVDEALRQLKVATQDENELTDKLQRITKNMTHEREHWLQWYENILS
                     STIKEYTMRKIEYERKKLTLLERVRTDVRRADSNGGLSRLGRKSTNPSTNTSQSTEGD
                     TWTGEHRQRTQVQVDKVAHTEFDKTLGTTETLKNDTTSLDARHAARMLGLPTF"
     gene            <586087..>588615
                     /gene="TDEL0A03310"
                     /locus_tag="TDEL_0A03310"
                     /db_xref="GeneID:11502938"
     mRNA            <586087..>588615
                     /gene="TDEL0A03310"
                     /locus_tag="TDEL_0A03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678826.1"
                     /db_xref="GeneID:11502938"
     CDS             586087..588615
                     /gene="TDEL0A03310"
                     /locus_tag="TDEL_0A03310"
                     /inference="similar to DNA sequence:INSDC:YDR385W,YOR133W"
                     /note="similar to Saccharomyces cerevisiae EFT2 (YDR385W)
                     and EFT1 (YOR133W); ancestral locus Anc_5.467"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678874.1"
                     /db_xref="GeneID:11502938"
                     /db_xref="GOA:G8ZM19"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZM19"
                     /translation="MVAFTVDQMRSLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQKAG
                     IISAAKAGEARFMDTRKDEQERGITIKSTAISLFAEIGEEDVKDMKQKTEGASFLINL
                     IDSPGHVDFSSEVTAALRVTDGALVVVDTVEGVCVQTETVLRQALGERIKPVVVINKV
                     DRALLELQVSKEDLYQSFSRTVESVNVIISTYADEVLGDVQVYPSQGTVAFGSGLHGW
                     AFTIRQFANRYGKKFGVDKAKMMERLWGDSYFNPKTKKWTNKDTDADGKPLERAFNMF
                     VLDPIFRLFAAIMNFKKDEIPVLLEKLEINLKGDEKDLEGKALLKVVMKKFLPAADAL
                     LEMIVMHLPSPVTAQYYRAEQLYEGPADDASCLAIKNCDPKADLMLYISKMVPTSDKG
                     RFYAFGRVFAGTVKSGQKVRIQGPNYVPGKKDDLFLKAIQRVVLMMGSRTEPIDDCPA
                     GNIVGLVGIDQFLLKSGTLTTNEASHNMKVMKFSVSPVVQVAVEVKNANDLPKLVEGL
                     KRLSKSDPCVLTTMNESGEHIVAGTGELHLEICLQDLENDHAGIPLKISPPVVSYRET
                     VEGESSQVALSKSPNKHNRIYLKAQPIDEEVSLAIETGKINPRDDLKARARIMADEFG
                     WDVTDARKIWCFGPDGNGPNLVVDQTKAVQYLHEIKDSVVAAFQWATKEGPIFGEQMR
                     SVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGVLLAEPKIQEPVFLVEIQCPEQAV
                     GGIYSVLNKKRGQVVSEEQRPGTPLFTVKAYLPVNESFGFTGELRQATGGQAFPQMVF
                     DHWATLGSDPLDPTTKAGEIVLAARKRHGMKEQVPGWQEYYDKL"
     gene            <588837..>590717
                     /gene="TDEL0A03320"
                     /locus_tag="TDEL_0A03320"
                     /db_xref="GeneID:11503384"
     mRNA            <588837..>590717
                     /gene="TDEL0A03320"
                     /locus_tag="TDEL_0A03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678827.1"
                     /db_xref="GeneID:11503384"
     CDS             588837..590717
                     /gene="TDEL0A03320"
                     /locus_tag="TDEL_0A03320"
                     /inference="similar to DNA sequence:INSDC:YDR386W"
                     /note="similar to Saccharomyces cerevisiae MUS81
                     (YDR386W); ancestral locus Anc_5.468"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678875.1"
                     /db_xref="GeneID:11503384"
                     /db_xref="GOA:G8ZM20"
                     /db_xref="InterPro:IPR006166"
                     /db_xref="InterPro:IPR010996"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR020819"
                     /db_xref="UniProtKB/TrEMBL:G8ZM20"
                     /translation="MSLPSDLKHLYAQWLEEFTAVLNPRQDQLASTYDKARRNLLDAE
                     SVIYYPQDLKKIKGIGDTIMRRLEKRLQQHCSELGVPVPVRPTASELQRGLKRTTTAL
                     RSKSAEGTTENVNQSGPAKKRQRKYIPKKRSGGYGILLALLQANAVTRGISKDSIVEI
                     GQRYCDSSMGPNFMTKELRGAWSAVKSLIKHELVVEQGRPKIYFLTEEGQQLAKTLKL
                     ADKIVFENENEGGTEGFECNRVVDSEVTANLHQLLGIEGNTTVSRPEDASSSLINVTF
                     QDPNATPVNKQSRISRSRTLAISTPVSRTIAGVRRAYSIEKPQNGESTLKRRFDGISY
                     EVWHKGTYEVYPIIDHREVKSHQNRDFFAKALELKGIKCEIRQLALGDIVWIAKNTKT
                     GTECILNTIIERKRLDDLAISIRDNRFMEQKNRLEKSGCKNKYYLIEETMARTMEGMT
                     EALKTALWVILVYYRFSMIRTVNADETVEKLYALHTVINREYLEKNLVVIYPNDLRNQ
                     DDFLKVLEKFRLEFEKDHTIECCHTYPCFQEIMGKGEMSTVGELTIRILMYINGVSIE
                     KAVAIQSRFPTLNHILTAYNECETEEEAKLLMFSKLGDAPGTKKITKGLSEKIADVFS
                     KF"
     gene            complement(<590772..>592421)
                     /gene="TDEL0A03330"
                     /locus_tag="TDEL_0A03330"
                     /db_xref="GeneID:11503240"
     mRNA            complement(<590772..>592421)
                     /gene="TDEL0A03330"
                     /locus_tag="TDEL_0A03330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678828.1"
                     /db_xref="GeneID:11503240"
     CDS             complement(590772..592421)
                     /gene="TDEL0A03330"
                     /locus_tag="TDEL_0A03330"
                     /inference="similar to DNA sequence:INSDC:YDR387C"
                     /note="similar to Saccharomyces cerevisiae YDR387C;
                     ancestral locus Anc_5.469"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678876.1"
                     /db_xref="GeneID:11503240"
                     /db_xref="GOA:G8ZM21"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZM21"
                     /translation="MENGQCVRTPATSPTSEVDDVYSDLYSTLSQVTSSTVNDIDQLP
                     YQLTFKSAVTYLGACLCGLLFGYDTGVISGVLLKIRPEDISREVITNFDKELITSVTC
                     LGSFFGSILGFPLSDTYGRRKTLAFCSAIFIVGGIWMALSKSLSLLIMGRLVVGVAIG
                     IAAQCVPVFLSEVSPASIRGTVLTLNSLAITGGQFLSYVAAYMLADLKHSWRYLFGIS
                     AIPAVIFLALMKFIPESPRWLISRSEFTKAHASLRVIYPAASSQQLGLKLRKLVQDIC
                     KLRKYEDIEEPLLLNRSKLFGPKSKAKTSKQSMDGNQNGTVTTEIPDSLPQDRHQKQV
                     HKMEPRAKRALVIGCVLMFFQQASGFNAFMYYATILFEDLNVSNPLLPAMGIAFTNFL
                     FTFVALGLVDIVGKRAMLLYTIWIMTLSLLLSTVSFDINDTRLILTSVLMFVASFASA
                     MGNIPWSSVEFLPLNRRAFGASCISCTNWLTNTVVSMSFLSLVNHFGSKNIMLAFALF
                     TALNWVFVYFWYPEVKGLTLEEIGKVFDHGIDVNYVYRNYH"
     gene            <592752..>594173
                     /gene="TDEL0A03340"
                     /locus_tag="TDEL_0A03340"
                     /db_xref="GeneID:11502802"
     mRNA            <592752..>594173
                     /gene="TDEL0A03340"
                     /locus_tag="TDEL_0A03340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678829.1"
                     /db_xref="GeneID:11502802"
     CDS             592752..594173
                     /gene="TDEL0A03340"
                     /locus_tag="TDEL_0A03340"
                     /inference="similar to DNA sequence:INSDC:YDR388W"
                     /note="similar to Saccharomyces cerevisiae RVS167
                     (YDR388W); ancestral locus Anc_5.470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678877.1"
                     /db_xref="GeneID:11502802"
                     /db_xref="GOA:G8ZM22"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR004148"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:G8ZM22"
                     /translation="MSFKGFTKAVARAPQSFRQKFNMGEQVEDPVYEDAERRFKELET
                     EVKKLSDESKRYSGAVNGMLTHQIGFAKAMEEIFKPISGKMSDPNAAVPEDNPEGIEA
                     CEQYRAIVAELQEVLKPDLKLIDEKIILPCADLLKTIGCIRKMATKRNHKKLDLDRRY
                     NNYKKYESKDNPNPKDEERMFKAQAEMEAAQQEYDYYNEMLKTQLPVLFGLEAQFVQP
                     LFVSFYFMQLNIFYTLYNRFQEMKIPYFDLTTDILEAFQFKRGNVEEQCDALTITRFK
                     LGYSKAKLEMTRKRYGSQSPTSTGGPSQTGYPASPTSPTAYNAAPGAYGAGAPGAFGA
                     GVPGAGVPGAGVPGAGAYGAAAGAVAGAGAYGAAAPGAYGMQSPTATGFQQSPTTAGS
                     YGQSAPPPAYSMSTATTAPPAANTVTALYDYQAQAPGDLSFTAGAVIEVVQRTDDPNE
                     WWTGRYNGQQGVFPGNYVQVNKN"
     gene            <594838..>596790
                     /gene="TDEL0A03350"
                     /locus_tag="TDEL_0A03350"
                     /db_xref="GeneID:11503110"
     mRNA            <594838..>596790
                     /gene="TDEL0A03350"
                     /locus_tag="TDEL_0A03350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678830.1"
                     /db_xref="GeneID:11503110"
     CDS             594838..596790
                     /gene="TDEL0A03350"
                     /locus_tag="TDEL_0A03350"
                     /inference="similar to DNA sequence:INSDC:YDR389W,YOR134W"
                     /note="similar to Saccharomyces cerevisiae SAC7 (YDR389W)
                     and BAG7 (YOR134W); ancestral locus Anc_5.471"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678878.1"
                     /db_xref="GeneID:11503110"
                     /db_xref="GOA:G8ZM23"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:G8ZM23"
                     /translation="MTSGGSGMASPTKSPISLLWKQLNSNPKSMSTDSLSLPSPVSSN
                     QNLNGETAGLRMPVLSSSENYEDSNLSAKQSSKVWSGSTPNSSEYKHFRDDFLANRHG
                     FTGRVFGVSLSESLSVASAEVIVQSGLVSFGRIPIVVAKCGAYLKANGLETSGVFRIA
                     GNSKRVKELQYIFSSPPDYGAKFNGWDAYTVHDVASLLRRFLNNLEEPLVPLDLYEAF
                     RKPLQNRPRILRHMANQTTTGSNANKENTDVLKKPNAEADKDDRANDGDEEKEDDDPQ
                     LSEERKKKRQRHRKRLIRDIRAAIKEYEGLFVSISNDTKQLTIYLLDLMSLFARQSQF
                     NLMTGRNLAAIFQPSILSHPQHDMDPREYELSRYVTEFLIEYSYKLLPHLLKLTKDEQ
                     QQQPQQEPQQQAQEQPQQQPQQPSQTNQLEAPKAHKLVVTNEKNESVTFATPDSISIP
                     LKTENEASVAPSTTIFGSPSKNAPPRQPLKVPKQRRPHSKSIGSAPIPPDVIASNKRK
                     SRLFPWSPKPGILSDNGGDFTATEEEGDEYYDEEHREAMHSPLSVNSNSVTRQQFLPI
                     PPMNRSLSGNSTASSLTRRPMSAIFIGSRNSSIDAIDAAKGNDTGNDKKVLSDEGELE
                     ERGTRSRKRDSWFQRLRSRSRSNTRS"
     gene            complement(<596893..>598869)
                     /gene="TDEL0A03360"
                     /locus_tag="TDEL_0A03360"
                     /db_xref="GeneID:11502808"
     mRNA            complement(<596893..>598869)
                     /gene="TDEL0A03360"
                     /locus_tag="TDEL_0A03360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678831.1"
                     /db_xref="GeneID:11502808"
     CDS             complement(596893..598869)
                     /gene="TDEL0A03360"
                     /locus_tag="TDEL_0A03360"
                     /inference="similar to DNA sequence:INSDC:YDR390C"
                     /note="similar to Saccharomyces cerevisiae UBA2 (YDR390C);
                     ancestral locus Anc_5.472"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678879.1"
                     /db_xref="GeneID:11502808"
                     /db_xref="GOA:G8ZM24"
                     /db_xref="InterPro:IPR000127"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018074"
                     /db_xref="InterPro:IPR019572"
                     /db_xref="InterPro:IPR023280"
                     /db_xref="UniProtKB/TrEMBL:G8ZM24"
                     /translation="MTYLALNPSTRLLQMKLHNGIKSMKCAYIEALGSSSMARESNIV
                     KIVGQENHKKLRSFKCLIVGAGGIGSELLKDCILMDFGEIHIVDLDTIDLSNLNRQFL
                     FRQRDIKQPKSTTAVKAVQHFNNSKLIPYQGNVMDTTQFPLAWFGQFDIIFNGLDNLA
                     ARRYVNKMTQFLGKPLLESGTSGFDGYIQPIIPGQTECFDCTPKETPKTFPVCTIRST
                     PSQPVHCIVWAKNFLFNQLFNTDTPANENTNDWGTEDQAEIERIKQETNELHDLQKII
                     LTNDDSRINDILVKLFIRDIEKLLQIENLWKTRTKPSPLDQTLIDKASKAELQNPSLS
                     SLWDIQEQVTEFIRVTKVLMQRIHEGEKSLEFDKDDEDTLRFVSTAANIRSHIFNIPV
                     KTGFDIKQIAGNIIPAIATTNAVIAGLSTLTALRVLNLLSYAPTKKATDLNMAFTAKA
                     SNLSMGRYISNPKLAPPNPACPVGGKVCRGVLKITEKGLNEINLSKLIDFIREKYEYP
                     EETSIIDTSNQRLLADYDFDDLECKTLADCKLHAGSVVLFSDEEGVDGGSYRKAIELY
                     IETVKGPLENEINLPDVVVPLVTVSEQAPATEEQEEPSQLKSETDKGIIDLGSEDETS
                     TAGKKRPLVDIETNDAKRIKLDQDDNNDDLIELE"
     gene            <599855..>600970
                     /gene="TDEL0A03370"
                     /locus_tag="TDEL_0A03370"
                     /db_xref="GeneID:11503347"
     mRNA            <599855..>600970
                     /gene="TDEL0A03370"
                     /locus_tag="TDEL_0A03370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678832.1"
                     /db_xref="GeneID:11503347"
     CDS             599855..600970
                     /gene="TDEL0A03370"
                     /locus_tag="TDEL_0A03370"
                     /inference="similar to DNA sequence:INSDC:YOR136W"
                     /note="similar to Saccharomyces cerevisiae IDH2 (YOR136W);
                     ancestral locus Anc_5.473"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678880.1"
                     /db_xref="GeneID:11503347"
                     /db_xref="GOA:G8ZM25"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004434"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:G8ZM25"
                     /translation="MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFI
                     EGDGVGPEISKSVKDIFAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALK
                     GPLATPIGKGHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYA
                     GIEHVIVPGVVQSIKLITREASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFV
                     TVAKELAHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDILSDLNSGLSA
                     GSLGLTPSGNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHASK
                     IEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL"
     gene            complement(<601033..>602712)
                     /gene="TDEL0A03380"
                     /locus_tag="TDEL_0A03380"
                     /db_xref="GeneID:11503252"
     mRNA            complement(<601033..>602712)
                     /gene="TDEL0A03380"
                     /locus_tag="TDEL_0A03380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678833.1"
                     /db_xref="GeneID:11503252"
     CDS             complement(601033..602712)
                     /gene="TDEL0A03380"
                     /locus_tag="TDEL_0A03380"
                     /inference="similar to DNA sequence:INSDC:YOR137C"
                     /note="similar to Saccharomyces cerevisiae SIA1 (YOR137C);
                     ancestral locus Anc_5.474"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678881.1"
                     /db_xref="GeneID:11503252"
                     /db_xref="GOA:G8ZM26"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8ZM26"
                     /translation="MQRRLRHRRIITILRRLAIASFFLLAYSSRSSFIIHLQNTFNVP
                     TTSEYRGGLIDDVQSIRCYRWFGQCRSLIAKQRSSDDRIVSWSRISKNLTDESLYSIE
                     TSFFYKTYLYVHEWDGSVNPGPISELAISRDSSMIPIQVTQDVQRLIKTSDSSVFHNH
                     VHRERRPIIDFFTRDHSDSDIIHSLGEDWKYKGGGIWCKHRSDQDPITNIQLYLGSGF
                     LESRPNWKEVIHEYSRNKGHKSQLISVTREINNGHEKGEQSVIIKDDDVLRISLSPHY
                     GKSLKILQISDIHFRCSEDTIAVLSEFQTKHFISNVISRERPDLVVVTGDFLDGDNSL
                     DYQACIMKLVQPMIKSKTPYAITTGVSDYSRFAAISQIQDFIKGLPYSLNRYASPEGH
                     LAISSHFSKGTDAAIYILDSFHPVKQFFSMQKDYQTYRYALAFRHLPIPEYRPEGVFP
                     IIGQYNEQSIVKSKLFDDKILQKIMYSFNVKAMSCGHEHSNDCCLQSRGDMWLCYGGS
                     AGIGIDRMNGMEPSVRLFNIDGDLDEVTSWKRNFRLIESVYDYQYIYQGQL"
     gene            complement(<603062..>604930)
                     /gene="TDEL0A03390"
                     /locus_tag="TDEL_0A03390"
                     /db_xref="GeneID:11502843"
     mRNA            complement(<603062..>604930)
                     /gene="TDEL0A03390"
                     /locus_tag="TDEL_0A03390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678834.1"
                     /db_xref="GeneID:11502843"
     CDS             complement(603062..604930)
                     /gene="TDEL0A03390"
                     /locus_tag="TDEL_0A03390"
                     /inference="similar to DNA sequence:INSDC:YOR138C"
                     /note="similar to Saccharomyces cerevisiae RUP1 (YOR138C);
                     ancestral locus Anc_5.475"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678882.1"
                     /db_xref="GeneID:11502843"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="UniProtKB/TrEMBL:G8ZM27"
                     /translation="MNDTDAVRSLVEMGISKDVAEDALRRTNGDVEAAGNFIFCNDAP
                     AQISENVEQRAHIELPAGSASGFQPGDLNEYISNAPDTESEDFEEIDVEEDSVETGPS
                     LECSGRKGQISDPTVVLPLPPNFLFEGYFALFCLFVANYMPHLLARPDFIDLNYDKNW
                     YRGDSYTNAEYRLKYLSKNGSDDEQIEIVPKDELTQEDGDYTLQSELLWQLQKLASVA
                     NSRMSDRAYVRAKMFAIAVEPQVQRNMAEAEHLHEVLPSFIKSVAVDLEMCPNFQDNE
                     VRECFISSAFHTPSNSAPQEESTMKTWLSLFHFLPEEYETNLYRMFNALLFADDSVES
                     DQSDSPDGEGENSLSEIAPVFTIVFDEMEETTEAVPLAEGVEMPLEFYPQLYTKECKD
                     KLIKHIIAKRRQSQTDSRAILQEITDLKSFQGKDLSKFINSSLDYLQKDEKSPELIKG
                     LLDLKDQITNKKTKKMNEYKEIAHRLQSEWNLSLPEIQIVKTAKELGLIDDSYLLTMA
                     VISPYMYYTRNRDGQWFFVQSTPYEASYNVRACSSPLEIQDAIKQHTRRPSEAPLMFI
                     YCKKGFIPDDDTVLKALENNQGCHRFAKDDQLQLNKMQDLSSSALSSANASIPADL"
     gene            <605729..>608161
                     /gene="TDEL0A03400"
                     /locus_tag="TDEL_0A03400"
                     /db_xref="GeneID:11502836"
     mRNA            <605729..>608161
                     /gene="TDEL0A03400"
                     /locus_tag="TDEL_0A03400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678835.1"
                     /db_xref="GeneID:11502836"
     CDS             605729..608161
                     /gene="TDEL0A03400"
                     /locus_tag="TDEL_0A03400"
                     /inference="similar to DNA sequence:INSDC:YOR140W"
                     /note="similar to Saccharomyces cerevisiae SFL1 (YOR140W);
                     ancestral locus Anc_5.476"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678883.1"
                     /db_xref="GeneID:11502836"
                     /db_xref="GOA:G8ZM28"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027722"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:G8ZM28"
                     /translation="MLQQIPQEESNGGARKASILPGNGSSGGDSGTSTTAQSANASAH
                     VPLQNTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASF
                     VRQLNMYGFHKVSNDHNKGIQQQQQQQQPSSEAGQDGVKIWEFRHSMGIFKRGDIEGL
                     KFIKRRSSRNIAALNVRKNSNPTLSTNTGGHSQGEESDSAKQQHVPQVQQPPQQQQQP
                     FHPQMQPQWQRPQFIINAENEQQQQQQQQQQQQQQQQPLPPLSRTDSFILHRYSIFNQ
                     QFQSQQLETKLRELTQSFDGLRYDYFMLQYKHDELLEQLRVLNTDMVKLLDFLQKFVT
                     LQKLSSEVYHEASLKDDPSKLHQFQKHQQEMSYLEQEILRFKANLMQRLTKKLGSCAT
                     TTATSASTSYKPKPKPKPKHKLKHMHKHKHKHKPMPKHKPKPKPKHKPKLKHKHKHKH
                     KPKHRHKLKPKLKRKCNSHRNQARISLHMHLTSYREIQKNPRSVSRSSAPSAAAFAPH
                     LFAVPAAPSESNIQQPGPFISPPDFAGPRMMMNPFETTGQTSSVKRNMSILMDPLSSA
                     PHYSGPQNSSPSRHPGNLGSQIPRNPSPLVNSCKPPKQENEPPANEVSQPVQQNSSTK
                     RTTLKDGMFILKPNKNYSTTANRNIQNDNNTGTTTASMPPTTENGNNAGSANEQNGSK
                     DAPPIALSFRTFYSNNGDANLEDQSKGESSPKNPLARTAQDATIQNSGKIPIFKTSQG
                     YSKPSDSVRADSDLPATKEPSQHNIISPVPSRTDIESRRGSSGVYSLLNREGSAPASP
                     MGESSSNKKIKL"
     gene            complement(<608343..>610856)
                     /gene="TDEL0A03410"
                     /locus_tag="TDEL_0A03410"
                     /db_xref="GeneID:11502718"
     mRNA            complement(<608343..>610856)
                     /gene="TDEL0A03410"
                     /locus_tag="TDEL_0A03410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678836.1"
                     /db_xref="GeneID:11502718"
     CDS             complement(608343..610856)
                     /gene="TDEL0A03410"
                     /locus_tag="TDEL_0A03410"
                     /inference="similar to DNA sequence:INSDC:YOR141C"
                     /note="similar to Saccharomyces cerevisiae ARP8 (YOR141C);
                     ancestral locus Anc_5.477"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678884.1"
                     /db_xref="GeneID:11502718"
                     /db_xref="GOA:G8ZM29"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR027668"
                     /db_xref="UniProtKB/TrEMBL:G8ZM29"
                     /translation="MSQDTSEKSVVYEEPIDIPLEEDDDEDEEDDEVEEHDQEHDSVK
                     EEDDEEDDENNLHAAEISRSATATPIGQRNHVEDEEDEDYNDEDAKSQERAKKHPRLD
                     PAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTLPATGLFQPVLLI
                     NQKNYSSDYLKKDEQIFALRERKTLRNNTQTSSINNTPDVIDIKNTNTEVPDYIAAAD
                     EDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPKTELNDEFQEAPLKREQ
                     PEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYNKNSKPQMIEDQNDPGAINWI
                     KKSSKRYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYASLQDLINDVISLLEHALS
                     AEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGA
                     GQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQSEFPYQD
                     WDINSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVPDQQSEQYEFKVFDEVSLAP
                     LALFYPEIISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQSECLDGDLYS
                     GNNNNQLIMSKLLDLQTSFDDFQSKPPMEADSRKNYTPLEKAIIQSITNASTPIDVAK
                     MSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKLAKQAKDIKTA
                     GKTGESEEEDQSSKKINEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMDAAELA
                     WKGACVLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY"
     gene            <611671..>612657
                     /gene="TDEL0A03420"
                     /locus_tag="TDEL_0A03420"
                     /db_xref="GeneID:11502658"
     mRNA            <611671..>612657
                     /gene="TDEL0A03420"
                     /locus_tag="TDEL_0A03420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678837.1"
                     /db_xref="GeneID:11502658"
     CDS             611671..612657
                     /gene="TDEL0A03420"
                     /locus_tag="TDEL_0A03420"
                     /inference="similar to DNA sequence:INSDC:YOR142W"
                     /note="similar to Saccharomyces cerevisiae LSC1 (YOR142W);
                     ancestral locus Anc_5.478"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678885.1"
                     /db_xref="GeneID:11502658"
                     /db_xref="GOA:G8ZM30"
                     /db_xref="InterPro:IPR003781"
                     /db_xref="InterPro:IPR005810"
                     /db_xref="InterPro:IPR005811"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR016102"
                     /db_xref="InterPro:IPR017440"
                     /db_xref="UniProtKB/TrEMBL:G8ZM30"
                     /translation="MLRSTVTKNPAFRRLFSRESTPNDKTIRNLLLPKDTKVIIQGFT
                     GKQATFHAKISQEYGTNIVGGTNPKKAGQTHLGQPVFATVKDAMKEVGATATGIFVPP
                     PIAAAAIKEAIEAEIPLAVCITEGIPQHDMLYVAEMLKSQDKTRLVGPNCPGIINPGT
                     RVRIGIQPPKIFKPGNIGIVSKSGTLTYEAVQQTTLAGLGQTMVIGMGGDAFPGTDFI
                     DALKLFMEDPATEGIIMLGEIGGQAEIEAAQFLKEYNFSRANPLPVASFIAGKVAGQM
                     KGVRMGHSGAIVEGSGTDAESKKKALNEAGVTVVESPGHLGKALLDGFARLK"
     gene            612899..612970
                     /gene="TDEL0Atrna10G"
                     /locus_tag="TDEL_0Atrna10G"
                     /db_xref="GeneID:11503019"
     tRNA            612899..612970
                     /gene="TDEL0Atrna10G"
                     /locus_tag="TDEL_0Atrna10G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGG"
                     /db_xref="GeneID:11503019"
     gene            complement(<613050..>614000)
                     /gene="TDEL0A03430"
                     /locus_tag="TDEL_0A03430"
                     /db_xref="GeneID:11503376"
     mRNA            complement(<613050..>614000)
                     /gene="TDEL0A03430"
                     /locus_tag="TDEL_0A03430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678838.1"
                     /db_xref="GeneID:11503376"
     CDS             complement(613050..614000)
                     /gene="TDEL0A03430"
                     /locus_tag="TDEL_0A03430"
                     /inference="similar to DNA sequence:INSDC:YOR143C"
                     /note="similar to Saccharomyces cerevisiae THI80
                     (YOR143C); ancestral locus Anc_5.479"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678886.1"
                     /db_xref="GeneID:11503376"
                     /db_xref="GOA:G8ZM31"
                     /db_xref="InterPro:IPR007371"
                     /db_xref="InterPro:IPR007373"
                     /db_xref="InterPro:IPR016966"
                     /db_xref="UniProtKB/TrEMBL:G8ZM31"
                     /translation="MSEWCAENDERISVEIDQSKYAHLFNLEYCIKPGSTDKSALLVL
                     NQEINVSPIFLKLWSTFKLRVCADGGANRLYDFFKDNESDRAMYLPDYIIGDFDSLKP
                     ETEEYYKKAGVVVIKQQTQYSTDFTKALYLISVHFNSPDFRRKVLESTETNHSIELFS
                     GIHEWYDKTLKANKSRTLERISLLALGGIDGRFDQTIHSITQLYKLSSPDSQFNLCYL
                     SATDLIFFVPSGGFLLEYTKEFRDQCIGNCGLLPLNGPTEIIETSGLKWDVKNWHTCV
                     GEGKVSSSNRFVGIDKCFIDVKDGIVMNVEVFIDRIANCI"
     gene            <614217..>615197
                     /gene="TDEL0A03440"
                     /locus_tag="TDEL_0A03440"
                     /db_xref="GeneID:11502595"
     mRNA            <614217..>615197
                     /gene="TDEL0A03440"
                     /locus_tag="TDEL_0A03440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678839.1"
                     /db_xref="GeneID:11502595"
     CDS             614217..615197
                     /gene="TDEL0A03440"
                     /locus_tag="TDEL_0A03440"
                     /inference="similar to DNA sequence:INSDC:YDR392W"
                     /note="similar to Saccharomyces cerevisiae SPT3 (YDR392W);
                     ancestral locus Anc_5.480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678887.1"
                     /db_xref="GeneID:11502595"
                     /db_xref="GOA:G8ZM32"
                     /db_xref="InterPro:IPR003195"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G8ZM32"
                     /translation="MDKHKYRVEIQQMMFVFGETNDPPVETTSLIEDIVRGQVMEILL
                     QATKTAQMRNSKSILTEDVIFIIRHDKAKVNRLRTYLLWKELRKHAKDQDAAAAGTAP
                     GGGGDEEEKKGPAEKDDKDPANTMKVRKSQIKLPWDLQFMFNEQPLENNDDDDELDED
                     EREANLATLKKLKMADDRTRNMTKEEYVHWSDCRQASFTFRKAKRFRDWSGISQLTDS
                     KPHDDVIDILGFLTFEIVCSLTETALKIKKHEQRLQLQKDKSQQNNQDFEVTEIHRKK
                     RLFDGPDNVVNPLKRKHVEEAWRTLQTIDMRHRALTNFRGGKFRSRPIIM"
     gene            complement(<615253..>617505)
                     /gene="TDEL0A03450"
                     /locus_tag="TDEL_0A03450"
                     /db_xref="GeneID:11502601"
     mRNA            complement(<615253..>617505)
                     /gene="TDEL0A03450"
                     /locus_tag="TDEL_0A03450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678840.1"
                     /db_xref="GeneID:11502601"
     CDS             complement(615253..617505)
                     /gene="TDEL0A03450"
                     /locus_tag="TDEL_0A03450"
                     /inference="similar to DNA sequence:INSDC:YOR144C"
                     /note="similar to Saccharomyces cerevisiae ELG1 (YOR144C);
                     ancestral locus Anc_5.481"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678888.1"
                     /db_xref="GeneID:11502601"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZM33"
                     /translation="MKAAVSLSELLNGNTKARRAEANTNEVQEPTYNEDETLESIDMS
                     GEVGSSSPLKTSQPTPKEKGGPSVQSFLMSSRQKKGDTMLPKEFSEEPEIIALDDDFN
                     DELHLGIESENNGSRLPTVSRVEPPSSFKKTTLKDLFNNFRPESEPLKLKASVVSSIA
                     LQEEKKKVKRGAISSSAPFPSRQMVEPFGAIAENRSLNLPMNKKKRCITELISFDPDD
                     FKSLNDRESSQENTGRVKIASARKYSQLWTKLFKPRSVDDVMLEPSLKKNVAEWIETA
                     FLKLRRPTKRTKMLKRQKIEYDPLDDFIIDESLDIENTTEEFVPIMIMHGDGIGKNTL
                     LDVLMDHHEGQIYEVNTSNNRSKKDILDTLMDFSTTHYVKGQGSKGIILLDDVDVLFK
                     EHDKFFWQTVEKILLTSRRPIVILCRDINFVPSNVIQLAIEEDSLFHCKRVSHQTVIA
                     FLERYCRKIDLKIDRAILQLLVACSKRDIRKCLMDLQFCCTPPGDFKEPAASSQESVP
                     YPDLKKTSQHLDLLSFGDILDRQTVWKSSISQDIDHTLMTPHAQAALNGMADDQERLQ
                     HDYMVDYRLHLVDKLNNLQLPYELNVGNYLEQQLSCGLLAKPTKLNANQYEKMKSASV
                     NYLKTRVAKKNLIEGKVRKTRNSKRMREILDRFQGFYSADELDESVEVDFEVNNSKDV
                     KEQINPYVLEIAKAELQVKEGNKEIFFEQCKGIDKEEYNEVAWRLTQERLLKPIWFKA
                     DPNTVINCWK"
     gene            complement(<617779..>618597)
                     /gene="TDEL0A03460"
                     /locus_tag="TDEL_0A03460"
                     /db_xref="GeneID:11503046"
     mRNA            complement(<617779..>618597)
                     /gene="TDEL0A03460"
                     /locus_tag="TDEL_0A03460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678841.1"
                     /db_xref="GeneID:11503046"
     CDS             complement(617779..618597)
                     /gene="TDEL0A03460"
                     /locus_tag="TDEL_0A03460"
                     /inference="similar to DNA sequence:INSDC:YOR145C"
                     /note="similar to Saccharomyces cerevisiae PNO1 (YOR145C);
                     ancestral locus Anc_5.482"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678889.1"
                     /db_xref="GeneID:11503046"
                     /db_xref="GOA:G8ZM34"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:G8ZM34"
                     /translation="MVAPTALRKSEVATGNGEIDGASRIIGVNNKESIDDEDDDDVML
                     GQEAEVQEAANEEGVKKQSKESKGVVLDDQGKPRFGSANLAKEGKVKLESRKVAVPPH
                     RMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKAF
                     TLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENAT
                     RTRIVLADSKIHILGGFTHIRMAREAVVSLILGSPPGKVYGNLRTVASRLKERY"
     gene            <619819..>621600
                     /gene="TDEL0A03470"
                     /locus_tag="TDEL_0A03470"
                     /db_xref="GeneID:11502556"
     mRNA            <619819..>621600
                     /gene="TDEL0A03470"
                     /locus_tag="TDEL_0A03470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678842.1"
                     /db_xref="GeneID:11502556"
     CDS             619819..621600
                     /gene="TDEL0A03470"
                     /locus_tag="TDEL_0A03470"
                     /inference="similar to DNA sequence:INSDC:YOR147W"
                     /note="similar to Saccharomyces cerevisiae MDM32
                     (YOR147W); ancestral locus Anc_5.483"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678890.1"
                     /db_xref="GeneID:11502556"
                     /db_xref="GOA:G8ZM35"
                     /db_xref="InterPro:IPR012571"
                     /db_xref="UniProtKB/TrEMBL:G8ZM35"
                     /translation="MRPFYSRTLIWTSISSFCSRNAFRTHSALKGQYNFSKLRCLHSG
                     STFMNRSSERHEDLMSKNTDYLHVQNILLRKNQERMNKKQVLSEATNFYERFKINTKW
                     LLIRGNRPFSANEISTMFSWLLISQIVWIILGTTTFVSILLLIFNTVFAKEMVGKCIG
                     KLLNVFLEDVDIKFEDALVPEWKKGCIRFNKVELKTINRDDSVDQSADNSEQNLKFSL
                     KFHEIELTLSLKKWLLGNGPINDLSVYGMRGDVSVNYAYEQTPQDLFIDWFSNKEYRL
                     GRVQLTDSCVNIHDEQLDMKYRVSIYNLVMPQLRFEWMIPDFFNADVATGAINHSLFT
                     IHKRQHKLVYSNELERDLSPWKRITRLKLDSINVKDLGLNKSNVFNWFEDGNLEITAD
                     IMLPHESDENKENKYMVLDFRFKFKDLRARFPDNAPRLSTGEELISLEELKPLISFIN
                     TQNGYFRSMVNIENTNAVWNAPNVSVNKVVSYPNVTVIPSAQWNDGEDEVGSKGQEII
                     KFHEQPFHNNNEIVLRCRIAKNIQELNDKVMFQETGVYDTLSMELYVDLIRMVEEWEY
                     KKKNDFMKLWGTTVASQLLLFGIGAMV"
     gene            complement(<621663..>622286)
                     /gene="TDEL0A03480"
                     /locus_tag="TDEL_0A03480"
                     /db_xref="GeneID:11502720"
     mRNA            complement(<621663..>622286)
                     /gene="TDEL0A03480"
                     /locus_tag="TDEL_0A03480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678843.1"
                     /db_xref="GeneID:11502720"
     CDS             complement(621663..622286)
                     /gene="TDEL0A03480"
                     /locus_tag="TDEL_0A03480"
                     /inference="similar to DNA sequence:INSDC:YOR148C"
                     /note="similar to Saccharomyces cerevisiae SPP2 (YOR148C);
                     ancestral locus Anc_5.484"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678891.1"
                     /db_xref="GeneID:11502720"
                     /db_xref="InterPro:IPR026822"
                     /db_xref="UniProtKB/TrEMBL:G8ZM36"
                     /translation="MNGGFCLNLNKKSKNGQKDAKKRKRQNVFGGDEGAGGKAKISIT
                     HVEEFKEKKPKQLVIKAKRLVSTLAEALDVKEETEVKFGLINSTDDDQELPNDKSVTR
                     ERLTNSESRWLSNIPETTTEEEYEAVPVEDFGKAMLRGMGWDSDEEDDSNEQKKIKLP
                     HEEARPLFMGIGAKAHSKGREPSHTPDDSFLPIVRVIRDQASERTLE"
     gene            <622423..>623754
                     /gene="TDEL0A03490"
                     /locus_tag="TDEL_0A03490"
                     /db_xref="GeneID:11502588"
     mRNA            <622423..>623754
                     /gene="TDEL0A03490"
                     /locus_tag="TDEL_0A03490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678844.1"
                     /db_xref="GeneID:11502588"
     CDS             622423..623754
                     /gene="TDEL0A03490"
                     /locus_tag="TDEL_0A03490"
                     /inference="similar to DNA sequence:INSDC:YDR393W"
                     /note="similar to Saccharomyces cerevisiae SHE9 (YDR393W);
                     ancestral locus Anc_5.485"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678892.1"
                     /db_xref="GeneID:11502588"
                     /db_xref="InterPro:IPR008839"
                     /db_xref="UniProtKB/TrEMBL:G8ZM37"
                     /translation="MIPRRQVQLTIFGRAELLYVTGIVQKAHFTSRGCLLQISKESTR
                     TENSKQTRTLWDLWEPRWKKIQNQLNDTRSLLNRYSSQLSYHASKAKTSIQEANKKLA
                     AQEREKSDQRLNYNKDVKTSEKIKDLPSQRELHRRKWSRKLEFYFDSLQETIFTATRA
                     LNDVTGYSSIQRLRNSIELLEKSTEENRIELKKLKDTYADAIEQRTRSQKELNELLQR
                     KSSWSPTDLERFTEIYKDDALNLKREQELKLEVSAKESKQEELGDDLYRAILTRYHEE
                     QIWSDKIRRTSTWGTFILMGVNIFLFLVFQLLLEPWKRRRLTRSFEDKVKKALEDYSV
                     EQNLKLEAMSANIKRGSSRVEEPQRITTEKVPPQEPRIVLTAPEQSEHETIKNKQLIE
                     RVWAWIKNFGNKFQPSSISQWDSQTTFSNVELYTYSILLLFLGVVSTALIK"
     gene            <623972..>625252
                     /gene="TDEL0A03500"
                     /locus_tag="TDEL_0A03500"
                     /db_xref="GeneID:11503129"
     mRNA            <623972..>625252
                     /gene="TDEL0A03500"
                     /locus_tag="TDEL_0A03500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678845.1"
                     /db_xref="GeneID:11503129"
     CDS             623972..625252
                     /gene="TDEL0A03500"
                     /locus_tag="TDEL_0A03500"
                     /inference="similar to DNA sequence:INSDC:YDR394W"
                     /note="similar to Saccharomyces cerevisiae RPT3 (YDR394W);
                     ancestral locus Anc_5.486"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678893.1"
                     /db_xref="GeneID:11503129"
                     /db_xref="GOA:G8ZM38"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZM38"
                     /translation="MDELGIINPAETAVEERAAVKSYGALLSQLNNNNANLGSNTSSD
                     VYLKLKRLEKEYELLTLQGDYIKDEQRHLKRELLRAQEEVKRIQSVPLVIGQFLEPID
                     QNTGIVSSTTGMSYVVRILSTLDRELLKPSMSVALHRHSNALVDILPPDSDSSISIMS
                     ENEKPDVTYADVGGLDMQKQEIREAVELPLTQADLYQQIGIDPPRGVLLYGPPGTGKT
                     MLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIA
                     TKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDR
                     KIEFPSLRDRRERRLIFGTIAAKMSLAPETDLDSLIIRNDSLSGATIAAIMQEAGLRA
                     VRKNRYVILQSDLEEAYAAQVKTDSDVDKFDFYK"
     gene            complement(<625331..>626854)
                     /gene="TDEL0A03510"
                     /locus_tag="TDEL_0A03510"
                     /db_xref="GeneID:11502860"
     mRNA            complement(<625331..>626854)
                     /gene="TDEL0A03510"
                     /locus_tag="TDEL_0A03510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678846.1"
                     /db_xref="GeneID:11502860"
     CDS             complement(625331..626854)
                     /gene="TDEL0A03510"
                     /locus_tag="TDEL_0A03510"
                     /inference="similar to DNA sequence:INSDC:YOR149C"
                     /note="similar to Saccharomyces cerevisiae SMP3 (YOR149C);
                     ancestral locus Anc_5.487"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678894.1"
                     /db_xref="GeneID:11502860"
                     /db_xref="GOA:G8ZM39"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:G8ZM39"
                     /translation="MSWSPLQLTALAISGFIALQSSYVHPDEHFQSLEVLAVRYLGVN
                     GSLPWEFEPLNAARSFVPLLLNYGPLYFIILTIFKVRDSMTILGLVRLQNFLIYIALC
                     QLVFKRLSETRGIDSKRTNFFIATSYLTCSFQSHSFSNSLETILLLLVLALYNELILD
                     EKKRKVPACQASMILGFLIMLGVFNRITFPAFILLPSLAVFWYYYRSHKFHLVLLTFV
                     SLICCLIFVEIDTVLYQSSKWVIAPLNNLLYNFDESNLQLHGLHPRYNHMLLNLPQIM
                     GPAFLFLNPRSMNSFTRNLPLLSVLSGLLLLSAFKHQELRFLIPLAPQMFSCFDDQTF
                     FQSTRSVHVKRLWLIFNLFLAIVMGIYHQGGILRVISYFQRDDSPLGVHIWWKTYSPP
                     TWMYMNKELTTSTTLIENDIESIDLLPFETTKNHIVDLKGCDIELLNTTLHQFLRNGA
                     NVNLIAPNSVKSRLEKLSQFMLVPAREEKAHLDLDHLDFGDFSTFAPGITVYNVSLL"
     gene            <627118..>629967
                     /gene="TDEL0A03520"
                     /locus_tag="TDEL_0A03520"
                     /db_xref="GeneID:11502571"
     mRNA            <627118..>629967
                     /gene="TDEL0A03520"
                     /locus_tag="TDEL_0A03520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678847.1"
                     /db_xref="GeneID:11502571"
     CDS             627118..629967
                     /gene="TDEL0A03520"
                     /locus_tag="TDEL_0A03520"
                     /inference="similar to DNA sequence:INSDC:YDR395W"
                     /note="similar to Saccharomyces cerevisiae SXM1 (YDR395W);
                     ancestral locus Anc_5.488"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678895.1"
                     /db_xref="GeneID:11502571"
                     /db_xref="GOA:G8ZM40"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013713"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZM40"
                     /translation="MLDEQAILNCVEQTMIADAKVIKEAELQLFEYQKRPGFTTFLLK
                     VLSDEEIPTHIRLSSAIYFKNKIQRSWNATNREDGIKPDEQQVIKENLIQALVKNSEN
                     NHIRPHLTESVRGILGNNDEWDLTGVINDLLNSGKQEYVYSGLLLLFEVCIAHRWSMA
                     DHRQEIDRVIAIVFPTIEVIASQLADREDYRSNELMYLIIKCFKYACLNNFPQYFLNT
                     EKLNAWIQLHLYLCARPLPKEVFSLDPSDRCLDKRVKVNKWGFGNLNRFIHKFSRVTK
                     SVSQEFVSNVFNNIIPAILQEYFIVIQAWRDKTLWLGESALHYMIQFLEKCLVTEEAY
                     PLIQPHLETIIERVIFPCLCANEESVQLLEEDPEEYTRRYFDMNKESSTADVASCDFV
                     FVVGHKRASQLDKILPFVNSVFISYTENPDDLETAFKQEGAMRMISTLFTLLDSPSDL
                     ETIFSRYIVPILSQNRYMFLVARALETISVYPNEFKDLETLSRLFQLTYDHFMTSDLI
                     PIQVEAADALKSLVVSNPGIHSHISAQVPGIMEKLLRLSKEFQIDTLSEVMEVFVERF
                     ADELMVFAGDLAANLVDQFLQLGCSLLDNSGNSYSTGDQDSEIQASSLLQTMTTMVMS
                     MSKVSLIDKFLPVVKFVIVNAQISFLTEIVDLMDSLALSSQALFNQFTPEIWEMVHDV
                     FDSFQTYAMSYFEGYLIFFETLVTHGFPQDQTFLQPFLEILSLKLDSDIDYDVESVLD
                     ILVFYALSMRDIPLFDKALKAASNDELELDDGDIIKLFLANVFVKPVETLQVSEKEGA
                     TLILLTKWFSCKFSSVFSIKLQIMAILSLFKLPELPGALKGFTSQFADKLVSLTEKLP
                     EAIRKRDAMSKGEEGIEEVFGNDVDPAEDGYFEEYEEDLKETMLDQINVFQEVHSFLS
                     QAQQQDNKKYNTIINSLSDEKKHSLQVILDFVSQN"
     gene            complement(<630053..>630508)
                     /gene="TDEL0A03530"
                     /locus_tag="TDEL_0A03530"
                     /db_xref="GeneID:11502940"
     mRNA            complement(<630053..>630508)
                     /gene="TDEL0A03530"
                     /locus_tag="TDEL_0A03530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678848.1"
                     /db_xref="GeneID:11502940"
     CDS             complement(630053..630508)
                     /gene="TDEL0A03530"
                     /locus_tag="TDEL_0A03530"
                     /inference="similar to DNA sequence:INSDC:YDR397C"
                     /note="similar to Saccharomyces cerevisiae NCB2 (YDR397C);
                     ancestral locus Anc_5.489"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678896.1"
                     /db_xref="GeneID:11502940"
                     /db_xref="GOA:G8ZM41"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G8ZM41"
                     /translation="MANELEDVSLPKATVQKIISEVLEPDLTFSKEAREIIIKSGIEF
                     IMILSSMASEMAESDAKKTIAPEHVIKALEELEYNEFVPFLEQQLAEYKGSQRIKEKR
                     DAKFKKSGLSEEELLRQQEELFRQSRSRLHQTSVSGASSDGVKAEEDDV"
     gene            <630893..>632758
                     /gene="TDEL0A03540"
                     /locus_tag="TDEL_0A03540"
                     /db_xref="GeneID:11502600"
     mRNA            <630893..>632758
                     /gene="TDEL0A03540"
                     /locus_tag="TDEL_0A03540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678849.1"
                     /db_xref="GeneID:11502600"
     CDS             630893..632758
                     /gene="TDEL0A03540"
                     /locus_tag="TDEL_0A03540"
                     /inference="similar to DNA sequence:INSDC:YDR398W"
                     /note="similar to Saccharomyces cerevisiae UTP5 (YDR398W);
                     ancestral locus Anc_5.490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678897.1"
                     /db_xref="GeneID:11502600"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZM42"
                     /translation="MSNLEVPVVCSEYDGEGRFLCGVTVALNRQRVSVQSTDPGAPLN
                     ENVLLLEESNLRVIVVRWGFLESPGTRCVFLGLNNGEVWIYSPAANEVVYKLSTGNSS
                     KINDVVVKSESVWCVDSEDWIYEFSLGDFTVKQRFQVESCISLGRLCLIDDKLLVASH
                     CIFLVDISSRKVIQTYPGHTTPVTHLKALTSEYFVTGASSDRFLNVYDLHTGATKTVL
                     VLQSNLQEFSHSEEHSIAATTEDGDVEIFSDPLVANITNKRRGNKSKQSNKTIHGSFE
                     LNGKTSKKPFLNVSINRDILNLAWLQNATIPNFVQLKWEGLSADHTVQLVSKTTAGDH
                     SLYGTETAAVGNYKEGNARVTHGDNFKHVNDVIKQWEAELTQQEREDNEKATESLADK
                     LELTSLNVSKKKTTATTAGTVTVILSQALQSNDHSLLETVLNNRDERVIRDTIFRLKP
                     PLAVILLERLAERIARQTHRQGPLNVWVKWCLIIHGGYLVSIPNLMSSLSSLHSTLKR
                     RSALLPRLLTLEVKLESTLNGIYPTQDIDEALLELQSPQDSQEEDEDEDVEYNEELDD
                     AGLIEDGEDDYDDSEEDEDEESLNELPDGPQDGKSSQDLGVSDDDEAGYSDVEMS"
     gene            <632976..>633623
                     /gene="TDEL0A03550"
                     /locus_tag="TDEL_0A03550"
                     /db_xref="GeneID:11502756"
     mRNA            <632976..>633623
                     /gene="TDEL0A03550"
                     /locus_tag="TDEL_0A03550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678850.1"
                     /db_xref="GeneID:11502756"
     CDS             632976..633623
                     /gene="TDEL0A03550"
                     /locus_tag="TDEL_0A03550"
                     /inference="similar to DNA sequence:INSDC:YDR399W"
                     /note="similar to Saccharomyces cerevisiae HPT1 (YDR399W);
                     ancestral locus Anc_5.491"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678898.1"
                     /db_xref="GeneID:11502756"
                     /db_xref="GOA:G8ZM43"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:G8ZM43"
                     /translation="MSDEKQYISYNNVHQLCQEAAPKIKAFKPDIIIAIGGGGFIPAR
                     ILRTFLKEPNTPNIRIFAIILSLYENILTASGGEVEQIGVKVQRTQWIDYKQCKLDLV
                     GKNVLIVDEVDDTRTTLHYALSELEKDADEQAKAKGIDVEKNPEFKTTFSIFVLHDKV
                     KPKKADLPAEIVNDNNRYFAARTVPDSWLAYPWESTDIVYHTKMAIEQGNDVFLP"
     gene            <633838..>634851
                     /gene="TDEL0A03560"
                     /locus_tag="TDEL_0A03560"
                     /db_xref="GeneID:11502698"
     mRNA            <633838..>634851
                     /gene="TDEL0A03560"
                     /locus_tag="TDEL_0A03560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678851.1"
                     /db_xref="GeneID:11502698"
     CDS             633838..634851
                     /gene="TDEL0A03560"
                     /locus_tag="TDEL_0A03560"
                     /inference="similar to DNA sequence:INSDC:YDR400W"
                     /note="similar to Saccharomyces cerevisiae URH1 (YDR400W);
                     ancestral locus Anc_5.492"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678899.1"
                     /db_xref="GeneID:11502698"
                     /db_xref="GOA:G8ZM44"
                     /db_xref="InterPro:IPR001910"
                     /db_xref="InterPro:IPR015910"
                     /db_xref="InterPro:IPR023186"
                     /db_xref="UniProtKB/TrEMBL:G8ZM44"
                     /translation="MTINSIPIWLDCDPGHDDAIAMLISCFHPAFKLLGLGASYGNAP
                     SENTSYNARSLITAFGKTQDVPIYPSAKRPWVFEPEYAPDVHGASGLDGTTLLPVPEC
                     EMIIEKSYLDAMEEAIITHNGEITLVSTGALTSVATLLRDRPHLKKMVRYISIMGGGI
                     DLGNRNDNHSAEFNIWIDPQAANFILSDPDIKNKCILLPLNVTHKAIADQRVQDQIRG
                     KGQSKLRELFYELFKFFEHCYKDAQGFDYPPTHDPLTLMPLLQFYGWVNPSVLQLTYR
                     RLNLHAIEDRNSPDLGKTCILKEYNSQEDLGTIVCFDMNIGFFWEQVFQALDRAAKSS
                     TIE"
     gene            complement(<634944..>636413)
                     /gene="TDEL0A03570"
                     /locus_tag="TDEL_0A03570"
                     /db_xref="GeneID:11502920"
     mRNA            complement(<634944..>636413)
                     /gene="TDEL0A03570"
                     /locus_tag="TDEL_0A03570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678852.1"
                     /db_xref="GeneID:11502920"
     CDS             complement(634944..636413)
                     /gene="TDEL0A03570"
                     /locus_tag="TDEL_0A03570"
                     /inference="similar to DNA sequence:INSDC:YDR402C"
                     /note="similar to Saccharomyces cerevisiae DIT2 (YDR402C);
                     ancestral locus Anc_5.493"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678900.1"
                     /db_xref="GeneID:11502920"
                     /db_xref="GOA:G8ZM45"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002401"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:G8ZM45"
                     /translation="MALAGILVSIFFVLVGHLIFKIVVPPLNFPRNIPTIPFYVIFLP
                     TIFNIDQTKLYDMYLREPLEKHGAAKIFFGSRWNIIVTRPELMAHVFREEDTFAKSGN
                     QKKIPYAVIAAYTGDNVISAHGQVWRTYRSVVTNGLQHFDDKPFYKNAELFCNGIEKL
                     RRKTPESASMGPLIQRLCLDNISEVALGFDFGALTQDDNQLHKHLIDIKKQIFHPMYL
                     TFPFLDLLPIPARRKAFKDVASFREQLVTKIQDNLVTNYKFEQTSFASSDLIRAHNNE
                     IINYQQLTDNIVIILVAGHENPQVLLTTSLYLLGKHPALQQKIRAEVQDVNDSKELSE
                     LPFLNSFIFEAIRLFPPLNIIINRKTTKACRLGPEIVIPKDTYVGYNNFGTSHDPKVW
                     GPNADQFDPTRWGEDNETILKNWKHAKNAYTMTAFHGGRRACLGEKLALTEMRVTIAE
                     VLRQYKWTLASDWEERMTPAGPLSPSNLKLNFESCSDAI"
     gene            <637135..>638736
                     /gene="TDEL0A03580"
                     /locus_tag="TDEL_0A03580"
                     /db_xref="GeneID:11502665"
     mRNA            <637135..>638736
                     /gene="TDEL0A03580"
                     /locus_tag="TDEL_0A03580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678853.1"
                     /db_xref="GeneID:11502665"
     CDS             637135..638736
                     /gene="TDEL0A03580"
                     /locus_tag="TDEL_0A03580"
                     /inference="similar to DNA sequence:INSDC:YDR403W"
                     /note="similar to Saccharomyces cerevisiae DIT1 (YDR403W);
                     ancestral locus Anc_5.494"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678901.1"
                     /db_xref="GeneID:11502665"
                     /db_xref="InterPro:IPR007817"
                     /db_xref="UniProtKB/TrEMBL:G8ZM46"
                     /translation="MTCTKKSVTVTEVVKSDSYLKKPILDSKNDIGIPHKLSDLSTYS
                     KFLALYTRDPEDAGYYSIEEKQGCKIKDKWSELIEFIKETEPVPASINENVVEFNIPA
                     SVADQFTCSLGLPIKVSEYMKENENQIRGCVTTIENENDFNDWFIFHILDQSRLRLSE
                     VPTKNTDDRYHESFADFFEQALKNTIVNDQWEAGGRDYFIERVRYFTDRHLKIECVLP
                     AFPCKSSNFDKVGGLVPDKGEELALRRLIKATQDAAKIYPPGMKVWIVSDGHVFSDCI
                     GVDDDIVSTYTAQLHQLYEKVKIPGVDAIGFCGLNDLFFGGAAASNFNFKFIEEVKLN
                     HYTGTQICSVSDVSRAIMMKGCDTDDGRLRKQISIDGHPRLHLYRGFSRFMMEDLSRL
                     PFFKDTSRKGFKKIISKIAFNMIRRNDAYSNLVELIFPHHMRLSIHAHTNSGPKFGIK
                     VISPEQCHTVKSLEDIEEPKFEDLLHIPTPWHNCVVKIDGKRYVLTKSSIVREALENG
                     SYEGEWIETSLESGEGGHFVITKAN"
     gene            complement(<639112..>639627)
                     /gene="TDEL0A03590"
                     /locus_tag="TDEL_0A03590"
                     /db_xref="GeneID:11503075"
     mRNA            complement(<639112..>639627)
                     /gene="TDEL0A03590"
                     /locus_tag="TDEL_0A03590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678854.1"
                     /db_xref="GeneID:11503075"
     CDS             complement(639112..639627)
                     /gene="TDEL0A03590"
                     /locus_tag="TDEL_0A03590"
                     /inference="similar to DNA sequence:INSDC:YDR404C"
                     /note="similar to Saccharomyces cerevisiae RPB7 (YDR404C);
                     ancestral locus Anc_5.495"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678902.1"
                     /db_xref="GeneID:11503075"
                     /db_xref="GOA:G8ZM47"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR005576"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="UniProtKB/TrEMBL:G8ZM47"
                     /translation="MFFIKDLSLNITLHPSFFGPHMKDYLKTKLLQEVEGSCTGKFGY
                     ILCVLDYDKIDIERGRILPTDGSADFIVRYRAVVFKPFRGEVVDGTVVSCSQHGFEVQ
                     VGPMKVFVTKHLMPQDLIFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAI
                     GSIKEDYLGAI"
     gene            <639877..>640371
                     /gene="TDEL0A03600"
                     /locus_tag="TDEL_0A03600"
                     /db_xref="GeneID:11502640"
     mRNA            <639877..>640371
                     /gene="TDEL0A03600"
                     /locus_tag="TDEL_0A03600"
                     /product="mitochondrial 54S ribosomal protein YmL23"
                     /transcript_id="XM_003678855.1"
                     /db_xref="GeneID:11502640"
     CDS             639877..640371
                     /gene="TDEL0A03600"
                     /locus_tag="TDEL_0A03600"
                     /inference="similar to DNA sequence:INSDC:YOR150W"
                     /note="similar to Saccharomyces cerevisiae MRPL23
                     (YOR150W); ancestral locus Anc_5.496"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL23"
                     /protein_id="XP_003678903.1"
                     /db_xref="GeneID:11502640"
                     /db_xref="GOA:G8ZM48"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR005823"
                     /db_xref="InterPro:IPR023563"
                     /db_xref="InterPro:IPR023564"
                     /db_xref="UniProtKB/TrEMBL:G8ZM48"
                     /translation="MSQKVGHSSLAFARLWHHVDLARDKRTLGRLASAIAITLIGKHK
                     PVYHQSQDCGDYVVVSNCQRLRVTGKKLEQKTYWSHSSKPGHLKLRTMEKVVADKGFG
                     EILKKAVSGMLPKNKLRKPRLERLKVFDGADHPYKQNITAFVYDQPYVQSKLKQLKAS
                     EEVK"
     gene            complement(<640575..>644243)
                     /gene="TDEL0A03610"
                     /locus_tag="TDEL_0A03610"
                     /db_xref="GeneID:11503260"
     mRNA            complement(<640575..>644243)
                     /gene="TDEL0A03610"
                     /locus_tag="TDEL_0A03610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678856.1"
                     /db_xref="GeneID:11503260"
     CDS             complement(640575..644243)
                     /gene="TDEL0A03610"
                     /locus_tag="TDEL_0A03610"
                     /inference="similar to DNA sequence:INSDC:YOR151C"
                     /note="similar to Saccharomyces cerevisiae RPB2 (YOR151C);
                     ancestral locus Anc_5.497"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678904.1"
                     /db_xref="GeneID:11503260"
                     /db_xref="GOA:G8ZM49"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007646"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="UniProtKB/TrEMBL:G8ZM49"
                     /translation="MSAAEDDYYNEDPYGYEDENSPITAEDSWAVISAFFREKGLVSQ
                     QLDSFNQFVDYTLQDIISEDSTLILEQLAQHTTEADNISRKYEISFGKIYVTKPMVNE
                     SDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAVDVPGRELKYELIAEESEDDSES
                     GKVFIGRLPIMLRSKNCYLSDATELDLYKLKECPFDMGGYFIINGSEKVLIAQERSAG
                     NIVQVFKKAAPSPISHVAEIRSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQ
                     DIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFIGR
                     RGTALGIKKEKRIQYARDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKD
                     QDDRDHFGKKRLDLAGPLLAQLFKTLFRKLTKDIFRYMQRTVEEAKDFNMKLAINAKT
                     ITSGLKYALATGNWGEQKKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAK
                     PRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSEWGMEPLED
                     YVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMVRDIREKELKI
                     FTDAGRVYRPLFIVEDDETLGHKELKVRKGHIGKLMATEYQDIEGGFEDSEDYTWSSL
                     LNEGLVEYIDAEEEETILISMQPEDLEPVQEAHEFNEDDDLAKRIRATQHATTFTHCE
                     IHPSMILGVAASVIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
                     KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRS
                     YMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDIIIGKTT
                     PISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLITTNQDGLKFVKVRVRTTKVP
                     QIGDKFASRHGQKGTIGITYGREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLS
                     KVAALSGNEGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPT
                     YYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLK
                     ERLMEASDAFRVHICGICGLMSVIAKLNHNQFECKGCDNKIDIYQINIPYAAKLLFQE
                     LMAMNITPRLYTDRSKDF"
     gene            <644491..>645195
                     /gene="TDEL0A03620"
                     /locus_tag="TDEL_0A03620"
                     /db_xref="GeneID:11503128"
     mRNA            <644491..>645195
                     /gene="TDEL0A03620"
                     /locus_tag="TDEL_0A03620"
                     /product="mitochondrial 54S ribosomal protein YmL41"
                     /transcript_id="XM_003678857.1"
                     /db_xref="GeneID:11503128"
     CDS             644491..645195
                     /gene="TDEL0A03620"
                     /locus_tag="TDEL_0A03620"
                     /inference="similar to DNA sequence:INSDC:YDR405W"
                     /note="similar to Saccharomyces cerevisiae MRP20
                     (YDR405W); ancestral locus Anc_5.498"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL41"
                     /protein_id="XP_003678905.1"
                     /db_xref="GeneID:11503128"
                     /db_xref="GOA:G8ZM50"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR013025"
                     /db_xref="UniProtKB/TrEMBL:G8ZM50"
                     /translation="MTRVVSGRALSQVGLAGTRSLATVVEPKVRVSDQILNWSREAIE
                     RGDAHFKVGGTKLYFPKARVILLRPNAKHTPYQAKFIVPKSFNKLDLRDYLFHIYGLR
                     AMNVTTQLLHGKYTRANIASPRYRSPQVKKMTIDMAEPFIWPEEPKPEENGLWDSTFN
                     KNRNLYREDVYRPGSDQFKPSKAFDGAVGPFKPVAQPFIPKFLGRELRNRKQKYHDKQ
                     ARMNQLIKLDKHGASP"
     gene            complement(<645258..>645896)
                     /gene="TDEL0A03630"
                     /locus_tag="TDEL_0A03630"
                     /db_xref="GeneID:11503319"
     mRNA            complement(<645258..>645896)
                     /gene="TDEL0A03630"
                     /locus_tag="TDEL_0A03630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678858.1"
                     /db_xref="GeneID:11503319"
     CDS             complement(645258..645896)
                     /gene="TDEL0A03630"
                     /locus_tag="TDEL_0A03630"
                     /inference="similar to DNA sequence:INSDC:YOR152C"
                     /note="similar to Saccharomyces cerevisiae YOR152C;
                     ancestral locus Anc_5.499"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678906.1"
                     /db_xref="GeneID:11503319"
                     /db_xref="UniProtKB/TrEMBL:G8ZM51"
                     /translation="MMVWSLLLYLVSVVVPLVITLETLAVVGRRESSASLSTLVLQLK
                     YWSLYGMVFGLLPGAVVRGILNNLPFSGLLAVVGSSVLTAEVVRDFTLFLQTQDGKYV
                     FLMSKLNDPSVSWTKWLRYAATSSDSDEGVFVFGEFTKFWVSLACRSPDTHYLESCFN
                     ELQEKVVGLARLMGGYLHSRGAGAPRVDPVRFSEGYDMLEDILLDSKKDHVE"
     gene            <646252..>650781
                     /gene="TDEL0A03640"
                     /locus_tag="TDEL_0A03640"
                     /db_xref="GeneID:11503203"
     mRNA            <646252..>650781
                     /gene="TDEL0A03640"
                     /locus_tag="TDEL_0A03640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678859.1"
                     /db_xref="GeneID:11503203"
     CDS             646252..650781
                     /gene="TDEL0A03640"
                     /locus_tag="TDEL_0A03640"
                     /inference="similar to DNA sequence:INSDC:YOR153W,YDR406W"
                     /note="similar to Saccharomyces cerevisiae PDR5 (YOR153W)
                     and PDR15 (YDR406W); ancestral locus Anc_5.500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678907.1"
                     /db_xref="GeneID:11503203"
                     /db_xref="GOA:G8ZM52"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR005285"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029481"
                     /db_xref="UniProtKB/TrEMBL:G8ZM52"
                     /translation="MSVEEANDTSSASSSVPAYHGFDSKAQEHVKQLARTLSQQSGID
                     VNDGKDEDRAADGNMADRYSIFSNMSKSGVNPVFDSEDGHYDERLDPTSDQFVSAAWI
                     KNMSYLALADPDYYKPYSLDCCWKDLSASGASADVAYQSTIMNLPRKVVSSVWRSIVP
                     AKEANTFQILKPMDGIINPGELLVVLGRPGSGCTTLLKSISANTHGFKVGKESHIAYK
                     GLSPADINKHFRGEVVYNAEADIHLPHLTVYQTLLTVARLRTPQNRIKGVSREAWANH
                     VTEVAMATYGLSHTRNTKVGSELVRGVSGGERKRVSIAEVTICGSKFQCWDNATRGLD
                     SATALEFVRALKTQADITNTAATVAIYQCSQDAYDLFDKVCVLSEGYQIYFGPAKEAK
                     KYFQDMGYYCPDRQTTADFLTAVTSPAERIINEEFTNKRIAVPQTAAEMSEYWRNSPN
                     YKRLLQQIDTKMTENDEDERQRIKDAHVARQSKRARPSSPYTVSYMMQVKYLLIRNIW
                     RIKNSSSIALFQVIGNSVMAFILGSMFYKIMLKDTTDTFYFRGASMFFAILFNAFSSL
                     LEIFSLYEARPITEKHRTYSLYHPSADAFASVLSEVPTKLITSVCFNIIFYFLVNFRR
                     NGGRFFFYFLINIIATFTMSHLFRCVGSLTKTLTEAMVPAAVLLLALAMFTGFAIPET
                     KMLGWSKWIWYINPLSYLFQSLMVNEFHGRRFVCTTFVPSGPAYQNISGTERVCGAVG
                     AEPGADYVLGDAFLKVSYNYVNEHKWRGFGIGLGYVVFFLAVYLFLCEVNQGAKQKGE
                     ILVYPLNVVRRLKKERQLHSKTAAGDIEKAGGEDSAISDRKMLQESSESSSTDEEGGL
                     NKSKAIFHWRNLCYDIKIKKEDRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAD
                     RTTMGVITGEIFVNGRLRDESFPRTIGYCQQQDLHLKTSTVRESLRFSAYLRQPAKVS
                     IEEKNKYVEEVIKILEMEHYADAVVGVAGEGLNVEQRKRLTIGVELVAKPALLVFLDE
                     PTSGLDSQTAWSICQLMRKLANHGQAILCTIHQPSAMLMQEFDRLLFMRRGGETVYFG
                     DLGEGCTTMINYFESHGSGKCPPSANPAEWMLEVVGAAPGSHANQDYHEVWRNSEEYK
                     AVQEELDSMERELPNTTGQLIDDDERHKAYAASLMYQIKMVSVRLFEQYYRSPDYLWP
                     KFFLTIFNNLFIGFTFFKADRSMQGMQNQMLSIFMYTVIFNTLLQQYLPAFVQQRDLY
                     EARERPSRVFSWKAFITSQILVEVPWNILAGTLAFLIYYYPVGFYANASAAGQLHERG
                     ALFWLFSIAFYVYIGSMGILCISFMDLAASAANLASLLFTMSLSFCGVLATSQAMPRF
                     WIFMYRVSPLTYFIDALLALGIANVNVECSDYEYSKFAPAGGQTCGEYMAPYIQMAGT
                     GYLADPMATDECRFCQFSKTNDFLATVSSNYDRRWRNYGIFICYIAFDYIAAVFLYWL
                     SREPKKTKLGKKKQQ"
     gene            complement(<650910..>652241)
                     /gene="TDEL0A03650"
                     /locus_tag="TDEL_0A03650"
                     /db_xref="GeneID:11503238"
     mRNA            complement(<650910..>652241)
                     /gene="TDEL0A03650"
                     /locus_tag="TDEL_0A03650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678860.1"
                     /db_xref="GeneID:11503238"
     CDS             complement(650910..652241)
                     /gene="TDEL0A03650"
                     /locus_tag="TDEL_0A03650"
                     /inference="similar to DNA sequence:INSDC:YOR155C"
                     /note="similar to Saccharomyces cerevisiae ISN1 (YOR155C);
                     ancestral locus Anc_5.501"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678908.1"
                     /db_xref="GeneID:11503238"
                     /db_xref="GOA:G8ZM53"
                     /db_xref="InterPro:IPR009453"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G8ZM53"
                     /translation="MSSRYRVEYHLKSHRKDGFVDWIKGLLATPFVLHAVSHDVDDLT
                     TTQRVRSQYAEIFKDIQNLVANKIDFDSRNGQLEENDDTEVRYDLMGKSRLNQLVPTI
                     GSFFTELPLEKAFLWEDSQRGISERRMVAPSFNDVRRILNTAQIFYFVDKRRKYHHNQ
                     LKLVTFDGDVTLYEDGGSLNSSSPVIFYIVRLLAANIRVGIVTAAGYDEPVQYEHRLK
                     GLIVAVHDASDLTMEQKHNLTVMGGESNYLFRYHENDEGEFGFQTVEQGEWLLPHMTE
                     WKLSDMDQTLDFAEKTLKSLRDRLHLPGETVIVRKKRAVGIVPGEKFDVATQSQVQVK
                     LEREQLEEVVLTLQTTLETFPPARRIKFSCFDGGSDVWCDIGGKDLGLRVLQNYYSPH
                     DPIKPCETLHVGDQFAPVGSANDFKARLAGCTLWIASPAETVTNLRRLLAD"
     gene            <652837..>654486
                     /gene="TDEL0A03660"
                     /locus_tag="TDEL_0A03660"
                     /db_xref="GeneID:11502811"
     mRNA            <652837..>654486
                     /gene="TDEL0A03660"
                     /locus_tag="TDEL_0A03660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678861.1"
                     /db_xref="GeneID:11502811"
     CDS             652837..654486
                     /gene="TDEL0A03660"
                     /locus_tag="TDEL_0A03660"
                     /inference="similar to DNA sequence:INSDC:YOR161C"
                     /note="similar to Saccharomyces cerevisiae PNS1 (YOR161C);
                     ancestral locus Anc_5.502"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678909.1"
                     /db_xref="GeneID:11502811"
                     /db_xref="GOA:G8ZM54"
                     /db_xref="InterPro:IPR007603"
                     /db_xref="UniProtKB/TrEMBL:G8ZM54"
                     /translation="MSEKYKPPSRPPPSYGNGPNGQGPFQDNSAEYYNQQPQQQEGAQ
                     QPADQGQGNQYNFRQDQYYNLNAQSEGAPIGSFEEAFPTDDKPKWNDWPFTIFFLLCV
                     AAFIVVASITLRGWAQTYSQTGSGIYNGTDTGTLNTNSAVLLVFAVVLALVFSFLGIL
                     LCRLYPKFFIYCGMIVNIVAGLGTAIMYLALRYWSAGIVFLVFTLLTAFFYWQMRSRI
                     PFSVAVLKTVIDAMKKCPQTLLVSFIGTIVAGAFGVLFSAVIVATYIKFDPKENNAGC
                     DVNGGGCSNSKKIGLLVLVFFCGYYISEVIKNVIHCTVSGIYGCWYYMSKSDQGMPRW
                     PALGSWRRAMTYSFGSICFGSLIVALIETLKQIINLARQSLIGNGNGAAAQIGFMILG
                     WIVNFLQWLASYFNHYAYAFIALYGRPYLKSAKQTWYMLREKGMDALINDNLINVALG
                     LYTLFASYMSALLAFLYLRFTQPAYNSSGSFNAPLIAFSFLIAMQISNIANETIRSGT
                     STFFVALGNDPEVFHASYPERFDEIFRAYPDVLKKLSHQDV"
     gene            complement(<654618..>657509)
                     /gene="TDEL0A03670"
                     /locus_tag="TDEL_0A03670"
                     /db_xref="GeneID:11502680"
     mRNA            complement(<654618..>657509)
                     /gene="TDEL0A03670"
                     /locus_tag="TDEL_0A03670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678862.1"
                     /db_xref="GeneID:11502680"
     CDS             complement(654618..657509)
                     /gene="TDEL0A03670"
                     /locus_tag="TDEL_0A03670"
                     /inference="similar to DNA sequence:INSDC:YOR160W"
                     /note="similar to Saccharomyces cerevisiae MTR10
                     (YOR160W); ancestral locus Anc_5.503"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678910.1"
                     /db_xref="GeneID:11502680"
                     /db_xref="GOA:G8ZM55"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZM55"
                     /translation="MSFQVADVQKALQCVSSNATQEKKNEALHFLEDFQKSAAAWTIC
                     HDVLTTVDPSFLELHVFAAQTLRNKVTYDLSQLEGNLMEFKTSLLNLLILHNQKLVIT
                     QLSVALARLAIQFIQWRDPIVEIIHCLNPYPSKLLGFLRILPEETLDIGSTPLSENEF
                     NSRTHELINTIAEDVLNFLISCVDILKSQQQSESDITLEKIMHCLTSWSFEFPVDQLL
                     SVRPLISLVFESLLQGPDESSETFDAAVECLSVILRESRDAPNEQLVLALYEQLMQLQ
                     IKLLPNLLVAQEDDLDYEIMEGLTRLFVEAGEAWSVFISKSPDVYKPIVTALLMFTCK
                     NSDLDIAAYTFPFWFSLKQNLVLPRYQQSKEQYVPIFENLISGIIRHLQYPTDQFDSS
                     ESEDKFKDFRYHMGSVLKDCAAVIGTSRALNQPLTRIKEAVNKGGSWQELEAPLFSLR
                     TMAQEISLSENNQLPQIFQILCSLPEHPKIRYASTLVLGRYTEWTAKHPEMLKMQLDY
                     IFNGFNEGQKNPDIITASSHALMFLCTDCSSLLSDYIDQLYDFYFNVGSILDIESQFE
                     LCQGLSAVIDKQSPDKISAVLQKLLDDCFSKINDIVPKWKADPTAFSALIADKIDLVY
                     ATFEELKPKNEYPQQGPEPLLPQIEFIWNSLSTLLIDCGALSDNVIVERATKLLRRLF
                     EKFHLFCEPILVPVAEFLAQGYAATGLGSYLWCSGSIIIVYGDDEALPVPTQLKDAVW
                     HFAVTQSNTFIQNFNKIQTERINDHYESIMDFFSMISDLIMFYPKEFLLSSELLGSTA
                     DVALKSVTRVENYDAYVLILRCLDDLLSWGFRTPPISTVAISEVPEEWRQQILKEIVV
                     ARGSTIITSLFIGLVTNFELTTHSDAVSCIVKCFRLACELNNNDPMICAQWVFQTVEQ
                     LGSVTTKEKDNLSETVVNGLNQKDYRKVREGIRTFIAWYLRKNVNPRCY"
     gene            <657692..>657973
                     /gene="TDEL0A03680"
                     /locus_tag="TDEL_0A03680"
                     /db_xref="GeneID:11502818"
     mRNA            <657692..>657973
                     /gene="TDEL0A03680"
                     /locus_tag="TDEL_0A03680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678863.1"
                     /db_xref="GeneID:11502818"
     CDS             657692..657973
                     /gene="TDEL0A03680"
                     /locus_tag="TDEL_0A03680"
                     /inference="similar to DNA sequence:INSDC:YOR159C"
                     /note="similar to Saccharomyces cerevisiae SME1 (YOR159C);
                     ancestral locus Anc_5.504"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678911.1"
                     /db_xref="GeneID:11502818"
                     /db_xref="GOA:G8ZM56"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027078"
                     /db_xref="UniProtKB/TrEMBL:G8ZM56"
                     /translation="MSSKSKAMVPPINCIFDYLQQQTLVTFWLFEQVGIRIRGKISGF
                     DEFMNVVIDDALEIPVDPKTGVEDIEKGRKLGKILLKGDNITLITSVDD"
     gene            complement(<658036..>658956)
                     /gene="TDEL0A03690"
                     /locus_tag="TDEL_0A03690"
                     /db_xref="GeneID:11502819"
     mRNA            complement(<658036..>658956)
                     /gene="TDEL0A03690"
                     /locus_tag="TDEL_0A03690"
                     /product="mitochondrial 37S ribosomal protein PET123"
                     /transcript_id="XM_003678864.1"
                     /db_xref="GeneID:11502819"
     CDS             complement(658036..658956)
                     /gene="TDEL0A03690"
                     /locus_tag="TDEL_0A03690"
                     /inference="similar to DNA sequence:INSDC:YOR158W"
                     /note="similar to Saccharomyces cerevisiae PET123
                     (YOR158W); ancestral locus Anc_5.505"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein PET123"
                     /protein_id="XP_003678912.1"
                     /db_xref="GeneID:11502819"
                     /db_xref="UniProtKB/TrEMBL:G8ZM57"
                     /translation="MGKGIARHGFKSGVLPITRSILKNPTTKQENIIAKVNAPKPKGP
                     QGIGFAEGVAHPKNSHREPAPVKFLDVEELIQQTAAAPSSIRTATTSQQETKLRKAEL
                     RRQYLSETFRKEENRLLSLEKLMKQKEEALEEEKRAELASLNESKSSDLTIPTLERIV
                     EGPLMRQRAPDEEKLHQMKRTYNRELMELKAKERKLEDLLSLYHVSNEFIVTEKQLLR
                     KIDEAFANEGSDVLRTRLSMGASRIRSRNESSIGDALFGTVAGGEHVGLPLVKEHLSG
                     EMKKFAEEVELKTSEVIERKKSDIDTIMQN"
     gene            complement(<659122..>662862)
                     /gene="TDEL0A03700"
                     /locus_tag="TDEL_0A03700"
                     /db_xref="GeneID:11503253"
     mRNA            complement(<659122..>662862)
                     /gene="TDEL0A03700"
                     /locus_tag="TDEL_0A03700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678865.1"
                     /db_xref="GeneID:11503253"
     CDS             complement(659122..662862)
                     /gene="TDEL0A03700"
                     /locus_tag="TDEL_0A03700"
                     /inference="similar to DNA sequence:INSDC:YDR407C"
                     /note="similar to Saccharomyces cerevisiae TRS120
                     (YDR407C); ancestral locus Anc_5.506"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678913.1"
                     /db_xref="GeneID:11503253"
                     /db_xref="InterPro:IPR013935"
                     /db_xref="UniProtKB/TrEMBL:G8ZM58"
                     /translation="MMKSLGHGASFVWPSRIRALVVPIGKWKRHQFNEAVENLQSYSE
                     IRLLDITPIDSSLFTPQGFPNGRLFFDFSSYGYNDSLDLFLYDFEPFRKIFVVIGLIN
                     DDNNPESSLQTLKERYPTIISHNVIVTNTSGETNVGENIFYCGQKLEDNLETILCDVG
                     KTFLQALSQYYSSYKHVTLRSPGAIGGNSVMKTTLTRQVAALTAVVSPSSTNASKRLS
                     SIEITTNNIKRSASLKLAKSLSSSENRSHSRSRGRQLKILGNFQLLAGRYTDALNSFN
                     EAVTLLHKIRDYLWLGSALDGVAICFLLLSYLQIPFQIPPLVNVLCPIQPNNIVPEGQ
                     SPRNSVQYTPMKSPRDSTSSLSSVAAVDVESINLPKLIKSISEKIMYYYELSLSHTCD
                     YTPQTVYSEILLKTLTFMVVCQSGSELSLDALKLIIQGSMPESPSVDEVPSEALFTRG
                     EIYSFANRVFDLQLKKMEVESQCKIYVNLAQIYGSLGFERKKAFVLRLLLVAIVSDTE
                     HIQWHEEYKERLQEMVKLYGIEDGAVEKSSDNPHEVSWLILQKKCLQLCLTVSTRVND
                     NEAAAHYTSVLICRYAHLLTQSEQQALFKSYMQPLILEGYIQSYWDPFLLRELKFVRL
                     ESNGLTIDGEQIPIETEIIKQNDSVVDIEAPQVFNPFKALQATSSSKNNESAEVQGSF
                     LVGDKAMISCMVQNPFKFEIGITGVQFDAEMMEYCELDENEISLMHPVFVPAESMRLI
                     NLPLTLKKPTFHKWLTIDSLNVSVLGMSSKVFKIVATEKKGVDSAMSDERCIFEKIQI
                     KILPEQPELQLLRTENISDNSWMMLHGTKKKVSITVRNKSLSCPIDYLQFSSISNIEK
                     SMKPDYWKKLPADDLFGIEKQLQWLKNSFVKILNAPSHIAPNEVITIDVEVDATSVPL
                     QFNGFDLIANYGMRAGDGSCIYLKKLRLPYEVFLKRSIEVPGLEVIPLNELFSPKMES
                     VDWIKFIMKKAHSDKDFHVGDYALLLIDIRNSWIDGIDVKVEFEDFHGQSYMIEADHT
                     TRVIVPFKKLGYETTNLKNKAIPRVFAGRQYIQSGLREEQEFEMRETFWCREHVLSKL
                     HCQWHLSRDPTKTGVVDFRQFLDKFDERMVSIMYANKLPYHVELELDKCTIEKGQSLW
                     VKATVTPTQSRQSSTRNSMLLLNFMLFDNQTCKLLPKSNRRILYNGTLNHHIMATKKA
                     TINLTLLPIETGNYEIFVSIASTDGDESTIQFNSGPVTFQVN"
     gene            <663138..>663923
                     /gene="TDEL0A03710"
                     /locus_tag="TDEL_0A03710"
                     /db_xref="GeneID:11502628"
     mRNA            <663138..>663923
                     /gene="TDEL0A03710"
                     /locus_tag="TDEL_0A03710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678866.1"
                     /db_xref="GeneID:11502628"
     CDS             663138..663923
                     /gene="TDEL0A03710"
                     /locus_tag="TDEL_0A03710"
                     /inference="similar to DNA sequence:INSDC:YOR157C"
                     /note="similar to Saccharomyces cerevisiae PUP1 (YOR157C);
                     ancestral locus Anc_5.507"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678914.1"
                     /db_xref="GeneID:11502628"
                     /db_xref="GOA:G8ZM59"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR024689"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8ZM59"
                     /translation="MAGLSFDNYQRNNFLASKSHAQPKATSTGTTIVGVKFNNGVVIA
                     ADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTEAVTQLISSNLELHSLYASRE
                     PRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGAHLFSIHAHGSTDVGYYQSLGSGS
                     LAAMAVLESHWKQDLTKEEAINLASDAIEAGIWNDLGSGSNVDVCVMEIGKDAEYLRN
                     YRTPNVREPKQQSYKFARGTTAVLRESIVNICDVQEETVDIVG"
     gene            complement(<663976..>664617)
                     /gene="TDEL0A03720"
                     /locus_tag="TDEL_0A03720"
                     /db_xref="GeneID:11502748"
     mRNA            complement(<663976..>664617)
                     /gene="TDEL0A03720"
                     /locus_tag="TDEL_0A03720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678867.1"
                     /db_xref="GeneID:11502748"
     CDS             complement(663976..664617)
                     /gene="TDEL0A03720"
                     /locus_tag="TDEL_0A03720"
                     /inference="similar to DNA sequence:INSDC:YDR408C"
                     /note="similar to Saccharomyces cerevisiae ADE8 (YDR408C);
                     ancestral locus Anc_5.508"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678915.1"
                     /db_xref="GeneID:11502748"
                     /db_xref="GOA:G8ZM60"
                     /db_xref="InterPro:IPR001555"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR004607"
                     /db_xref="UniProtKB/TrEMBL:G8ZM60"
                     /translation="MGKSRITVLISGSGSNLQALIDAQAEGKLGNAEIVSVISSSKKA
                     YGLTRASNAKIPTKVHSLYPYTRDISKENKEKRAEARVQFEKDLAELVLSDKPDLVVC
                     AGWLLILGPEFLSCAKSVPIINLHPALPGAFDGTTHAIEMAWKKAQEEDKPFTAGCMV
                     HYVIEEVDRGEPLLIKELEIIPGKETLDEYETRVHEAEHVAIVEAVVAALTKI"
     gene            <665192..>667573
                     /gene="TDEL0A03730"
                     /locus_tag="TDEL_0A03730"
                     /db_xref="GeneID:11502978"
     mRNA            <665192..>667573
                     /gene="TDEL0A03730"
                     /locus_tag="TDEL_0A03730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678868.1"
                     /db_xref="GeneID:11502978"
     CDS             665192..667573
                     /gene="TDEL0A03730"
                     /locus_tag="TDEL_0A03730"
                     /inference="similar to DNA sequence:INSDC:YDR409W,YOR156C"
                     /note="similar to Saccharomyces cerevisiae SIZ1 (YDR409W)
                     and NFI1 (YOR156C); ancestral locus Anc_5.509"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678916.1"
                     /db_xref="GeneID:11502978"
                     /db_xref="GOA:G8ZM61"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR004181"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR023321"
                     /db_xref="InterPro:IPR027229"
                     /db_xref="UniProtKB/TrEMBL:G8ZM61"
                     /translation="MTANAASATGRGLHHEIQEVIVQMETLRVPELKAVCRSLGQTIA
                     GRKAELQERIRSYVRNSCTIGYVDPWRPKTVRLLIDKVKLGETLPSYEDVWMTLRTGV
                     YNHPVATGHQPVSTLQQPAATTVSPGYADHPNPAWPSEVAKSQALRSKVPKQPSLYFK
                     PTPFYKMKKMIPETAQKINITNVRGACVAKFKLTKADWALLESDKKYKLYLLCGELTG
                     TPTTAGEPIQFPHPNEIRFNNVQVKDNVRGLKNKPGTAKPADLTPYLRPSPQMNVLEV
                     VYAFTKSEYYIYCYIVEQVTPEELLAEVLARPKIIKAATLSYIKRCLSEEEDDLITTN
                     TVMTLQCPVSYTRMKYPIKSVMCKHLQCYDALWYICSQMQIPTWQCPVCQISISLKDL
                     AICEYVDEILKNSNEDVEQVDISTDGSWKPLTEEKPVQKETNKSTETTVKKEYNDDDE
                     ESDLPLSRLLQGDSRSATPNEPVVISLDSDAEDETTDMGEVNGNDNQQQSGSVPSGPV
                     PSSGSYMDSSTSDSGQTLDPKIREANTPTAATKNHGPQENSINYVNRHQEVPNILGKT
                     PLQNSHSDQDTSLREADPASPTPMSSARNSYYPSVSGSFNNNNEQSSRASDSSLPPHN
                     NTPPVLRRPTDSSANSILGLTGQVVVPPTSENSLPPLLHTNGGNSPNESGTNDTDQPS
                     TDAPKLPPLPPASKLYNRSDRDNSSDTSHSFVYIPPYSRGKRPIVSPFIPKKPYMNHL
                     PQKRQLSSNSQHTINGNNIDNGNGANAQTLGVSVSDAPASSTHSDDFIDLTSD"
     gene            complement(<667608..>668342)
                     /gene="TDEL0A03740"
                     /locus_tag="TDEL_0A03740"
                     /db_xref="GeneID:11503256"
     mRNA            complement(<667608..>668342)
                     /gene="TDEL0A03740"
                     /locus_tag="TDEL_0A03740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678869.1"
                     /db_xref="GeneID:11503256"
     CDS             complement(667608..668342)
                     /gene="TDEL0A03740"
                     /locus_tag="TDEL_0A03740"
                     /inference="similar to DNA sequence:INSDC:YDR410C"
                     /note="similar to Saccharomyces cerevisiae STE14
                     (YDR410C); ancestral locus Anc_5.510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678917.1"
                     /db_xref="GeneID:11503256"
                     /db_xref="GOA:G8ZM62"
                     /db_xref="InterPro:IPR007269"
                     /db_xref="InterPro:IPR025770"
                     /db_xref="UniProtKB/TrEMBL:G8ZM62"
                     /translation="MSDHDVDNGIQLNKPYADVEKNPLDQVSFTAFCLGIVLGIFLGS
                     LMIIKLKNFNFYIISLCIFHFLEYYITARYDSSKVNLDSFLLNNGSAYLICHIIAIIE
                     TLVEYVYEPDFKADNESAFSKTVVRLGYLCMFVGQFVRSLAMATAGSSFSHIVQQERQ
                     SDHVLVKHGIYSWSRHPSYFGFFYWAVGSQMILLNPVSFVLFSVILWRFFNQRIKVEE
                     AYLIRFFGDEYIQYKSQIPVRIPFIK"
     gene            complement(<668434..>669171)
                     /gene="TDEL0A03750"
                     /locus_tag="TDEL_0A03750"
                     /db_xref="GeneID:11502796"
     mRNA            complement(<668434..>669171)
                     /gene="TDEL0A03750"
                     /locus_tag="TDEL_0A03750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678870.1"
                     /db_xref="GeneID:11502796"
     CDS             complement(668434..669171)
                     /gene="TDEL0A03750"
                     /locus_tag="TDEL_0A03750"
                     /inference="similar to DNA sequence:INSDC:YML041C"
                     /note="similar to Saccharomyces cerevisiae VPS71
                     (YML041C); ancestral locus Anc_5.511"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678918.1"
                     /db_xref="GeneID:11502796"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="UniProtKB/TrEMBL:G8ZM63"
                     /translation="MLVEEINKKTYDPSVYYTSLDSQTSSHARSKVSKSLGSSRSSKR
                     VNYSLADLENKLYTQKQDAADDSNQSRDSTILDKFTQQEIIQSKKRYMELDTENQKEL
                     VDVPSLLSAITGINRNKIDTGNSNPSSVRQKNKIEIPKTIHLSYRSTKPPVPKRKNTN
                     RVVALKKTLSSRRPLQSYLETLDQVNKSIIYHNVANKKYFKVLPVITICSVCGGYDSI
                     SSCVQCGNKICSLRCFNLHNETRCIHR"
     gene            complement(<669261..>671249)
                     /gene="TDEL0A03760"
                     /locus_tag="TDEL_0A03760"
                     /db_xref="GeneID:11503360"
     mRNA            complement(<669261..>671249)
                     /gene="TDEL0A03760"
                     /locus_tag="TDEL_0A03760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678871.1"
                     /db_xref="GeneID:11503360"
     CDS             complement(669261..671249)
                     /gene="TDEL0A03760"
                     /locus_tag="TDEL_0A03760"
                     /inference="similar to DNA sequence:INSDC:YML042W"
                     /note="similar to Saccharomyces cerevisiae CAT2 (YML042W);
                     ancestral locus Anc_5.512"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678919.1"
                     /db_xref="GeneID:11503360"
                     /db_xref="GOA:G8ZM64"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:G8ZM64"
                     /translation="MKTYRGRLMQLPLTRRMSSSSQRFPILQRFPFETQNGEHYWAYK
                     DNEAHRSTRANYKGDTFSQQSKLPSLGVPELEQTISKYLQTIKPYCSESSEYARQELL
                     CKDFVDNLGPVLQKRLVEFASNKRNWMSELWDNQAYLEYNDPVTPYVSYFYSHKPLPT
                     SHRSIDSDPLLKATAIVVTVSRIIESLKDESLPAEIVKDSPFCMNSFHLMFNTSRLPG
                     LPQDNRDTNVFYSIYENNYIVVAYKGNFYKLITHDPHTAKPLEPNAIWTQFYSIVNEK
                     SAHLNIETNSGVGLLTTLARDQWRSAYRDLVKNPLSKESLEVIHKAAYLVALDDSIPV
                     TLEEKSRNLWHGNGFNRYFDKSLQFIVAQNGSSGCMNEHSKMDGTPTCFLNDYVCRQI
                     SKLNPETFTKAVHRSAKEHEVTHLPFLITPAVKEWINVAQDSFNAEILQHDLRVWHYN
                     RLGKKFIKKNGMSPDAFIQQVIQLAVYKYLGKQLPTYEAASTRRFFKGRTEAGRPVSE
                     PSHDFVTAWENPKSSTSEKVSLLKKSAKFHSDYLKAAAAGQGVDRHFFGLKNMLTSTD
                     SVPPLFTDSLFNYSSTWLISTSQLSSEMFDGYGWSQVNDNGFGLAYMLNNDWLHINIV
                     NKPLASGLSVDRLHYYLNVAADEIHDALIAEEGLKAKL"
     gene            complement(<671518..>672423)
                     /gene="TDEL0A03770"
                     /locus_tag="TDEL_0A03770"
                     /db_xref="GeneID:11503144"
     mRNA            complement(<671518..>672423)
                     /gene="TDEL0A03770"
                     /locus_tag="TDEL_0A03770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678872.1"
                     /db_xref="GeneID:11503144"
     CDS             complement(671518..672423)
                     /gene="TDEL0A03770"
                     /locus_tag="TDEL_0A03770"
                     /inference="similar to DNA sequence:INSDC:YDR411C"
                     /note="similar to Saccharomyces cerevisiae DFM1 (YDR411C);
                     ancestral locus Anc_5.513"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678920.1"
                     /db_xref="GeneID:11503144"
                     /db_xref="GOA:G8ZM65"
                     /db_xref="InterPro:IPR007599"
                     /db_xref="InterPro:IPR022764"
                     /db_xref="UniProtKB/TrEMBL:G8ZM65"
                     /translation="MANNIHGLGHSGSDGFRSELVRALYNIPVVTRYLISAVVVVKVI
                     TRLFVTPNNYVYYKFSDMLKYAQFWRPFTSSIMLHPEPMAAMLEFYTLYSRSSQLELR
                     RQRLDYVFYMVFCIIVMSLMVPLWYGSSNTVILTSGFITCLTYSWSLDHLNVNVMVYG
                     LFPIRGKFFPLIQLLIDFLFFGQWFPITVMGFLTAYLYCCLDTGTLGPLYGWATGASE
                     YYGISPNGKFGAPQWLHRLLQASRNPSSVISARSGGRKLGFKDQETTIPTTVTTTSAS
                     RNSSTAAQRRAKTSIFPGSGQRLGN"
     gene            <672620..>673285
                     /gene="TDEL0A03780"
                     /locus_tag="TDEL_0A03780"
                     /db_xref="GeneID:11502714"
     mRNA            <672620..>673285
                     /gene="TDEL0A03780"
                     /locus_tag="TDEL_0A03780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678873.1"
                     /db_xref="GeneID:11502714"
     CDS             672620..673285
                     /gene="TDEL0A03780"
                     /locus_tag="TDEL_0A03780"
                     /inference="similar to DNA sequence:INSDC:YDR412W"
                     /note="similar to Saccharomyces cerevisiae YDR412W;
                     ancestral locus Anc_5.514"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678921.1"
                     /db_xref="GeneID:11502714"
                     /db_xref="InterPro:IPR019186"
                     /db_xref="UniProtKB/TrEMBL:G8ZM66"
                     /translation="MPPSRSNRQILTQGKKYANKKLKKFGTDEVAFNKDDRLEYLTGF
                     HKRKLQRQKKAREFNQEQDRLTRIEERKNMRDERKRQLEERLHDFKKGLDLAVSDDEE
                     VEDKEEEWEGFSDDGDDESTEPSVKPILKTVYTDDSSVSVETLEPNDNFAYLAKVNNV
                     NLSESEKILTQSISRAGKYAKFLGMADKDDKPKQKKKKFRYLTKNERKANQYKANANK
                     RRR"
     gene            complement(<673300..>674349)
                     /gene="TDEL0A03790"
                     /locus_tag="TDEL_0A03790"
                     /db_xref="GeneID:11502847"
     mRNA            complement(<673300..>674349)
                     /gene="TDEL0A03790"
                     /locus_tag="TDEL_0A03790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678874.1"
                     /db_xref="GeneID:11502847"
     CDS             complement(673300..674349)
                     /gene="TDEL0A03790"
                     /locus_tag="TDEL_0A03790"
                     /inference="similar to DNA sequence:INSDC:YDR414C"
                     /note="similar to Saccharomyces cerevisiae ERD1 (YDR414C);
                     ancestral locus Anc_5.515"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678922.1"
                     /db_xref="GeneID:11502847"
                     /db_xref="GOA:G8ZM67"
                     /db_xref="InterPro:IPR004342"
                     /db_xref="UniProtKB/TrEMBL:G8ZM67"
                     /translation="MDAEKVPGPLVIAIPASERVNVLLLIAIWLWQTILKFLSSYQLD
                     VSTLVQTRNPNEVVLPLNQLQMQRLSRKFAIRISKIVVPLLVVSMICQQWAETNDFAH
                     LLVSIIPLVEFAIIIGSIIQKCQIIAYCVKRILLIEPTPRSMRNVYILISDTLTSFTK
                     PLIDFSLHMTALVLSKDAVWTHFDLLVSLFPLEIRIWQCLREFYLTKDRSMLVNALKY
                     CSGIPIVVSVWYTRVAPDIQNFNTVYWFQCLNSCFTLFWDVKMDWRCNSLLQIRKNHK
                     STNSVIFPKFIYYIGFLTDFTIKFWWIWVMKTPNHMLFFQSELQYLEVLRRSIWVIFK
                     LESEYVMTRNLVTEK"
     gene            <675028..>676197
                     /gene="TDEL0A03800"
                     /locus_tag="TDEL_0A03800"
                     /db_xref="GeneID:11502820"
     mRNA            <675028..>676197
                     /gene="TDEL0A03800"
                     /locus_tag="TDEL_0A03800"
                     /product="mitochondrial 54S ribosomal protein RML2"
                     /transcript_id="XM_003678875.1"
                     /db_xref="GeneID:11502820"
     CDS             675028..676197
                     /gene="TDEL0A03800"
                     /locus_tag="TDEL_0A03800"
                     /inference="similar to DNA sequence:INSDC:YEL050C"
                     /note="similar to Saccharomyces cerevisiae RML2 (YEL050C);
                     ancestral locus Anc_5.516"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein RML2"
                     /protein_id="XP_003678923.1"
                     /db_xref="GeneID:11502820"
                     /db_xref="GOA:G8ZM68"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR005880"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR014726"
                     /db_xref="InterPro:IPR022666"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="InterPro:IPR022671"
                     /db_xref="UniProtKB/TrEMBL:G8ZM68"
                     /translation="MLILLRNCVIPPALVRQRATSVVGLHRFFSSRSGLLQRIEQNAA
                     ADGETGFVSPQMLKIIPNDTDIATLEKQDELIRRRRKLSKEITQMKKLKPVSPGLRWW
                     RTPIYPYLYKGRPVRALTEAKRGKGGRNHSGRITVRHRGGGHKRRIRLVDFTRTDPGQ
                     QTVQRIEYDPGRTSHIALLKNNQTGKLSYIIACDGLRAGDVVESYRQGIPEDLLREMG
                     GKVDPAILSVRTAQRGNCLPISMIPIGSIVHNVGITPVGPAKFCRAAGTYARIISKTP
                     EKKKAIVRLQSGEHRYVSLEACATIGIVSNIDHQNRSLGKAGRSRWLGIRPTVRGVAM
                     NKCDHPHGGGRGKSKSKKLSMSPWGQLAKGFKTRRGKNQNRMKVRDRPRGKDARK"
     gene            complement(<676266..>677393)
                     /gene="TDEL0A03810"
                     /locus_tag="TDEL_0A03810"
                     /db_xref="GeneID:11502763"
     mRNA            complement(<676266..>677393)
                     /gene="TDEL0A03810"
                     /locus_tag="TDEL_0A03810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678876.1"
                     /db_xref="GeneID:11502763"
     CDS             complement(676266..677393)
                     /gene="TDEL0A03810"
                     /locus_tag="TDEL_0A03810"
                     /inference="similar to DNA sequence:INSDC:YDR415C"
                     /note="similar to Saccharomyces cerevisiae YDR415C;
                     ancestral locus Anc_5.517"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678924.1"
                     /db_xref="GeneID:11502763"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="UniProtKB/TrEMBL:G8ZM69"
                     /translation="MRSRLFVFISLVCLCVAIGSNDVRILEIGKGERIEVRESEKGLL
                     KRRGVGFIDVTDHLNWPWSKNVDDEHDLPSYNYPKQTSEVDSFENLSTLIDKDEMYMN
                     LANFCSFFTRYYKSPSGYESALWLSEIIHNITDVIPKGAVEIEHFDHKKWRQFSIIVR
                     IPGHKTPENLVVMGSHLDSLNLIFPSWIATPGADDNGSGTVTNLEALRVYAKHIADGN
                     FPDNTVEFHFYSAEEGGLLGSMDVFSSYKEQEKLVVAMIQQDMTGYVRNKRDEHIGLV
                     TDFTDPALVDFMKVIINSYASIPYRETTCGYACSDHGSAMKNGFPAAFILESEYNKTN
                     QYIHTTMDTLDRLSFDHMAEHAKVTLGAVLELANWEFMRLT"
     gene            complement(<677606..>678400)
                     /gene="TDEL0A03820"
                     /locus_tag="TDEL_0A03820"
                     /db_xref="GeneID:11503336"
     mRNA            complement(<677606..>678400)
                     /gene="TDEL0A03820"
                     /locus_tag="TDEL_0A03820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678877.1"
                     /db_xref="GeneID:11503336"
     CDS             complement(677606..678400)
                     /gene="TDEL0A03820"
                     /locus_tag="TDEL_0A03820"
                     /inference="similar to DNA sequence:INSDC:YEL051W"
                     /note="similar to Saccharomyces cerevisiae VMA8 (YEL051W);
                     ancestral locus Anc_5.518"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678925.1"
                     /db_xref="GeneID:11503336"
                     /db_xref="GOA:G8ZM70"
                     /db_xref="InterPro:IPR002699"
                     /db_xref="UniProtKB/TrEMBL:G8ZM70"
                     /translation="MSGTREQVFPTRMTLGLMKTKLKGANQGYSLLKRKSEALTKRFR
                     DITKRIDDAKQKMGRVMQTAAFSLAEVSYATGENIGYQVQESVSNARFKVKARQENVS
                     GVYLPQFESYIDANINDFKLTGLGRGGQQVQRAKEIYSKAVETLVELASLQTAFIILD
                     EVIKVTNRRVNAIEHVIIPRTENTIAYINSELDELDREEFYRLKKVQEKKQLETARLD
                     AEMKEAKLAKQQQQEGSHNEVNKDDDTAADAQSATVVEEQEEDVIF"
     gene            <678643..>681060
                     /gene="TDEL0A03830"
                     /locus_tag="TDEL_0A03830"
                     /db_xref="GeneID:11503146"
     mRNA            <678643..>681060
                     /gene="TDEL0A03830"
                     /locus_tag="TDEL_0A03830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678878.1"
                     /db_xref="GeneID:11503146"
     CDS             678643..681060
                     /gene="TDEL0A03830"
                     /locus_tag="TDEL_0A03830"
                     /inference="similar to DNA sequence:INSDC:YDR416W"
                     /note="similar to Saccharomyces cerevisiae SYF1 (YDR416W);
                     ancestral locus Anc_5.519"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678926.1"
                     /db_xref="GeneID:11503146"
                     /db_xref="GOA:G8ZM71"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G8ZM71"
                     /translation="MDDISRYVADEDDLAFEYELQRTPQSVVTWRRYLDSWKEDGRPD
                     SHIVWLYERFCRQFQSDMEIWEDYIQWLLQRCGKSVEYTDIMELFIRSLSYCAKNCED
                     LCIMFLEFAIGQLDLKYIRMAFDISLKRLPRDGHGRVWEKVLRFIDETLSPLTRNEET
                     EYDDIFEELSILIYKGLFEKTDEGNHELDLWTSLILKRYLDVCPSEQRPLNVIRIAQT
                     GDHDFLYTAYRKFYGNGPQSTLPYSTNLLYLESLESLNKREAYEQFITELAGVFPENW
                     VELKVTLVKFYIKSAQHDKIVHVLEDSLARTQSVQEFSVLYSTYLNYEKAFIDIVLQE
                     LKNNSQVIGDWEQQVESHLSRLQGLIESYEIRLNDIKIRRNPNLVSNWSERATLFPAA
                     AGKCDVYSHAILTIDPYRVNIPGSLGKLWCAYAELYWEAGDFDSAREVYDRGLRVPYP
                     YLQDLEELWTTWAEHELESFSIEFAIKLMEDALQVPENPELLVDRFKEGDKKVPAQAV
                     VFTSLKLWLLYLDFTESLSYDSSEYTEKTIALYEQMIALKVATPMVFINYAHFLQEHR
                     EELSSFQVYERAIGTFPPETQLEIWDLYLTEGTAEDSPLAKEQIRDLFDQALENLTNG
                     RIDCKTIFLLYSDFEEQCGLLNRCCEILLQGARKTANLEDKITLWQMCISKAKALLGN
                     EESRKLYEECIQSLPNSQVMKFVVDFARTEAVLGEIERARELFKYGAQLLPPGRNGLL
                     WEKWDEFEVRNGNKESYKDMLKLKRKLEKEMRIETEAESQLEGNIAFVAASKQNVVNP
                     EEIELNI"
     gene            complement(<681119..>682627)
                     /gene="TDEL0A03840"
                     /locus_tag="TDEL_0A03840"
                     /db_xref="GeneID:11502981"
     mRNA            complement(<681119..>682627)
                     /gene="TDEL0A03840"
                     /locus_tag="TDEL_0A03840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678879.1"
                     /db_xref="GeneID:11502981"
     CDS             complement(681119..682627)
                     /gene="TDEL0A03840"
                     /locus_tag="TDEL_0A03840"
                     /inference="similar to DNA sequence:INSDC:YEL052W"
                     /note="similar to Saccharomyces cerevisiae AFG1 (YEL052W);
                     ancestral locus Anc_5.520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678927.1"
                     /db_xref="GeneID:11502981"
                     /db_xref="GOA:G8ZM72"
                     /db_xref="InterPro:IPR005654"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZM72"
                     /translation="MSVITLQLQSANNLRNCKALISLCSGFAKRQLVTSTAPPSHASV
                     TPLEQYNRLVNLKKLRNDPYQQGIIKSLGSLYDALVGYQPPAIKTPNAVDQVGWRASF
                     LGNLMKFKSKADDFSGIPKGIYLYGDVGCGKTMLMDLFYSTVPASLSKKRIHFHQFMQ
                     YVHRRSHEIIKEQNLDALGAAKGKDIDPIPFLAAEIASSARLLCFDEFQVTDVADAML
                     LRRLLTSLLSKEYGVVLFATSNRHPDELYVNGVQRESFIPCIELIKKRTEVIFLDSPT
                     DYRKIPRPSLSVYYYPEKGQKYNSPKCQAERESHINQWYNYFAQKENTSSTEHEVLYD
                     FTLTTWGRKFRVPKCTPACVAQFTFRELCEQPLAAGDYLSLASNFKAFIVTDIPYLTV
                     YVRDEVRRFITFLDAVYDSGGKLATTGAADFTSLFVEPEDILNSFELKADIKDDSASE
                     QDTEDDALVKKHGFSKEIAKKSQMFALDEERFAFARALSRLHQMSSADWIER"
     gene            <682995..>685316
                     /gene="TDEL0A03850"
                     /locus_tag="TDEL_0A03850"
                     /db_xref="GeneID:11503139"
     mRNA            <682995..>685316
                     /gene="TDEL0A03850"
                     /locus_tag="TDEL_0A03850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678880.1"
                     /db_xref="GeneID:11503139"
     CDS             682995..685316
                     /gene="TDEL0A03850"
                     /locus_tag="TDEL_0A03850"
                     /inference="similar to DNA sequence:INSDC:YEL053C"
                     /note="similar to Saccharomyces cerevisiae MAK10
                     (YEL053C); ancestral locus Anc_5.521"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678928.1"
                     /db_xref="GeneID:11503139"
                     /db_xref="InterPro:IPR007244"
                     /db_xref="UniProtKB/TrEMBL:G8ZM73"
                     /translation="MPLEDQLEKLDISDTSYGSMTAEIETLRDEDGEPMEELVDITQM
                     FFDLGRDLSPHTIIKDPGFNLFEGTHSLEVNNEKLDSSLISLTDEERQFDCNLAYGDD
                     ELLRLKHVTAIVDLLTRFLVSWLNEYQTLPTTVLSCRYVEHLLIESSKAGRLTYLHSG
                     DPLYDQVLCDAIYGICYFAKFVQKLLKAGVIFEEEDLNFNGMGLDFLSYFEEQQVIVD
                     RLHRSIEFVESSQGDKGTFLSRLLRIIICLVKMEDHLELYSADVTRLDELIEESRYLD
                     EHDVSQEYTPPPGCFSMSIQKRLSNRFPPKHLVVPNWNYKGFSTMAQDLKIVLKVNDA
                     ATMLEAAQLAQYFNKLTQRHVIARALFPLYFIRDDQTILGKYSTLDCIHMHLREFSAM
                     STTISKQSPQELEPILQEAMNVLFEWYQNTAQNTSRYRQGYNRQLLLWDALHAQMETT
                     EFELAQRGIADQTMGQQGRIPFMPYSSWAFSMKVTAMLDYVTKGFDLDVYKPFESFSM
                     FWYAYYLSYNLEACLENVQQFIDSKINSIHGLAKKIKKVKTIEKKNELKAQHRHLMDT
                     EMEQLRTNKRYLSYLFMNTAIIKSLSLAQVFQFSILRYLGIIDTNSPAKSKFTSDRLL
                     HDLRFKPFSSIGVPDVLTYETLQSTLREFSIEGTMSSVKLENARQCMDKELQSASNAI
                     ETIKKCISAGDNNGLIVTGTRLVKEEALDYYNHLQVSVEAIIANSTTISSHLKSLKSA
                     EWKHRHEVRLNVPKGGSPFFPLLELIEKVDRKK"
     gene            <685970..>686467
                     /gene="TDEL0A03860"
                     /locus_tag="TDEL_0A03860"
                     /db_xref="GeneID:11502989"
     mRNA            <685970..>686467
                     /gene="TDEL0A03860"
                     /locus_tag="TDEL_0A03860"
                     /product="60S ribosomal protein L12"
                     /transcript_id="XM_003678881.1"
                     /db_xref="GeneID:11502989"
     CDS             685970..686467
                     /gene="TDEL0A03860"
                     /locus_tag="TDEL_0A03860"
                     /inference="similar to DNA sequence:INSDC:YDR418W,YEL054C"
                     /note="similar to Saccharomyces cerevisiae RPL12B
                     (YDR418W) and RPL12A (YEL054C); ancestral locus Anc_5.522"
                     /codon_start=1
                     /product="60S ribosomal protein L12"
                     /protein_id="XP_003678929.1"
                     /db_xref="GeneID:11502989"
                     /db_xref="GOA:G8ZM74"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR020783"
                     /db_xref="InterPro:IPR020784"
                     /db_xref="InterPro:IPR020785"
                     /db_xref="UniProtKB/TrEMBL:G8ZM74"
                     /translation="MPPKFDPNEVKYLYLRAVGGEVGASAALAPKIGPLGLSPKKVGE
                     DIAKATKDFKGIKVTVQLKIQNRQAAASVVPAASSLVITALKEPPRDRKKEKNVKHSG
                     NIALDEIIEIAKQMREKSFGKNLASVTKEILGTAQSVGCRVDFKNPHDIIDAINAGEI
                     EIPEN"
     gene            <687098..>689011
                     /gene="TDEL0A03870"
                     /locus_tag="TDEL_0A03870"
                     /db_xref="GeneID:11502861"
     mRNA            <687098..>689011
                     /gene="TDEL0A03870"
                     /locus_tag="TDEL_0A03870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678882.1"
                     /db_xref="GeneID:11502861"
     CDS             687098..689011
                     /gene="TDEL0A03870"
                     /locus_tag="TDEL_0A03870"
                     /inference="similar to DNA sequence:INSDC:YDR419W"
                     /note="similar to Saccharomyces cerevisiae RAD30
                     (YDR419W); ancestral locus Anc_5.523"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678930.1"
                     /db_xref="GeneID:11502861"
                     /db_xref="GOA:G8ZM75"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR017961"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="UniProtKB/TrEMBL:G8ZM75"
                     /translation="MSKYKWKDLVKLKSKNESYESPLSVLCHIDVNCFYAQVEAVRCG
                     YTKDDPVVCVQWNSIVAVSYAARKYGITRMNTIQQALKKTQDLIPIHTAVFRKGEDFW
                     QYHDGWGPWNEDKEKQLPSSIYKISLDPYRRESRKIFKIFTEYCDLAEKASVDEVFLD
                     IARLCLQKLMGSEQILPGKENHNTIQLMQQMFKDGTYDSDAFLPPVPEELKELKFVGN
                     LLNPNDEPLIEDWDDVLFALGSQIAQELRDEIRQNLGYTTSCGLARTKIVCKLASNFK
                     KPDAQTIIKNSCINAFLDIGKFEITSFWSLGGILGKELIQVLHLPEDGTIRAVRERWP
                     QRDDLRIYLNRSAREFASKGQANGIIDLSRTNEVADKLYDAVRGQHRLPVVPQTMVKS
                     LMSNKNMTGQACNSLGDCFSWLEVFAGELAGRVHELQQEYNKIIIPRTVHVLVRAKSG
                     EAHSKSCQFQQNGKLSSQDLLKAGAKLTAEIDARFARGKEYAFYPLQNINMSLSNLEV
                     LSSKKSVVEMFGGQASAHKSKIELPPIIDLPKSGSSEVRNDYSCRSCNITFNNEKDFQ
                     EHADFHIAMSLSEKINGTSEGSNNLSLGERRLLNSQKRRGSTPELPGKRRPKKKKNDR
                     GSATDIYHYFAKG"
     gene            689359..689440
                     /gene="TDEL0Atrna8S"
                     /locus_tag="TDEL_0Atrna8S"
                     /db_xref="GeneID:11502697"
     tRNA            689359..689440
                     /gene="TDEL0Atrna8S"
                     /locus_tag="TDEL_0Atrna8S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCU"
                     /db_xref="GeneID:11502697"
     gene            <690387..>695477
                     /gene="TDEL0A03880"
                     /locus_tag="TDEL_0A03880"
                     /db_xref="GeneID:11503152"
     mRNA            <690387..>695477
                     /gene="TDEL0A03880"
                     /locus_tag="TDEL_0A03880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678883.1"
                     /db_xref="GeneID:11503152"
     CDS             690387..695477
                     /gene="TDEL0A03880"
                     /locus_tag="TDEL_0A03880"
                     /inference="similar to DNA sequence:INSDC:YDR420W"
                     /note="similar to Saccharomyces cerevisiae HKR1 (YDR420W);
                     ancestral locus Anc_5.524"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678931.1"
                     /db_xref="GeneID:11503152"
                     /db_xref="UniProtKB/TrEMBL:G8ZM76"
                     /translation="MKYHQLVRLVLIIFAITSSVRALPSSNALEEKTGSTEQNRETTN
                     SFSGDAYTIQSPSHTSNLQTGTSDRSSSNKIDSRSGTTSVIANSADKSSSAPGDANDQ
                     KVGSESESSPTTSTQSDIPTTSQLWSEASKSSSVKPEVISSSQQKTETTSLSIPSSTS
                     SIGTSLSSASDRAVGSTNSGGSSNTYDKKTSSQTVYTISSDTETKLSNTPTTIQSSST
                     RSGISSDKNSGISAGLTSDSSVKASSSTSSTSDQLALQTSKSQDINTISSSSGAPTSS
                     PASSFTALSDTTSTTFSDSKPALITGQSSSLSTDTPPLASSISNTQSSQNNIADDTDR
                     NEGTSSKITTNSETSPALNTQNVVTIIPTESKSTLTINDTPLTSSSQSTRPTSSITDE
                     LTSLTSTPASTASSDSTTASGFSWDNPFANELFVNPSTTSDATQSTASNSDTLVGSTS
                     SSSAISVTPTSPTSADQATTSTGHQLTWDSSSPTPTFTVPTDTTISSSEPEISSESSG
                     EFKSTSSEEQPTSSSTGEQSSSSSIDTSITSSPIDSAGEGEQTFSKSSSEPGFDQSTS
                     TPTTTVVIDVSGFRPLTFFFSSSESSLEVSHTSSSTFNEPDTASTMPSNSYGEGTSTS
                     LTSDTSESSAPDWDPSSSTMATPPLSNSQSTSDDFEQSTTEYSGPSSTTSTPEVPIIT
                     LTSSSEPVYTLSTTTPSSSSILTPITTDATRDSSSVLQTNSANTITNPISSLSSFGQS
                     SQEYSGSAPHYTDTSSSQTTGSIFEVTLATSTISSITSQDSPTFDLSYITSQSSISST
                     STSGNVGGEIATSITSVDTSNIDIGQSSYESPSQSSLTTASQFQVSQDGTSSAMETGS
                     VLNGQPESTGAQSFTSDIASATSLTESSYDSIATEEPTSSSNLETIDSSSKTATATYD
                     SDSLSNSIASQQASGSSDFQTNIGTTSSPFDTATSTFLTSSLSDSMVSEQPTVSNNPQ
                     DTHSISQTETLEPSSTSSGTSTDDTQPNDTGSESLSLSATTRSSVDLISGTESDGSLR
                     MTLTTRPAQSTGSLLTTGQTTAANTGARSSSVGGRTTFWLPSSIQVQSDPTRSGTSSF
                     DPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEFLVSSSTTAAQIFHFLPFVL
                     SFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQETVTGISKRSDSEFPFNA
                     SAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDDTSQLFNNPDPTLDALA
                     ALIDPSIPLTGLIDGSTGSLNGGNPSTQSHSPSSPYKSQSSDDNSGSLGTATNSGLSS
                     AVKKRLVIYLTCLVFGTLLWILVFMFLYKHLYGGRVIAKRAYQRDAAQEEKQHYNFAD
                     ITSVHSAETEPANDKSDDVPQEKDVASASQSRYSLPEDLMITGENTVYSVSQGLQYFV
                     AEDGSFYYAGPLQSTSEENETTKGDSADIEDINDYLYSADQERSIVTNEQSSCDIGSL
                     QIDEEGNFVVSDPSPNEEEHEITSSNSATIELYNNNNLYKMTRTVNSNEISSPRYLDQ
                     DSQGEISDAGMGQEGNPDFLSSTEQNWHISSPDESENFPGRSVFGFYGSDDSNNIVQS
                     LPAENCIDEYLYVSGDDDSLLDSPLGVRIEEIDDDAVDVHVDDLDELDEEMYKRRSKL
                     MTQQQRTENGMLHMSRVMKAKAQGTRRI"
     gene            <695880..>698375
                     /gene="TDEL0A03890"
                     /locus_tag="TDEL_0A03890"
                     /db_xref="GeneID:11502612"
     mRNA            <695880..>698375
                     /gene="TDEL0A03890"
                     /locus_tag="TDEL_0A03890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678884.1"
                     /db_xref="GeneID:11502612"
     CDS             695880..698375
                     /gene="TDEL0A03890"
                     /locus_tag="TDEL_0A03890"
                     /inference="similar to DNA sequence:INSDC:YDR421W"
                     /note="similar to Saccharomyces cerevisiae ARO80
                     (YDR421W); ancestral locus Anc_5.525"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678932.1"
                     /db_xref="GeneID:11502612"
                     /db_xref="GOA:G8ZM77"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G8ZM77"
                     /translation="MDQISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPP
                     CKRCKREGKTCEFLQSRKKSVFKRQHRTNGLELQDEVEKHVVITHEVDVGGPSDRIER
                     HSRNKIDGKWRFEISSMQNALEFLAKAAGSVAKEDNQLHEIKQIDPSQVSRDDSSWKD
                     LTPTSFEASRAGIMAPLEADEGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLT
                     EEEVIKLVDVFFLTMYPFFPHIPLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLK
                     DNMQNNRNIEVHEQLWIYCQKLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWS
                     DYANSGDSKDRSNDFSISRDSERLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNETSS
                     KIFTATHISETHTAMNVGQRSTLTESLNEINLGSIKFPRNNSVGNEQFYLEKILENDD
                     SKDRWTRFLHDIRDDYAHHDEGPLTDIEREFLNDEYVLYYTADGDSKHRDSSNLLPFP
                     LRFSKIQRAKIELLRIITVGFEAIYCTKDKQQSLFNDPTRNLSLLHLISPLIESWYKS
                     YHDLLEPAEGKPCTVDLCRNKREVHYVVRKIDRESLICEYYYCQLYIYSSALQVDVKE
                     GQLKLHEITRSAKYVELAYNAAKMLLTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVK
                     CYLTLMGNAVVNNPLANTILKLTVIPAEDILKTIHTAALILKEASPDELHLCMRYSTI
                     LMSLCSEMRESEDYTTDSPTPGTTFGQDNDPSPIQPLDTAIPLPNDVVDWFSTSDEIG
                     LEFVESWAEMIEQRYLQGSSYSQNLGNAADTPT"
     gene            <698940..>700955
                     /gene="TDEL0A03900"
                     /locus_tag="TDEL_0A03900"
                     /db_xref="GeneID:11502772"
     mRNA            <698940..>700955
                     /gene="TDEL0A03900"
                     /locus_tag="TDEL_0A03900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678885.1"
                     /db_xref="GeneID:11502772"
     CDS             698940..700955
                     /gene="TDEL0A03900"
                     /locus_tag="TDEL_0A03900"
                     /inference="similar to DNA sequence:INSDC:YML006C"
                     /note="similar to Saccharomyces cerevisiae GIS4 (YML006C);
                     ancestral locus Anc_5.526"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678933.1"
                     /db_xref="GeneID:11502772"
                     /db_xref="UniProtKB/TrEMBL:G8ZM78"
                     /translation="MQKSIKVDDYFDNDDNGLWSWYLSHIRSGDFEEFSRNKLKVTLL
                     RRFLNSHFDSNRSHYGQNTKILFVSIPDKVHRDLSLLENFLRDYFHLEHLEHIEITKL
                     TQSPVYNHENHYILIDKLNNFDDPTFLQFASTRWQQQLSNQQSNRLSDRQSGSIPNND
                     SSVEFNKKPCGTVTERSRAGSLSSFSANSGPSDLGSDTGGLQNIEVRSIQSESTAGQF
                     NQIPINSINDQDDENESIVLDFSHSLLRKQMEEKKSQAQRIRQQEYSADTNQTITNLH
                     TNDKDTNASDIYSPAISENVSINSYEDESMRDGSDSITAKDSYSGQPLALTTTHYKDD
                     TQGSSDDSQEENISELSSVSRSMKSLGSQTSLGDNNDYENNSDSSDYSVVSILPSISI
                     SDARGHYRLVMQSSLLQDPETKEIYTAIRQSNNQPTVADVDDDWLLYDSQFSMNNLQM
                     LTLQELLDMNRSFPKIIFYSMIVVSDEQQELLQWSNGMTQKEDTADASSSIPRADSYA
                     SMSRDPQQFYANMDDDDTSLSEQSGPMMYAPTRLQSNTSTAHRSIRTVNSIGDWAFVH
                     KNETKRQGSHRGSTSQAGVSGVQFDSDNQNLQFLHPERVHSRNGLSKVSTMASLNPVE
                     RSKSTPLPVILISFSNLDGESKHWKDKITTFRRKKNHRQHEKGCIIM"
     gene            complement(<701073..>703322)
                     /gene="TDEL0A03910"
                     /locus_tag="TDEL_0A03910"
                     /db_xref="GeneID:11503162"
     mRNA            complement(<701073..>703322)
                     /gene="TDEL0A03910"
                     /locus_tag="TDEL_0A03910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678886.1"
                     /db_xref="GeneID:11503162"
     CDS             complement(701073..703322)
                     /gene="TDEL0A03910"
                     /locus_tag="TDEL_0A03910"
                     /inference="similar to DNA sequence:INSDC:YDR422C"
                     /note="similar to Saccharomyces cerevisiae SIP1 (YDR422C);
                     ancestral locus Anc_5.527"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678934.1"
                     /db_xref="GeneID:11503162"
                     /db_xref="InterPro:IPR006828"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:G8ZM79"
                     /translation="MGNSPSVQEHQQQPHGVLDANHPFRRAQLGNEMNSGRQQSITSQ
                     LFPSRNTRHVGPHSMNAKRNRHPHPQPPSLFKSDYSLRSTAEETPANTGSTENIRDNM
                     AGLSLKSSNENAQVPSFLTPGHSTPTVQPTRQAAVPAADLKNKLQNGLNQQKEISSHR
                     FQRPSVVALKKTLLDDGELHSTSSRSTSGDVVSSASLDIYSALNLDSPTQSGSKAKDT
                     DADPDTSDFDDISDDGYLQSEDVVLNQSLLQNVLRRDMKRKRPAKKSKVPNTSHVSNL
                     KASSNSVSYESLENGNVPDAKKLKSLSYDGSLPSFQPTAQNNDRLNGLAHDNGFNRID
                     SFEKGSVEHREVETSPTMRNSSSASPSSSSIISNTEPEKVHVILKWRDQIEDPSKCKI
                     TIISTDIASALNFDPSDKSFHGTFSMKYDEKENNFYVPNLSLPPGIYKFQFVINGEIR
                     HSNLLPSATDSVGNIVNWFEVIPGYESVEPFRNEIDYHENMGIDPPQSDSSTSTGKHH
                     DESPGKVPLVQPVPGRPPLAARHTSSYSNKQERSGTPYSDYTGVSRCNSAVRKSPLIH
                     QTLSSIDLVTALQPKKYEYSNEIPELFKAGNVLGQSDENQFPTPPPPPMNPPSYDQPS
                     FLENVVDCNQDNLFVSLQQGGLLDAETAEQLFLEKYTVPDLPVYLNSTYLNKIFNEFQ
                     KHNSLGSNSSGLNHIIPHVNLNHLLTSSIRDEMISVGCTTRYEGKFITQVVYAPCYYA
                     SGPKAEGKK"
     gene            complement(<703498..>704898)
                     /gene="TDEL0A03920"
                     /locus_tag="TDEL_0A03920"
                     /db_xref="GeneID:11502707"
     mRNA            complement(<703498..>704898)
                     /gene="TDEL0A03920"
                     /locus_tag="TDEL_0A03920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678887.1"
                     /db_xref="GeneID:11502707"
     CDS             complement(703498..704898)
                     /gene="TDEL0A03920"
                     /locus_tag="TDEL_0A03920"
                     /inference="similar to DNA sequence:INSDC:YML007W,YDR423C"
                     /note="similar to Saccharomyces cerevisiae YAP1 (YML007W)
                     and CAD1 (YDR423C); ancestral locus Anc_5.528"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678935.1"
                     /db_xref="GeneID:11502707"
                     /db_xref="GOA:G8ZM80"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="InterPro:IPR013910"
                     /db_xref="InterPro:IPR023167"
                     /db_xref="UniProtKB/TrEMBL:G8ZM80"
                     /translation="MERALPPLISRTSTRSNTSSMSAMSASTVKRPLEQSSSPMAPAA
                     KGSKPGRKPLDEETKNKRTAQNRAAQRAFRERKEKKMKELEDKVQSLEQANRDTVVES
                     EFLRSQLLTLVNELKKYRPAKANDLQVLDYLAKHERTEPTDKEIEQSVQKKMDFTFAF
                     PWKDRKEAEAQAQHFPSPGSSMLSSSSASVNSAASPSNKRRSTASRSTSTSTSTTGWM
                     DNVFYSDDAQKLPQFAIKGDSTADPLFSNEFNFDDQFDEQVSQFCTKMNKACGTRECP
                     IPGFTPQMASPQVASPQILTNSWDTVASPAFGQQSLAPSKKQLTKTPPSQPELPFIDP
                     TMAFPTDDDEGLFFRTHRDENSLFAELLDEVEPTDNNFVNENLINEEPSTTTAVAEET
                     RPKPKTETDVVPSRDGKLLKCSEVWDRITTHPKYSAIDIDGLCGELMTKAKCSEKGVV
                     VQAEDVQRVLDKHMDV"
     gene            <705886..>707010
                     /gene="TDEL0A03930"
                     /locus_tag="TDEL_0A03930"
                     /db_xref="GeneID:11502921"
     mRNA            <705886..>707010
                     /gene="TDEL0A03930"
                     /locus_tag="TDEL_0A03930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678888.1"
                     /db_xref="GeneID:11502921"
     CDS             705886..707010
                     /gene="TDEL0A03930"
                     /locus_tag="TDEL_0A03930"
                     /inference="similar to DNA sequence:INSDC:YML008C"
                     /note="similar to Saccharomyces cerevisiae ERG6 (YML008C);
                     ancestral locus Anc_5.529"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678936.1"
                     /db_xref="GeneID:11502921"
                     /db_xref="GOA:G8ZM81"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013705"
                     /db_xref="InterPro:IPR025810"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZM81"
                     /translation="MSEVVELRQRQAQFTKELHGDDIGSKSGFAAFVSKNRSAQKEAV
                     EKYLKHWDGRTDKDAEERRLDDYNESTHSYYNVVTDFYEYGWGSSFHFSRFYKGENFF
                     AAMARHEHYLAYQADIQKGDLVLDVGCGVGGPAREISRFTGCNIIGLNNNDYQLAKAK
                     WYAKKYHLQDQLDFVKGDFMNMDFEPNTFDKVYAIEATCHAPSLEGVYSQIYKVLKPG
                     GTFAVYEWVMTKNYDESNPAHRKIAYEIELGDGIPKMFSVDVAQEALKSAGFEVTVAQ
                     DLADSDDEVPWYYPLTGEWKYVQNLSDIGTFFRTSYLGRKFTTAMVSLLEKVGAAPEG
                     STKVTNALEEAAVGLVAGGKEKLFTPMMLFVAKKPVDAKE"
     gene            <707319..>708962
                     /gene="TDEL0A03940"
                     /locus_tag="TDEL_0A03940"
                     /db_xref="GeneID:11502584"
     mRNA            <707319..>708962
                     /gene="TDEL0A03940"
                     /locus_tag="TDEL_0A03940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678889.1"
                     /db_xref="GeneID:11502584"
     CDS             707319..708962
                     /gene="TDEL0A03940"
                     /locus_tag="TDEL_0A03940"
                     /note="ancestral locus Anc_5.530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678937.1"
                     /db_xref="GeneID:11502584"
                     /db_xref="GOA:G8ZM82"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZM82"
                     /translation="MSKYDTKHIDHPVLRDIPTSLGELKHRFLTQPYREITILNPPEK
                     SNVVDEDTELAPVNERTGMDKYWAIVTTGAGLFSDGYINNSISTVSLCLSLIYGDQYT
                     NSRAIQNVSSIAFAGTVVGQLSFGYIADYYSRKAAMLIGTTMLILLSILCAGAWGVGT
                     TGTNAGGLFAAITAYRFFLGIAIGSEYSSSSPAAAEASNLLPAGKRNRYFCLFTNFMI
                     DFGFVISAFVPMVLLWICTPKHLTPVWRITIGLGALPPITLFYFRLKYKESAAFRKTK
                     FRKVMPYWRLIKFYWFRLAVVSIIWFLYDFSAYAFGTYSSIIINIVLGEDASLYKTFG
                     WNVVFNLFYIPGAFLGAFSADWFGPRNTLFVGLLLQAALGYIMAGCLEHLRQHIAGFV
                     VVYGIFMTLGEFSAGDNIGLLASKAFSVPVRGTLYGFAAAIGKVGAFVGSYVFPDIIK
                     NAGGYDTTTGLQAPYWVASSLCIFSALLGYFFLPDVDQEASMEEDVKFLEYLKSTGYD
                     ISQLGYDNETKIKLDISDSSPSSDGDMKLNTKDETFELH"
     gene            complement(<709114..>709515)
                     /gene="TDEL0A03950"
                     /locus_tag="TDEL_0A03950"
                     /db_xref="GeneID:11502642"
     mRNA            complement(join(<709114..709344,709397..709419,
                     709494..>709515))
                     /gene="TDEL0A03950"
                     /locus_tag="TDEL_0A03950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678890.1"
                     /db_xref="GeneID:11502642"
     CDS             complement(join(709114..709344,709397..709419,
                     709494..709515))
                     /gene="TDEL0A03950"
                     /locus_tag="TDEL_0A03950"
                     /inference="similar to DNA sequence:INSDC:YDR424C"
                     /note="similar to Saccharomyces cerevisiae DYN2 (YDR424C);
                     ancestral locus Anc_5.532"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678938.1"
                     /db_xref="GeneID:11502642"
                     /db_xref="GOA:G8ZM83"
                     /db_xref="InterPro:IPR001372"
                     /db_xref="InterPro:IPR019763"
                     /db_xref="UniProtKB/TrEMBL:G8ZM83"
                     /translation="MSQSSGNPVLKASDISDDMKEDVFAISLDAIEKCQLERDIAASI
                     KKHLDVKYGKTWHVIVGKNFGSYVTHEKGHFMYFYVGPLAFLVFKTA"
     gene            <709668..>711446
                     /gene="TDEL0A03960"
                     /locus_tag="TDEL_0A03960"
                     /db_xref="GeneID:11502929"
     mRNA            <709668..>711446
                     /gene="TDEL0A03960"
                     /locus_tag="TDEL_0A03960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678891.1"
                     /db_xref="GeneID:11502929"
     CDS             709668..711446
                     /gene="TDEL0A03960"
                     /locus_tag="TDEL_0A03960"
                     /inference="similar to DNA sequence:INSDC:YDR425W"
                     /note="similar to Saccharomyces cerevisiae SNX41
                     (YDR425W); ancestral locus Anc_5.533"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678939.1"
                     /db_xref="GeneID:11502929"
                     /db_xref="GOA:G8ZM84"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:G8ZM84"
                     /translation="MNIFGESDEEDNNPFSGTNHLYASGIAAVAEGEDDFIPKGAIVE
                     GEGERTSEIGEAPERDSSNDEEYDPGHIESVGGNTTGTTGQFEPYVSLSMSMANTAVP
                     EHDDDTIIQIVEAGDYKDPWGKHAIGYAIRYQGKEIIRRYSEFDTLRQALVKLLPTIV
                     IPPIPSKHPLIKYFLRPLSAETDSRIIEKRKRMLSSFLNNCYSIQEIRNHVVFTKFLD
                     PEYSWKDVLNSPPIVILPMNNLLAPPLNPTKPSPLHSLLPGQTSLSRLDPTAHNGSTT
                     ELETQYAQIEGRLRRYKNSLQPLQKILRQHRLHFHSLSSLFAELGAYYNAFSLQDNVI
                     GSESLAAQTKSLSDGIERIGHGFDVNYVSSEILVDKLLTILEEPSGEILQFLEDAKRV
                     IHFRKLKQLQYQIIEATIAKREARIKSLKETQNQMKRLEDALQQNALESPTIAEAMRH
                     LETTRSTDETSNGQMQETDQPSPTSTRPSHASFMKQAKRGRGKRRSRNGELEPHMLTE
                     EERQEEIQKLQKEVEKLNDCFRLTKKDMEDINRSSLHSLTALLEFIDQKWVMMLKSFP
                     KSVLSWLTECLKAWKNAKIAVNNIET"
     gene            <711688..>712878
                     /gene="TDEL0A03970"
                     /locus_tag="TDEL_0A03970"
                     /db_xref="GeneID:11503338"
     mRNA            <711688..>712878
                     /gene="TDEL0A03970"
                     /locus_tag="TDEL_0A03970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678892.1"
                     /db_xref="GeneID:11503338"
     CDS             711688..712878
                     /gene="TDEL0A03970"
                     /locus_tag="TDEL_0A03970"
                     /inference="similar to DNA sequence:INSDC:YDR427W"
                     /note="similar to Saccharomyces cerevisiae RPN9 (YDR427W);
                     ancestral locus Anc_5.534"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678940.1"
                     /db_xref="GeneID:11503338"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="UniProtKB/TrEMBL:G8ZM85"
                     /translation="MPTSHEIDTVLTTLRMEADPELAPLFLEFEQLYEPKLWHQLTQR
                     LKVLFEDPKSSSIRLRLYSNFVTKFYDKINQLSVVEFLLQSLKHHEDLDESLKLLTDL
                     QESFKQIDEKKQRNDGLKDHENGCLLIEIEVARIYLAKNELVKSRDLLDELEKTLDIR
                     DAVPLKVTNAFYSVNAEYYRLKKDFNSFYYTSLLYLSTIPPHEKQPEENADEYKELAY
                     NLSLAALLGDKIYNFGELLHHPIMRSITDDVDYNWLFELLSALTVGDFDKFERLVDIQ
                     IPKVPILHENECFLKQKICLMTLVESVFVKNIRTLSFDDIATATHMPKDNIEHLVMRA
                     ISLNLIKGSIDQVNELVSVTWVQPRIINNEQIDRMKDKLVEWRQEVSALGEKIDAHGK
                     SIWV"
     gene            complement(<712902..>713633)
                     /gene="TDEL0A03980"
                     /locus_tag="TDEL_0A03980"
                     /db_xref="GeneID:11502800"
     mRNA            complement(<712902..>713633)
                     /gene="TDEL0A03980"
                     /locus_tag="TDEL_0A03980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678893.1"
                     /db_xref="GeneID:11502800"
     CDS             complement(712902..713633)
                     /gene="TDEL0A03980"
                     /locus_tag="TDEL_0A03980"
                     /inference="similar to DNA sequence:INSDC:YDR428C"
                     /note="similar to Saccharomyces cerevisiae YDR428C;
                     ancestral locus Anc_5.535"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678941.1"
                     /db_xref="GeneID:11502800"
                     /db_xref="GOA:G8ZM86"
                     /db_xref="InterPro:IPR013094"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8ZM86"
                     /translation="MKESLYDRTEVFHRPEGTSNALVFIHGGAWIDKNNTANDFKELS
                     DLMIETGTVDYVLASIDYRLSPEVQHPVHLQDVVENLYRMIQELKLTSIQLLGHSVGA
                     TLAWQVSVSDENLFPSPDKLQLVKSKLVGVFLVDGIYSLTELLDEYPSYDYFVSQAYK
                     DFSRDFEEFDRSINRIPSNLKTIHLLHSYRDELLTLRQTNYMSSLLQKAAIPFTLCFN
                     DMGSHEEVYRNAKLANYLLSNVVFT"
     gene            complement(<713693..>714529)
                     /gene="TDEL0A03990"
                     /locus_tag="TDEL_0A03990"
                     /db_xref="GeneID:11503361"
     mRNA            complement(<713693..>714529)
                     /gene="TDEL0A03990"
                     /locus_tag="TDEL_0A03990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678894.1"
                     /db_xref="GeneID:11503361"
     CDS             complement(713693..714529)
                     /gene="TDEL0A03990"
                     /locus_tag="TDEL_0A03990"
                     /inference="similar to DNA sequence:INSDC:YDR429C"
                     /note="similar to Saccharomyces cerevisiae TIF35
                     (YDR429C); ancestral locus Anc_5.536"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678942.1"
                     /db_xref="GeneID:11503361"
                     /db_xref="GOA:G8ZM87"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR017334"
                     /db_xref="InterPro:IPR024675"
                     /db_xref="UniProtKB/TrEMBL:G8ZM87"
                     /translation="MSETLQPEVIENSDGSKTVITYRTENGQKYKVTQKVKEIKVTEK
                     VHKSVAARRQWKKYGEEKNAPPGPNHSTTQLGEEVQLRLSRNWRQLEQEETQKAKITS
                     DSVISCRLCGNAHYTMNCPFKSILNDIAALEDPGSAAAPGAEATEEAPVSSAAAAAAE
                     GGSRYVPPSRRAGAKDPSSDAYRDSRERDDMATLKITQLNENADENTLREELLFPFAP
                     IPKVVVVRNRETGRSRGLSFVTFASEEIAEQALHFLDGRGFMNLILRVEWSKPKVPET
                     NA"
     gene            <714764..>714976
                     /gene="TDEL0A04000"
                     /locus_tag="TDEL_0A04000"
                     /db_xref="GeneID:11503112"
     mRNA            <714764..>714976
                     /gene="TDEL0A04000"
                     /locus_tag="TDEL_0A04000"
                     /product="mitochondrial 54S ribosomal protein YmL39"
                     /transcript_id="XM_003678895.1"
                     /db_xref="GeneID:11503112"
     CDS             714764..714976
                     /gene="TDEL0A04000"
                     /locus_tag="TDEL_0A04000"
                     /inference="similar to DNA sequence:INSDC:YML009C"
                     /note="similar to Saccharomyces cerevisiae MRPL39
                     (YML009C); ancestral locus Anc_5.537"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL39"
                     /protein_id="XP_003678943.1"
                     /db_xref="GeneID:11503112"
                     /db_xref="GOA:G8ZM88"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:G8ZM88"
                     /translation="MAKAKSKSTIIKLISSAATGYSRHVTVNRGAPLVKQVRYDPVAE
                     RHVLFTEAKKRKIAERRPLDFLRTNK"
     gene            complement(<715077..>718076)
                     /gene="TDEL0A04010"
                     /locus_tag="TDEL_0A04010"
                     /db_xref="GeneID:11502682"
     mRNA            complement(<715077..>718076)
                     /gene="TDEL0A04010"
                     /locus_tag="TDEL_0A04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678896.1"
                     /db_xref="GeneID:11502682"
     CDS             complement(715077..718076)
                     /gene="TDEL0A04010"
                     /locus_tag="TDEL_0A04010"
                     /inference="similar to DNA sequence:INSDC:YML010W"
                     /note="similar to Saccharomyces cerevisiae SPT5 (YML010W);
                     ancestral locus Anc_5.538"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678944.1"
                     /db_xref="GeneID:11502682"
                     /db_xref="GOA:G8ZM89"
                     /db_xref="InterPro:IPR005100"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR017071"
                     /db_xref="InterPro:IPR022581"
                     /db_xref="InterPro:IPR024945"
                     /db_xref="UniProtKB/TrEMBL:G8ZM89"
                     /translation="MEEQPSMPDTEQESRPVAVEPIAQEERPSAAEENQNNGEVNNET
                     VSEEKADANAPSEEQGPSEDAQGDDKKRGREENEDEDGDEDDDDDEDDEDDEEEGGPS
                     KKRRQERNRFLDIEAEVSDDEDEDEDEEESELIREGFITRGDDDDESAEAHREDRLHR
                     QLDQDLNKSSEEDAQRLAKELRERYGRSSSKQYRAAAQDGYVPQRFLLPSVDTATIWG
                     VRCRPGKEKELVRKLLKKKFNLDRAMGNKKLKILSIFQRDNYTGRIYIEAPKQSVIEK
                     FCNGVPDIYVSQKLLIPVQELPLLLKPNKSDDVALEEGSYVRIKRGIYKGDLAVVDQI
                     SENNLEVMLKIVPRLDYGKFDDVDPSTNQRKARRPTFAHRAPAQLFNPTMALRLDQAN
                     LYKRDDHHFTYRNDDYVDGYLYKSFRIQHVETKNIQPTVEELARFGSKEGAVDLTSIS
                     QTIKKAQAARVTFQPGDRVEVLNGEQRGSKGIVIKTASDVATVKVPEFPTKPLEFLMS
                     SLRKVFEPGDHVTVVSGEHQGDAGLVLTVKHGQVTFMSNQTREEVTITANNLTKSIDS
                     TPTSSQFALHDIVELSAKNAACIIQAGHDIFKVIDDSGKVSTITKGSILNKINTARAR
                     VAAVDAGGNEIKIGDTVMEKVGARREGQVLYIQSQQIFVMSKKILENAGVFLVNPMNV
                     EAIASKDNMLSSKLDLNKINPDFVSKMGPPSQARLQQPQQQVRMGRDLALGKTVRIRS
                     AGYKGQLGIVKDVNGENATVELHSKNKHITIDKHRLTYYNREGGEGVTYDELVNRRGK
                     LPQARIGPSYVSAPRHMATGGNLGATNQPLAGGMTPGWSSFDGGKTPAVNSHGAGGGG
                     ASTWGSTSTWGGASAWGGQPAGGASSWGGASAWNGQGTGATSTWGGNSAWGNKSSWGG
                     ASTWASGGDTNGASSAWGGRGDKSAYGGTSTWGGNKNNGGGASSWGNNGNTQGHSSTW
                     GGNQENGNRSSWNEQSNNGSGSSWGSH"
     gene            <718270..>718791
                     /gene="TDEL0A04020"
                     /locus_tag="TDEL_0A04020"
                     /db_xref="GeneID:11503122"
     mRNA            <718270..>718791
                     /gene="TDEL0A04020"
                     /locus_tag="TDEL_0A04020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678897.1"
                     /db_xref="GeneID:11503122"
     CDS             718270..718791
                     /gene="TDEL0A04020"
                     /locus_tag="TDEL_0A04020"
                     /inference="similar to DNA sequence:INSDC:YML011C"
                     /note="similar to Saccharomyces cerevisiae RAD33
                     (YML011C); ancestral locus Anc_5.539"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678945.1"
                     /db_xref="GeneID:11503122"
                     /db_xref="InterPro:IPR014841"
                     /db_xref="UniProtKB/TrEMBL:G8ZM90"
                     /translation="MELNYKKVESFLKAPVPQDIEDEILGAYATYNLERDMRSEDLRN
                     YFESLQLPRELYKMVGKSDLTVEGTDVVDFERLLRCTYHLLVFMDNEQIIDEMWGLLV
                     QASGRDQSFPNVKLRDHVLSIKDLQKVSNFVGIDRASGIVEMISCATSGKRVYMTYLD
                     FAYVMGKLGYLRF"
     gene            complement(<718802..>719443)
                     /gene="TDEL0A04030"
                     /locus_tag="TDEL_0A04030"
                     /db_xref="GeneID:11502971"
     mRNA            complement(<718802..>719443)
                     /gene="TDEL0A04030"
                     /locus_tag="TDEL_0A04030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678898.1"
                     /db_xref="GeneID:11502971"
     CDS             complement(718802..719443)
                     /gene="TDEL0A04030"
                     /locus_tag="TDEL_0A04030"
                     /inference="similar to DNA sequence:INSDC:YML012W"
                     /note="similar to Saccharomyces cerevisiae ERV25
                     (YML012W); ancestral locus Anc_5.540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678946.1"
                     /db_xref="GeneID:11502971"
                     /db_xref="GOA:G8ZM91"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:G8ZM91"
                     /translation="MQVSYWKFFLVVFAVLSSTVSALHFDIAATTKPEPFCVRDFVSE
                     GQLVVIDITTSGSSNDGQTLNLYVRDSLGNEYRRKKDLVGEARIAFTAPSTTSFDVCL
                     ENIASYSGRSMSRAVELDIESGSQARDWNMISASEKLNSVEVELRRIEELADEIVDEL
                     TYLKNREERLRDTNESTNRRVRNFSILVILVLIGLGAWQINYLKNYFKSKHII"
     gene            complement(<719669..>722632)
                     /gene="TDEL0A04040"
                     /locus_tag="TDEL_0A04040"
                     /db_xref="GeneID:11502834"
     mRNA            complement(<719669..>722632)
                     /gene="TDEL0A04040"
                     /locus_tag="TDEL_0A04040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678899.1"
                     /db_xref="GeneID:11502834"
     CDS             complement(719669..722632)
                     /gene="TDEL0A04040"
                     /locus_tag="TDEL_0A04040"
                     /inference="similar to DNA sequence:INSDC:YDR430C"
                     /note="similar to Saccharomyces cerevisiae CYM1 (YDR430C);
                     ancestral locus Anc_5.541"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678947.1"
                     /db_xref="GeneID:11502834"
                     /db_xref="GOA:G8ZM92"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="InterPro:IPR013578"
                     /db_xref="UniProtKB/TrEMBL:G8ZM92"
                     /translation="MLRFKRYATTYAQRQVLRKYPVGASIHGYDIERVMPVPELKLTA
                     VHLIHGHTGAEHLHIDRDDRNNVFSIGFKTNPPDCTGVPHILEHTTLCGSYKYPVRDP
                     FFKMLNRSLANFMNAMTGPDYTFFPFSTTNKTDFANLRSVYLSSTLNPLLKPEDFYQE
                     GWRLEHMNVEDQNSDIVFKGVVYNEMKGQVSNANYYFWIKFQESIYPSLNNSGGDPQY
                     ITDLHYNELVDFHQTNYHPSNAKTFTYGDLPLEDTLKTLSKEFAGYGKRKSSKKALFP
                     IEMNQDVEVNVKGQVDPMLPSDKQLKTSMTWLCGSPQDMYESFLLKVLGSILMDGHSS
                     IVYQKLVESGIGLDLSVNAGVDSSTSVNFLTIGLQGVSDLSKFRETVNEIFKEVLAKP
                     FDRQKIEAIIQQLELSKKDHKSDFGLQLLYSVLPGWTNKVDPFDGLQFDETLQRFRED
                     LEGKGDALFKDLISKYIIDKPCFKYSMQGSEDFSTVLEEEEKTRLNKKLHQLNESDKD
                     VIYKRGLLLQEKQNSVEDLSCLPSLKISDIPRTGSNYKVNGQNTSTMSRITDTNGITY
                     IRAKRKLSEAIPLDLYPYLPLFADSLTSLGTSTQDYSEIEDAMKLHTGGISTHIDVSS
                     DPLTLEPHLYFRFDGWSLNSKTDHIFSIWKKLLVETDFRKHSEKLKVLIRSLASSNTS
                     AVAESGHTFARDYAAAHYSNSKAISESLNGVQQLQLITKLANSMDDEEAFQTNLVDKL
                     IELKERIIGSQDLQFFITTDSQPLADEVKSQISRFVQEMPQRTTKGGLDVSKFPLLPL
                     SETNTLIDFPFQVHYAGKSLPGVPYTHPDGAPLQVLANILTFKYLHREVREKGGAYGG
                     GAGYSALDGLFNFFSYRDPHPLQSLQTFDKSGSYVLNNARWGKGELDEAKMTIFQQVD
                     APISRKSEGVTHFYSGVTDEMRQKRREQLLDVSLSDVHRVTEKYLLDQTGANAVIGPV
                     IEGKTIPPKWQIKSL"
     gene            <722870..>724075
                     /gene="TDEL0A04050"
                     /locus_tag="TDEL_0A04050"
                     /db_xref="GeneID:11503085"
     mRNA            <722870..>724075
                     /gene="TDEL0A04050"
                     /locus_tag="TDEL_0A04050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678900.1"
                     /db_xref="GeneID:11503085"
     CDS             722870..724075
                     /gene="TDEL0A04050"
                     /locus_tag="TDEL_0A04050"
                     /inference="similar to DNA sequence:INSDC:YDR432W"
                     /note="similar to Saccharomyces cerevisiae NPL3 (YDR432W);
                     ancestral locus Anc_5.542"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678948.1"
                     /db_xref="GeneID:11503085"
                     /db_xref="GOA:G8ZM93"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8ZM93"
                     /translation="MSESYEQQPPAEEYPEAPVPTSSGDIDIEQQPPAEEEQKQPEEN
                     MPPPTHEGEDLEQRHRPHHEDHGMMEEHHHHHPGPQPYYPPPPQPEGELSTTRLFVRP
                     FPFDVQESELNEIFTPFGPMKEVKILNGFAFVEFEEADSASRAIEEVNGKTFANQPLE
                     VMFSKLPPKRYRIVLRNLPEGCSWQELKDLARENNLETTFSSVNTRDFDGTGALEFPT
                     DEVLEDALEKLNNIEFRGSVISVERDDNPPPIRRSNRGGFRGRGGFRGGFGGGFRGGF
                     GGPRGGSVAQEADSVAQEAALVAQEVALVAQEVASVAQEVALTVLEAVLVLQEVVTAP
                     QEVTMVVQEVALVVQEVALVAQEVATVVQEVIMVLQGATMVLQEIPTEPETLLHVKGL
                     QPDNKCNQE"
     gene            complement(<724580..>726394)
                     /gene="TDEL0A04060"
                     /locus_tag="TDEL_0A04060"
                     /db_xref="GeneID:11502928"
     mRNA            complement(<724580..>726394)
                     /gene="TDEL0A04060"
                     /locus_tag="TDEL_0A04060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678901.1"
                     /db_xref="GeneID:11502928"
     CDS             complement(724580..726394)
                     /gene="TDEL0A04060"
                     /locus_tag="TDEL_0A04060"
                     /inference="similar to DNA sequence:INSDC:YML013W"
                     /note="similar to Saccharomyces cerevisiae UBX2 (YML013W);
                     ancestral locus Anc_5.543"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678949.1"
                     /db_xref="GeneID:11502928"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8ZM94"
                     /translation="MPIIEHNGQVFHLSHEEREKLDEFRVITDFPQDDLPLIIRLLQN
                     YGWHLERALSFYFDGDWKSSIIAQELPAIPNRPPTPATFPPIPERSPFIASDAHLIPS
                     LRVVKPLPSNFREVFSVVGLNKNNGDVWNMNPQHSPLIIILMFIPRLLVKLGVSVLSL
                     LWGLITFGFNSHLDERTNVRKVPSRPKEKQPPFDQLISPLIDGQGLERLNKLMSTQSF
                     NEALKICQDEFKYLLIVFIGDVSDEEDPDVNSQRFISKVLSNPTVLSMLESYKDELII
                     YLGSVHELETWLVAQDLRIKYVPECLLVGNVLNSKGSVNGVTRLSVLSKLRISSAKKF
                     ENSLKVTIEKFQPELVVSRTEQAEILLAREIKKLQDDAYQNSLEQDRVKAEERKMKEE
                     EALLELNNKTQREKDKKIKETVKHLQWLRSCADFMKKEPATSGVGTVATLQIRTSKGL
                     RLVKEFSSTTSLHSLYVKIGCHLYLDTNSKDQEELSKIIADKLQSLAEDDSVLCFKDR
                     EVLKDELKAENLTKAIELELKKWKDEMSSDLEFDFELVSPFPREKIPVDKEMTVKEVT
                     QLWPKGSLLVEELVEDDEDDEDDDEDDEDEESMESGSE"
     gene            complement(<726553..>727371)
                     /gene="TDEL0A04070"
                     /locus_tag="TDEL_0A04070"
                     /db_xref="GeneID:11503237"
     mRNA            complement(<726553..>727371)
                     /gene="TDEL0A04070"
                     /locus_tag="TDEL_0A04070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678902.1"
                     /db_xref="GeneID:11503237"
     CDS             complement(726553..727371)
                     /gene="TDEL0A04070"
                     /locus_tag="TDEL_0A04070"
                     /inference="similar to DNA sequence:INSDC:YML014W"
                     /note="similar to Saccharomyces cerevisiae TRM9 (YML014W);
                     ancestral locus Anc_5.544"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678950.1"
                     /db_xref="GeneID:11503237"
                     /db_xref="GOA:G8ZM95"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZM95"
                     /translation="MAELKEEEYVHKVYNEIAGHFSETRYKPWPIVTKFLLGQAVGSI
                     GIDVGCGNGKYLNVNPNVFIIGSDRSSGLIQCANEIDPGHNVLVADGMQLPHRNNTFD
                     FAISIAVVHHWTTRERRIAAIGHILSKLKAGGEALIYCWALEQGNSRRGYCEGMEQDV
                     LVPWVLQAKTKKTQMEATKQAVEKPDLRKVPLKERCAYIANWRKQVEEKRLKDLQEIK
                     NRQQKDEKNQTKYRFYHLYREGELEEDCESAGGSLVSGGYEKDNWYVVVKKPEV"
     gene            <727818..>729380
                     /gene="TDEL0A04080"
                     /locus_tag="TDEL_0A04080"
                     /db_xref="GeneID:11502876"
     mRNA            <727818..>729380
                     /gene="TDEL0A04080"
                     /locus_tag="TDEL_0A04080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678903.1"
                     /db_xref="GeneID:11502876"
     CDS             727818..729380
                     /gene="TDEL0A04080"
                     /locus_tag="TDEL_0A04080"
                     /inference="similar to DNA sequence:INSDC:YDR434W"
                     /note="similar to Saccharomyces cerevisiae GPI17
                     (YDR434W); ancestral locus Anc_5.545"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678951.1"
                     /db_xref="GeneID:11502876"
                     /db_xref="GOA:G8ZM96"
                     /db_xref="InterPro:IPR019540"
                     /db_xref="UniProtKB/TrEMBL:G8ZM96"
                     /translation="MWDGNLRKYVGLCFLACYFLLGVPLWYKLTNIYRAPLPVEYIKS
                     LHENKFQDVHLVIPVYIKSDTYRFPDIHNAVQIQVNHLLNSKKQYVGWSLQVLAYESL
                     NATEIKYSDNEYHVVSLVLDDFVGYSVAYDAKETTVFYNDEAMVNNDIPFYVAQSLVE
                     HTFALEYNQLGSDLSTHGDSMVITYNPNMHLSISLLSGDGLPVAWEIESTLQRYFTPF
                     REFMAPLVNFTVDTNIVYFNDLNLHMLKDHDSVTSQELSHTVDLSELSSMNYLSDSGA
                     LNLAIVFPSNITTPSGFKFINSTSNSSRISDDWQSFIVPQWGNIIINRNPLPPNALLK
                     ESYLTPIMYQFATDVFQLLGLTKGSQDLSSPFVTIDSFKRLTILRNINKAEETLWSLV
                     KLTQSFQQMSIPQDVLKNATEALDLRLKIIDMLNDPNLGGDLVWNEALSLSNKLVKSS
                     ETAFFHGEMVQQNFFPQEHRIAVYLPLLGPTSVVIFFGFIKLLKEKPVEDTSEKQEKE
                     VIKQDGNDQLED"
     gene            <729571..>730575
                     /gene="TDEL0A04090"
                     /locus_tag="TDEL_0A04090"
                     /db_xref="GeneID:11503188"
     mRNA            <729571..>730575
                     /gene="TDEL0A04090"
                     /locus_tag="TDEL_0A04090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678904.1"
                     /db_xref="GeneID:11503188"
     CDS             729571..730575
                     /gene="TDEL0A04090"
                     /locus_tag="TDEL_0A04090"
                     /inference="similar to DNA sequence:INSDC:YML015C"
                     /note="similar to Saccharomyces cerevisiae TAF11
                     (YML015C); ancestral locus Anc_5.546"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678952.1"
                     /db_xref="GeneID:11503188"
                     /db_xref="GOA:G8ZM97"
                     /db_xref="InterPro:IPR006809"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G8ZM97"
                     /translation="MSENEGPLDLIPTVNYPPLLTNANYLSTKQMIDQVVSEDQEYVS
                     WKLKSMRTGGTMNSYMQDFLRKTKENNNLPMDSSAEDHSPSEDEINHVPRNICFPRDF
                     YEEALQKVPRPREISQDEQFKLLVTNLDEQQTNRFEVFHRTSLNKTQVKKIAGMVINQ
                     SVTENIRVFLQAIGKLYAGEIIELALDVRQKWLDGRMMIEFDRRKSVAKRLKKYLKKL
                     TKFVEGSNDDHEDSVDETESDLYFDDEEDQMVLVEQGNKLLKSEKNSPEIRLGLINQY
                     NKLVKEFNTIDVSVEKYANSPILPEHIREAWRLYQLQSDTLPAAQWRTQGEGNGWMFR
                     "
     gene            complement(<730582..>731568)
                     /gene="TDEL0A04100"
                     /locus_tag="TDEL_0A04100"
                     /db_xref="GeneID:11503170"
     mRNA            complement(<730582..>731568)
                     /gene="TDEL0A04100"
                     /locus_tag="TDEL_0A04100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678905.1"
                     /db_xref="GeneID:11503170"
     CDS             complement(730582..731568)
                     /gene="TDEL0A04100"
                     /locus_tag="TDEL_0A04100"
                     /inference="similar to DNA sequence:INSDC:YDR435C"
                     /note="similar to Saccharomyces cerevisiae PPM1 (YDR435C);
                     ancestral locus Anc_5.547"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678953.1"
                     /db_xref="GeneID:11503170"
                     /db_xref="GOA:G8ZM98"
                     /db_xref="InterPro:IPR007213"
                     /db_xref="InterPro:IPR016651"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZM98"
                     /translation="METVVQQTDYDALSCRMSAIAKGYLPSPSLQVDRCNYHQYKEFH
                     MEYLRALKSVSMRIYSIVNRVVKTSFPVMNYGTYLRTVSIDVALNDYLTSLGKDKKVQ
                     VINLGCGSDLRMIPLLQNFPTLTYIDVDYDSSISVKSKVLWNSEALKNLLDLQRDEST
                     GEVFAERYKLASSDLNRLEETMQRLHDLTEKDCTTIIITECLLCYMRQEESQKLIGSI
                     VSYYQSGTWIAYDPIGGSEPNDRFGRVMQANLRESRNLEMPTLMIYNSKEKYASRFPT
                     TDASVTDMWEIFSNRISADENKRLRSLQFLDEIEELKVMQKHYVLSTASWQK"
     gene            <732331..>734355
                     /gene="TDEL0A04110"
                     /locus_tag="TDEL_0A04110"
                     /db_xref="GeneID:11503171"
     mRNA            <732331..>734355
                     /gene="TDEL0A04110"
                     /locus_tag="TDEL_0A04110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678906.1"
                     /db_xref="GeneID:11503171"
     CDS             732331..734355
                     /gene="TDEL0A04110"
                     /locus_tag="TDEL_0A04110"
                     /inference="similar to DNA sequence:INSDC:YDR436W,YML016C"
                     /note="similar to Saccharomyces cerevisiae PPZ2 (YDR436W)
                     and PPZ1 (YML016C); ancestral locus Anc_5.548"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678954.1"
                     /db_xref="GeneID:11503171"
                     /db_xref="GOA:G8ZM99"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR011159"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8ZM99"
                     /translation="MGNSSSKSSRKGSSGKSSVDSAASTTHPFTRTDTSQSVKSTKSS
                     RSLRSRHSEKFSGNGNENANPEHSSTPPSRKDSGLKNHRSHEPSQETLDNDNNNFLQP
                     LTPNSERRLSSSKRSSFNTADLPPSMIQMEPKSPILKNSKYHSASILNYNENALTDDD
                     DEDRTNENVRTNSTTSGRNQLDILRNSSRPSSVRSSSSTKPRRRSDGEPGASPSQHLM
                     SRSNSHASSIHSRKSSGSAGTTAYSTPLNSPGVFGKNDEQDDDYFGAVSSNSSQRDTV
                     GAGTDPSHVSSSDGTTNGDHGHRADAKNFSQRESINEYPSVLPMDPELQDGLMDDKSS
                     SNDNIRQSISKKKRVVRPINIDETIQKLLDAGYAGKRTKNVCLKNSEIARICHMAREM
                     FLSQPSLLELSPPVKIVGDVHGQYADLLRLFTKCGFPPSANFLFLGDYVDRGKQSLET
                     ILLLLCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRCNIKTWKIFVDTFNTLPL
                     AAIVAGKFFCVHGGLSPVLNSMDEIRHVSRPTDVPDFGLINDLLWSDPTDSPNEWEDN
                     ERGVSYCYNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSLVTVFSAPNYCGEFD
                     NWGAVMSVSEGLLCSFELLDPLDGAALKQVMKKGRQERKLANQQHMQVPQ"
     gene            <734602..>735027
                     /gene="TDEL0A04120"
                     /locus_tag="TDEL_0A04120"
                     /db_xref="GeneID:11502675"
     mRNA            <734602..>735027
                     /gene="TDEL0A04120"
                     /locus_tag="TDEL_0A04120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678907.1"
                     /db_xref="GeneID:11502675"
     CDS             734602..735027
                     /gene="TDEL0A04120"
                     /locus_tag="TDEL_0A04120"
                     /inference="similar to DNA sequence:INSDC:YDR437W"
                     /note="similar to Saccharomyces cerevisiae GPI19
                     (YDR437W); ancestral locus Anc_5.549"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678955.1"
                     /db_xref="GeneID:11502675"
                     /db_xref="InterPro:IPR013717"
                     /db_xref="UniProtKB/TrEMBL:G8ZMA0"
                     /translation="MDKDYDKEYEWFSYYISVTSVLILIVIWSVLPEDTEAGSLHRGV
                     FKVILDVLPQRNWIIYSQCLVLMGMLYTYFGILMYNEDVLMAPLDDLRTITDSRGEVV
                     ICGSDSKMLKAYAFKESSGIIDLPIMDVCEILYSTDTVS"
     gene            complement(<735166..>736587)
                     /gene="TDEL0A04130"
                     /locus_tag="TDEL_0A04130"
                     /db_xref="GeneID:11502823"
     mRNA            complement(<735166..>736587)
                     /gene="TDEL0A04130"
                     /locus_tag="TDEL_0A04130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678908.1"
                     /db_xref="GeneID:11502823"
     CDS             complement(735166..736587)
                     /gene="TDEL0A04130"
                     /locus_tag="TDEL_0A04130"
                     /inference="similar to DNA sequence:INSDC:YML017W"
                     /note="similar to Saccharomyces cerevisiae PSP2 (YML017W);
                     ancestral locus Anc_5.550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678956.1"
                     /db_xref="GeneID:11502823"
                     /db_xref="UniProtKB/TrEMBL:G8ZMA1"
                     /translation="MSLEEFLGDDSLGESVWNEDDINLDAISNTTSLDLLKSKSQKHD
                     SDSHHPFGYQQHSFHGNDHPSFASKGPPYIVKFSQLPPRFSDADINELFHEKYTKFIK
                     FKLFWELNKNPSIATLKEGSIFDQNFKRTGKVGFVELYSGRDMDKVLKYWTTPLATIH
                     NIKLEPAEFEDFKEYRLKGELLKDSKDDAGRPYIAPRHKSNPFGSAKPVDTQSKILDI
                     EEKVGKLHIEDTRILRRLSGGDPGPVLQPGKVTLLKKTPEEQEKKKPLSYLDVVKKSA
                     EDGKKPSASSSANATPSPNMKRASLDAEVVANSAINVLAENNDEIKVADENGRAFQFK
                     NSERDHDAVGYQSYDRPPRGGRGGGYGRGQPSGYRGGRGGRGGRGGRGGPRHQYRDQN
                     ENENYRKSNRQNNSPQDLRNNQGHNNSAGNNFQEEKRYSMFKPASGFLHESGNESSNY
                     KHNYRGNSNNHRGHNNRGRFTPA"
     gene            <737337..>738485
                     /gene="TDEL0A04140"
                     /locus_tag="TDEL_0A04140"
                     /db_xref="GeneID:11502793"
     mRNA            <737337..>738485
                     /gene="TDEL0A04140"
                     /locus_tag="TDEL_0A04140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678909.1"
                     /db_xref="GeneID:11502793"
     CDS             737337..738485
                     /gene="TDEL0A04140"
                     /locus_tag="TDEL_0A04140"
                     /inference="similar to DNA sequence:INSDC:YDR438W,YML018C"
                     /note="similar to Saccharomyces cerevisiae THI74 (YDR438W)
                     and YML018C; ancestral locus Anc_5.551"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678957.1"
                     /db_xref="GeneID:11502793"
                     /db_xref="GOA:G8ZMA2"
                     /db_xref="InterPro:IPR009262"
                     /db_xref="UniProtKB/TrEMBL:G8ZMA2"
                     /translation="MISRFSKRWTLGLMMLALVIVLWVLSSFMINLIFEDGSYRKPFF
                     ITYINTAAFTFYLLPTSKAILKNYWRTGQWNIHDQLRIQEEGSGSGEVGSPLIPKSDS
                     SDDGERLSLYETIKLSAEFCILWFSANFVTNASLSYTSVASQTILSSTSSFFTLFVGA
                     LCRVEKISKVKVIGSMVSFFGILLVTRSDSKPTHIKPLPGSRDILDQNNDAFKTLIGN
                     ILALLGALLYGVYSTLLKRKVKDESRVNMKVFFGFVGLFTLIFLWPSMILLHYMGWET
                     FELPSTSRVIAIVVANCLITFVSDFCWANAMLLTSPLTVTVGLSVTIPFAMFGDFILK
                     HKPMTLLYLLGAILILGSFFIINKSSEEENLENLIEDADRDINDRITA"
     gene            complement(<738542..>739519)
                     /gene="TDEL0A04150"
                     /locus_tag="TDEL_0A04150"
                     /db_xref="GeneID:11502696"
     mRNA            complement(<738542..>739519)
                     /gene="TDEL0A04150"
                     /locus_tag="TDEL_0A04150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678910.1"
                     /db_xref="GeneID:11502696"
     CDS             complement(738542..739519)
                     /gene="TDEL0A04150"
                     /locus_tag="TDEL_0A04150"
                     /inference="similar to DNA sequence:INSDC:YML019W"
                     /note="similar to Saccharomyces cerevisiae OST6 (YML019W);
                     ancestral locus Anc_5.552"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678958.1"
                     /db_xref="GeneID:11502696"
                     /db_xref="InterPro:IPR006844"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR021149"
                     /db_xref="UniProtKB/TrEMBL:G8ZMA3"
                     /translation="MQFNQLLFFWYFVVFQRSVYALLDNAKSILPLQDSNGIIRVTDA
                     NYDELKSGVFDYYNILFITTTKSNKQGLVCETCNKFEPIYRKVSLATHQQAPGAKVLF
                     FQADVSENRKLVKEIGLTTIPHVLVFPPPQLGDEFKWSKSEFYQYELNSNSVKTPLHF
                     GDFLAKILKVYIGISEDFEYKEFAIYFAICVIVFSILKRKVLPMIPNKSKFFCGLFSL
                     GIIMLSITGFKFTQMNGIPFIARDSKGQIMYFSGGMSWQFGIEIFTVSMMYIGMGLAT
                     LTLIYIVKTGTETRLKNGAMIAISCLVYYTFSYFLSCFKIKNPEYPYTI"
     gene            <739671..>740441
                     /gene="TDEL0A04160"
                     /locus_tag="TDEL_0A04160"
                     /db_xref="GeneID:11503001"
     mRNA            <739671..>740441
                     /gene="TDEL0A04160"
                     /locus_tag="TDEL_0A04160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678911.1"
                     /db_xref="GeneID:11503001"
     CDS             739671..740441
                     /gene="TDEL0A04160"
                     /locus_tag="TDEL_0A04160"
                     /inference="similar to DNA sequence:INSDC:YDR439W"
                     /note="similar to Saccharomyces cerevisiae LRS4 (YDR439W);
                     ancestral locus Anc_5.553"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678959.1"
                     /db_xref="GeneID:11503001"
                     /db_xref="InterPro:IPR018479"
                     /db_xref="UniProtKB/TrEMBL:G8ZMA4"
                     /translation="MSTLLQLLANYYKNVIESQRIYHENVQIYASPLEESGSTGSGSS
                     SRVAEEMFLLQRQVSHLTAEIQSLSRENDKLRGLQATHKALMESKLNNSKKIIDKLKR
                     EQRDYRAAPDRESDSTPPPPELSKKGQAPFHLLSPLNVRKIDGAKHDHITAASSKPTG
                     LRQVLTGGHQTLFDGDQTIENLSADRTDDVLFINSIKHKDKLGSVVLPTEALSEDEDS
                     QVKATSKPTLAVTNGKGVTKKRKLARKRIQTVDSDKED"
     gene            complement(<740520..>742415)
                     /gene="TDEL0A04170"
                     /locus_tag="TDEL_0A04170"
                     /db_xref="GeneID:11503070"
     mRNA            complement(<740520..>742415)
                     /gene="TDEL0A04170"
                     /locus_tag="TDEL_0A04170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678912.1"
                     /db_xref="GeneID:11503070"
     CDS             complement(740520..742415)
                     /gene="TDEL0A04170"
                     /locus_tag="TDEL_0A04170"
                     /inference="similar to DNA sequence:INSDC:YML020W"
                     /note="similar to Saccharomyces cerevisiae YML020W;
                     ancestral locus Anc_5.554"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678960.1"
                     /db_xref="GeneID:11503070"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8ZMA5"
                     /translation="MVSSPPSSRASTKSLKVDVKSETNLSSLREGGTVGHKPSRTWSV
                     WSKDSDDTRITAAAGNSKAKTQEDKQAAVSRNVESAAIEGSSSRPNKNIETEATPSSQ
                     VQDSEERTSAHGQEANNESKNSSWFFWGRRSNANEQVVENGNEERVVSSSASTNVMSN
                     KIIPHSTSDAVLLKNKKDTEIAEEASSQLLSEQNPNIVVPSFDILPRQSTWASLGFTI
                     GKIARSWHILSDGNVRQRCLYQRGPEETLHKISNGGQKPIRVLIVGVHGFFPTKMIRP
                     FIGEPTGTSMKFVSEAEQVVLKYFQKHKRRIEISKIALEREGEVMDRVNFFFDVMKNW
                     TKELNQADFIYFVAHSQGSPVTMLLLGQLIDNGIIKLENTSFFNAEDVPVSSNKKVIS
                     ILAMAGINNGPFYGADQTLFVRAYQTIERESLRELFQFQKFDSNLSKQLLRSIRIIIG
                     SGIKITFVGSINDQLVPLYSSTCLFVNHPNIFRATFIDRGSRTPAFITRLLNIAGSLL
                     DLGYDDHGIIKEISSSLAGTLTGGGHSTVYNEAQVYELGIRFALETTDLQADVPVEFK
                     PFKLEQLSSNPYHLPWCMRGLLYETNAHLEPAEVPCLFSEFEEWEPETKQLKDVKYRL
                     NGLKSKL"
     gene            <742669..>743712
                     /gene="TDEL0A04180"
                     /locus_tag="TDEL_0A04180"
                     /db_xref="GeneID:11502993"
     mRNA            <742669..>743712
                     /gene="TDEL0A04180"
                     /locus_tag="TDEL_0A04180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678913.1"
                     /db_xref="GeneID:11502993"
     CDS             742669..743712
                     /gene="TDEL0A04180"
                     /locus_tag="TDEL_0A04180"
                     /inference="similar to DNA sequence:INSDC:YML021C"
                     /note="similar to Saccharomyces cerevisiae UNG1 (YML021C);
                     ancestral locus Anc_5.555"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678961.1"
                     /db_xref="GeneID:11502993"
                     /db_xref="GOA:G8ZMA6"
                     /db_xref="InterPro:IPR002043"
                     /db_xref="InterPro:IPR005122"
                     /db_xref="InterPro:IPR018085"
                     /db_xref="UniProtKB/TrEMBL:G8ZMA6"
                     /translation="MTVETKRKQSTIEEFFGKSSKKIKVAKESLAAKARTDASVKLDE
                     DLKTTKETVANEIEDTDVADVKEKFKKSLSGYLQTLLAMEIDTIDPSWFVHLKEEFKK
                     PYFVKLKQFVTKEQQEYTVFPPARDVYSWSRLTPFDKVRVVIIGQDPYHNYNQAHGMA
                     FSVRAPTPAPPSLKNIYKELKQNYSDFQIDNQNGDLTPWALQGVLLLNTALTVRAHNA
                     NSHSKKGWEVFTKKVVESLIKESEKDGRSLVFLLWGNNATKLVDSLLNASSLPHKKNL
                     KVFKSVHPSPLSASRGFFGNTHFKLINDWLHNERGEKMIDWSVVPGSQLTEVAQANQI
                     LEGEKRPSKEVDL"
     gene            <743879..>745591
                     /gene="TDEL0A04190"
                     /locus_tag="TDEL_0A04190"
                     /db_xref="GeneID:11503055"
     mRNA            <743879..>745591
                     /gene="TDEL0A04190"
                     /locus_tag="TDEL_0A04190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678914.1"
                     /db_xref="GeneID:11503055"
     CDS             743879..745591
                     /gene="TDEL0A04190"
                     /locus_tag="TDEL_0A04190"
                     /inference="similar to DNA sequence:INSDC:YDR440W"
                     /note="similar to Saccharomyces cerevisiae DOT1 (YDR440W);
                     ancestral locus Anc_5.556"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678962.1"
                     /db_xref="GeneID:11503055"
                     /db_xref="GOA:G8ZMA7"
                     /db_xref="InterPro:IPR013110"
                     /db_xref="InterPro:IPR021162"
                     /db_xref="InterPro:IPR025789"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZMA7"
                     /translation="MSVTQKDISGEESSTLYSSPKTTQSDGYSADVAESRLQDTNNGV
                     QQQLKGTRKGRSRALQGLLEEACKYHSQYEYTLPRGFLRNRSQPGKSSQELEEDESID
                     EKVARPKSTRKRSESVKRNSPSAAGRRKQRSTRSKSTSPSSDSPVPTKIQNENAFEAA
                     GNNGVRHISKNQEVTFVKQDQELFNIPYDMIDIEYLEQNETYKDHPLPSAFLTAKRHQ
                     NDISVLTVALKSPLFSNYSEEYHIDFSKDSRIYNPMSELGKLIEYSAIIFLPAAYADT
                     VKKTIIPGLNKAFDTSNDEEFAEVINNYNKILKQVPRGEVIKHLAQRKNVPRSFFHDF
                     LHIVYTRSIHPNFRKLKEYEAFSNYVYGELLPSFLSEVYSQCGMNSESVFMDLGSGVG
                     NCVVQAALEYGCKLSFGCEIMPNASALTELQHEELVKRCNLFGLKLHPVEFSLRRSFV
                     DNRRVDELVPQCDIILVNNFLFDNTMNQKVEGILQKVKTGCKIITLKNLRPFGYTINF
                     ENVDSILNRLHVERFELKENSVSWTHRGGEYFISTVLPDMDESLFDPSMRKRNIKRPA
                     HYTR"
     gene            complement(<745644..>746213)
                     /gene="TDEL0A04200"
                     /locus_tag="TDEL_0A04200"
                     /db_xref="GeneID:11502996"
     mRNA            complement(<745644..>746213)
                     /gene="TDEL0A04200"
                     /locus_tag="TDEL_0A04200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678915.1"
                     /db_xref="GeneID:11502996"
     CDS             complement(745644..746213)
                     /gene="TDEL0A04200"
                     /locus_tag="TDEL_0A04200"
                     /inference="similar to DNA sequence:INSDC:YDR441C,YML022W"
                     /note="similar to Saccharomyces cerevisiae APT2 (YDR441C)
                     and APT1 (YML022W); ancestral locus Anc_5.557"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678963.1"
                     /db_xref="GeneID:11502996"
                     /db_xref="GOA:G8ZMA8"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR005764"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:G8ZMA8"
                     /translation="MSVEAYAQELKAALHQYPNFPEKGILFEDFLPIFRCPKLFQKLV
                     DAFKIHLEETFSTGKIDYIVGLESRGFLFGPSLALAMGIGFVPVRKAGKLPGELVSAV
                     YQKEYGTDVCEMQKEAIPANSNIVIVDDIIATGGSAAAAGDLVKQVGGNILEYCFVME
                     LDFLKGAEKLSAPCFTLLNAQQEALKEAN"
     gene            <746395..>748053
                     /gene="TDEL0A04210"
                     /locus_tag="TDEL_0A04210"
                     /db_xref="GeneID:11503041"
     mRNA            <746395..>748053
                     /gene="TDEL0A04210"
                     /locus_tag="TDEL_0A04210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678916.1"
                     /db_xref="GeneID:11503041"
     CDS             746395..748053
                     /gene="TDEL0A04210"
                     /locus_tag="TDEL_0A04210"
                     /inference="similar to DNA sequence:INSDC:YML023C"
                     /note="similar to Saccharomyces cerevisiae NSE5 (YML023C);
                     ancestral locus Anc_5.558"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678964.1"
                     /db_xref="GeneID:11503041"
                     /db_xref="InterPro:IPR014803"
                     /db_xref="UniProtKB/TrEMBL:G8ZMA9"
                     /translation="MAPGIANHTSIGENDDERLPYYVDVSDDTLFTFEVLNSMCMLDN
                     YDHLLFTLECQSVDEEKFAIPPFDVLLVLMTLTTVSDHYKEPILRQNDPYNTSRGKLS
                     RRAFKILRFYVKMLQKYDLNGGQRPDIELLRCQFFLIIDSLSSNARWARPHRRKRRKT
                     ENGVIYNFDVAEAEDSELGNIIANPYPYVSCLEQKKSILGNDLLSIKLKQPGSFINMI
                     LWTLSNSLQEDNVLYIDNHEVWMPLLELIVDLFVLRHDFFIKHELKSAIDDYHMVQLL
                     SESPLANFLHLIDSSQSGISFCQCIFLSCDYKFDDLDVSIELHPVYYGENTLSKTYIP
                     RTSFSKVYKLKRSMSLRRKIIGTYCKLLTEVPTGHQLIKPKPSADELIKNLSYSLAKF
                     NDIDEFEAFFLTGDLTVASYFVPLIAEDTLCHLFSNFKKSIERLDIKHVALTLVENLD
                     NIGAFLYECTCFFDKGFFVPPERQIKSIELVEINKADICMLALFQYIKFLEGGEVIKS
                     NSKFHDFINAVNGNDRRRKRILSRNAPDSNLPPLMPLLLKLLKS"
     gene            complement(<748109..>752113)
                     /gene="TDEL0A04220"
                     /locus_tag="TDEL_0A04220"
                     /db_xref="GeneID:11503054"
     mRNA            complement(<748109..>752113)
                     /gene="TDEL0A04220"
                     /locus_tag="TDEL_0A04220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678917.1"
                     /db_xref="GeneID:11503054"
     CDS             complement(748109..752113)
                     /gene="TDEL0A04220"
                     /locus_tag="TDEL_0A04220"
                     /inference="similar to DNA sequence:INSDC:YDR443C"
                     /note="similar to Saccharomyces cerevisiae SSN2 (YDR443C);
                     ancestral locus Anc_5.559"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678965.1"
                     /db_xref="GeneID:11503054"
                     /db_xref="GOA:G8ZMB0"
                     /db_xref="InterPro:IPR009401"
                     /db_xref="UniProtKB/TrEMBL:G8ZMB0"
                     /translation="MSNDCSMYRLEDLLSSFYKIESIEKINYHQYVPKKQDDQWSIQM
                     ELYLRKQSSRNLVALLSRELWCFSINDDPVPTPPKLSATGDDVTTLDKSGQFTAHYSK
                     PNLPPHYALFLKALRRMLYINLTAKACNKLVPFGNACISLEGMKQSQILQLEPHLFEN
                     GDLAITISTKNLQLLPLTVENINESFLRRHALYLAPSGIRMYLSSSDKQCLVNPPKNA
                     EILLKTLFISHGIELPDKNEVQWVKVIPNLNHLNGYTPNIAAYMDPPLDTRTITWPLS
                     LCFAQTALDAKDQSDGDLSCHDLHEAFDVIDDFNQLKQTSAYRTPSSSGGALGNSLGT
                     NPLSSGGGYTEQFQHFYKNPAWSSQSANDNVAPKISPRVSSPSYSTFDKALPGSSETF
                     AGVAGLTTPSINENEFSDRRGLTNGFELTPVKSDVTLNLKRCLNDREPIPKTVSPSQP
                     SDGMIEDGACSDSVVDKELFGEEEEEEDDNLFGESSQSSANPGESKSFTPGKAGTDEI
                     TEDMFGMSDDEDGSRSTTSKSGAFFLENEAELRIQPSKRSSMKRKYLDIPMEEMTLSN
                     SPLYMDPGAPLPVETPKDRRKSVFAPLNFNPIIENNVDNKYKNGGKFSFSPSQHEESL
                     KFDVSTADISSSEDESESSVDFDDLNIKPEAISSENNLRDAQYNLYSSIQAPLDSVPP
                     NVNKVDLLPSNIPGTGELIKETSNGIWKINNQEMGQSDPLITSGGGSIPSAQAKNDRY
                     SFLSRGYLTGGTNSSNLPESDSGVPETTPANVSLLPESSSSLPFLLRHMPLSSMPSVF
                     SCSNPTVTITKNDQYILAILAEQVVFDYNIFNGFGKPQILNSGLKDCQKGLIAETIRE
                     LFSSFSRVHGNELISSLSTIKEPSIYVKKHHSMMNMSADSQVFSKFLNVKPAKGIKNF
                     RFLMLTTSYAEDCLSFVSTLCQTYIGYEFGFCELLKLTSDDSQGLMQLPDFDKSRLLL
                     LAAQIVTYCSTNKNAGKDVPVMILLPIECYKLEELTSKVAKFEIIHNEVTSKIPNAQI
                     YLKVVLMDFIRSPLTSVDDYNNLCVSVYNILPPKTVKFTSIAHKLPEKVTFRTLQQSA
                     GTAAIGYDTYIHLAYARSVDKEWVFAAFSDSSGNESLIKQWYVGTSKTRFDEACNEIW
                     GLALHLSAKKFGKICLILTRLNGVLPDDELMNWRRLSGKAIHLAVVCVDDDTKISFFD
                     EDKMYPTFKPLYENQELTRKVDPRRLDDYEIRDIAQDVHGVIFESCFPLTNSQHRCAI
                     KSGALMKFKRSAGDSIVDKFEVNLLNCPHSDSTKLLETILREFRNLGALSSWFGVSNG
                     ENAHIPWHVLAVKK"
     gene            complement(<752422..>752907)
                     /gene="TDEL0A04230"
                     /locus_tag="TDEL_0A04230"
                     /db_xref="GeneID:11503013"
     mRNA            complement(<752422..>752907)
                     /gene="TDEL0A04230"
                     /locus_tag="TDEL_0A04230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678918.1"
                     /db_xref="GeneID:11503013"
     CDS             complement(752422..752907)
                     /gene="TDEL0A04230"
                     /locus_tag="TDEL_0A04230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678966.1"
                     /db_xref="GeneID:11503013"
                     /db_xref="GOA:G8ZMB1"
                     /db_xref="InterPro:IPR000889"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029759"
                     /db_xref="InterPro:IPR029760"
                     /db_xref="UniProtKB/TrEMBL:G8ZMB1"
                     /translation="MSEFYKLSPKDKKGEPFPFSQLEGKVVLIVNVASKCGFTPQYEE
                     LEALYKKYKDQGLVVLGFPCNQFGSQEPGSDEEIGQFCQLNYGVSFPVLKKVDVNGGN
                     ADPVYEYLKSQKSGLLGFRGIKWNFEKFLVDKKGVVQQRYSSLTKPSSLDSAIADLLK
                     A"
     gene            <753303..>755636
                     /gene="TDEL0A04240"
                     /locus_tag="TDEL_0A04240"
                     /db_xref="GeneID:11503096"
     mRNA            <753303..>755636
                     /gene="TDEL0A04240"
                     /locus_tag="TDEL_0A04240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678919.1"
                     /db_xref="GeneID:11503096"
     CDS             753303..755636
                     /gene="TDEL0A04240"
                     /locus_tag="TDEL_0A04240"
                     /inference="similar to DNA sequence:INSDC:YDR444W"
                     /note="similar to Saccharomyces cerevisiae YDR444W;
                     ancestral locus Anc_5.560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678967.1"
                     /db_xref="GeneID:11503096"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8ZMB2"
                     /translation="MRPWEKRRSDDGLLLFDDTQSLGIGDLYRYKITVDKSKLEEEGI
                     STDVLFVRVKNKESALLRPVYLTGPYACYVDVRPHNYDENKKFEGDEKIQFTSDLRPD
                     EHFKAKLYLNENSRREDGLYSWTVDVLSQVSVTSLPKVEYGIRIGTTKAASKHVPDVS
                     PVKGFEIDVKDTDTLWNLPPKFPTKPVHLVIVTHGIFSNIGCDMLYIKDKIEEKTFPM
                     DESINPNIVVRGCMDNMGKSARGVRYLGSRVGKFVISTVDLLNQIYKVDKISFIGHSL
                     GGPTQAMALHYIAVKRPDIFDAQTGVKPINFIALASPFLGVVGDFPRYVSLALDVGAL
                     GVTGRDLTLRHTPVFFRNGLGGSRGPSRLHKLILEALPQSPALAVLERLVHRTLYANV
                     LHDGIVPLRTAALLYLDWKSLAKVHEIRKQKAKALNDGDAALKKIPKPPASYTSSSSD
                     QSSDTNTTKLNHNFPNGFSSAQDLAESGRASTPNDDTEITIGSSFSADDEKVDSRVEN
                     GNGIAQANSVEHDNGSKEKVDRHGNVQADGVEHGIENGKNNSEEKVDRHGNVQADGVE
                     NGKNGSNEEVDKHGSDNKASIGEIPVESMDKKAALQWLMPQGLSKGNRHAKYFRTQTM
                     EMGTGSAEVHGRHKEEKQFVPPPNASTVMAAISVITAPIPTQEYIKDPSIRTDAIVHD
                     KIYHPSELPPPHYTNRPFIKKVIYPNESNNRHQERIARMWQETMTWRKVLVDLKPDSH
                     NNINVRRRFTNLFGNVAIADMVETHFGEEACQKYAVF"
     gene            complement(755785..755857)
                     /gene="TDEL0Atrna6K"
                     /locus_tag="TDEL_0Atrna6K"
                     /db_xref="GeneID:11503101"
     tRNA            complement(755785..755857)
                     /gene="TDEL0Atrna6K"
                     /locus_tag="TDEL_0Atrna6K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:11503101"
     gene            <756579..>758300
                     /gene="TDEL0A04250"
                     /locus_tag="TDEL_0A04250"
                     /db_xref="GeneID:11502690"
     mRNA            <756579..>758300
                     /gene="TDEL0A04250"
                     /locus_tag="TDEL_0A04250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678920.1"
                     /db_xref="GeneID:11502690"
     CDS             756579..758300
                     /gene="TDEL0A04250"
                     /locus_tag="TDEL_0A04250"
                     /inference="similar to DNA sequence:INSDC:YBR298C"
                     /note="similar to Saccharomyces cerevisiae MAL31
                     (YBR298C)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678968.1"
                     /db_xref="GeneID:11502690"
                     /db_xref="GOA:G8ZMB3"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZMB3"
                     /translation="MMSQDTITRSSTSVPVSREKIMEPLYASSCASTPPDKVTSNEPE
                     YSSALNPVGGIPEKPLKEYITVMFMCLMIAFGGFVFGWDTGTISGFVNHTDFIVRFGQ
                     FDPARQSFYLSDVRIGLIVSIFNIGCALGGLTLSHLGDIYGRRIGLMVVVLVYVVGII
                     IQISSTDLWYQYFIGRIVSGLGVGAIAVLSPALISEISPKHLRGTCVSFYQLMITLGI
                     FLGYCTNYGTKRYTNSIQWRLPLGLCFACAIFMIVGMLLVPESPRYLVEKERLDEARI
                     SLAKSNKLPVDDPGVAFELELITAGVEAERLAGNATWSELFSRKGKILQRVVMGVMIQ
                     SLQQLTGNNYFFYYGTTIFNAVGLEDSFQTSIILGLVNFLSTFVSLWVVDRFGRRKCL
                     LWGSASMAACFVVFASVGVTSLWPNGRDQPSSKGAGNAMIVFTCFFIFCFATTWAPIA
                     YVIVAESYPLRVKNRAMAIAVGSNWIWGFVIAFFTPFITSAINFYYGYVFMGCLVFSF
                     FYVFFCVCETKGLTLEEVNEMYEEGVLPWKSVNWVPRKMRVLEDNVEVVHIDGVSFLP
                     SASPKLY"
     gene            <758507..>759331
                     /gene="TDEL0A04260"
                     /locus_tag="TDEL_0A04260"
                     /db_xref="GeneID:11503314"
     mRNA            <758507..>759331
                     /gene="TDEL0A04260"
                     /locus_tag="TDEL_0A04260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678921.1"
                     /db_xref="GeneID:11503314"
     CDS             758507..759331
                     /gene="TDEL0A04260"
                     /locus_tag="TDEL_0A04260"
                     /inference="similar to DNA sequence:INSDC:YDR446W"
                     /note="similar to Saccharomyces cerevisiae ECM11
                     (YDR446W); ancestral locus Anc_5.561"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678969.1"
                     /db_xref="GeneID:11503314"
                     /db_xref="InterPro:IPR029178"
                     /db_xref="UniProtKB/TrEMBL:G8ZMB4"
                     /translation="MTSIKSEPHSDTPLTFSNVQNDLGVQSRDLDGKAANATSDSRPA
                     LGSKKVNVAIGKKEPSKELKKHIFEEFLLSPGRVGTATASSYSSKDKPLVKQEPEYSK
                     GLIHEGTETPIKRQTNVVEAANSSKKKKLNTAEKFKKVIPANDIMDTTRQQFENPGLY
                     SPIRKLLYESNKDYGKTSDQHLFRDLEHESERNFCQEASRWPMVEWIEHGQVLLKEHT
                     NLIGQLVQQRIELSHKFQAITTIINERAEALNNQGEILDEKMIKIENLGKEILDII"
     gene            complement(<759433..>760033)
                     /gene="TDEL0A04270"
                     /locus_tag="TDEL_0A04270"
                     /db_xref="GeneID:11503269"
     mRNA            complement(join(<759433..759840,760031..>760033))
                     /gene="TDEL0A04270"
                     /locus_tag="TDEL_0A04270"
                     /product="40S ribosomal protein S17"
                     /transcript_id="XM_003678922.1"
                     /db_xref="GeneID:11503269"
     CDS             complement(join(759433..759840,760031..760033))
                     /gene="TDEL0A04270"
                     /locus_tag="TDEL_0A04270"
                     /inference="similar to DNA sequence:INSDC:YDR447C,YML024W"
                     /note="similar to Saccharomyces cerevisiae RPS17B
                     (YDR447C) and RPS17A (YML024W); ancestral locus Anc_5.562"
                     /codon_start=1
                     /product="40S ribosomal protein S17"
                     /protein_id="XP_003678970.1"
                     /db_xref="GeneID:11503269"
                     /db_xref="GOA:G8ZMB5"
                     /db_xref="InterPro:IPR001210"
                     /db_xref="InterPro:IPR018273"
                     /db_xref="UniProtKB/TrEMBL:G8ZMB5"
                     /translation="MGRVRTKTVKRASKALIERYYPKLTMDFQVNKRLCDEIATIQSK
                     RLRNKIAGYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPEVSALDLEHSKGVLNV
                     DNQTADLVKSLGLKLPLSVTSVSAQRERRFRRRI"
     gene            <760547..>761854
                     /gene="TDEL0A04280"
                     /locus_tag="TDEL_0A04280"
                     /db_xref="GeneID:11503020"
     mRNA            <760547..>761854
                     /gene="TDEL0A04280"
                     /locus_tag="TDEL_0A04280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678923.1"
                     /db_xref="GeneID:11503020"
     CDS             760547..761854
                     /gene="TDEL0A04280"
                     /locus_tag="TDEL_0A04280"
                     /inference="similar to DNA sequence:INSDC:YDR448W"
                     /note="similar to Saccharomyces cerevisiae ADA2 (YDR448W);
                     ancestral locus Anc_5.563"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678971.1"
                     /db_xref="GeneID:11503020"
                     /db_xref="GOA:G8ZMB6"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR016827"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:G8ZMB6"
                     /translation="MSKFHCDACFSDCNNRVRISCAECPEYDLCVPCFSQGSYNGNHL
                     PSHDYRIIETNWHPILCEDWGADEELALIKGSQSLGLGNWQDVADHVGSRDKEGVAEH
                     YMKYYIYSEFYPIPDITKDLKVDREEFMEERKKRIERFREKPLEPSRKPVASVPSCHE
                     VQGFMPGRLEFETEFENEAEGPVKDMVFEPDDQPLDIELKLIILDIYNSRLTTRAEKK
                     RVLFENGLMEYRRLQGIDKRRTKEAKDLFNAIKPLANLMTAQDFDEFSRDILEELRCR
                     TRIRQLQEWRSNGITTMEAGLKYERDKQLRISALERFGSSNNMTVNGNAINGRHRATT
                     AHRNNADYSQNYNESAGRKKNMTASEIQHSTDFGLLSPDEQQLCIQLKILPKPYFAIK
                     ELLFRELLRSGGALRKKNCRDLLNIEPAKANKIYDFFESQNWI"
     gene            complement(<761867..>763189)
                     /gene="TDEL0A04290"
                     /locus_tag="TDEL_0A04290"
                     /db_xref="GeneID:11503000"
     mRNA            complement(<761867..>763189)
                     /gene="TDEL0A04290"
                     /locus_tag="TDEL_0A04290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678924.1"
                     /db_xref="GeneID:11503000"
     CDS             complement(761867..763189)
                     /gene="TDEL0A04290"
                     /locus_tag="TDEL_0A04290"
                     /inference="similar to DNA sequence:INSDC:YDR449C"
                     /note="similar to Saccharomyces cerevisiae UTP6 (YDR449C);
                     ancestral locus Anc_5.564"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678972.1"
                     /db_xref="GeneID:11503000"
                     /db_xref="GOA:G8ZMB7"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013949"
                     /db_xref="UniProtKB/TrEMBL:G8ZMB7"
                     /translation="MSSKTRYYLEQCIPEVEDLIDKGLFTKNEVSTIMKKRTDFEHRL
                     NSRGSSIRDYMKYISYETSVDKLRAKRVKRILDSTKTNSISDWSIQQRIAFIYTRGCN
                     KFPSDLKFWAMHLNFLKTRGNSTSYKRIHNVYNELLKLHPNNVEVWISCAKYEYEVHA
                     NFKSCRVVFQNGLRFNPDVPKLWYEYVKFELNFITKLINRRKVMGLINEREQELDMLK
                     EQNDKKASTEDNGIEAPSTGDAMKDKLNEFPEADMNMLGNEETNPALRGDIALAIFDL
                     CMETLSESYYKKHTGYYSITDRQMNKELSLDTIRYLYEKSVEYISLFDHFQDLHRDYL
                     INHVLEYWRKDHRSISLQQELPELYVDVILMDTTLNIRFMSVESLDIEQLQLSVKKYF
                     AYKNKLDEDMSKDLQKRYAAYLRETYVDKLNKENDPRYDTLQLITRKL"
     gene            <763388..>764244
                     /gene="TDEL0A04300"
                     /locus_tag="TDEL_0A04300"
                     /db_xref="GeneID:11503009"
     mRNA            join(<763388..763414,763480..>764244)
                     /gene="TDEL0A04300"
                     /locus_tag="TDEL_0A04300"
                     /product="mitochondrial 54S ribosomal protein YmL6"
                     /transcript_id="XM_003678925.1"
                     /db_xref="GeneID:11503009"
     CDS             join(763388..763414,763480..764244)
                     /gene="TDEL0A04300"
                     /locus_tag="TDEL_0A04300"
                     /inference="similar to DNA sequence:INSDC:YML025C"
                     /note="similar to Saccharomyces cerevisiae YML6 (YML025C);
                     ancestral locus Anc_5.565"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL6"
                     /protein_id="XP_003678973.1"
                     /db_xref="GeneID:11503009"
                     /db_xref="GOA:G8ZMB8"
                     /db_xref="InterPro:IPR002136"
                     /db_xref="InterPro:IPR013005"
                     /db_xref="InterPro:IPR023574"
                     /db_xref="UniProtKB/TrEMBL:G8ZMB8"
                     /translation="MFNRNRLWKIAHAVRYQSTKAAETVLPNAAIPPRYTLATVRAFP
                     SLEPLTFAPVPTSVLAAPLRRDILWRAVVYENDNKRVGSSNPPGRSENGYSRRKLLPQ
                     KGSGRARAGDANSPTRHNGARALARTAPNDYSTVLPSKVYSQAVINALSHQYRSGNLF
                     IIGGANALSKTNELDLNELELIPSNTTGDILFERFMKEHKLQGKKLLFIISEPREALL
                     QNTDRFKDKVDVVQQELVDVNDLLKAKRIFIELAALEYLTVTHSL"
     gene            <764673..>765270
                     /gene="TDEL0A04310"
                     /locus_tag="TDEL_0A04310"
                     /db_xref="GeneID:11502895"
     mRNA            join(<764673..764722,764877..>765270)
                     /gene="TDEL0A04310"
                     /locus_tag="TDEL_0A04310"
                     /product="40S ribosomal protein S18"
                     /transcript_id="XM_003678926.1"
                     /db_xref="GeneID:11502895"
     CDS             join(764673..764722,764877..765270)
                     /gene="TDEL0A04310"
                     /locus_tag="TDEL_0A04310"
                     /inference="similar to DNA sequence:INSDC:YDR450W,YML026C"
                     /note="similar to Saccharomyces cerevisiae RPS18A
                     (YDR450W) and RPS18B (YML026C); ancestral locus Anc_5.566"
                     /codon_start=1
                     /product="40S ribosomal protein S18"
                     /protein_id="XP_003678974.1"
                     /db_xref="GeneID:11502895"
                     /db_xref="GOA:G8ZMB9"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="InterPro:IPR010979"
                     /db_xref="InterPro:IPR018269"
                     /db_xref="InterPro:IPR027437"
                     /db_xref="UniProtKB/TrEMBL:G8ZMB9"
                     /translation="MSSLVVQEQGSFQHILRLLNTNVDGNIKVVYALTTIKGVGRRYA
                     NLVCKKADVDLHKRAGELTQEELERIVQIMQNPTQYKIPAWFLNRQRDVTDGKDYHTL
                     ANGVESKLRDDLERLKKIRAHRGIRHFWGLRVRGQHTKTTGRRRA"
     gene            complement(<765442..>766434)
                     /gene="TDEL0A04320"
                     /locus_tag="TDEL_0A04320"
                     /db_xref="GeneID:11502873"
     mRNA            complement(<765442..>766434)
                     /gene="TDEL0A04320"
                     /locus_tag="TDEL_0A04320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678927.1"
                     /db_xref="GeneID:11502873"
     CDS             complement(765442..766434)
                     /gene="TDEL0A04320"
                     /locus_tag="TDEL_0A04320"
                     /inference="similar to DNA sequence:INSDC:YDR451C,YML027W"
                     /note="similar to Saccharomyces cerevisiae YHP1 (YDR451C)
                     and YOX1 (YML027W); ancestral locus Anc_5.567"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678975.1"
                     /db_xref="GeneID:11502873"
                     /db_xref="GOA:G8ZMC0"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017970"
                     /db_xref="UniProtKB/TrEMBL:G8ZMC0"
                     /translation="MMSGKPLLPSLAVLLNNNMLHSEPCSPLLENLKPRFYNDDQGAI
                     RLPPLGFNGITRPKSVDSALRHVPITNSTGSYTPARQPQLRTQSFTEAEPATPSTPVV
                     KKKSTNQSARKNDMLTPLSAARAVITPSANDKKRAFAFITHSQETFPTKEPKIDNAPL
                     ARRKRRRTSTQELNILQAEFNACPAPDKRKRQELAERCNMSEKAVQIWFQNKRQASKR
                     QNNSAQRAVQSTPVAQIPTEPAVTTPEATSGETTPPRTSKRGQALTFHLTSDKKVLTP
                     IKTSPNSRVNKLINGDGSGSPRSKPRSAANSINTSGSPTKRIPLQELNNNTLVH"
     gene            <767157..>769154
                     /gene="TDEL0A04330"
                     /locus_tag="TDEL_0A04330"
                     /db_xref="GeneID:11502997"
     mRNA            <767157..>769154
                     /gene="TDEL0A04330"
                     /locus_tag="TDEL_0A04330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678928.1"
                     /db_xref="GeneID:11502997"
     CDS             767157..769154
                     /gene="TDEL0A04330"
                     /locus_tag="TDEL_0A04330"
                     /inference="similar to DNA sequence:INSDC:YDR452W"
                     /note="similar to Saccharomyces cerevisiae PPN1 (YDR452W);
                     ancestral locus Anc_5.568"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678976.1"
                     /db_xref="GeneID:11502997"
                     /db_xref="GOA:G8ZMC1"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR012358"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8ZMC1"
                     /translation="MTSENLLEDKSPRRRVLERNWLYAACSFVLVLWLVFTRYEKFSN
                     CADKIAHFEATPVPGNWSEEDVEAYKMLGLTPKDPVLIRNLETGQEKKLHGRFLHITD
                     MHPDAFYKEGSSVEYSCHSGKPPPHKKNFASKFGDATKGCDAPEELIDYTLEWIKDNL
                     RDKIDFVIWTGDNVRHDNDRKIPRTEMQILEMNDQISRKMQRVFSDPNSDNPRDFDVT
                     LIPSIGNNDVFPHNMFALGPTLQTREYYRIWDNVIPQEQQRTFYRGACFVTEVIPGRL
                     AVLSINTLYLYKANPLVDNCDSKKQPGYQLLAWLGSVLEELRQRDVKVWLSGHVPPIE
                     KNFADSCYDKFTLWTHEYRDIIIGGLYGHMNIDHFIPVDGEASRKAIESEVEINSSED
                     DDDEEEILDHAMAASEVHLMGAKPENKESYMNGIRDKVYKKVHQEVEESVANEDMMCG
                     KKRNEHKTFEEICENYSIVTISGSVIPTFNPSIRIWEYNTTDLEADSSTWQKHSWDDF
                     YEKLNKIMDNEYNSEEEDELTIDDEIEIEKKKSNRKKKRKNKADKTIPKKKPAKLALG
                     PAYTPQLFSPTKFVQYYADLKQINEDYYSLLDSGKKPGEAAERSFKYQVEYTSEEGPY
                     PMKSLMVEDFISLASKLATDKKIWQKFLKRAFMSTGYTDDN"
     gene            complement(<769242..>769832)
                     /gene="TDEL0A04340"
                     /locus_tag="TDEL_0A04340"
                     /db_xref="GeneID:11502901"
     mRNA            complement(<769242..>769832)
                     /gene="TDEL0A04340"
                     /locus_tag="TDEL_0A04340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678929.1"
                     /db_xref="GeneID:11502901"
     CDS             complement(769242..769832)
                     /gene="TDEL0A04340"
                     /locus_tag="TDEL_0A04340"
                     /inference="similar to DNA sequence:INSDC:YDR453C,YML028W"
                     /note="similar to Saccharomyces cerevisiae TSA2 (YDR453C)
                     and TSA1 (YML028W); ancestral locus Anc_5.569"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678977.1"
                     /db_xref="GeneID:11502901"
                     /db_xref="GOA:G8ZMC2"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR019479"
                     /db_xref="InterPro:IPR024706"
                     /db_xref="UniProtKB/TrEMBL:G8ZMC2"
                     /translation="MVAQVQKQAPTFNKTAVIDGVFDEVSLDKYKGKYVVLAFIPLAF
                     TFVCPTEIIAFSEAAKRFTDIGAQVLFASTDSEYSLLAWTNVERKDGGLGKVDIPLVA
                     DTNHSLSRDYGVLIEEAGVALRGLFIIDPKGVIRHITINDLPVGRNVEEALRLVEGFQ
                     WTDKNGTVLPCNWTPGAATIKPGVSESKEYFSSANK"
     gene            complement(<770095..>772533)
                     /gene="TDEL0A04350"
                     /locus_tag="TDEL_0A04350"
                     /db_xref="GeneID:11503030"
     mRNA            complement(<770095..>772533)
                     /gene="TDEL0A04350"
                     /locus_tag="TDEL_0A04350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678930.1"
                     /db_xref="GeneID:11503030"
     CDS             complement(770095..772533)
                     /gene="TDEL0A04350"
                     /locus_tag="TDEL_0A04350"
                     /inference="similar to DNA sequence:INSDC:YML029W"
                     /note="similar to Saccharomyces cerevisiae USA1 (YML029W);
                     ancestral locus Anc_5.570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678978.1"
                     /db_xref="GeneID:11503030"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8ZMC3"
                     /translation="MECLALAPLRFTIWSSDFRLIRTNLLVNAHPKTTVKRLLQYVHS
                     QLVAELEASGNADNGQLEGVEAYTLHYRSQELLLNTFLQDVEPMHGQGFIRLRFERKS
                     SRSGSAENLEYDRDTDFSTTNLEINVNALSVDKVMSIYEPNVAMGITMARLKKLVLKG
                     VYDYEMKDSKNLCGLKESHAVSDLAGFIIKGKQSPVSLIAGEGSELQDDLTLSELLGY
                     DFAPEKASHFTVMFKIRHNVESSDGEDSIVLQFVSDATLSVNEMTVTPDTTVEHVKEF
                     ICSVYAHALRLSTNDIKLIYKGQLVHMTDFAGNPAKMMSYINEPGRANIHVHINQEFN
                     EPGPGFWSELFSHRETLEGTRTEAVDVAAHSMQPSSSVRSQTHPTNPSPIVAAGKRQY
                     KYVTSSGVPVQLTEERFVKCMLNDEQILVPANNLDPFKIQLQVAGHTISLSSIDCIVE
                     DGFVKLSHSAIARLESKMQCSIVKNSYAMQEVNVNYIGANGDDSIQQNRWNPITYLRD
                     SLPAALLVFRTIYLIGNYSIIPIFFLSRLSPLVERKYIFLISVLYVLRGIWTTREIWD
                     MWSAYLNLSVINEDTYVEIKNYITSGSSTRQFYQDCKNSTAVTDIFMAANLREARSNL
                     FAAHDIHGFEGDSTAALNDLFQKIHDNELPKEPMDAFVLSCLNLYGTNRNTISSPYRE
                     SLHELLLIAHRDMERNRPSHELPWYKHVLHTMKNQIERLRELQVTTKITERVIPDPAH
                     DSIPMAILKNVILFFLIIFPPVKNHVDVIIRERASRINQLDQPQEEQAEPELIQELPA
                     NASGVQRHRNEQDD"
     gene            complement(<772765..>773250)
                     /gene="TDEL0A04360"
                     /locus_tag="TDEL_0A04360"
                     /db_xref="GeneID:11502877"
     mRNA            complement(<772765..>773250)
                     /gene="TDEL0A04360"
                     /locus_tag="TDEL_0A04360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678931.1"
                     /db_xref="GeneID:11502877"
     CDS             complement(772765..773250)
                     /gene="TDEL0A04360"
                     /locus_tag="TDEL_0A04360"
                     /inference="similar to DNA sequence:INSDC:YML030W"
                     /note="similar to Saccharomyces cerevisiae YML030W;
                     ancestral locus Anc_5.571"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678979.1"
                     /db_xref="GeneID:11502877"
                     /db_xref="GOA:G8ZMC4"
                     /db_xref="InterPro:IPR007667"
                     /db_xref="UniProtKB/TrEMBL:G8ZMC4"
                     /translation="MSRMPSSFDGGDDDVKEMPFMEKIVFHCKQQPLVPLGTLLTTGA
                     VILAAKNVRGGNKLKAQIYFRWRVGLQAATLVALIAGSYVYGSAVQQQKSKEEQMREK
                     AKVREQLWIQELERRDKETHYRKKRAELVRMRAQEDEEAIARLQKELKDLEIQIRGQA
                     D"
     gene            complement(<773339..>773902)
                     /gene="TDEL0A04370"
                     /locus_tag="TDEL_0A04370"
                     /db_xref="GeneID:11503010"
     mRNA            complement(<773339..>773902)
                     /gene="TDEL0A04370"
                     /locus_tag="TDEL_0A04370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678932.1"
                     /db_xref="GeneID:11503010"
     CDS             complement(773339..773902)
                     /gene="TDEL0A04370"
                     /locus_tag="TDEL_0A04370"
                     /inference="similar to DNA sequence:INSDC:YDR454C"
                     /note="similar to Saccharomyces cerevisiae GUK1 (YDR454C);
                     ancestral locus Anc_5.572"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678980.1"
                     /db_xref="GeneID:11503010"
                     /db_xref="GOA:G8ZMC5"
                     /db_xref="InterPro:IPR008144"
                     /db_xref="InterPro:IPR008145"
                     /db_xref="InterPro:IPR017665"
                     /db_xref="InterPro:IPR020590"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZMC5"
                     /translation="MPRPIVLSGPSGTGKSTLLKKLFAEFPNKFGFSVSSTTRSPRAG
                     EVDGKDYNFVPVEEFKRMISADEFVEWAQFSGNYYGTTVASVKKVADSGRTCILDIDM
                     QGVKSVKYKTDLDARFLFVAPPSVADLEKRLRGRGTETEESIAKRLAAAKAEIEYAET
                     GAHDQILVNDDLQRAYNELKEFIAQEE"
     gene            <774396..>776273
                     /gene="TDEL0A04380"
                     /locus_tag="TDEL_0A04380"
                     /db_xref="GeneID:11503014"
     mRNA            <774396..>776273
                     /gene="TDEL0A04380"
                     /locus_tag="TDEL_0A04380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678933.1"
                     /db_xref="GeneID:11503014"
     CDS             774396..776273
                     /gene="TDEL0A04380"
                     /locus_tag="TDEL_0A04380"
                     /inference="similar to DNA sequence:INSDC:YDR456W"
                     /note="similar to Saccharomyces cerevisiae NHX1 (YDR456W);
                     ancestral locus Anc_5.573"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678981.1"
                     /db_xref="GeneID:11503014"
                     /db_xref="GOA:G8ZMC6"
                     /db_xref="InterPro:IPR004709"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="InterPro:IPR018422"
                     /db_xref="UniProtKB/TrEMBL:G8ZMC6"
                     /translation="MLVRLLLSLAFKVAWCAGGAVLKLDEDELLPMPSAPVDGDPITG
                     DPTGDVNPVTEEMFSSWALCILLFLLISALWSSYYLSQRRITAVHETVLSIFYGMVVG
                     LVIRLSPGHYIQDTVTFNSSYFFNVLLPPIILNSGYELNQVNFFNNMFSILTFAIPGT
                     FISAVVLGIIIFIWTALGLEGINISFVDALSVGATLSATDPVTILSIFNAYKVDPKLY
                     TVIFGESLLNDAISIVMFETCQKFHGSPAKFSSLFEGIGLFLMTFMISLLIGLFIGIL
                     VALILKHTHIRRYPQIESCIILLIAYESYFFSNGCHMSGIVSLLFCGITLKHYAYYNM
                     SRRAQITIKFIFQLLARLSENFIFIYLGLELFTEVELVYKPVLIIVTALSICIARWCS
                     VFPLSRFINWVYKMKTVRSMGSSAATSISIPDEMPYNYQVMTFWAGLRGAVGVALAMG
                     IQGEFKFTLLATVLVVVVLTVIIFGGTTAGMLEVLNIKTGCVDENDNSDDEFDIEAPR
                     PSGLARSFATRLQPYSDENSPAGTPTALDIPDATESNLLSDFPPVAGATSPNNPVVSR
                     VSIETHRLKDSFGNIFNSDSQWFHNFDEQVLKPVFLDSNPQPGKENGGGSPAPFESDR
                     S"
     gene            complement(<776373..>778211)
                     /gene="TDEL0A04390"
                     /locus_tag="TDEL_0A04390"
                     /db_xref="GeneID:11503031"
     mRNA            complement(<776373..>778211)
                     /gene="TDEL0A04390"
                     /locus_tag="TDEL_0A04390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678934.1"
                     /db_xref="GeneID:11503031"
     CDS             complement(776373..778211)
                     /gene="TDEL0A04390"
                     /locus_tag="TDEL_0A04390"
                     /inference="similar to DNA sequence:INSDC:YML031W"
                     /note="similar to Saccharomyces cerevisiae NDC1 (YML031W);
                     ancestral locus Anc_5.574"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678982.1"
                     /db_xref="GeneID:11503031"
                     /db_xref="InterPro:IPR019049"
                     /db_xref="UniProtKB/TrEMBL:G8ZMC7"
                     /translation="MLDAPIPLSSRYSYHTIFGDICKTRFNHLATRMSLIFTVLQAVL
                     LAVVSNRSSSNLERALKVPLWVFLLYVSSLFIVVARKNYLHVQYRGYSNLLEVIFGQL
                     VCMRAIVYESVHLVCSFLISLTYSDVLGLGTAVSSYTFSQCLLLYVWVLVPTLYTLQH
                     CLFDLDRLSFNFEAHFQPPQQYINASLPRIITKSAIMTLSLGFVSPLIFFLIYSCWWV
                     GFVGHLQLMLLSFCIFINLEFINIAFNAHMSIGCLHKGKPISSLSSTPIETLLTGLSS
                     KKPFTKFTAFQELSFRATSADASLRVPIYHTRYRNTHIWPVILSECLATLQETNESVT
                     NYLKSLENSMKLQDNPNYSQTLYDNVDEKLFGNKVAVNPAGFSSSQSRFPGSPPVLSQ
                     NGPSRKITLKDDNVLLRRNIPRDERGGFTYGSKNFISAPHAFDEPIITQETTLLKLTG
                     ALLRAARKQINLFFFPSAISSQDQQPQVSIIEAWCISKRRQAEKLVPQAVCLAECIIS
                     LMGLLINAIEEDPKGGVVSSVGEVLKCLERSVGALGRFADWHPEVNRKSTDTDGESPD
                     VISILYDLSVSAFLEIVLKYNVLLNDLYLDDDVVKLSKWVLSQCSE"
     gene            <778465..>779763
                     /gene="TDEL0A04400"
                     /locus_tag="TDEL_0A04400"
                     /db_xref="GeneID:11502564"
     mRNA            <778465..>779763
                     /gene="TDEL0A04400"
                     /locus_tag="TDEL_0A04400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678935.1"
                     /db_xref="GeneID:11502564"
     CDS             778465..779763
                     /gene="TDEL0A04400"
                     /locus_tag="TDEL_0A04400"
                     /inference="similar to DNA sequence:INSDC:YML032C"
                     /note="similar to Saccharomyces cerevisiae RAD52
                     (YML032C); ancestral locus Anc_5.575"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678983.1"
                     /db_xref="GeneID:11502564"
                     /db_xref="GOA:G8ZMC8"
                     /db_xref="InterPro:IPR004585"
                     /db_xref="InterPro:IPR007232"
                     /db_xref="UniProtKB/TrEMBL:G8ZMC8"
                     /translation="MEERKPLVVKTNEDIQTKLDKKLGPEYISKRVGFGSSRVAYIEG
                     WRAINLANQIFGYNGWSTEVKSVIVDFLDERQGKFSIGCTAIVRVSLENGTFREDIGY
                     GTVENERRKAAAFERAKKSAVTDALKRSLRGFGNALGNCLYDKDFLSKIDKVKFDPPD
                     FDEGSLFRPSDEISESSRSNTLDHSEAGNMSKRRRLTKTGTAGLDRVSESATNGQQQP
                     PMQRPVELKRQQPPSNNVERSEEQSAEVGAEQDELLDDSLMFSDDFQDDDLINMGRKE
                     EPAPVPRPSEETSNESVTFVTAKAAPTVQNKRPVTQENMFDPKYQAQSIRHTVDQTTS
                     KPVPASLLKEKGIDDSRESSYEKFAAKGKQIGAEGSVSQPSAIEPNSQPTSTTSSRYA
                     PPNTVIHPNSGSVLPQPPKPTRREVGRPKVNPPHLRKASP"
     gene            <780072..>789851
                     /gene="TDEL0A04410"
                     /locus_tag="TDEL_0A04410"
                     /db_xref="GeneID:11503185"
     mRNA            <780072..>789851
                     /gene="TDEL0A04410"
                     /locus_tag="TDEL_0A04410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678936.1"
                     /db_xref="GeneID:11503185"
     CDS             780072..789851
                     /gene="TDEL0A04410"
                     /locus_tag="TDEL_0A04410"
                     /inference="similar to DNA sequence:INSDC:YDR457W"
                     /note="similar to Saccharomyces cerevisiae TOM1 (YDR457W);
                     ancestral locus Anc_5.576"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678984.1"
                     /db_xref="GeneID:11503185"
                     /db_xref="GOA:G8ZMC9"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR010309"
                     /db_xref="InterPro:IPR010314"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR025527"
                     /db_xref="UniProtKB/TrEMBL:G8ZMC9"
                     /translation="MVRLSRYEKMQKEQNAETFKPLLDDLTQCDQAEFVEKLISIQEW
                     DRSRDDLFVWTPVLNRMDEMMSKIVDKYSYKSSDFQKNPVKLIEMSKNDESLCVHLMQ
                     FTARLLCNTENRFIYSSMDVMNNMLNCPNFKVKLCAVKVLAIIGERYIIARERIDTEN
                     ILGDSHLKKKALKLALCLPSSTMDEDGEHFSLVDLYFDKKKYPTKFSKLKYTYYTSST
                     NANKRASQNAGLRDYNGAQSSMKKFFLSQEDLQSHSLQQLFDKGMEVIPAQEWFDFSL
                     KVTIAKAFSDDCFENKELRSLILRAKFNAMALVNTIFIPPQVSSKLFELDPYAFNSLT
                     EFISLSETKVPKELRLDSLFALECVSLKHVWCSDIVRNLGGNMSHGLLFQILRYIGKI
                     LRENSPEVDEEYNVRFFYLISNLADVKGLHESLLSAGLIPSLLDIISVKHSNYRRTMA
                     SATHLLEAVINDVDSTAEFINNNGFTILINSITEEVDFALENPDYGSPPKYSVVYYSV
                     SFRQLAYIRSLLKLVLKLLKTDSGDRIRNLIDSPILVSLKKILENRPVFGYTLITYVL
                     DVIQRVINSEPTIYPILVEAGLIPYIIDHFSDFLGPYSELLSLLPDVISALCLNADGL
                     NKVKEKNMIPLLFEAVAGPKYARVLSWKEEATDLGASMDELARHYPELKPHILDCFAN
                     IVKNLPDQIDFDQPYLYISPNGTELFYQNKDELVEEKEENAGELAFWDIQKSTPTVDC
                     FADIFYGMTLENSTLEGLPEKVNFDDLLSIIAMKRPPFDYTTSQALLNFTDVLQLFDE
                     HHKDFALPSMMKALDEQLHSIRGFLTFQNNESFILQAKTGRDNSDVENLLADLHRLST
                     ILYITTDVYVNITSLSSARILQIMEYLDKAGLAIIENLRLLFQKCALEEMYLTRYMPD
                     DAITETQPSTLGNVPPVQIHVSKPTRREIKDNFTSAKLKNSFEVRAVLNKLQSCTAML
                     LRCFLRLSHAKNIDFESYDRALEVHIFDEVTKQVISMMHAVPLDNNLPYFLMIFNFNN
                     HIFTFPKTSVTGTGILQTVPAYLFYQGGGYKFYFDAIKALFAKMSTFTDMAAIEEVDY
                     IKGSDEVLTLSCLLNMLTFFNKSIQFEAMENVSSMETFYPHLLDDYNVTKALMVLVKL
                     LALGLIFDLNEGGLLFNRQSRSVPYAAFKQTLTMLKNVFSDANEEDEEFYELRWDLIP
                     PSRRKVQLLKACGITEDTAQLYLSSVDDELPSNEKPEVFNEEQWSKYQSYISTDTWQV
                     HPAPLEPQYEQKGSSDDLDSMRNEFFDNDLPQTVFDVLPNYPKLVNAFARTLLQMFSN
                     YDEPSENFAAKVLDKVIDTDSQDSATLSSLIHLFGIFLNEKYVYENADNQIHKFLTYL
                     QNSLKPEFINSPWFSKALYVYEIILAKSEVPALESLPSDVNVRFRLPPMTPVYRIPHD
                     IKQSIFDTLIRVGEITSFYSALATCRILIFYARDEVFAGEISRSGILSKLLKVIGVFQ
                     KSEKTNYLESSFLLLVRRCFETTDIVTSLIRCELNKSFTTRIIGDHKEKERDLTGIVE
                     EKPHVVMRNPESFVDVLCEHARFQSFNDDGKLIEYNLARVFDPEEKEANESRVKPAST
                     ADVQSRTGIVHLLLSQLMAASKKDWTSEPVSPEKEVKEKKDDKVDPARNPVCAYMMFL
                     LKVLVELVSSYKQSKFEFLTFDRRNSYTEFPKPRATALNFFLYQLLDKSVGREQSKFE
                     AKRREVVGMLARSVIVGFLATVQDDNNKKSDLKVVDPDMNFIRKFTIESIVKALRNTS
                     STSKLLEANVSKLDTWFKIISSMVFVQAPYLRLILDSNKIDADQYQICKLMIELNVPS
                     AITDCMALLDLNYPFCKKLMNNAVDPLNSINSVRNNYSDLFKVEGNDDEVEVDEESDK
                     EDPSDMFKNSALGMYDVADIEEDDEEDEDSLIGDDGDIAFVDADDEAFEVVFSDENEA
                     DEGNDIASQLDSDSDEDMDSEGNEDISEDMSSEEVRAHDDDMFNDATNGEDDSYEGSD
                     DIDVIDVEGGPYESDLDIDLSDYGIEESDWESGLSELSASDDEGEDADAADNDDDVPG
                     GIRRRWTTADGFDIVEDTSDEDEATGVFQGIEHVFHGETQPLFRVQDGRNHGRHHQRS
                     FRSHGHQPLGLPSLTLLNGGRRHQSNLINPLGPSGLEEIENGISDQLVNVNSGSRYRP
                     DHSHFAGVLFSGEFFDERSPDGIVLKPTVSRWKDIFDMFYDSKSYATYVIPTVISRLY
                     KPSLELLQEAKRKDEEQKRLAKSKVESLAKEPLEPSSIENENASPVETNEGPVEHEPV
                     YVIIDGAEVDIGGTDIDAEFLSALPDDMRAEVFAQHVRERRAEAMHHDLHLREIDSDF
                     LDAIPENLREEILDQETAESRFSNVVHSINEHDERDIDEEMVSGEEDDNEQNTVGNRE
                     QRDEESEKKKSGGRVYFAPLVDRAGIAAIMKSIFISQPYVHREIYHELLYRLCANKQN
                     RSDIINILLLILTEGVIDQHSLEKVYNLICSRVHGSAKAQGSPSTIRLLPADCTPLVV
                     ANQAIEILQNLIEADSRLKYFFITEHENLMINKAPVKNRRDIFNKNLKWPIKYLFALL
                     NRKIITDETVLMDLLTKILQVCTKPIEAIAKNSDGANSKRKFPVPFFDRNDFEKIVSV
                     IRLESCNTKVFQQTLNIMHNLSVLKDAVNVFTKELISLAIETVESLVPDLEKFTLEGT
                     SAASGNEINSELVQKFTLPSSHQAKLLKVLTAVDYLYTQKKTLSEEDVNKLMAVYNEM
                     KLGQVWASLSRSLFEFESHKGLSTSATVLLPLIESLMVVFKHGKTPQGNKMNNLKYED
                     EKSLDFARLPVDQLFFHFTEAHKKLLNQMIRSNPKLMSGPFSLLVKNPKVLDFDNKRY
                     YFIAKLGAEAQDRPKLSITVRREQVFLDSYRALFFKSNDDIKKSKLEITFKGESGVDA
                     GGLTREWYQVLSRQMFNPDYALFLPVESDKTTFRPNRTSGINPEHLSFFKFIGMIIGK
                     AIRDQCFLDCHFSREVYKNILGRPVSLKDMESLDLDYYKSLLWILENDITDVIEETFS
                     VETDDYGEHKIIDLIENGKNVPVTEQNKQDYVKKIVEYKLHISVKEQMDNFLQGFYAL
                     IPIELISIFDEQELELLVSGLPDIDVDDWKNNTTYVNYTANCKQINYYWRAVRSFDAE
                     ERAKLLQFVTGTSKVPLNGFKELSGVSGVCKFSIHRDYGSVDRLPSSHTCFNQLNLPA
                     YSSYETLRGSLLLAINEGHEGFGIA"
     gene            complement(<790205..>792613)
                     /gene="TDEL0A04420"
                     /locus_tag="TDEL_0A04420"
                     /db_xref="GeneID:11502663"
     mRNA            complement(<790205..>792613)
                     /gene="TDEL0A04420"
                     /locus_tag="TDEL_0A04420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678937.1"
                     /db_xref="GeneID:11502663"
     CDS             complement(790205..792613)
                     /gene="TDEL0A04420"
                     /locus_tag="TDEL_0A04420"
                     /inference="similar to DNA sequence:INSDC:YDR458C,YML034W"
                     /note="similar to Saccharomyces cerevisiae YDR458C and
                     SRC1 (YML034W); ancestral locus Anc_5.577"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678985.1"
                     /db_xref="GeneID:11502663"
                     /db_xref="GOA:G8ZMD0"
                     /db_xref="InterPro:IPR018996"
                     /db_xref="InterPro:IPR025856"
                     /db_xref="UniProtKB/TrEMBL:G8ZMD0"
                     /translation="MDTKYLEPGFDPSSLKVAQLRRILTENGVEFQPQAKKNTLLGLF
                     NEHVKPKIPKLRRRYENLLPSDKGIVTVGTVNKKKKKKKNKLESNPSGSENYEADINA
                     SKSDTLDPSAHLKESTPFSDVNEFQQSSGFNRKARKRKVTEESNVKDADGDLEMDMKV
                     EETDKKRRRKIGEGDHTPITDKVARKTTKKSPHRSLTIDKFESSSSSDSSFNESSILN
                     VSRRDQSGHLSMEVASPKNDFSYGKRTLAPDLTKLKVSPAFEEELKMAYKESSVPVLA
                     RSDSQSGQDKEYASGPADVSLEKNESSISVTPVRSEPASEEEVVLSEATVSKEEVAPR
                     ESSTDELEQKNYTPELITEQDVQESDDRVKHMQEVIDDINEKAQETPRRTYSKVSSFF
                     KSLATTLQALSIFFLVMTPIIYGLWYREQRVLVGYCGHEIESSPSLDFESPVLAEFGD
                     LLEAQKPRCLPCPDHAICYPYMKMKCGPEYTLQPNRWSLHGLIPLSDACVKDSRREKL
                     IGEVVKKSLEFLRTKNAQHSCGEGKDDLKSGMTEEELYQIFYESRAPWINDEEFDELW
                     AQAVADLIQEPEITWRQVSNIFFESNSISRALFTNDFNQYVQLSNGKFEVPDSPSDDA
                     ETDGLQRAEGHLSQANGYEKNRVFRSTSKKYIGLRCRFEREISNTYHRFSHFIWTVIT
                     ISILIKLISYKIRNYYKQREAVDHISKKVIIRLKATKKQQQGANFLSTVQLRDVLLAD
                     ITDLKRKNSMWQRVVRKLENNNTNVKSSLMEIHGEIMKCWEWVGPVESEPNNEEREHG
                     RQQE"
     gene            <792839..>795064
                     /gene="TDEL0A04430"
                     /locus_tag="TDEL_0A04430"
                     /db_xref="GeneID:11502764"
     mRNA            <792839..>795064
                     /gene="TDEL0A04430"
                     /locus_tag="TDEL_0A04430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678938.1"
                     /db_xref="GeneID:11502764"
     CDS             792839..795064
                     /gene="TDEL0A04430"
                     /locus_tag="TDEL_0A04430"
                     /inference="similar to DNA sequence:INSDC:YML035C"
                     /note="similar to Saccharomyces cerevisiae AMD1 (YML035C);
                     ancestral locus Anc_5.578"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678986.1"
                     /db_xref="GeneID:11502764"
                     /db_xref="GOA:G8ZMD1"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006329"
                     /db_xref="InterPro:IPR006650"
                     /db_xref="UniProtKB/TrEMBL:G8ZMD1"
                     /translation="MNVDDATKELTDLSLEPAPSYDAPVYDQSGEDLVEHGAENGSGM
                     QDAHFSYRESKQLFDSGSKQIAVDDRLAPSSIMDQPTSMQREEKKEPGRQESYKMRSL
                     PDSAAQQFTDVPSPELVGLYKNVAECRNLRAKYQGLSMQRSDQNPKNKPGWVIYPHPP
                     KPTYDAATKTVVKVENKPDSEVFDLSQCDIPGEDSEWDFGINEDDSYAVHRAGALDQV
                     IADIPSLRDYYLDLDKLVSISSDGPAKSFAFRRLQYLEARWNLYYLLNEYQETSVSKR
                     NPHRDFYNVRKVDTHVHHSACMNQKHLLRFIKHKLKHCSDEKVIFRDDQVLTLNEVFK
                     SLNLSGYDLSIDTLDMHAHKDTFHRFDKFNLKYNPIGESRLREIFLKTDNYIKGSYLA
                     QITKQVISDLENSKYQNCEYRISVYGRSIDEWDKLANWVIDNKIFSHNVRWLVQIPRL
                     YDIYKKTGTVNTFQDIITNLFKPLFEVTKNPQSHPKLHVFLQRVIGFDSVDDESKVDR
                     RFHRKYPKPSLWEAPQNPPYSYYLYYLYSNLAALNQWRAKRGFNTLVLRPHCGEAGDP
                     EHLVSAYLLAQSISHGILLRKVPFVQYLYYLDQIGIAMSPLSNNALFLTYDKNPFPRY
                     FKRGLNVSLSTDDPLQFSYTREPLIEEYSVAAQIYKLSNVDMCELAKNSVLQSGWEAS
                     IKAHWIGKNFEDDGVEGNDVGRTNVPNIRVNYRWDTLSTELDLVNHFATFKGTENGCQ
                     A"
     gene            complement(<795121..>796218)
                     /gene="TDEL0A04440"
                     /locus_tag="TDEL_0A04440"
                     /db_xref="GeneID:11502839"
     mRNA            complement(<795121..>796218)
                     /gene="TDEL0A04440"
                     /locus_tag="TDEL_0A04440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678939.1"
                     /db_xref="GeneID:11502839"
     CDS             complement(795121..796218)
                     /gene="TDEL0A04440"
                     /locus_tag="TDEL_0A04440"
                     /inference="similar to DNA sequence:INSDC:YDR459C"
                     /note="similar to Saccharomyces cerevisiae PFA5 (YDR459C);
                     ancestral locus Anc_5.579"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678987.1"
                     /db_xref="GeneID:11502839"
                     /db_xref="GOA:G8ZMD2"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:G8ZMD2"
                     /translation="MRFSLPQWRYFSWFRCIGPSLVFGLAVYCTWGFAHELCYNQIDK
                     RFHQRAAAIGLMFAVSFLDVLLVIIWYQAAIAVGPGRLPKVPPYMILPEDFSIDRIGD
                     PAETAHSLVPPVCYQSCPRGNPIWCSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGA
                     VIGRDNYRFFIQFVMYMAILSLFVFVPICAFIRRIIHDGDTQHSLNPNLIVILIIAVF
                     AWLMTTSMLVTHAVCIVTNTTSVEVMARRDDSSFNRTVCYYSFKAGMRYVVQLKNNEL
                     HSLWRKKDLWLNMVDFLGSNMLLWFLPLRSNDNEPNQDLEEMDNKVLPLQRVLGHYYE
                     PFSDQTIDLIEKKIANNDYLTTLHAYGDRYI"
     gene            <796437..>797405
                     /gene="TDEL0A04450"
                     /locus_tag="TDEL_0A04450"
                     /db_xref="GeneID:11502774"
     mRNA            <796437..>797405
                     /gene="TDEL0A04450"
                     /locus_tag="TDEL_0A04450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678940.1"
                     /db_xref="GeneID:11502774"
     CDS             796437..797405
                     /gene="TDEL0A04450"
                     /locus_tag="TDEL_0A04450"
                     /inference="similar to DNA sequence:INSDC:YDR460W"
                     /note="similar to Saccharomyces cerevisiae TFB3 (YDR460W);
                     ancestral locus Anc_5.580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678988.1"
                     /db_xref="GeneID:11502774"
                     /db_xref="GOA:G8ZMD3"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR004575"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015877"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:G8ZMD3"
                     /translation="MKSLVDDYYDNKDMCPICKTDRYLSPDVKFLVNPECYHKICESC
                     VDRIFSLGPAQCPYKNCDKILRKNKFKTQIFDDVGVEKEVDIRKRVFAVFNKKLEDFE
                     GSLEEYNKYLEEIEEIVYNLDNGIDVAQTEEKLRTYEELNRQLIMTNMERNKQDLESF
                     EQRQQFEKEMRMKKRILVRQIEEEERMNKEWAKKEIVNRLSSADDVDDVIEGVKNTVK
                     LKKSSARRKLEELNRVMMNNPYLAANSGGPRKDAVPFTPFNGDRDVSKRYNLDESLYS
                     DPFIKDLQERKDFIASGFRVDYVYSRMLTEAFMGLGCVIGEELQTS"
     gene            complement(<797391..>797990)
                     /gene="TDEL0A04460"
                     /locus_tag="TDEL_0A04460"
                     /db_xref="GeneID:11502923"
     mRNA            complement(<797391..>797990)
                     /gene="TDEL0A04460"
                     /locus_tag="TDEL_0A04460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678941.1"
                     /db_xref="GeneID:11502923"
     CDS             complement(797391..797990)
                     /gene="TDEL0A04460"
                     /locus_tag="TDEL_0A04460"
                     /inference="similar to DNA sequence:INSDC:YML036W"
                     /note="similar to Saccharomyces cerevisiae CGI121
                     (YML036W); ancestral locus Anc_5.581"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678989.1"
                     /db_xref="GeneID:11502923"
                     /db_xref="GOA:G8ZMD4"
                     /db_xref="InterPro:IPR013926"
                     /db_xref="UniProtKB/TrEMBL:G8ZMD4"
                     /translation="MTSYSLPQFPDYKVTVSLFEDVSNAAELRSNVAEIPFALIDARL
                     ICSSEQLYSAIYRALVETTYNRMRTKSLHSECLLCLSPSSNIGEAFQTFGIRDDCQVV
                     IGVQILGPKDPGSTQQIRDFVQGTEVECCDENIQKHYNEDTIRKYVNRLLWVIFDNAV
                     FLLTYPCKMQVYKLNQKFRPETMEGLSRALVNAIQLRGL"
     gene            <798172..>799071
                     /gene="TDEL0A04470"
                     /locus_tag="TDEL_0A04470"
                     /db_xref="GeneID:11503077"
     mRNA            <798172..>799071
                     /gene="TDEL0A04470"
                     /locus_tag="TDEL_0A04470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678942.1"
                     /db_xref="GeneID:11503077"
     CDS             798172..799071
                     /gene="TDEL0A04470"
                     /locus_tag="TDEL_0A04470"
                     /inference="similar to DNA sequence:INSDC:YML037C"
                     /note="similar to Saccharomyces cerevisiae YML037C;
                     ancestral locus Anc_5.582"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678990.1"
                     /db_xref="GeneID:11503077"
                     /db_xref="UniProtKB/TrEMBL:G8ZMD5"
                     /translation="MAEPDSDQEESLGTGNNDLEVFLDKLVPSNDFHPQALVEPKSAY
                     ELLDEAPNGRKLMNYLFHSAKDDDCRSSELQRITSSIAEKWFEEERRSSTQLTPAALQ
                     LDAPVIFSWSKKASGTRSNPTVDRKTNPVGETTNQILFKSISSRLSEIAKHREDIRGA
                     AKEAHEAIDPESSLRKQQWAVSEFHVDPLQPFVARALPRESKKENTSKKKAKRRSILN
                     FWGLNTESKRKEKLKVTKEDVVEKPQDNGPTANEMSELVESPTEKRTQEVTPTLLDQP
                     VSLSSPASAMSMSSFVPLQPKKK"
     gene            complement(<799116..>799301)
                     /gene="TDEL0A04480"
                     /locus_tag="TDEL_0A04480"
                     /db_xref="GeneID:11502882"
     mRNA            complement(<799116..>799301)
                     /gene="TDEL0A04480"
                     /locus_tag="TDEL_0A04480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678943.1"
                     /db_xref="GeneID:11502882"
     CDS             complement(799116..799301)
                     /gene="TDEL0A04480"
                     /locus_tag="TDEL_0A04480"
                     /inference="similar to DNA sequence:INSDC:YDR461C-A"
                     /note="similar to Saccharomyces cerevisiae YDR461C-A;
                     ancestral locus Anc_5.583"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678991.1"
                     /db_xref="GeneID:11502882"
                     /db_xref="UniProtKB/TrEMBL:G8ZMD6"
                     /translation="MEKGTNDHKQDPDGPPSYEETMRQDALRTENTGHTHKPKRTSRK
                     GYPGGEHLTYHGAKKGK"
     gene            <799756..>800190
                     /gene="TDEL0A04490"
                     /locus_tag="TDEL_0A04490"
                     /db_xref="GeneID:11502866"
     mRNA            <799756..>800190
                     /gene="TDEL0A04490"
                     /locus_tag="TDEL_0A04490"
                     /product="mitochondrial 54S ribosomal protein YmL28"
                     /transcript_id="XM_003678944.1"
                     /db_xref="GeneID:11502866"
     CDS             799756..800190
                     /gene="TDEL0A04490"
                     /locus_tag="TDEL_0A04490"
                     /inference="similar to DNA sequence:INSDC:YDR462W"
                     /note="similar to Saccharomyces cerevisiae MRPL28
                     (YDR462W); ancestral locus Anc_5.584"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL28"
                     /protein_id="XP_003678992.1"
                     /db_xref="GeneID:11502866"
                     /db_xref="InterPro:IPR019192"
                     /db_xref="UniProtKB/TrEMBL:G8ZMD7"
                     /translation="MLSPSGRCGQMIQPVRVFARSVRTKSKGGLPPAAQRVVTQLSVM
                     SASRKQPKLLKLSREDLIKHQTIQRCWSTYQAELRVERNEQLKLQYKSTKNAMDLLEQ
                     LDPELFEAANAPEHGKRFPLELKVPTEFPPSKIWYGEYKKKD"
     gene            <800473..>801654
                     /gene="TDEL0A04500"
                     /locus_tag="TDEL_0A04500"
                     /db_xref="GeneID:11502872"
     mRNA            <800473..>801654
                     /gene="TDEL0A04500"
                     /locus_tag="TDEL_0A04500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678945.1"
                     /db_xref="GeneID:11502872"
     CDS             800473..801654
                     /gene="TDEL0A04500"
                     /locus_tag="TDEL_0A04500"
                     /inference="similar to DNA sequence:INSDC:YML038C"
                     /note="similar to Saccharomyces cerevisiae YMD8 (YML038C);
                     ancestral locus Anc_5.585"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678993.1"
                     /db_xref="GeneID:11502872"
                     /db_xref="GOA:G8ZMD8"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:G8ZMD8"
                     /translation="MRNLIVLILGWYLCSITLSLYNKWMFDPTKGLQIAFPILVTAFH
                     QSVLWLISFLYVKYRKLEDNGQAVTQAKLPNWKFYLKYIVPTAIAAAGDIGFGNVSFK
                     YISLTVYTIIKSASIAFVLLFGCMFNLEQFHWKLGVIVLVMFAGVVLMVLTPKKDNTN
                     LQDESTLILGSFLVLISSCLSGLRWVYTQLTLRKQPRPHYESIAHSDGAIPDLRTRSS
                     TIKKPHPIHTICQLAPVMGIALLVTSLIIERPFPGILKSKLFTSGEDPEVYNFKSIVK
                     GLILLIIPGIEVFFMTVCEFGILQTAHVLTLSIAGIVKELLTIICGMILLGERLTGFN
                     NWVGMCIILLDVFYYNYFRFQQDHKNNVLAEKDEEELVPYSITTDSMMQEYELDVIGS
                     K"
     gene            complement(<801707..>804055)
                     /gene="TDEL0A04510"
                     /locus_tag="TDEL_0A04510"
                     /db_xref="GeneID:11503044"
     mRNA            complement(<801707..>804055)
                     /gene="TDEL0A04510"
                     /locus_tag="TDEL_0A04510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678946.1"
                     /db_xref="GeneID:11503044"
     CDS             complement(801707..804055)
                     /gene="TDEL0A04510"
                     /locus_tag="TDEL_0A04510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678994.1"
                     /db_xref="GeneID:11503044"
                     /db_xref="GOA:G8ZMD9"
                     /db_xref="InterPro:IPR004583"
                     /db_xref="InterPro:IPR018325"
                     /db_xref="InterPro:IPR018326"
                     /db_xref="InterPro:IPR018327"
                     /db_xref="InterPro:IPR018328"
                     /db_xref="UniProtKB/TrEMBL:G8ZMD9"
                     /translation="MDNNLSPEHFHLIRKVLREGPQNAEDRPLKRKRRRVRDYGSNES
                     KPAVTISIDSSSDPEPQAEVVDLDSPPESNYPEKDDDLEDDYGEEDYRSDEFEDVTEP
                     ATSDDIGDVSVTIESTSKKIKNNNRVKNLCSNEERRWRRYYHMAYLACLMVHGADVNE
                     WVNNAKLLRRLSKLIPESLFSLLHPEKDEEMPLRSTRKLLDGLRKCMELWQKHWKVKR
                     RYTGLEYYMRDWQEISGKPNLKRKFTEKDFVRQVLKGHGNCDLATQGFVALLRSCNVN
                     ARLIMSCQPPDFTNLKKREPTSTRDYSYESVFKYPIFWCEVWDKFSKKWITVDPTNLQ
                     TIEQVRNGSKLEPRGVSCCKRNLLRYVIGFDRKNGCKDVTRRYASWYNSKCRRRRITN
                     NESGSEWFDKVIRALHRRKRTKIDDYEEEYFNQRDVDEGMPDNLQDLKNHPKYILEKD
                     LRNNQILKPNCKECGYLNVGNGKQILKVYDRRDLIDLKSAKQWYMEGRVLKIGSRTRK
                     KVMKSNRGARYKNTDGAPEEERLYSVEDTQVYNPPPASVPDGKIEVNAYGNIEVFTPT
                     MIPANCCLIESPNAIKAAKFVAVEYARAVTGFKFERGNASKPIIGGVVVAKWFKDSVV
                     SAIEGIEYVSETEEREKHELSALNDWNVLLMKIRIKRNLNLTYGNVQEQVEVESDEDQ
                     SSDEAPGGGFFPSANAHNEEAKPTAIDSDEAEYMDRDRMGGFKDGKKQTQELGNKSFE
                     SGGFIAPEKEKSATATEESTVEQDDNENYEQFMEELGFSDKE"
     gene            <804275..>805072
                     /gene="TDEL0A04520"
                     /locus_tag="TDEL_0A04520"
                     /db_xref="GeneID:11503339"
     mRNA            <804275..>805072
                     /gene="TDEL0A04520"
                     /locus_tag="TDEL_0A04520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678947.1"
                     /db_xref="GeneID:11503339"
     CDS             804275..805072
                     /gene="TDEL0A04520"
                     /locus_tag="TDEL_0A04520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678995.1"
                     /db_xref="GeneID:11503339"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:G8ZME0"
                     /translation="MISEKAATALATVGTVCWCIQLIPQIWYNWKRKDCTGLPPLMML
                     LWVFSGIPFAIYFCVSEGNLALQVQPHLFMFFCGISFIQTCYYPPVQLPKIKIAAILG
                     IFAATCVGMEVGFILWLRPLYRKGTHWPALIFGILASVLLALGLLPPYFELAKRRGRV
                     IGINFLFLSVDCLGAWLSIISVIVGNMDIMGIVLYCIVAALEMGIFTSHIIWCCRFKW
                     FRKGAVEETDLEMESTNDAAEVKSDLETATNDVGAVSGTEDHLRGKI"
     gene            <805574..>807028
                     /gene="TDEL0A04530"
                     /locus_tag="TDEL_0A04530"
                     /db_xref="GeneID:11502549"
     mRNA            <805574..>807028
                     /gene="TDEL0A04530"
                     /locus_tag="TDEL_0A04530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678948.1"
                     /db_xref="GeneID:11502549"
     CDS             805574..807028
                     /gene="TDEL0A04530"
                     /locus_tag="TDEL_0A04530"
                     /inference="similar to DNA sequence:INSDC:YDR463W,YHR006W"
                     /note="similar to Saccharomyces cerevisiae STP1 (YDR463W)
                     and STP2 (YHR006W); ancestral locus Anc_5.586"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678996.1"
                     /db_xref="GeneID:11502549"
                     /db_xref="GOA:G8ZME1"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8ZME1"
                     /translation="MPFVPLLKLGSRIWELFQQIVEVVVISENDEVKKEDKEEKVEVK
                     KVESREAAELFPRKHNVDLNLFKDVSVTPCAMDMSTMETPMTMTVSPEGNVSCKLKNE
                     IKATSPITPESSTTAKTPTPDGVSPQDEVAKDKEVFVCHYCDAKFRIRGYLTRHIKKH
                     AIQKAYHCPFFSAEAPQDMRCHNSGGFSRRDTYKTHLRARHFTYPKGVKPQDRTKSSG
                     HCSQCEQFFENTDQWVEQHIETGECKALPKGYYRNIKSERKSGKLRMIKVSTGHSRFI
                     STAQSVVEPEVLLNKDALEAMAIVAQDTKRSDLLSKFGNNKIMMSSTCYKGIKPKKDP
                     MCKGKEPELVTGELRLSSNNYTPLDASGPESMDDETALNEISSSINFSPMDNHLLEPV
                     PSSSSQSSHEDPVVATKGVVQPVLFNDPFSVPLDLEQCSFSNGAIIGDHTTYRKSSDE
                     MSKVDMDYTLLGQVNLRNSEQYMNLYNYNFGTNL"
     gene            <807351..>811682
                     /gene="TDEL0A04540"
                     /locus_tag="TDEL_0A04540"
                     /db_xref="GeneID:11503071"
     mRNA            <807351..>811682
                     /gene="TDEL0A04540"
                     /locus_tag="TDEL_0A04540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678949.1"
                     /db_xref="GeneID:11503071"
     CDS             807351..811682
                     /gene="TDEL0A04540"
                     /locus_tag="TDEL_0A04540"
                     /inference="similar to DNA sequence:INSDC:YDR464W"
                     /note="similar to Saccharomyces cerevisiae SPP41
                     (YDR464W); ancestral locus Anc_5.587"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678997.1"
                     /db_xref="GeneID:11503071"
                     /db_xref="InterPro:IPR021386"
                     /db_xref="UniProtKB/TrEMBL:G8ZME2"
                     /translation="MSDDRGDDLNFNELVGSLLSSHNADENREELGIGTKKPIASNDH
                     ENGEVELPEFGGGEEDDALAAVVANAIQNMDDEPGEVEEVNVPREENFEVGHGDEEQE
                     DQQWAQILQQGILQGAAGRHDSSQQEEQLDPDDENLRRAILESLGELNVVDREVTEKD
                     SATDTKSKSKKSTKKKKKKDKDHNKDKSTSTKKKKPHKKDKAGKDDLLDFDDVIKGFM
                     RQGAEVPEAEESEEVGDAETQALVEATLKAFERELLSSQTAPFAAKPKTSSKKKSTAK
                     TISTTAKDDDKGAAKAIATSAAESSNVVSEAPKKKKKKKKQSKGAEKSKDVYEEDEFS
                     RALAEMVNEVVKTSLTDKTTEAPEIPEESIPTIPEPIATSPEDQIEQPVDADQGAQGE
                     ETFDLNQIMQKAMSMAFQEQTQENLDNVAMEEFNRGLRDLNVSEILTTGKQKKKSKSP
                     RRKISTEKSRLAGTTDSSKKKITPKPAIPAEEALRKKYSQAATAAAAAARKRIAAKNK
                     VSRLQMKSERKKAREERKLQKKQAKEQLELERKELELIVAKGPPYPPDLRLTKSGKPK
                     KPYRRWTLEEMEKRASMPPGELQNVGKVKKPRKKKSKKLKKMPLSTLKKIPIFNFIRG
                     NATTDVKNNLKDGDETVRELPLQTYHLDINKLAPPDTVSPEQWEKERRIKEEQVIVPK
                     SNGSAQFAFDAARKTVVRREKIPLHPPWIIPSQVPFALPVARRRRKERLKEPKRAHRS
                     LRERRKSREGRASFSSNVRAKIIPAVLLPIIKTLKAAARAKSASGASSEEASRHLVTI
                     IRHTKRSIAQTLSMARRQSVRNYTAIKSESDLDKRPSEAGIKKAAKIPIFSLARIKQI
                     DTSEDDSVKLQKANKFSPTVIKLEDEHSLEDFEKKTKKLSPEEQHITHKGQAIDRQDS
                     AGAQETPQQVLSPDDSMIDETLREHSAADNHTSAEREYSQENETQPADEQEVSSTHMT
                     FPENSKENHVESSHTDSRDDVPGIHQEMDKKESSDTKDDVSREKARRLAEEGHLDPAA
                     NETSTIHQTSNVESHPVESPSKHGRLSLLKTEVSEGASLDQSSLTFLKDTLDQSDLKG
                     EQKVLDVLDSLVKDHLTNSDENSVGLPADVRNIISATIEELIPAIDEQETRIEDEPQP
                     KRRKGPPPVLNLDGLVPPNSLHIIPKIEETPRPSVVKKASPKVKKPRKKAEQPVLLYA
                     FDVPDFKNMQGRRTMLLKRAKNHLTNDEMNILKKEINKERKRKWRDANVEKNWENDLR
                     ARMKKRANAKFGENDSLEKGKWYQDEVNKSLAERGIKQEDIDKANDGNSDKKNIGSTN
                     LSDNEVLNMIASTLNKLDVARLLEQELNEDAANFPENKINGKKKGVSSKEMSTATRSI
                     EGVEHSNVMIPPYNEHESFHEEVINCSATEELDETGNAKRPYPDDIPVSVPLMKRPKA
                     LSTQEDK"
     gene            complement(<811830..>813422)
                     /gene="TDEL0A04550"
                     /locus_tag="TDEL_0A04550"
                     /db_xref="GeneID:11503028"
     mRNA            complement(<811830..>813422)
                     /gene="TDEL0A04550"
                     /locus_tag="TDEL_0A04550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678950.1"
                     /db_xref="GeneID:11503028"
     CDS             complement(811830..813422)
                     /gene="TDEL0A04550"
                     /locus_tag="TDEL_0A04550"
                     /inference="similar to DNA sequence:INSDC:YHR007C"
                     /note="similar to Saccharomyces cerevisiae ERG11
                     (YHR007C); ancestral locus Anc_5.588"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678998.1"
                     /db_xref="GeneID:11503028"
                     /db_xref="GOA:G8ZME3"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:G8ZME3"
                     /translation="MSESHSIVGKVVECGSAAISHFLALSLAQQVSIVVATPFIYNLV
                     WQLLYSFRSDRPPMVFHWIPWFGSAIPYGTRPYEFFAECQAKYGDIFSFVLLGKVMTV
                     YLGTKGHEFVFNAKLADVSAEAAYTHLTTPVFGKGVIYDCPNSRLMEQKKFCKGALSK
                     EAFQSYVPLMVEEVYKYFRTSPNFNMNEKSSGKIDVMVTQPEMTIFTASRTLLGKEMR
                     DKLDTGFAYLFGDLDKGFIPVNFVFPNLPLAVNKKRDEAQRTISSTYISLIEERRKNN
                     DIQDRDLIDSLMKNSTYKDGVKMTDQEIANLLIGVLMGGQHTSAATSAWALLHLAERP
                     DVQQELYDEQMRVLDNGKKEVTYDLLQQMPKLNQMIKETLRLHHPLHSLFRKVMRDIQ
                     VPNTSYVVPKNYHVLVSPGYCHLQDKYFPNAHTFDLHRWDDDPASSSSGGEQVDYGFG
                     AISKGVSSPYLPFGGGRHRCIGEHFAFLQLGVLMSIFIRTIKWRFPEGKTVPQPDFQS
                     MVTLPIGPAEVVWGKRNPEQKI"
     gene            complement(<813739..>814899)
                     /gene="TDEL0A04560"
                     /locus_tag="TDEL_0A04560"
                     /db_xref="GeneID:11502903"
     mRNA            complement(<813739..>814899)
                     /gene="TDEL0A04560"
                     /locus_tag="TDEL_0A04560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678951.1"
                     /db_xref="GeneID:11502903"
     CDS             complement(813739..814899)
                     /gene="TDEL0A04560"
                     /locus_tag="TDEL_0A04560"
                     /inference="similar to DNA sequence:INSDC:YDR465C"
                     /note="similar to Saccharomyces cerevisiae RMT2 (YDR465C);
                     ancestral locus Anc_5.589"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003678999.1"
                     /db_xref="GeneID:11502903"
                     /db_xref="GOA:G8ZME4"
                     /db_xref="InterPro:IPR017408"
                     /db_xref="InterPro:IPR026480"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZME4"
                     /translation="MSDLHHLLTFPTRPIGQDYLTSLQEYLSSGIPSTYTLEQAAAFM
                     KDGSDDVGESSSNTTPLHILARSLPLDLSQQETDVVLEMMNTLFEYGAGWNFIDYENK
                     TIGDLLLERNQKRDGPLYSRVVEAGVTAELLHRKINGGEIEFIEDPTDVEPQVIEPTE
                     EEIADHTADDQDTYLDTKLEYTEGFLVTKENRDGVMMDWETDIMDLAAKTICPPAREL
                     TVLNIGFGMGIIDGLIQSHHPHKHYICEAHPDVLAKMKADGWYDRPNVVVLEGRWQDS
                     LNALLDEGTVFFDGIYYDTFSEHYDDMLDLYSVVVGLLKPDGVFSFFNGLGADRSLCY
                     DVYRRIVALDVQDYGLECQYTTVPVTIDQQWHSVKRSYYNCNYYYHPRITFR"
     gene            complement(<815013..>815711)
                     /gene="TDEL0A04570"
                     /locus_tag="TDEL_0A04570"
                     /db_xref="GeneID:11502908"
     mRNA            complement(<815013..>815711)
                     /gene="TDEL0A04570"
                     /locus_tag="TDEL_0A04570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678952.1"
                     /db_xref="GeneID:11502908"
     CDS             complement(815013..815711)
                     /gene="TDEL0A04570"
                     /locus_tag="TDEL_0A04570"
                     /inference="similar to DNA sequence:INSDC:YHR008C"
                     /note="similar to Saccharomyces cerevisiae SOD2 (YHR008C);
                     ancestral locus Anc_5.590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679000.1"
                     /db_xref="GeneID:11502908"
                     /db_xref="GOA:G8ZME5"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019831"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="InterPro:IPR019833"
                     /db_xref="UniProtKB/TrEMBL:G8ZME5"
                     /translation="MFAKNCVNSVRRAALNGTFVAKRTKVTLPELDWDFNALEPYISG
                     QINELHYTKHHQTYVNGFNTAVEQLSDLKEQLGKDPSPTIARKIIGVQQNLKFHGGGY
                     TNHCLFWKNLTPESQGGGQLPKGAFADQIKQQFGSLDNLIKLTNAKLAGVQGSGWAFI
                     VRNLDNGGKLDVVQTYNQDTVTGSLIPLVAIDAWEHAYYLQYQNRKAEYFGAIWNVIN
                     WKEAARRYDSCEIN"
     gene            <816247..>818331
                     /gene="TDEL0A04580"
                     /locus_tag="TDEL_0A04580"
                     /db_xref="GeneID:11503120"
     mRNA            <816247..>818331
                     /gene="TDEL0A04580"
                     /locus_tag="TDEL_0A04580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678953.1"
                     /db_xref="GeneID:11503120"
     CDS             816247..818331
                     /gene="TDEL0A04580"
                     /locus_tag="TDEL_0A04580"
                     /inference="similar to DNA sequence:INSDC:YDR466W"
                     /note="similar to Saccharomyces cerevisiae PKH3 (YDR466W);
                     ancestral locus Anc_5.591"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679001.1"
                     /db_xref="GeneID:11503120"
                     /db_xref="GOA:G8ZME6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZME6"
                     /translation="MNDARKRSPHDFVFKQELGHGSYSTVYKAVDRTNANRVYAIKVC
                     SKQHIIKEKKVKYVTIEKNTLNLLTRARHPGIVKLHYTFHDEENLYFVLDYAPGGELL
                     SLLHRMKTFSEMWACHFTCQLIDSMQFLHSQGIIHRDLKPENLLLNNEGRLMITDFGT
                     ATGTDSRGSSFVGTAEYVSPELLLHNQCDVSSDIWALGCMIYQFLQGSPPFRGENELQ
                     TFEKTVSLDYPWNNPQVTPKGINPVVVDLTRRILVLDPSVRPTLQQIKLHKWFELVDW
                     NNKELLWRGIWQIQQAVPRSPHQMISNRQLHVIDTPIRNIPITKQKKRKPAKVSNTTS
                     SIVEWRKNWACSGVDPLTPSDSPTQGYTPLNNRPSSPAFIQPTVRSAPVSHHPPIHKS
                     PVRKSSSSSLPRLMVDTQKSANGIPSINSSPIDMPINTVSKAIVAHDNFALKQDCVII
                     YEIPYYLQGPEMSLKSYNRVDNDLITQLVQEHDVELRSRLVSFLTLFKDGTLSYRTES
                     SSRHIINIGDPNLSMYDFDFNQEKGTGFLILERYRNKIWFISIPSKKQTPVGSIKNKD
                     ESWVACFFRARQLMEDQKSLSDKVAGIKLTEPIKTTRPISSKAQRNASSPVLGSKSQQ
                     QRKASASRSPATSPVLVQSPTMKRYAAPQNMVISSSRYEVLHSLRPNSANDDASSGAS
                     AAFKNLQKRKAK"
     gene            complement(<818441..>820048)
                     /gene="TDEL0A04590"
                     /locus_tag="TDEL_0A04590"
                     /db_xref="GeneID:11502801"
     mRNA            complement(<818441..>820048)
                     /gene="TDEL0A04590"
                     /locus_tag="TDEL_0A04590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678954.1"
                     /db_xref="GeneID:11502801"
     CDS             complement(818441..820048)
                     /gene="TDEL0A04590"
                     /locus_tag="TDEL_0A04590"
                     /inference="similar to DNA sequence:INSDC:YHR009C"
                     /note="similar to Saccharomyces cerevisiae YHR009C;
                     ancestral locus Anc_5.592"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679002.1"
                     /db_xref="GeneID:11502801"
                     /db_xref="GOA:G8ZME7"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="UniProtKB/TrEMBL:G8ZME7"
                     /translation="MATDFIDKLTFLSHPSGKSQGKHHIVIVGAGIIGVCTAYYLTRH
                     PDFHPDTHHITILESKRVAGGASGKAGGLLASWAFPQQIVPLSFRLHQELSDEYDGGN
                     VWDYRRLTTVSLEADVEDLCGAECSKRDGESCSCVSSCSSSSSSSSSCKSSSSQTSGL
                     KVPVPKKKRNNDILSGCEAEDEDSGRSSSFFHSDSNLNSLSMGPRDRDPADQIDFNDA
                     NDFQPQSREITGDLAADDMRNNNASIDEAKGPSVPLPGDLNWIKKHLVNDWSSLGGTD
                     STAQVHPYKFTHFLLSKAMESNAVDLILGKVDQIQYNDSGACCGISYTPTAETEFAST
                     ATTQRSVNIDDSSHVVLAMGPWTSKILPDCPISGLRAHSITIKPSTGTVSPYAIFTEL
                     KIDKNQYFSPEMYARKDEVYVCGEGDTLVDLPETSDAVEVVREKCDELYHYVSKLSKN
                     LSSGHILKRQACYLPVLNVPTSSGPLIGETNVDGLYVASGHSCWGINNAPATGKVMAE
                     LLLEGEAKSADISALDPGLYFDASILE"
     gene            complement(<820500..>821120)
                     /gene="TDEL0A04600"
                     /locus_tag="TDEL_0A04600"
                     /db_xref="GeneID:11502968"
     mRNA            complement(<820500..>821120)
                     /gene="TDEL0A04600"
                     /locus_tag="TDEL_0A04600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678955.1"
                     /db_xref="GeneID:11502968"
     CDS             complement(820500..821120)
                     /gene="TDEL0A04600"
                     /locus_tag="TDEL_0A04600"
                     /inference="similar to DNA sequence:INSDC:YDR468C"
                     /note="similar to Saccharomyces cerevisiae TLG1 (YDR468C);
                     ancestral locus Anc_5.593"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679003.1"
                     /db_xref="GeneID:11502968"
                     /db_xref="GOA:G8ZME8"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:G8ZME8"
                     /translation="MNAEQDPFEQVVRDTKEQIDRLRHHLSGNGPRNDSDEVAEILGD
                     VEETIKDLDRSVIVMKRNGQDTGGRGSQVEDLRNALQALKYQPRVLIDEEEEEEPSAA
                     SRENPFNNPLQEQMIREQDTHLDSIHHTMTNLHLQAQTMGNELEDQGELLNEMDTNMD
                     SLSNKLSRGRRQLEWVYEKNKERYNDCCIGLLIVVLIVLLVLAFIA"
     gene            <821238..>821447
                     /gene="TDEL0A04610"
                     /locus_tag="TDEL_0A04610"
                     /db_xref="GeneID:11503100"
     mRNA            <821238..>821447
                     /gene="TDEL0A04610"
                     /locus_tag="TDEL_0A04610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678956.1"
                     /db_xref="GeneID:11503100"
     CDS             821238..821447
                     /gene="TDEL0A04610"
                     /locus_tag="TDEL_0A04610"
                     /inference="similar to DNA sequence:INSDC:YDR469W"
                     /note="similar to Saccharomyces cerevisiae SDC1 (YDR469W);
                     ancestral locus Anc_5.594"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679004.1"
                     /db_xref="GeneID:11503100"
                     /db_xref="InterPro:IPR007858"
                     /db_xref="UniProtKB/TrEMBL:G8ZME9"
                     /translation="MNEEQPRHDDLNLVNLPETVGGSQTRKYLNQNVVPHLLNGMRLI
                     ATEKPQDPLRVLGEYLIKQSESSKN"
     gene            complement(<821476..>822918)
                     /gene="TDEL0A04620"
                     /locus_tag="TDEL_0A04620"
                     /db_xref="GeneID:11503244"
     mRNA            complement(<821476..>822918)
                     /gene="TDEL0A04620"
                     /locus_tag="TDEL_0A04620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678957.1"
                     /db_xref="GeneID:11503244"
     CDS             complement(821476..822918)
                     /gene="TDEL0A04620"
                     /locus_tag="TDEL_0A04620"
                     /inference="similar to DNA sequence:INSDC:YDR470C"
                     /note="similar to Saccharomyces cerevisiae UGO1 (YDR470C);
                     ancestral locus Anc_5.595"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679005.1"
                     /db_xref="GeneID:11503244"
                     /db_xref="GOA:G8ZMF0"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8ZMF0"
                     /translation="MEEPGSRLQVRPYYNPESFNAGYSAVFRPDQGVIDANGQSIASK
                     LNIVQTSGKNLAKRIGKGASSSGSLLSGLSLNNGKRLLSKVSAGDNGDSPKSIADMEW
                     LDFLNLKAWKRIFGQLFDQFFRKYFRHLVQQPFEVARCLLQVGDFGQLDALEVPAPVE
                     LRDEEDDNEEIDFFPKANDQELLPNLEEDELERSLINNPDKYSPTAGNEMLIRPQSKH
                     TIDIINSVMDNEGMKGLWKANNTTFIYNFLSLTLDAWFTGLISPFLGVPDPYFMDIIH
                     SPDVKSSIILTLTASTLTKLILLPLDIIRTRFMVTSLRKGSKPIRSLRKLVRCWSWRA
                     DIRRVPGDMWILTILQSISNVTFNKIFDVVIYHQWNVERHSQVKWYNTFKLLSQTVEL
                     LVRLPLENLLRRCQVNFLVNDSRHPLKIEHADLIVKPIGYRGIWNSLRDPRTSSGLWN
                     GWRVGLMSLCCGYGFEMISTDAVDLEQEKF"
     gene            <824136..>824713
                     /gene="TDEL0A04630"
                     /locus_tag="TDEL_0A04630"
                     /db_xref="GeneID:11502535"
     mRNA            join(<824136..824166,824334..>824713)
                     /gene="TDEL0A04630"
                     /locus_tag="TDEL_0A04630"
                     /product="60S ribosomal protein L27"
                     /transcript_id="XM_003678958.1"
                     /db_xref="GeneID:11502535"
     CDS             join(824136..824166,824334..824713)
                     /gene="TDEL0A04630"
                     /locus_tag="TDEL_0A04630"
                     /inference="similar to DNA sequence:INSDC:YDR471W,YHR010W"
                     /note="similar to Saccharomyces cerevisiae RPL27B
                     (YDR471W) and RPL27A (YHR010W); ancestral locus Anc_5.597"
                     /codon_start=1
                     /product="60S ribosomal protein L27"
                     /protein_id="XP_003679006.1"
                     /db_xref="GeneID:11502535"
                     /db_xref="GOA:G8ZMF1"
                     /db_xref="InterPro:IPR001141"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:G8ZMF1"
                     /translation="MAKFLKAGKVAVVVRGRYAGKKVVIVKPHDEGSKAHPFGHALVA
                     GIERYPLKVTKKHGAKKVAKRTKIKPFIKVINYNHLLPTRYTLDVESFKTVVSTETFE
                     EPSQREEAKKVIKKAFEERHQAGKNQWFFSKLSF"
     gene            <824952..>826289
                     /gene="TDEL0A04640"
                     /locus_tag="TDEL_0A04640"
                     /db_xref="GeneID:11503370"
     mRNA            <824952..>826289
                     /gene="TDEL0A04640"
                     /locus_tag="TDEL_0A04640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678959.1"
                     /db_xref="GeneID:11503370"
     CDS             824952..826289
                     /gene="TDEL0A04640"
                     /locus_tag="TDEL_0A04640"
                     /inference="similar to DNA sequence:INSDC:YHR011W"
                     /note="similar to Saccharomyces cerevisiae DIA4 (YHR011W);
                     ancestral locus Anc_5.598"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679007.1"
                     /db_xref="GeneID:11503370"
                     /db_xref="GOA:G8ZMF2"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002317"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR010978"
                     /db_xref="UniProtKB/TrEMBL:G8ZMF2"
                     /translation="MISKRSFSQTALKRFLKKPQFNVKSIVNDLPQYRESIAKRQLVA
                     GAGLLEGLQNLPEAYETIRGLNHKIALVQGQRKSLEAEIKNDRSKIEVRASEIKSLKS
                     QYQLISKELDLAELKVTDMCSSLPNLVSPNSPATEPQIVHWINPQDSYEPDAKRDHVN
                     IMVEKGLVDFQTASNVSGTSWFYLLNEGAELEQALVSYALKQAKEAGFQVCIPPSIVR
                     NEVIDSCGFRPRDMNNEQQIYHINDTSLGLTATAEIALAGLGINKVMDLSKGPRSVVG
                     VSRSYRAEAGARGKDTKGLYRVHEFTKVELFVWAKPEESTRLLEKLKDLQIDIVTSLG
                     LSAKVLNMPANDLGAPAYKKYDIEAWMPGRGSFGEITSSSNCLDYQSRRLNTRFKNEL
                     TGKPEYVHTLNGTAMAVPRVILALIENFYCPTTGKITIPEPLRPFMNNRTCIE"
     gene            <826606..>827442
                     /gene="TDEL0A04650"
                     /locus_tag="TDEL_0A04650"
                     /db_xref="GeneID:11502738"
     mRNA            join(<826606..826653,826726..>827442)
                     /gene="TDEL0A04650"
                     /locus_tag="TDEL_0A04650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678960.1"
                     /db_xref="GeneID:11502738"
     CDS             join(826606..826653,826726..827442)
                     /gene="TDEL0A04650"
                     /locus_tag="TDEL_0A04650"
                     /inference="similar to DNA sequence:INSDC:YHR012W"
                     /note="similar to Saccharomyces cerevisiae VPS29
                     (YHR012W); ancestral locus Anc_5.599"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679008.1"
                     /db_xref="GeneID:11502738"
                     /db_xref="InterPro:IPR000979"
                     /db_xref="InterPro:IPR024654"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8ZMF3"
                     /translation="MLVLALSDAHIPDRAIDLPDKFKKLLSVPNKISQVVLLDNCTKS
                     YDLLKFVNEVSPNVAIVRGEFDNAQLPTTKKNRIKESIPINTVIRQGNFKIGCCSGYT
                     VVPKGDPLSLLALARQLDVDIMLWGGTHNVEAYTLEGKFFVNPGSCTGAFNSDWPIMS
                     EDEVINKKETTEVDTNKQDEESAVKSEEPKETTSTDKKEKVEISNLDINGSNVPSFCL
                     LDIQDSVCTLYIYIYIEGEVKVDRVVFKKEETQIQP"
     gene            complement(<827824..>828483)
                     /gene="TDEL0A04660"
                     /locus_tag="TDEL_0A04660"
                     /db_xref="GeneID:11503342"
     mRNA            complement(<827824..>828483)
                     /gene="TDEL0A04660"
                     /locus_tag="TDEL_0A04660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678961.1"
                     /db_xref="GeneID:11503342"
     CDS             complement(827824..828483)
                     /gene="TDEL0A04660"
                     /locus_tag="TDEL_0A04660"
                     /inference="similar to DNA sequence:INSDC:YHR013C"
                     /note="similar to Saccharomyces cerevisiae ARD1 (YHR013C);
                     ancestral locus Anc_5.600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679009.1"
                     /db_xref="GeneID:11503342"
                     /db_xref="GOA:G8ZMF4"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G8ZMF4"
                     /translation="MPVTIRRATIDDIICMQNANLHNLPENYMLKYYMYHVLSWPEAS
                     FVATTTDVNEPGLEDLTLEDGAGKQIKLNSNYVAPGEKLVGYVLTKMNDDPDQQNEAP
                     NGHITSLSVMRTYRRMGIAEKLMRQALFALREVYQADYVSLHVRQSNRAALHLYRDTL
                     EFEVLTVEKSYYQDGEDAYAMKKVLKLDELHPKNFAHPKSSTERPEDDLESDLLEDVA
                     V"
     gene            <828655..>829506
                     /gene="TDEL0A04670"
                     /locus_tag="TDEL_0A04670"
                     /db_xref="GeneID:11502960"
     mRNA            <828655..>829506
                     /gene="TDEL0A04670"
                     /locus_tag="TDEL_0A04670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678962.1"
                     /db_xref="GeneID:11502960"
     CDS             828655..829506
                     /gene="TDEL0A04670"
                     /locus_tag="TDEL_0A04670"
                     /inference="similar to DNA sequence:INSDC:YDR472W"
                     /note="similar to Saccharomyces cerevisiae TRS31
                     (YDR472W); ancestral locus Anc_5.601"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679010.1"
                     /db_xref="GeneID:11502960"
                     /db_xref="InterPro:IPR007194"
                     /db_xref="InterPro:IPR016696"
                     /db_xref="InterPro:IPR024096"
                     /db_xref="UniProtKB/TrEMBL:G8ZMF5"
                     /translation="MSQRIILPSTSDEGVFNNSEGYEYTIGPKQSLPNEASMAMIPSR
                     LYNESLMFRKQEVSLSATTFLFQGMVSYIHSHSKSSTEFESTLNEHGFSIGSKLLELL
                     NLRASIPATAHSRTSNFLGTSASSNNALNETAGSATGSGANSLGASEHIYHNHENGSD
                     SIASLITNTRSRDLKILDMLQFVHGTVWSYLFGHVSDDLVKSSERDNEYMIVDNRPVL
                     TQFIPGGVSCDYFVCGIIQGFLNTAEFPCKVSAHCMPQNGFDRRVVYLIQFDKHVLER
                     EGLRFGQ"
     gene            <829629..>830543
                     /gene="TDEL0A04680"
                     /locus_tag="TDEL_0A04680"
                     /db_xref="GeneID:11502591"
     mRNA            <829629..>830543
                     /gene="TDEL0A04680"
                     /locus_tag="TDEL_0A04680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678963.1"
                     /db_xref="GeneID:11502591"
     CDS             829629..830543
                     /gene="TDEL0A04680"
                     /locus_tag="TDEL_0A04680"
                     /inference="similar to DNA sequence:INSDC:YHR014W"
                     /note="similar to Saccharomyces cerevisiae SPO13
                     (YHR014W); ancestral locus Anc_5.602"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679011.1"
                     /db_xref="GeneID:11502591"
                     /db_xref="UniProtKB/TrEMBL:G8ZMF6"
                     /translation="MQRKRFRVIPESEKPLQPKTTNVRTALVDTSSKTHSTKKTGSSS
                     NKRKTSAAGEPKKRRKHNPGTVFESEDVRIKLVDQASKSAKSLDGACSTETQLGDPSP
                     HGRLTKIDEEDDSLKLGDFDQPPQSTSTPILCSSPRYEPEQESSPFMVNELGRPSLMF
                     YSPTAHPYYSQHSFRGNSQSQWRCFQEPERCSTHFVGANYHYLPSQPISVAQQPEPYM
                     QMNYPAALVPPGIQGQPEYQVVYPSAIRGYHGMLPPGYPMTPYLRLPNNGLSTSNNST
                     PSYKSSGGEATYRSSEQGSKKGTGTGSV"
     gene            complement(830679..830760)
                     /gene="TDEL0Atrna9S"
                     /locus_tag="TDEL_0Atrna9S"
                     /db_xref="GeneID:11503126"
     tRNA            complement(830679..830760)
                     /gene="TDEL0Atrna9S"
                     /locus_tag="TDEL_0Atrna9S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCU"
                     /db_xref="GeneID:11503126"
     gene            <831207..>832985
                     /gene="TDEL0A04690"
                     /locus_tag="TDEL_0A04690"
                     /db_xref="GeneID:11503178"
     mRNA            <831207..>832985
                     /gene="TDEL0A04690"
                     /locus_tag="TDEL_0A04690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678964.1"
                     /db_xref="GeneID:11503178"
     CDS             831207..832985
                     /gene="TDEL0A04690"
                     /locus_tag="TDEL_0A04690"
                     /inference="similar to DNA sequence:INSDC:YOR023C"
                     /note="similar to Saccharomyces cerevisiae AHC1 (YOR023C);
                     ancestral locus Anc_5.603"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679012.1"
                     /db_xref="GeneID:11503178"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8ZMF7"
                     /translation="MDDQSDSMSMHNSIGASNASGTVAGQVLFMDSHDVPPRTNPHPP
                     HSGYYQVATPKSPHELILDDQDVDLASQRDNFHDPNSRHGHDGDKRQDSLMGRLAGES
                     EETERLKYETAKTEILEKLHLQTLISHKEAQGIQREIKRVDAQMTLLRKLHDDQELQK
                     KVEEHTERQNDRVRRQLLEANTVANSSGYLADMSTFSSFAGFSSNPPLSAGSFIPTHH
                     YHTRSKSSGNVTEVAHLRPANSTIIDMRLAGSKSIPTGTNQFHDLGPDVQSFRPNQMN
                     MHHRRNYSSTCLTSNSGVVGKNEDNEAIFRRYDGILIIIKCSFCPRSGFTSAQGIVNH
                     TRLKHGKTYSSQPLAVLHNQKLIEEKKQDPQVLEKFKELGKDPYKEYLPSEVAIPCSA
                     PKSNQREPSPKQTNIKNKDAVSESQSPRLTNHLKKLYNKGDFEDLVEMVNDASKDLEV
                     VLKQPSPESSESEEDDGKQETESESAAASSVNSNTPNAESSSSKPESTQAPSTSPLEK
                     AIGGNQETSSTASPSPAASGQRRSSRKRKNEQREIAKELQERARPAEKKARPDVLALT
                     SVPEHDKRSSHYNLRAKSKLRNNSFH"
     gene            <833165..>835153
                     /gene="TDEL0A04700"
                     /locus_tag="TDEL_0A04700"
                     /db_xref="GeneID:11502681"
     mRNA            <833165..>835153
                     /gene="TDEL0A04700"
                     /locus_tag="TDEL_0A04700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678965.1"
                     /db_xref="GeneID:11502681"
     CDS             833165..835153
                     /gene="TDEL0A04700"
                     /locus_tag="TDEL_0A04700"
                     /inference="similar to DNA sequence:INSDC:YOR022C"
                     /note="similar to Saccharomyces cerevisiae YOR022C;
                     ancestral locus Anc_5.604"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679013.1"
                     /db_xref="GeneID:11502681"
                     /db_xref="GOA:G8ZMF8"
                     /db_xref="InterPro:IPR004177"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8ZMF8"
                     /translation="MYLRPLVRVVFVQKCFLSTAAGGSVSKGPTLWYHASDVPLTKPY
                     DSKYKPSKPAEKFVKFSASDCRRLEGAFQKWSKSQKETKELTSVPVNEDFLFEVNIPK
                     MVLKPTYWRGPTYEVRRGIWMNANNNPLAYELTAEIERFYAKMDSSLEGDKEQEKQDL
                     FRFTQPYGKHRMVLFVDKTTAYLLPDLKGGELQLKLLRTNLIPPMGDKITRGSSSNHL
                     TDAAASAKRTIENEIQGTTKQLGKLSDLISWELPSVFGMPDSKDSTKGNDDDSDVFKR
                     EIETDYDNDATTPQRDVKHLVLCVHGIGQNLGKKYEYVNFAHTVNILRTNMKKLYMES
                     GKLQKMNRGDGSSDWRENCNVQVLPISWRHTVGFQTDATQPNKENPELPPLGDITLNG
                     VLGLRRLLGDIALDILLYGEPYYRKRILDEVKKHLNDTYNLFKERNPGFGGEVHLIGH
                     SLGSLILFDILCEQDDFKLDFDVKNFYSIGSPTGVFKLIQRTKIGSKQDEPEETSTSF
                     QKPKCENLYNLFHVCDPISYRMEPLVELSMAQYQAANISHWSAGDGIASRVLEFGGSI
                     LKDIPGTAIKGQKPGNGKTMLPVDVVEKLTKLNRTGRIDYMLPPGFLEVDIIAAAKAH
                     VSYFEEPDIAGFILKEILAKNHGNHDVIVTKLNRSSDA"
     gene            <835259..>835897
                     /gene="TDEL0A04710"
                     /locus_tag="TDEL_0A04710"
                     /db_xref="GeneID:11503383"
     mRNA            <835259..>835897
                     /gene="TDEL0A04710"
                     /locus_tag="TDEL_0A04710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678966.1"
                     /db_xref="GeneID:11503383"
     CDS             835259..835897
                     /gene="TDEL0A04710"
                     /locus_tag="TDEL_0A04710"
                     /inference="similar to DNA sequence:INSDC:YOR021C"
                     /note="similar to Saccharomyces cerevisiae YOR021C;
                     ancestral locus Anc_5.605"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679014.1"
                     /db_xref="GeneID:11503383"
                     /db_xref="InterPro:IPR007364"
                     /db_xref="UniProtKB/TrEMBL:G8ZMF9"
                     /translation="MKYIIEHMEQDFSQWVTLEYAQIIRDIGAENLILSSLPEGTTES
                     EIPDKLLHMGLRWTTKDLNHLTEEFKDLQPLQNGRVCLLDPRADQDLQPAETEQFDYF
                     VFGGILGDHPPRDRTTEIKVAYPDLVVGRRLGDKQMTTDTAIRTTQQIIEKGKKFQDI
                     HFIDYPEFRFSKNEATEMPFRYILDAQNNPILPEGMLALIKRDSEQSLDDLL"
     gene            complement(<835932..>836150)
                     /gene="TDEL0A04720"
                     /locus_tag="TDEL_0A04720"
                     /db_xref="GeneID:11502650"
     mRNA            complement(<835932..>836150)
                     /gene="TDEL0A04720"
                     /locus_tag="TDEL_0A04720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678967.1"
                     /db_xref="GeneID:11502650"
     CDS             complement(835932..836150)
                     /gene="TDEL0A04720"
                     /locus_tag="TDEL_0A04720"
                     /inference="similar to DNA sequence:INSDC:YOR020W-A"
                     /note="similar to Saccharomyces cerevisiae YOR020W-A;
                     ancestral locus Anc_5.606"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679015.1"
                     /db_xref="GeneID:11502650"
                     /db_xref="InterPro:IPR021278"
                     /db_xref="UniProtKB/TrEMBL:G8ZMG0"
                     /translation="MSPAYKILGMSVQPHVLAIGTLLATGAGVYLGTGKNEDQNKAES
                     KEPVKQGESEVDVEKLLNQFLESETEKK"
     gene            <836718..>837038
                     /gene="TDEL0A04730"
                     /locus_tag="TDEL_0A04730"
                     /db_xref="GeneID:11503226"
     mRNA            <836718..>837038
                     /gene="TDEL0A04730"
                     /locus_tag="TDEL_0A04730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678968.1"
                     /db_xref="GeneID:11503226"
     CDS             836718..837038
                     /gene="TDEL0A04730"
                     /locus_tag="TDEL_0A04730"
                     /inference="similar to DNA sequence:INSDC:YOR020C"
                     /note="similar to Saccharomyces cerevisiae HSP10
                     (YOR020C); ancestral locus Anc_5.607"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679016.1"
                     /db_xref="GeneID:11503226"
                     /db_xref="GOA:G8ZMG1"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR018369"
                     /db_xref="InterPro:IPR020818"
                     /db_xref="UniProtKB/TrEMBL:G8ZMG1"
                     /translation="MSTLLNSAKSIVPLLDRVLVQRVKAQAKTASGLYLPEKNVEKLN
                     QGTVLAVGPGFTDANGNKVAPQVKVGDQVLIPQYGGSSIKLKDDEEVILFRDSEILAK
                     INDA"
     gene            complement(<837071..>838354)
                     /gene="TDEL0A04740"
                     /locus_tag="TDEL_0A04740"
                     /db_xref="GeneID:11502893"
     mRNA            complement(<837071..>838354)
                     /gene="TDEL0A04740"
                     /locus_tag="TDEL_0A04740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678969.1"
                     /db_xref="GeneID:11502893"
     CDS             complement(837071..838354)
                     /gene="TDEL0A04740"
                     /locus_tag="TDEL_0A04740"
                     /inference="similar to DNA sequence:INSDC:YDR473C"
                     /note="similar to Saccharomyces cerevisiae PRP3 (YDR473C);
                     ancestral locus Anc_5.608"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679017.1"
                     /db_xref="GeneID:11502893"
                     /db_xref="GOA:G8ZMG2"
                     /db_xref="InterPro:IPR010541"
                     /db_xref="InterPro:IPR013881"
                     /db_xref="InterPro:IPR027104"
                     /db_xref="UniProtKB/TrEMBL:G8ZMG2"
                     /translation="MARKVGKESDHDGKQSRGLQTEINPLLLSSNLNLIKEQYRNANP
                     YLSTSTLRSNDKVTKRLERGLKFHEKGEVSSQIERQREEQRLEYERQKEQEILNKIRR
                     EKEQAETSAKIARGELPDTKVGEDKYIRRIEDVPEVEWWDKPYLDDQLNVLPKYQGGY
                     EEESESDEEDEVPSIQYVHHPVPIKVHNPKPTTKVYLTKKEQKKIRRNKRKFEREEKE
                     TRIKMGLDPKPEPKVKLSNMMSVYENNQNITDPTQWEHTVIEQVEQRKRKHLETNMIR
                     HEEAVKRRKESKKVELSTDNCCKVFRFKSLANPKIRFKLNTNSKQLALRGACLRVGDQ
                     GEGMIIVVGSEKSCKFFERLVLERIKWDEPFRDRATDTLIETPNNHAEKVWQGYLECS
                     KFPRWFMKVCRDDLELKNTLRQFDAEHFLTDVSHT"
     gene            complement(<838492..>840672)
                     /gene="TDEL0A04750"
                     /locus_tag="TDEL_0A04750"
                     /db_xref="GeneID:11503058"
     mRNA            complement(<838492..>840672)
                     /gene="TDEL0A04750"
                     /locus_tag="TDEL_0A04750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678970.1"
                     /db_xref="GeneID:11503058"
     CDS             complement(838492..840672)
                     /gene="TDEL0A04750"
                     /locus_tag="TDEL_0A04750"
                     /inference="similar to DNA sequence:INSDC:YDR475C,YOR019W"
                     /note="similar to Saccharomyces cerevisiae JIP4 (YDR475C)
                     and YOR019W; ancestral locus Anc_5.609"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679018.1"
                     /db_xref="GeneID:11503058"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G8ZMG3"
                     /translation="MFLEDNTESLKNTYKTVKLYPELQGTGKGDKKLEDDMVVRQKFK
                     PCVSFNTFPSYMGDDNGDDGLDFPGVQIPNEYTMEEYYDDESGYMSNNMEYFLRNNYL
                     TDNSKFGGSPPPRNLSDKAAALNSMFRIAQNGKIVRVDYPTTPTITNDAIIINRAQPG
                     WSSAWLARKSRIEERIKEKQTHFRFPHITFPQQPLTKKRIISHDGYTPISKDERRRER
                     VLQEKVGFPNSPKTILCHVSGRRHTWVALDWAVRELAQSTDHIVVVANIPRFATANYG
                     RSRSNNRFGAPNGRHRSRSAEPKSAYITESQGGSAEWTSGYSAEMVSNKLEDILTYIA
                     VIVPKDIKVKVTVEIVIGKTKKILVDAMNVYTPDFCISTTLKWQRTDSLILWKAKNLT
                     DILCTKYPIPVVVIPVKRMYEFEAALQKDFAPKENTGSSSEDVSSQSVDQPSRPDGQA
                     PQSPTICLEASDMDSESDFSDSNSDGASVSTTSKEDLIEATKKHREEISEGLKELDGK
                     EHKTAMQKNTDKLDLITQASLTFAMQVQNMNQEDREAGFTQLKRVITGETENKTHTVR
                     SMVDVGSYPKKSHNKHVPSTKPRTSQIKFASNVNARDGNRALGNSKIKVTSPESSPPP
                     PTHPRSSHDEPLRKTKSSQPTSIRKVRSASNISRVKSNESMTSSGSSSSGRKKGGFLS
                     IFRHSGSRSRSTSRRNSDASDTDAVSLNDSDSGKKRRSRLFGFG"
     gene            complement(<841005..>841718)
                     /gene="TDEL0A04760"
                     /locus_tag="TDEL_0A04760"
                     /db_xref="GeneID:11502868"
     mRNA            complement(<841005..>841718)
                     /gene="TDEL0A04760"
                     /locus_tag="TDEL_0A04760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678971.1"
                     /db_xref="GeneID:11502868"
     CDS             complement(841005..841718)
                     /gene="TDEL0A04760"
                     /locus_tag="TDEL_0A04760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679019.1"
                     /db_xref="GeneID:11502868"
                     /db_xref="GOA:G8ZMG4"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZMG4"
                     /translation="MGGSLLRSWIDSLWSRILSIFLFQKELSIAIIGLQNSGKTTLTH
                     MLGGRPFEQDTVPTLGIQVSQFSLENSLIKVYDLGGQTRFQSLWERCFSKVDLIIYMI
                     DLSDTMTLDESFEKLSKVMQMTQEDRIPMLVIGNKIDLIQEPKEKQTIATIPTYNYDS
                     SERLRIDSTNSHLLKNADVLTRQVGVDLKNRQLHIPLRSSESQDIDVLPLNRDIAVFT
                     MSCRNGLCISNVIDWIVQL"
     gene            complement(<841847..>842491)
                     /gene="TDEL0A04770"
                     /locus_tag="TDEL_0A04770"
                     /db_xref="GeneID:11502915"
     mRNA            complement(<841847..>842491)
                     /gene="TDEL0A04770"
                     /locus_tag="TDEL_0A04770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678972.1"
                     /db_xref="GeneID:11502915"
     CDS             complement(841847..842491)
                     /gene="TDEL0A04770"
                     /locus_tag="TDEL_0A04770"
                     /inference="similar to DNA sequence:INSDC:YDR476C"
                     /note="similar to Saccharomyces cerevisiae YDR476C;
                     ancestral locus Anc_5.610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679020.1"
                     /db_xref="GeneID:11502915"
                     /db_xref="InterPro:IPR019595"
                     /db_xref="UniProtKB/TrEMBL:G8ZMG5"
                     /translation="MSKAAQQAIVAHMNRDHRLALEDYLYVYGKVPITSHIRFVRMQN
                     IELECMTLQFTHMELETDVEKIILLEPPLKDWNEARPRLVEMAHSAAAKRGLSTIQVN
                     DMRYPSTVAEYALICAIFLPFLCYKFRGLLQWLPLPSVVLKFLDNDLVLGGIILFAVV
                     THLIEVVAILRPKLHFYRVPTDFLIEWYVFGMLEGYPCIKRLDRLAGELLKRQN"
     gene            <842715..>844580
                     /gene="TDEL0A04780"
                     /locus_tag="TDEL_0A04780"
                     /db_xref="GeneID:11502907"
     mRNA            <842715..>844580
                     /gene="TDEL0A04780"
                     /locus_tag="TDEL_0A04780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678973.1"
                     /db_xref="GeneID:11502907"
     CDS             842715..844580
                     /gene="TDEL0A04780"
                     /locus_tag="TDEL_0A04780"
                     /inference="similar to DNA sequence:INSDC:YDR477W"
                     /note="similar to Saccharomyces cerevisiae SNF1 (YDR477W);
                     ancestral locus Anc_5.611"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679021.1"
                     /db_xref="GeneID:11502907"
                     /db_xref="GOA:G8ZMG6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR013896"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR028375"
                     /db_xref="UniProtKB/TrEMBL:G8ZMG6"
                     /translation="MSNNSRVESGSGHRHHHHHHHHHGHGSGQRSTLADGSRIGNYQI
                     VKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHI
                     IKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMSEKEARRFFQQIISAVEYCHRHKI
                     VHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGP
                     EVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIV
                     NPLNRISIHEIMQDEWFKVDLPDYLIPADLKHQQPENEEAQTAAENGPHQEEIDDDLV
                     NALSKTMGYEKDEIYESLESGHDSSALNEIRDAYNLIKENKSLIKDLKSDKSTCDELD
                     TFLAQSPPTFQQRSTSDVNNQTNAAVGAQAPQQQASSRKMAAQQRTYHQTSFNDQSKE
                     EDSTISILPTSLPQIHRANMLAQGLPAASKISPLVNKKSKTRWHFGIRSRSYPLDVMG
                     EIYIALKNLGAEWAKPSEEDLWTIRVRWKYDVAQNKNNEKIPDLMKMVIQLFQIETNN
                     YLVDFKFDGWESSHGEATKESNVSEDEMSTFSAYPFLHLTTRLIIMELAVNSQGG"
     gene            <844870..>846291
                     /gene="TDEL0A04790"
                     /locus_tag="TDEL_0A04790"
                     /db_xref="GeneID:11502892"
     mRNA            <844870..>846291
                     /gene="TDEL0A04790"
                     /locus_tag="TDEL_0A04790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678974.1"
                     /db_xref="GeneID:11502892"
     CDS             844870..846291
                     /gene="TDEL0A04790"
                     /locus_tag="TDEL_0A04790"
                     /inference="similar to DNA sequence:INSDC:YOR025W"
                     /note="similar to Saccharomyces cerevisiae HST3 (YOR025W);
                     ancestral locus Anc_5.612"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679022.1"
                     /db_xref="GeneID:11502892"
                     /db_xref="GOA:G8ZMG7"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:G8ZMG7"
                     /translation="MAKDAKCEQTPSPRASRSPSSLGSPQKVELKTERLTPIAELDIG
                     DVRLQQINRILNRSRKIVVLTGAGISCNAGIPDFRSSSGLYELVKKQFPELPIMSGQE
                     MFDISLFRDELKISVFATFMEKLYSSVQMAQPTKTHKFIAHLKNRNKLLRCYTQNIDG
                     LEENLGLEMSNNETNDTTITAFNSRWKNFDVVQLHGDLNSLACTRCFHVFQWSRYWCR
                     SFRRGELPTCPTCEEQNYKRFQQGKRQTGITGLLRPNIVLYGENHPSCEFIAQGLTLD
                     VQRGKPDFLIIMGTSLKVDGVKRVVRQISKQVHERGGIVILVNKTSIGDSSWHGVIDY
                     QIMRDCDEWVTYLEAQIPDFFKTQEQIDKLRQLRREASDLRKKALEEQKQNNLLTMIK
                     TPPSTPVRKDQKQAQSFDGNLENVKKRLVTTSKSPCKRQKKLPDNEKISKRKPKYIHY
                     TNSQLSQYIMKRHLLFKSEKLML"
     gene            <846413..>846985
                     /gene="TDEL0A04800"
                     /locus_tag="TDEL_0A04800"
                     /db_xref="GeneID:11503119"
     mRNA            <846413..>846985
                     /gene="TDEL0A04800"
                     /locus_tag="TDEL_0A04800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678975.1"
                     /db_xref="GeneID:11503119"
     CDS             846413..846985
                     /gene="TDEL0A04800"
                     /locus_tag="TDEL_0A04800"
                     /inference="similar to DNA sequence:INSDC:YDR478W"
                     /note="similar to Saccharomyces cerevisiae SNM1 (YDR478W);
                     ancestral locus Anc_5.613"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679023.1"
                     /db_xref="GeneID:11503119"
                     /db_xref="InterPro:IPR007175"
                     /db_xref="UniProtKB/TrEMBL:G8ZMG8"
                     /translation="MNREQTEKFRDKQLIQKYNLIHLLPTLNVPELSGLYLKSFLNAT
                     KRYQLQLPPLINDSSSKFCGSCGAVRIPRFNVEMSTVEHNKTTADEPPRVLQYKCLNC
                     SYTETFPLESQSRNQIKLQNKDQGFVATWPQEKQQEKVTNKVEKKTSAKDRAKKRKLN
                     SLSNLLSKKNEEKKKQNSPSLSLESFMQQG"
     gene            complement(<847038..>848654)
                     /gene="TDEL0A04810"
                     /locus_tag="TDEL_0A04810"
                     /db_xref="GeneID:11503341"
     mRNA            complement(<847038..>848654)
                     /gene="TDEL0A04810"
                     /locus_tag="TDEL_0A04810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678976.1"
                     /db_xref="GeneID:11503341"
     CDS             complement(847038..848654)
                     /gene="TDEL0A04810"
                     /locus_tag="TDEL_0A04810"
                     /inference="similar to DNA sequence:INSDC:YDR479C"
                     /note="similar to Saccharomyces cerevisiae PEX29
                     (YDR479C); ancestral locus Anc_5.614"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679024.1"
                     /db_xref="GeneID:11503341"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="UniProtKB/TrEMBL:G8ZMG9"
                     /translation="MESVTSFFWNEGSKNGGSSAIQEKRGPTSADNGSSSGSGTAVPG
                     SGMQKMMTDTLIEKIMRMALPPTTEMAMDNLETRIAAAKGRPSLSVQIMSRNFVLMNS
                     RLSLPFTLIDEVNKIFEWSNPAYTMSVVLIYSYIILRPLPTITSIPIFYLLFGVMVPQ
                     FLYIHKPNGSPYLEVNPMPADGPPLRKAEVPKPVPELSQEFILNLTDLQNRLMLYVKT
                     YDFIDQILIKFAFFTDEKKSSVAFVLLLSVALVNALFMDFFLTFIPLKAILLALGWSF
                     AIMMHPHNREKFFSTVYSEETRLRLLALSNRYDKLVGEQLRYIEAREHRMVAVYEIQK
                     FKHGKEWAPVGYSNDDFTLFSTLRIREEKIEDHCTSLLEEVKPPVDWQWLDDINWALD
                     LNPTEWLEEGLVEYVDTDLGTKWVYDLNLDGSRGGYRRRMWTNICIRKIECEPDDNDD
                     NDDEDDDDLVSTQLTTPTKVEKYSSHRVTRGSMSGVALPEDDTRPTVKRDSSTLSLSS
                     AVSSNSSTHSNHSEPSKAIDNLRDVLNSST"
     gene            <848835..>849815
                     /gene="TDEL0A04820"
                     /locus_tag="TDEL_0A04820"
                     /db_xref="GeneID:11502766"
     mRNA            <848835..>849815
                     /gene="TDEL0A04820"
                     /locus_tag="TDEL_0A04820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678977.1"
                     /db_xref="GeneID:11502766"
     CDS             848835..849815
                     /gene="TDEL0A04820"
                     /locus_tag="TDEL_0A04820"
                     /inference="similar to DNA sequence:INSDC:YOR026W"
                     /note="similar to Saccharomyces cerevisiae BUB3 (YOR026W);
                     ancestral locus Anc_5.615"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679025.1"
                     /db_xref="GeneID:11502766"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZMH0"
                     /translation="MARHQVVEVAQCPRDYVSEVLLLEDRRQIIVTSWDGLLTVYDYE
                     VEHRTVSLNSRLRHECALLACCYVDTFHGRQIYVSSVQGEVLQVDLESEGFIPVKNNY
                     ATLGIPCISDFQGQLICGSWDGTLQVVDCETNCVVLQERLSDGLKVISMDVDNERMVI
                     ATSRNKVRLFELPLRPKDKGTEVESGLKYQARKVKLTPQGDGYVCSSLDGRVAVEYLE
                     DESRKFAFRCHRLNLVDTSMVFPVNALSFRPNSNVLYTGGSDGSVSCWNLTSRKKVEQ
                     LPKFNENSVVQLACNEQVLCVATSDDSFKTNATKDETFELQPSRLYIVFL"
     gene            complement(<849827..>851281)
                     /gene="TDEL0A04830"
                     /locus_tag="TDEL_0A04830"
                     /db_xref="GeneID:11502979"
     mRNA            complement(<849827..>851281)
                     /gene="TDEL0A04830"
                     /locus_tag="TDEL_0A04830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678978.1"
                     /db_xref="GeneID:11502979"
     CDS             complement(849827..851281)
                     /gene="TDEL0A04830"
                     /locus_tag="TDEL_0A04830"
                     /inference="similar to DNA sequence:INSDC:YDR257C"
                     /note="similar to Saccharomyces cerevisiae SET7 (YDR257C);
                     ancestral locus Anc_5.616"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679026.1"
                     /db_xref="GeneID:11502979"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR011383"
                     /db_xref="UniProtKB/TrEMBL:G8ZMH1"
                     /translation="MDGYGQATEQFSAWLSEVAGVRMSPKIAISDLRNFNQGRCVVAR
                     EAIEGQEVLFEIPRSAILNVGTSRLTEKYPGIRGRLLEEIGHWEGLVLCMLYEMKVLN
                     IQSRWWAYFQVLPRPDEVNSLMFWNDEQLEGLKPSLIVERVGVAEAKQMYERVLQYVE
                     ESGVEELGSVSWSDFVYVASVIMSYSFDVELVDADPNEEQELSTVKNDGYMKSMIPLA
                     DTLNANTSKCNANLVYDIESLKMCATKPIGMGEQVYNIYGDHPNSELLRRYGYVEWEG
                     SKYDFGEVPMATLVNVIHQKFQWDIEHLTQLIDIIRDNETIGDELQGENIVLHAYDCY
                     SDGQIIPECVVLLQIMVTFLQISEARTLDRPAVERTLLRVVKKCFQLVESGRITKNCA
                     RMIEYVIDARLREYPSHAFREITPDHYSIPDIESLRQRMTEKVLQSEVDSLQNCFQSV
                     EENFKLIADSKLLENISKRKLPVKKFKTMKKVKR"
     gene            <851520..>853250
                     /gene="TDEL0A04840"
                     /locus_tag="TDEL_0A04840"
                     /db_xref="GeneID:11502679"
     mRNA            <851520..>853250
                     /gene="TDEL0A04840"
                     /locus_tag="TDEL_0A04840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678979.1"
                     /db_xref="GeneID:11502679"
     CDS             851520..853250
                     /gene="TDEL0A04840"
                     /locus_tag="TDEL_0A04840"
                     /inference="similar to DNA sequence:INSDC:YOR027W"
                     /note="similar to Saccharomyces cerevisiae STI1 (YOR027W);
                     ancestral locus Anc_5.617"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679027.1"
                     /db_xref="GeneID:11502679"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G8ZMH2"
                     /translation="MTSADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSN
                     RSACYTSLKKFAEGLKDAEECVKINPGWSKGYNRVGAAQFGLNNLEDAEKSYQKALEL
                     DSANKAAKEGLDQVLKTRESRQQMPDLGLGQMFNDPNMIEKLKKNPKTAELMKDPQLV
                     AKLAQYRTNPQAISQDLFTDTRLMTIMAALMGIDLNMGDANGPEAASGAKEEPREEPK
                     QAEAKTEEPLKENNEPEPMEVDEKGPQVAAEEEKAEGNKFYKARKFDEAIEHYNKAWE
                     LHKDITYLNNRAAAEYEKGDYETAIATLTNAVDEGREMRADYKVIAKSFARIGNAYHK
                     LGDLKKSINFYQKSLTEHRSADVLNKLRNAEKELKKQEAEEYVDPEKAEEARLEGKEY
                     FSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPNFI
                     RAYIRKASAQIAVKEFAAAVETLDTVRTKDSELNNGANAREIDQLYIKANNQRFQPED
                     VNENPEQTYQRAMKDPEVAAIMQDPVMQSILQQAQQNPAALQEHMQNPDVFRKIQTLI
                     AAGIIRTGHR"
     gene            complement(<853429..>855843)
                     /gene="TDEL0A04850"
                     /locus_tag="TDEL_0A04850"
                     /db_xref="GeneID:11503177"
     mRNA            complement(<853429..>855843)
                     /gene="TDEL0A04850"
                     /locus_tag="TDEL_0A04850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678980.1"
                     /db_xref="GeneID:11503177"
     CDS             complement(853429..855843)
                     /gene="TDEL0A04850"
                     /locus_tag="TDEL_0A04850"
                     /inference="similar to DNA sequence:INSDC:YDR258C"
                     /note="similar to Saccharomyces cerevisiae HSP78
                     (YDR258C); ancestral locus Anc_5.618"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679028.1"
                     /db_xref="GeneID:11503177"
                     /db_xref="GOA:G8ZMH3"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR018368"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028299"
                     /db_xref="UniProtKB/TrEMBL:G8ZMH3"
                     /translation="MLRLIKRPSVERQLQSRINAAVKASSIPTAGKLESVNVESGFKR
                     SLMTQVTPVRQRLEIGRNARMLRPLTSKRNIQMKMNPNQGEPEKPALEQFGTNLTKLA
                     KEGKLDPVIGRDEEIARAIQILSRRTKNNPVLIGRAGVGKTSLIDGLAQRIVANEVPD
                     SLKDKQLVTLDLGSLIAGAKYRGEFEERLKKVLDEIDKSNGQVIIFIDEVHMLLGLGK
                     TDGSMDASNILKPKLAKGLRCISATTLDEFKIIEKDPALTRRFQPILLNEPSVSDTIS
                     ILRGLKERYEVHHGVRITDTALVSAAVLSNRYVTDRFLPDKAIDLVDEACAVLRLQHE
                     SKPDEIQKLDRAIMRIQIELESLKKETDPVSVERREALQKELDLKNDELSRLTKIWEQ
                     ERAEIEAIKNAKADLEQARIELEKCQREGDYTKASELRYAKIPDLERKVALSEKKNDG
                     EKENLLHDSVTSDDISKVVAKMTGIPTETVMKGDKDRLLFMEDSLKERVVGQDEAISV
                     ISDAVRLQRAGLTSEKRPIASFMFLGPTGTGKTELTKALAEFLFDDESNVIRFDMSEF
                     QEKHTVSRLIGAPPGYVMSESGGQLTEAVRRKPYAVVLFDEFEKAHPDVCKVLLQVLD
                     EGKLTDSMGHPVDFRNTLIVMTSNVGQDILLADKELNEEGKVSDQTKKEVIDAMKRMY
                     PPEFINRIDDMVVFNRLSKKVLRSIVDIRIEEIQERLNEKRMTINLSNEAKDWLTDRG
                     YDPLYGARPLNRLIHRSILNPMATFLLKGQIRNGETVNVSVSGEKLEVQPNHQEGESL
                     EEEPEK"
     gene            complement(<856082..>856576)
                     /gene="TDEL0A04860"
                     /locus_tag="TDEL_0A04860"
                     /db_xref="GeneID:11502781"
     mRNA            complement(<856082..>856576)
                     /gene="TDEL0A04860"
                     /locus_tag="TDEL_0A04860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678981.1"
                     /db_xref="GeneID:11502781"
     CDS             complement(856082..856576)
                     /gene="TDEL0A04860"
                     /locus_tag="TDEL_0A04860"
                     /inference="similar to DNA sequence:INSDC:YDR260C"
                     /note="similar to Saccharomyces cerevisiae SWM1 (YDR260C);
                     ancestral locus Anc_5.620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679029.1"
                     /db_xref="GeneID:11502781"
                     /db_xref="InterPro:IPR008401"
                     /db_xref="UniProtKB/TrEMBL:G8ZMH4"
                     /translation="MGSYRDSYFQYHHLVDSHQILYNEWNQDELPPPDEQEIGNNNLK
                     MKQGGSNSNNGTNGNVEASEGASKRYSGPRSNTNAYWDYFHDEEDWNLFKNVQLESNG
                     VATFNQPPDTNAQDESKGAQARTNPDYEASNAITGSIFNNKVVRMAMVQNSNWNDLSM
                     PHPE"
     gene            complement(<856793..>858406)
                     /gene="TDEL0A04870"
                     /locus_tag="TDEL_0A04870"
                     /db_xref="GeneID:11503024"
     mRNA            complement(<856793..>858406)
                     /gene="TDEL0A04870"
                     /locus_tag="TDEL_0A04870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678982.1"
                     /db_xref="GeneID:11503024"
     CDS             complement(856793..858406)
                     /gene="TDEL0A04870"
                     /locus_tag="TDEL_0A04870"
                     /inference="similar to DNA sequence:INSDC:YDR261C"
                     /note="similar to Saccharomyces cerevisiae EXG2 (YDR261C);
                     ancestral locus Anc_5.621"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679030.1"
                     /db_xref="GeneID:11503024"
                     /db_xref="GOA:G8ZMH5"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR018087"
                     /db_xref="UniProtKB/TrEMBL:G8ZMH5"
                     /translation="MLGVLAPLIFISCVVIASRDVISTEQLRTLQKRFDSYYNDNDSI
                     SVKGITIGGWLVSEPYITPSLYRNASELAAKSGNNSEIIDEFTFCDVLGYEQAQSLLQ
                     DHWESWINEADFKQISDDGFNLVRIPIGYWAWKQDYETNRYVGNITYTDPYVGNGLQL
                     KYLEKALSWAEQYSLNVWIDLHGAPSSQNGFDNSGERDLYSTKLGWLATSGSRDLTMA
                     VWQSIFESYLNLNTNSPIVGIEIMNEPLSPKLDSDQMTHCFYEAFKLFKDEQASHDNT
                     TFVIHDAFKEIGYWNLQFNPDYNNVSSQFTNISNLSFSSQDVLIDHHHYEVFTDSQLN
                     NTQYQRILNIMNYGDSIYDELPYHAAVVGEWSAAITDCATWLNGVGIGSRYDGSYYNT
                     TEFNTTDQPVGKCLSQQPIGNWTKQYRTQVRQFVEAQLATYSTRTSGWIFWNWKTEDA
                     AEWDYLKLKENNLFPSPFDNYTYFDTDGGLKPSVSSSLSKEATATSKSSAVAIQRPFQ
                     AVQWQHFSLTLNTIIGTSLVAIMLVCIFL"
     gene            <858758..>860479
                     /gene="TDEL0A04880"
                     /locus_tag="TDEL_0A04880"
                     /db_xref="GeneID:11502863"
     mRNA            <858758..>860479
                     /gene="TDEL0A04880"
                     /locus_tag="TDEL_0A04880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678983.1"
                     /db_xref="GeneID:11502863"
     CDS             858758..860479
                     /gene="TDEL0A04880"
                     /locus_tag="TDEL_0A04880"
                     /inference="similar to DNA sequence:INSDC:YOR030W"
                     /note="similar to Saccharomyces cerevisiae DFG16
                     (YOR030W); ancestral locus Anc_5.622"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679031.1"
                     /db_xref="GeneID:11502863"
                     /db_xref="InterPro:IPR014844"
                     /db_xref="UniProtKB/TrEMBL:G8ZMH6"
                     /translation="MSRWLLLRLGLLVVASASQTLPEGISDAIGPDNFSLTELLNEAL
                     SKPSFNQCRADVLTGGFISMGNESDTLQDNYTVSTPYLFISCPNDSRASQNDSLMLRN
                     LALALNAPSVVYDIDKVLSKDSFENSILMITFTKCAVCIGTWMVYLVWILLPSKTSFS
                     KSFLVPTYVLFSAIYDTAMLCKGVKDILEKQYRLNIQDSSEYESHIVNGVAHKVGSLI
                     CNAMANLNWTALIYYMFHDNKRIKVGWLPFTVANRNRLIIAIGLALTLIDTGLFAGLQ
                     WHATRPHATRPLWVSFKVFEFMIYTLFCGSTAFYIWRDFRFILAPQRKSSTSKIPIIT
                     ILRLIWDDYHETIPLLFYNINLFVLLYFTTIYLTIDFSPTHKWQFGVIGFMKLIVTVS
                     VWGLINVLERREFIISKETVLGRKIYNDDEYFFDPKLSSQYRSVDTDGSGGLSRSASR
                     ENERSNADNGNRKRSIYSPLKYPAKVWRSQMERSKNIRANSRKRRKRFLDTFIGKRVS
                     PDSAHKHPAGEMNEISSPTLQLGLHENERSSADLIRESAINSASECNTVETTLARNYI
                     YGYSDGD"
     gene            862030..862100
                     /gene="TDEL0Atrna11G"
                     /locus_tag="TDEL_0Atrna11G"
                     /db_xref="GeneID:11502888"
     tRNA            862030..862100
                     /gene="TDEL0Atrna11G"
                     /locus_tag="TDEL_0Atrna11G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11502888"
     gene            <862360..>863235
                     /gene="TDEL0A04890"
                     /locus_tag="TDEL_0A04890"
                     /db_xref="GeneID:11502635"
     mRNA            <862360..>863235
                     /gene="TDEL0A04890"
                     /locus_tag="TDEL_0A04890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678984.1"
                     /db_xref="GeneID:11502635"
     CDS             862360..863235
                     /gene="TDEL0A04890"
                     /locus_tag="TDEL_0A04890"
                     /inference="similar to DNA sequence:INSDC:YDR262W"
                     /note="similar to Saccharomyces cerevisiae YDR262W;
                     ancestral locus Anc_5.623"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679032.1"
                     /db_xref="GeneID:11502635"
                     /db_xref="InterPro:IPR000782"
                     /db_xref="UniProtKB/TrEMBL:G8ZMH7"
                     /translation="MLQRLSIMHSVLAAICVFTLLSTCLVEAKNVAGIEQYQDENGRL
                     RRRFTREELPLQARDGKRLPFDLDQVIDEDSKLLKRDPKRLPLDVDRIINEENRIVKR
                     GKVSNQQDFKVNKGEYEMRPVSLDSKLTSLKETLIFFGYARNDIELAAKLSDETQDII
                     IIAPTNDAISALPMKPWEYPQDIETLESSGATAMEIDNAIQHNILKFVRSHVVAYDDN
                     TSYREFKSGYTTLRSVDFENSRRQDADGDILLKKEGDTFYVASNRDKKFHEVEKIEAA
                     SNGVVLVIGSCLEWP"
     gene            complement(<863346..>865781)
                     /gene="TDEL0A04900"
                     /locus_tag="TDEL_0A04900"
                     /db_xref="GeneID:11502547"
     mRNA            complement(<863346..>865781)
                     /gene="TDEL0A04900"
                     /locus_tag="TDEL_0A04900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678985.1"
                     /db_xref="GeneID:11502547"
     CDS             complement(863346..865781)
                     /gene="TDEL0A04900"
                     /locus_tag="TDEL_0A04900"
                     /inference="similar to DNA sequence:INSDC:YOR032C"
                     /note="similar to Saccharomyces cerevisiae HMS1 (YOR032C);
                     ancestral locus Anc_5.624"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679033.1"
                     /db_xref="GeneID:11502547"
                     /db_xref="GOA:G8ZMH8"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:G8ZMH8"
                     /translation="MNGSDFFGKDQLYGGEVDDGGYYASSCLTSHHSSPAGAQNAASI
                     TPESFHSYQNGSQQQQDPQEAKLRGSPFDFSDYDESINFDIQPPRQLEQNSQVKVPVP
                     QVENPNVVKSEFSPVFPASESSSTSQSSSWMNRPQANDFFNDGYDYLVKDELDVNLDN
                     DVGSHDTNGKVFKKRKEKTSHNVIEKKYRTNINDKIFQLREIVPSLRVAYKRYSGIPV
                     LSQDATDLDGLEPARKLNKASILLKTIEYIQHLESKCSLYKSENQRLKSNISTPESLR
                     AQNSAVPTTTIPVGHEASTHSNNIPTDLSNQFDQFSDSAYNTMPLPVPQNNMNSYINE
                     NNNNNNNNANTDYTSKLLMGGLAMTMGASCFGDTGDMGSARALFAMPIFHFSPHSGFA
                     LSNANGMVSFQSSIFALLKISLVVITALYLLNGLLFSSKRTSDKNPTSDVVSMIPTKD
                     TVRFDTVGYLTRTLKKTFVLNKLKYNVNSMERIESRIAKCFAIKLYFQHSKFPWCNLA
                     EIYINKRWSELKKQVEEANLKSKGSLKMGLEWGMITNIASVEDKLTLGNQSLLQELSR
                     RHQEYELKEFLSLVNSFVLKEKIEKSMGRLMHQLANGKFQDLAQLAQSFHQQYIEDDK
                     ILESMPEEFTVIDCLTNPHKSSCDKLSKLIKNSREVKSEILLEEQLVLYGSVMRNLIN
                     LQKFDQCVIWMKKMPLRELSDSKDKLSIVGFTSMFLMLNSILENLQEFKQHPLILERV
                     CGDLRVWLGSSLGDVIELETRNKLINYCIDKALLCDSLTNYDDDEYDKETEEDVEEDQ
                     DDDTTEFEDDKES"
     gene            complement(<866033..>867814)
                     /gene="TDEL0A04910"
                     /locus_tag="TDEL_0A04910"
                     /db_xref="GeneID:11502637"
     mRNA            complement(<866033..>867814)
                     /gene="TDEL0A04910"
                     /locus_tag="TDEL_0A04910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678986.1"
                     /db_xref="GeneID:11502637"
     CDS             complement(866033..867814)
                     /gene="TDEL0A04910"
                     /locus_tag="TDEL_0A04910"
                     /inference="similar to DNA sequence:INSDC:YDR263C,YOR033C"
                     /note="similar to Saccharomyces cerevisiae DIN7 (YDR263C)
                     and EXO1 (YOR033C); ancestral locus Anc_5.625"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679034.1"
                     /db_xref="GeneID:11502637"
                     /db_xref="GOA:G8ZMH9"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR019974"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:G8ZMH9"
                     /translation="MGIQGLLPQLKSIQNPVSLVRYEGQTLGIDGYAWLHRAACCCAY
                     ELVTGQPTAKYLQFFIRKISMLKSFKIEPFFIFDGDAIGVKKDTEVKRREKRAENKSI
                     AEKLWKLGERSNAMDYFQKCVDVTPEMAKCIIDYCKTNRIQYIVAPFEADAQMVYLEK
                     QNLIHGILSEDSDLLIFGCRKLITKMNDFGECIEICRDDFDQLPRKFPLNQLTDEEIR
                     IMVCLSGCDYTSGIPKVGLITAMKLVRQFRTLDRVLLSIQRDGKYKVPPNFDQETILA
                     NFAFQFQRVFCPIRRKIVSLTEIPPHLLNCRELYESIGYVVHKSTGSKGCVMNDDDID
                     HDLHLRIAIGDLNPNNVQKRLVNREHKLQLTSKSELQVENSKSRPAVGSIDSFFSQAT
                     IDNKIPKLTVLDKISKPKPPVVDKIAETIKRRKLSHNYSIPTTTTSKFFQTTQPDEDD
                     IETEVPSSQLPTQVSSVSATQLETDDDEILDEVECDYKQPIGPSAPRTAGPRLLSTSA
                     DFSILHQFRYSGTREPLQAKNPNKMDRMVNVSSQKNMNSHKRPQNARGIVVRATTTTS
                     QQHQTTARPALRSLSLSSRFSYSANRS"
     gene            complement(<867970..>870222)
                     /gene="TDEL0A04920"
                     /locus_tag="TDEL_0A04920"
                     /db_xref="GeneID:11502606"
     mRNA            complement(<867970..>870222)
                     /gene="TDEL0A04920"
                     /locus_tag="TDEL_0A04920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678987.1"
                     /db_xref="GeneID:11502606"
     CDS             complement(867970..870222)
                     /gene="TDEL0A04920"
                     /locus_tag="TDEL_0A04920"
                     /inference="similar to DNA sequence:INSDC:YDR264C,YOR034C"
                     /note="similar to Saccharomyces cerevisiae AKR1 (YDR264C)
                     and AKR2 (YOR034C); ancestral locus Anc_5.626"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679035.1"
                     /db_xref="GeneID:11502606"
                     /db_xref="GOA:G8ZMI0"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8ZMI0"
                     /translation="MSGDKLETGVASDAEGSLDNLSLSSVQPILSNNAQDNDKGESED
                     TRNHLDAANGEEGEESDPILDRYFRACQKGDLKTVKEMIEGGIININEDYDPIEKVTG
                     LHWASINNRLSVVSYLVANGADVNAKAGTLHAPPLHWAARYGYVYIVHYLLAHGADAT
                     LEDDQGFNLLHLSVNSSNIMLVQYVLFFVVSKGIIDVDCQDPNGRTPLLWAAYQGDSL
                     TVDSLLRFGAHPKVPDSGGFTPLHWGTLKGQPHVLMYLIQSGGDFFLKTNDGKDCFTI
                     AKEMNTVHSLTEALNHCGFNPEGYPYKKYFGKSYHAKLTTFFIPWIFLGIAFGLFAHI
                     HPLIALPITLVFGIASIKALNNFVLTSYGRTGVTPLSLLRTPLYAGVFSGSVFWLVCV
                     WVRKVLPMTLVEEFWSNLALTILIFSVGYHFVKLLKEDSGCVPPERDYEKIRDTVSEL
                     LKVGKYDTRHFCIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYF
                     VALIEVAVWIFAHLCLEYFDELEDNYDDYNGDLKCFLIGDSELCAGLTYDLFTTLILL
                     WAVFQSIWVGCLVFVQAFQIFKGVTNYEYSKLMRDNKRINIDPAVANEFFSTAPEDLD
                     ADLTTESRVTDIDTTAPDSRRRPLPRLNESRRCFGTFCAITGMDQWIMILKEAVGMSR
                     EALGSSQTSQSSFPTDYGWKTNIKDFWLLSDKTAPMWQRVFYSPVTSRALLGGQEVNY
                     YELYNYPEKI"
     gene            complement(<870515..>872803)
                     /gene="TDEL0A04930"
                     /locus_tag="TDEL_0A04930"
                     /db_xref="GeneID:11502695"
     mRNA            complement(<870515..>872803)
                     /gene="TDEL0A04930"
                     /locus_tag="TDEL_0A04930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678988.1"
                     /db_xref="GeneID:11502695"
     CDS             complement(870515..872803)
                     /gene="TDEL0A04930"
                     /locus_tag="TDEL_0A04930"
                     /inference="similar to DNA sequence:INSDC:YOR035C"
                     /note="similar to Saccharomyces cerevisiae SHE4 (YOR035C);
                     ancestral locus Anc_5.627"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679036.1"
                     /db_xref="GeneID:11502695"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024660"
                     /db_xref="UniProtKB/TrEMBL:G8ZMI1"
                     /translation="MNQESASNSAVDKLCTRFTQELKTVDAKEYDEALNEILGPKSKN
                     GTGGRSTEQVEEVLTRSFQDHFESRKLLKTLVASDVTQALDVFEKLSLKTVALLVDCF
                     SNTEDTFNLLKELQYRIHMGEDIHIEYLLNTVLQLLHKFNYNFAQVGFLVQDLCQRVN
                     EPEVKSLMLLIFSVLDKKFHARFNDRLLKLMDSLLYESEAGAGNDPLSEIVGILTELY
                     PVLTNLCSEILLGKRLKMEVKEKVVAQDDDDFTISLLKLFSIACIDEIVRSHIAENYM
                     SLLERSLKVRQFRMYSALVLIKTWSFTKLQSVDVNTLAEYLIEGFNYSDIKDDEGMNI
                     CVEGLAYLSLKTSVKVSLRNNVVSCEKLAGLALSNNFNSTFYGVLVILANLSVSPKQS
                     KGKSAFESKSLKDLQSYADLKNPNSSEEDKTVEKEEDVLAFNEKYLLQNDLLSHLNSV
                     IASLSHGSKQQLMRIIYNICCNRDCIQECIKQGSVTAVLQYMAKKEPTKDLIRVLASR
                     SLTKLLIHTNPNIIFKKYSPVNAIAPLFELLPRLPTAADECAFEEDVVTVHDSYNALL
                     ALTNLASLNNSQGEDVCRRIVTHEEYWYVVENLMLDENKMLQRSTLELLSNLMGHPRP
                     IAVKFFNFDNPRSEKNFEILVKLLELEDLESQRAVAAIFANISTSIPFVAQELLKRTD
                     LLTKAVDVLHNQISDVELSERLILLFHALTDVIPDDHPEMGSFLMGNTKLIKSLEQAS
                     QMPDIGPHFAELIPITLERCQR"
     gene            <872976..>874025
                     /gene="TDEL0A04940"
                     /locus_tag="TDEL_0A04940"
                     /db_xref="GeneID:11502846"
     mRNA            join(<872976..873072,873142..>874025)
                     /gene="TDEL0A04940"
                     /locus_tag="TDEL_0A04940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003678989.1"
                     /db_xref="GeneID:11502846"
     CDS             join(872976..873072,873142..874025)
                     /gene="TDEL0A04940"
                     /locus_tag="TDEL_0A04940"
                     /inference="similar to DNA sequence:INSDC:YDR265W"
                     /note="similar to Saccharomyces cerevisiae PEX10
                     (YDR265W); ancestral locus Anc_5.628"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003679037.1"
                     /db_xref="GeneID:11502846"
                     /db_xref="GOA:G8ZMI2"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR025654"
                     /db_xref="UniProtKB/TrEMBL:G8ZMI2"
                     /translation="MASQEVQRIANNASDEPRADSLLLPFADAPSIVQAQQKDAQIET
                     ILSAKLLEVVKAVKGQLFANTHPLEISIAVKLMYLCLTTLKGSRTLGEEYVDLIYVGR
                     RGTKLVERYKKLLFIIFYCLSPYFTTKFLQKWRTSDNDKYSFKSVLNTLVNLHLVLFY
                     FRGAYYDIFKRIFGLRYAVGHKVDANEAKFRNSSSNSYKFLGYILLVQGASKVIPAIF
                     KQLRSIALPDTGRRNERRNWEEKGKDAITGIPEASQIVHIYLSDESQLPYIPQASRSC