GenomeNet

Database: RefSeq
Entry: NC_016503
LinkDB: NC_016503
Original site: NC_016503 
LOCUS       NC_016503            1292049 bp    DNA     linear   CON 03-APR-2018
DEFINITION  Torulaspora delbrueckii CBS 1146 chromosome 3, complete genome.
ACCESSION   NC_016503
VERSION     NC_016503.1
DBLINK      BioProject: PRJNA79345
            BioSample: SAMEA2272433
            Assembly: GCF_000243375.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Torulaspora delbrueckii (Candida colliculosa)
  ORGANISM  Torulaspora delbrueckii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Torulaspora.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 1292049)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1292049)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-DEC-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE616744.
            Accession numbers for all the chromosomes in this genome project:
            HE616742-HE616749.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1292049
                     /organism="Torulaspora delbrueckii"
                     /mol_type="genomic DNA"
                     /strain="type strain:CBS 1146"
                     /db_xref="taxon:4950"
                     /chromosome="3"
     gene            complement(<1863..>2399)
                     /gene="TDEL0C00100"
                     /locus_tag="TDEL_0C00100"
                     /db_xref="GeneID:11502011"
     mRNA            complement(<1863..>2399)
                     /gene="TDEL0C00100"
                     /locus_tag="TDEL_0C00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680062.1"
                     /db_xref="GeneID:11502011"
     CDS             complement(1863..2399)
                     /gene="TDEL0C00100"
                     /locus_tag="TDEL_0C00100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680110.1"
                     /db_xref="GeneID:11502011"
                     /db_xref="GOA:G8ZQV7"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:G8ZQV7"
                     /translation="MLLDLSGVRGFAETEFYMSIFKMVSLFVFNIIGIVLMTGGGPGN
                     TGYIDTRYWQDSRSFAAPVLKKFRNTIVSAAYSSSGNEMVVLTNTEVKDISSVSCAAK
                     RKFWRIALFYIVTVVIIGCLVPYNDERLLSRATSEDFSSSPFVIALSNTGSMGNKAAY
                     FMNAVILVAVVSVCNSCV"
     gene            <5609..>6976
                     /gene="TDEL0C00110"
                     /locus_tag="TDEL_0C00110"
                     /db_xref="GeneID:11500258"
     mRNA            <5609..>6976
                     /gene="TDEL0C00110"
                     /locus_tag="TDEL_0C00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680063.1"
                     /db_xref="GeneID:11500258"
     CDS             5609..6976
                     /gene="TDEL0C00110"
                     /locus_tag="TDEL_0C00110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680111.1"
                     /db_xref="GeneID:11500258"
                     /db_xref="GOA:G8ZQV8"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G8ZQV8"
                     /translation="MFIALDFDRYNISQALSANMLDHLHLTTEDYNLGNTINLVCFLA
                     SELPSQLISKKLGADIWIPTQLCLWSAVSMCQAAMTTRAGFLATRGLLGALQGGFICD
                     VCLWMSYFFTSKELPFRLSLFYIANPMTSVWSSLLSFALLKIKTGGLMDQSFRWLFLI
                     EGIFTFAVGVISFFKMPASAAQTKSWFRKEGWYTDREEKIVVNRVLRDDPNKGDMNNR
                     QPVSLKELWMSLTDYDLLPIYIVRLFTDIGATPLKNYMTLTLRKLGFSTYKTNALTIP
                     YNVFSTISMVAMGYFSEKINDRAFLCMSSSIWILACLIPLRYWPGSQVDVWGTYAILT
                     ALLSQPSIWALSISWCSANSNSVRSRAVSAALVNMFSQTANIIAANIYRDDDKPLYHR
                     GNTQLIGIAFGAVGACLVAKLYYKYRNKQRDAVWNKMTLEEQEKYRLSTIDIGNKRLD
                     FRFTH"
     gene            complement(<7481..>9190)
                     /gene="TDEL0C00120"
                     /locus_tag="TDEL_0C00120"
                     /db_xref="GeneID:11500259"
     mRNA            complement(<7481..>9190)
                     /gene="TDEL0C00120"
                     /locus_tag="TDEL_0C00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680064.1"
                     /db_xref="GeneID:11500259"
     CDS             complement(7481..9190)
                     /gene="TDEL0C00120"
                     /locus_tag="TDEL_0C00120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680112.1"
                     /db_xref="GeneID:11500259"
                     /db_xref="GOA:G8ZQV9"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZQV9"
                     /translation="MVTYNKHFGHRRKSATSYGSISETRIPENSLEELENIHGADEDE
                     DIKLSDIPNLWIIEAALFTNVFLSGFDGTVTASTYQTIGNEFNHMNISSWITTAYLIT
                     STSFQPLYGSFSDALGRRNCLFFANTSFTIGCLACGLSPNIVVLSFMRALTGIGGGGL
                     ITLSTIVNSDMIPSSKRGIFQAFQNLLLGLGAICGASFGGSIASSIGWRWCFFVQVPI
                     CITNSLIMSSYVPNQKEYEDREIGFLFHPKKILKDIDVTGSVFIIIGLTLQLLYLSLG
                     SSKVGVSWTSPSVLPLLFASGIILVLFVYNEAKTSARAIIPLELMRSSFSFVVLTISI
                     LVGFASYAYLFTLPLFFQIVLGDSTAKAGLRLTIPSLFTPVGGLITGICMSRYNCLQI
                     LLYAGVFLMALGNFLFLFIEKGSPNWLVGLFLIPANLGQGITFPATLFTFIFAFPKSR
                     QATATSTLYLFRSIGSVWGVAMSTGVIQLYFGKSLRSNLKDLLDEDKINELVTKITSN
                     SSYIEKLHGELKDVVIDCFDSSTKKAHLLSTILSLLALAFCVIKEFLKKPKIKEEGTY
                     CER"
     gene            complement(<9763..>12141)
                     /gene="TDEL0C00130"
                     /locus_tag="TDEL_0C00130"
                     /db_xref="GeneID:11500260"
     mRNA            complement(<9763..>12141)
                     /gene="TDEL0C00130"
                     /locus_tag="TDEL_0C00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680065.1"
                     /db_xref="GeneID:11500260"
     CDS             complement(9763..12141)
                     /gene="TDEL0C00130"
                     /locus_tag="TDEL_0C00130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680113.1"
                     /db_xref="GeneID:11500260"
                     /db_xref="GOA:G8ZQW0"
                     /db_xref="InterPro:IPR004648"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="UniProtKB/TrEMBL:G8ZQW0"
                     /translation="MEPEKPGRANDVVVVYLADEEASSTLEHRGSDAEVVTKNEKLKD
                     VAIDERVSTTDSSFDEAVVDDGVWEGDVSLLPNSPYPDVRAVVPIDDDPGIILNHWRT
                     WFLTTVFVVVFAGVNQFFSLRYPSLEINFLVAQVVCFPVGKALALLPDWKCKRFSFFD
                     LNPGPFTKKEHAVITIAVALTSSTAYAMYILNAQVSFYHMKLNAGYQLLLVWTSQMLG
                     YGAAGLTRRWVVDPPSCIWPQTLISVSLFDSLHSRKVDKTIVNGWSLDRYKMFYFVLI
                     GSFVWHWVPGFLFKGLSYFNVVLWGPKTRQNFVANALFGVSSGIGLLPISFDYTQVSQ
                     AMSGSVFATPFWVSANTYASVLIFFVIVLPILYFTNTWYAKYMPVISGSTFDNTQSSY
                     NVKKILNADYSINLEKYKEYSPVFVPFSYLLNYGLNFAAVVAVFVHCALYHGKDIYNK
                     LRDSNFGGMDIHRRIYTKNYKECPDWWYGVLQIITLALGFVTVCAFPTHFPPWAFVIA
                     LIIAYANFLPQGILEAITNQHVGLNIITELICGYMLPLKPMANLLFKLYGFIVMRQGL
                     NLSRDLKLALYMKVSPRLIFAIQIYATIISGLVNVGIQEWMRTNIKDICTTTQADGFT
                     CANGRTIFNASIIWSLPKYLFSPGRIYNPLMWFFLIGLLAPIVVFLIQKKFPKVSFFK
                     YLHTPVFFTGTNNIPPSTPYNYSLFFGMSFMLFLIRKNWPLWFSKYNFVTGAGVETGV
                     AIAVVIIFLCVQFPGGHLDWWGNTVYKNTGDLKSQKFYVLKEGETFGYDKWW"
     gene            complement(<12626..>13087)
                     /gene="TDEL0C00140"
                     /locus_tag="TDEL_0C00140"
                     /db_xref="GeneID:11500261"
     mRNA            complement(<12626..>13087)
                     /gene="TDEL0C00140"
                     /locus_tag="TDEL_0C00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680066.1"
                     /db_xref="GeneID:11500261"
     CDS             complement(12626..13087)
                     /gene="TDEL0C00140"
                     /locus_tag="TDEL_0C00140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680114.1"
                     /db_xref="GeneID:11500261"
                     /db_xref="GOA:G8ZQW1"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G8ZQW1"
                     /translation="MQLELKPFKEATKEHYQLLLDADPSKEAISKYLDRSFCFEARKG
                     TDLVGVFILLPTRPDTVEIVNVAVAETYQNRGIGTQLLEAALRWAADNSYKVVEIGTG
                     STSFGQLYLYQKCGFRIVGVDSDFFIEHYKEPIIENNLRLRDMIRLRKYLY"
     gap             13681..13878
                     /estimated_length=198
     gene            <14725..>16305
                     /gene="TDEL0C00150"
                     /locus_tag="TDEL_0C00150"
                     /db_xref="GeneID:11500262"
     mRNA            <14725..>16305
                     /gene="TDEL0C00150"
                     /locus_tag="TDEL_0C00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680067.1"
                     /db_xref="GeneID:11500262"
     CDS             14725..16305
                     /gene="TDEL0C00150"
                     /locus_tag="TDEL_0C00150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680115.1"
                     /db_xref="GeneID:11500262"
                     /db_xref="GOA:G8ZQW2"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZQW2"
                     /translation="MGILQTLFKADEDIRGSKARAILIGMFVAFGGVLFGYDTGTISG
                     ILTMDFVKKTFTDSGEFTASETSLITSILSAGTFVGAMLAPLATDTLGRRLGLFISCI
                     IFCVGVILQTIATEQALLIVGRVVAGFGVGVLSSIVPLYQSEAAPKWIRGAVVSCYQW
                     AITIGLLLAACVNEGTHKRNDSGSYRIPIALQLLWALILIVGMVFLPDTPRFHVMKGD
                     LKKARSSLCTLRGLRPEDKFVEEELEEIVANYEYEKTFGKSTILDCFKTGNHQLKRIT
                     TGIVIQALQQLTGINFIFYYGTQFFKSSGINNPFTIQLITNIVNVICTLPGIALVELA
                     GRRRLLLWGAVGMCVSEFLVAIIGTAVPNSTAANKTLIAFSCTFIASFAATWGPLAWV
                     VVGEIFPLRVRAKSVAICAGSNWLFNFVIAFITPYLVDEDRANLRSKVFFIWGGCTFL
                     CILFVYLFVYETKGLTLEEIDELYDTVTDARKSRSFVPTNKFLEVAPIPVEQYSSNEN
                     NSLGEGIEKANVGYIEKV"
     gene            <16995..>17840
                     /gene="TDEL0C00160"
                     /locus_tag="TDEL_0C00160"
                     /db_xref="GeneID:11500263"
     mRNA            <16995..>17840
                     /gene="TDEL0C00160"
                     /locus_tag="TDEL_0C00160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680068.1"
                     /db_xref="GeneID:11500263"
     CDS             16995..17840
                     /gene="TDEL0C00160"
                     /locus_tag="TDEL_0C00160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680116.1"
                     /db_xref="GeneID:11500263"
                     /db_xref="UniProtKB/TrEMBL:G8ZQW3"
                     /translation="MALSALKSLATGKKGARKPMTNLELRGEFENSIPIISVLMKRGF
                     YSFDSEYSYELFRSRNGLEYTALDVDGRGIPSLYITDDVTSLGSWKSDLPSFLTFKFV
                     VLPAHKPGPNVDCQLEVERNGLCLYRIPFYEIYRGIGENYIFSFSALRDRSKNFTISH
                     LSSNISNVNVRWRDCKSITGEYDDYSLQVTNKVLGEHKGGPGESEVPVIAYYSRANRD
                     SRYPKLFKQATLYVGNNTNEAVLLFTPRNIELITYQALLVHYLEYQERERRVDRSQTR
                     WSSWL"
     gene            <19462..>20196
                     /gene="TDEL0C00170"
                     /locus_tag="TDEL_0C00170"
                     /db_xref="GeneID:11500264"
     mRNA            <19462..>20196
                     /gene="TDEL0C00170"
                     /locus_tag="TDEL_0C00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680069.1"
                     /db_xref="GeneID:11500264"
     CDS             19462..20196
                     /gene="TDEL0C00170"
                     /locus_tag="TDEL_0C00170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680117.1"
                     /db_xref="GeneID:11500264"
                     /db_xref="UniProtKB/TrEMBL:G8ZQW4"
                     /translation="MKCILNYRTLLKLSQILAGKHFRPLMPMVSSLLNHLRPGKKGAR
                     KPKSESELRQDFDNSIPIASVLMERGFYTFDSESSYEDFKRNNSLGYRALDFCGKGIP
                     TLYITDDATSLGKWKGDRPHFLVFKFLVLPSEEAGPSENCHLEAEKNGLCLYRIPLCT
                     VYRRNEVDGMKYIFSFFDVQDRAKNFTMKCLSTSIADVKVRWQDRKSIMGEYDDYSLR
                     AMNQKALKMNQRALNCLLFAGKSRPF"
     gene            complement(<21059..>22825)
                     /gene="TDEL0C00180"
                     /locus_tag="TDEL_0C00180"
                     /db_xref="GeneID:11500265"
     mRNA            complement(<21059..>22825)
                     /gene="TDEL0C00180"
                     /locus_tag="TDEL_0C00180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680070.1"
                     /db_xref="GeneID:11500265"
     CDS             complement(21059..22825)
                     /gene="TDEL0C00180"
                     /locus_tag="TDEL_0C00180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680118.1"
                     /db_xref="GeneID:11500265"
                     /db_xref="GOA:G8ZQW5"
                     /db_xref="InterPro:IPR004006"
                     /db_xref="InterPro:IPR004007"
                     /db_xref="InterPro:IPR012734"
                     /db_xref="UniProtKB/TrEMBL:G8ZQW5"
                     /translation="MSQKQFKSDGNIVGPYLLGLARSNPGLTVIKHDRVVYRTKSAGN
                     DSKVALVSGGGSGHEPTHAGFVGDGALDAIAAGAIFASPSTKQIYSAIKAVESAKGVL
                     IIVKNYTGDVIHFGLAAERAKLAGMKVEMVAVGDDVSVGKKKGSLVGRRGLGATCLVH
                     KIAGAAATFGLELHDVAEVAQSVVDNSVTINASLDHCTVPGHKPENLLGKDEYEIGMG
                     IHNESGTQKSSPLPSIPELVSKLLPLVLGEDEDRSYVKFDPKDEVVLMINNMGGLSNL
                     ELGYAAEIVSEQLIEKYHIVPKRTITGTFITALNGPGFGITLLNASKAGKDIIKYFDY
                     PTTASGWNQMYHKAEDWKPLADGKVPSAPPLKQVRNEKKSGVKADYDTFAKILLAGIA
                     KINEVEPKVTFYDTIAGDGDCGTTLVTGGKALTEAIKDRSLRLDDAALGIEDIAYIVE
                     DSMGGTSGGLYSIYLSALAKGVRDSGDSKLTAETFKNASQFALDALYKYTRARPGYRT
                     LIDALQPFVETLNAGKGPRAAAKAAHEGAEKTRKMEALVGRASYVAKEELKRLDDEGG
                     LPDPGAVGLAALLDALVSEAGF"
     gene            <24067..>25554
                     /gene="TDEL0C00190"
                     /locus_tag="TDEL_0C00190"
                     /db_xref="GeneID:11500266"
     mRNA            <24067..>25554
                     /gene="TDEL0C00190"
                     /locus_tag="TDEL_0C00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680071.1"
                     /db_xref="GeneID:11500266"
     CDS             24067..25554
                     /gene="TDEL0C00190"
                     /locus_tag="TDEL_0C00190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680119.1"
                     /db_xref="GeneID:11500266"
                     /db_xref="InterPro:IPR001959"
                     /db_xref="InterPro:IPR010095"
                     /db_xref="InterPro:IPR021027"
                     /db_xref="UniProtKB/TrEMBL:G8ZQW6"
                     /translation="MTISTQNQAKKRKTSKSKAAKPYWNENAAHFSQQWGLNTMLPTA
                     AKKLGQKINSDSWFSVIKHPQAPIINDSLNLPLSSGVEEELIRARKIRIYPTNSQKET
                     LKKWFGCHRYIYNKALKMHKDGVLMNIKILREKLLNKKTSALTPEEQWLSEYNYDLKD
                     EALRDLVKNYSSNMAKFKKTRVPFKLRFKTKKAPVQTLSVLKKYWNKGKKTFYSDIYS
                     SFSLRGAEPLPEELPRDSRLQRTRNNKYYLIVPMAGGEIARKPPTEKFIFIDPGVRTF
                     LTGYDSSQTVVEIGKDAIVRIEKLKRRRRQLQSKLAKLRKHKKRQNHRKALHRLDEKI
                     SHIVQDLHKKSALFLCKSYDSIFLPKLNFHHCTKLNRKSRSSMATLAHCSFHDRLTMK
                     AEQFHDASVHEVEEDYTSKTCSTCGKIKNDLRSNKIYSCLGCFSVFDRDFNAAKNIML
                     KYICEHLMASGGSSISSSLSGGNGRLAMMGPGPFVRKYVVSPSEI"
     gene            <25849..>27732
                     /gene="TDEL0C00200"
                     /locus_tag="TDEL_0C00200"
                     /db_xref="GeneID:11500267"
     mRNA            <25849..>27732
                     /gene="TDEL0C00200"
                     /locus_tag="TDEL_0C00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680072.1"
                     /db_xref="GeneID:11500267"
     CDS             25849..27732
                     /gene="TDEL0C00200"
                     /locus_tag="TDEL_0C00200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680120.1"
                     /db_xref="GeneID:11500267"
                     /db_xref="GOA:G8ZQW7"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR022357"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="UniProtKB/TrEMBL:G8ZQW7"
                     /translation="MSNSSVSSSSSSSLGEHERPSEDRPKILLTTPSDHNNNQVKWDQ
                     ATSPAKVSGSERRNNPLGGPSRRSPLPSNSPGRFNQREEDPIVYAYSSPNLRALNNNP
                     NYEQARLADGLYGGVSRPNYVDPLYQQLNPTRNSNKKKPVWSLNQPLPHVVDQAMVDR
                     MLQKKRSGNRSRQSSRPGSTDVSRSGSMTSMNDWKKLIRKTASNLKLTDLEAQIPVPH
                     ATPRPSGVRADSSRIPSEPAKNRIPHGDVNFSLGDESSPPSVLDEEPQKAKNGNLDNV
                     THKEYLPTSPDKEYREAAQGGDGGVDVNDAGDDESEEMEFPNFWAKIRYTMREPFAEC
                     FGTLILVIFGVGGNLQATVTKGAGGSFESLSFAWGFGCMLGVYVAGGISGGHINPAVT
                     ISMAIFRKFPWKKVPVYIFAQIVGAFFGGAMAYGYFWSSITEFEGGKDIRTANLSGAC
                     LYTDPKPYVTWRNAFFDEFIGGAILVGCLMALLDDTNAPPASGMTAFIVGLLVAGIGM
                     ALGYQTSFTINPARDLGPRIFAAMVGYGRHPFQITHYWWSWGAWGGPIAGGIAGALVY
                     DIFIFTGSESPINYPDKGYVERRIGKLLHNEDAADEKTVSPDADGANSSDTLVRNQGS
                     STK"
     gene            complement(<28137..>28841)
                     /gene="TDEL0C00210"
                     /locus_tag="TDEL_0C00210"
                     /db_xref="GeneID:11500268"
     mRNA            complement(<28137..>28841)
                     /gene="TDEL0C00210"
                     /locus_tag="TDEL_0C00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680073.1"
                     /db_xref="GeneID:11500268"
     CDS             complement(28137..28841)
                     /gene="TDEL0C00210"
                     /locus_tag="TDEL_0C00210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680121.1"
                     /db_xref="GeneID:11500268"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:G8ZQW8"
                     /translation="MSTPIIRVHWLNESRAFRVLQLLEQLKLDYEIVPYKRNQDFRAP
                     EDAKKIHPLGRFPLVELEDRTTGKKKVLAESGYIFHYILQHLDSKGLLKNNDPDQAEQ
                     IEYFLYYAEGSLQLPLMVEFILSMTKKAPIPFPLSYLSGKVADKISEKYSKGELQNQL
                     KFVEGEIAKNQGYLVGGKLSGADILMLFPLQSALNRGFAKREEYPHISKFVDTLTSLD
                     SYSAAKAKATANGGKF"
     gene            <29513..>30610
                     /gene="TDEL0C00220"
                     /locus_tag="TDEL_0C00220"
                     /db_xref="GeneID:11500269"
     mRNA            <29513..>30610
                     /gene="TDEL0C00220"
                     /locus_tag="TDEL_0C00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680074.1"
                     /db_xref="GeneID:11500269"
     CDS             29513..30610
                     /gene="TDEL0C00220"
                     /locus_tag="TDEL_0C00220"
                     /inference="similar to DNA sequence:INSDC:YML131W"
                     /note="similar to Saccharomyces cerevisiae YML131W;
                     ancestral locus Anc_8.0"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680122.1"
                     /db_xref="GeneID:11500269"
                     /db_xref="GOA:G8ZQW9"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZQW9"
                     /translation="MVSAKQWVLKNTPVPGQPFNFNFEDPEASFELKEVNLSADDLKE
                     GGILVETHYISNDPAQKFWIASVDKNYSKGVEPGENIPARGLGKILASKNKDYQVGDY
                     VVGKFCWTTAVIVDDPVEAIVHKVSKDDVGELWWHLSVLGSTALTAYFIFYKYAGLQE
                     KEEYCGKTFVISGAAGAVGSVCTQLALNVFKAAKVIAIAGGPEKVKYVESFGANVVGV
                     DYKSDTFKDDLKHAAGGINTVDYFIDNVGGEILDLGVTLLKVHGTVIACGSISGYNDP
                     QKFVFKNYSAVITKRLTLRGLLVTDDLAEFPKAFAKLAQLIKAGDLDPSNSATLVDAI
                     GEKFEYIPVIWSGLFQGINKGKLISVVKKED"
     gene            complement(<30872..>31906)
                     /gene="TDEL0C00230"
                     /locus_tag="TDEL_0C00230"
                     /db_xref="GeneID:11500270"
     mRNA            complement(<30872..>31906)
                     /gene="TDEL0C00230"
                     /locus_tag="TDEL_0C00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680075.1"
                     /db_xref="GeneID:11500270"
     CDS             complement(30872..31906)
                     /gene="TDEL0C00230"
                     /locus_tag="TDEL_0C00230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680123.1"
                     /db_xref="GeneID:11500270"
                     /db_xref="GOA:G8ZQX0"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZQX0"
                     /translation="MSILVSGATGFIALHVVSDLLKQDYKVIGTVRSQEKADKLHKQF
                     GNNPNLSFELVSDIAAPEAFDKVFQKHGKDIKVVLHTASPFTLETTNYEKDLLLPAVN
                     GTKSILESIKKYAADSVERVVVTSSHAAVMDVSKEGDGSIVYTEKDWNPATWENCQID
                     GLNAYCGSKKLAEKAAWDFLEENKNVVKFKMSTINPTYVFGPQLFDEDVKDKLNTSCE
                     LINSILKNNPQVEYLLENFKGHFVDVRDVAKAHLVAFQKDEAIGQRLLTTNGRFVYQD
                     LVDIINEDFPQLKGKVIVGKPGAGKQLYGTFPDVNNTRSKEILGFEFISLHKSVHDTA
                     AQVLKKEGKL"
     gene            <32272..>33852
                     /gene="TDEL0C00240"
                     /locus_tag="TDEL_0C00240"
                     /db_xref="GeneID:11500235"
     mRNA            <32272..>33852
                     /gene="TDEL0C00240"
                     /locus_tag="TDEL_0C00240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680076.1"
                     /db_xref="GeneID:11500235"
     CDS             32272..33852
                     /gene="TDEL0C00240"
                     /locus_tag="TDEL_0C00240"
                     /inference="similar to DNA sequence:INSDC:YFL049W"
                     /note="similar to Saccharomyces cerevisiae SWP82
                     (YFL049W); ancestral locus Anc_8.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680124.1"
                     /db_xref="GeneID:11500235"
                     /db_xref="InterPro:IPR013933"
                     /db_xref="UniProtKB/TrEMBL:G8ZQX1"
                     /translation="MGEVVELFPVDSAVILRHERVLVKQMLHIFSEGELMQGPMDKHP
                     RKSVEIPDFTGPEKFKDESTSAYRMIQTDPLGERKISITGELMGGREYLCHTFKLKEV
                     SNRFVLVSHLVDTLGYEGNEENFLTEFNQLLPIELTSDIKDLLIEKKFLSDSDENVKY
                     VTLKSAFAQFGAALVACGERVIDDYWETIAKRQELTAHHRVFKLSKRLVSKLRILKPY
                     IFPEEHQQPANLTEESPSFESPWLTVTEQTSLDVRHQWGKEFSYGEHINAVVPGQSIN
                     GSLDLSAQCKIPKYHSKNSFQQAVQMKALDLPIGSAVHSAAIKTPITKQENTPSIPQP
                     AKKASNRILNSILDSGTSNKTKKPDVLEETVGQNAPGSTNETLNINGWKFDSLPLRSA
                     GILQSQRSLKGLPFYDQDKLVARVKKLTPNQVQKIEHIHDSVFLNVGLQNLRNTRSQK
                     WSKYWQYKSGVPIGLLSDKVDYFRDQYLKDALEETSSVTNYIPERNVDEIDITTREAN
                     ANYIGHSNIHGFRPPYRS"
     gene            complement(<33919..>35211)
                     /gene="TDEL0C00250"
                     /locus_tag="TDEL_0C00250"
                     /db_xref="GeneID:11500236"
     mRNA            complement(<33919..>35211)
                     /gene="TDEL0C00250"
                     /locus_tag="TDEL_0C00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680077.1"
                     /db_xref="GeneID:11500236"
     CDS             complement(33919..35211)
                     /gene="TDEL0C00250"
                     /locus_tag="TDEL_0C00250"
                     /inference="similar to DNA sequence:INSDC:YFL048C,YLR080W"
                     /note="similar to Saccharomyces cerevisiae EMP47 (YFL048C)
                     and EMP46 (YLR080W); ancestral locus Anc_8.2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680125.1"
                     /db_xref="GeneID:11500236"
                     /db_xref="GOA:G8ZQX2"
                     /db_xref="InterPro:IPR005052"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:G8ZQX2"
                     /translation="MKMKLLGTSMALIASVAHIVNAHATEKSDDTKLNQAMSLPDLIS
                     STKVPKSWTAGDSSVLEEGRIILTPQRGTKGSLWQKENYKLEDSFTLEWTFRSVNYEG
                     KSEGGLSFWFLSSNSRSDFKDETFYNGPSKFDGLQLLVDNNGPLSSTMRAQLNDGGEP
                     FTKQNVYDRSLASCLMGYQDSSVPSTLRLTYDRSENNLLKLQINNKICFQTRKVQFPA
                     GEYRIGVTAENANTPESFEILKMELYNGPIEDSYIPNVNEMGQPRVLTKVIDKETGQE
                     RLLEKEAYDIENDKISNYELYKKLDRVEGKILANDINALGAQITQLQKTQEELLKYIS
                     QVSQGTSVSKGKSGDAIDEDRSKYGDFISMNEKLEKMLIEQERAREAAKLATHSGPHI
                     DDIASKLALWLLPLIFIMLVMAYYTFKIRQEIVKTKLL"
     gene            complement(<35428..>35814)
                     /gene="TDEL0C00260"
                     /locus_tag="TDEL_0C00260"
                     /db_xref="GeneID:11500237"
     mRNA            complement(<35428..>35814)
                     /gene="TDEL0C00260"
                     /locus_tag="TDEL_0C00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680078.1"
                     /db_xref="GeneID:11500237"
     CDS             complement(35428..35814)
                     /gene="TDEL0C00260"
                     /locus_tag="TDEL_0C00260"
                     /note="ancestral locus Anc_8.3"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680126.1"
                     /db_xref="GeneID:11500237"
                     /db_xref="GOA:G8ZQX3"
                     /db_xref="InterPro:IPR011893"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:G8ZQX3"
                     /translation="MPYPKISIRFCTRCKWNLRSAWYLQELLQTFGDNLGEISLIPGE
                     TGEFRVLGQLGQDSEEICIWDRKVQDGFPDSKFLKQRVRNLLFDNNVSIGKHNERSSG
                     QNHLTGLNPPRETLIKQEECHDCNDN"
     gene            <35997..>38150
                     /gene="TDEL0C00270"
                     /locus_tag="TDEL_0C00270"
                     /db_xref="GeneID:11500238"
     mRNA            <35997..>38150
                     /gene="TDEL0C00270"
                     /locus_tag="TDEL_0C00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680079.1"
                     /db_xref="GeneID:11500238"
     CDS             35997..38150
                     /gene="TDEL0C00270"
                     /locus_tag="TDEL_0C00270"
                     /inference="similar to DNA sequence:INSDC:YFL047W"
                     /note="similar to Saccharomyces cerevisiae RGD2 (YFL047W);
                     ancestral locus Anc_8.4"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680127.1"
                     /db_xref="GeneID:11500238"
                     /db_xref="GOA:G8ZQX4"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:G8ZQX4"
                     /translation="MPNFADSFWSEDLVSGIQVLFEKLYDGCEECDMFIQLFASRMQF
                     EVNYGRQLGGVSTGIDHLDKVKNDPEVTTANALLSMTAQMVQEGKHHLSVASNIEAFI
                     LQPFSQWCDDHRKRVEYSEKSLKSNVGNYQKSRKYVSKLEREYFNKCRQLEDFKRSNF
                     NEDELVNATASLKLQEKYEDDVAREKDFQHFATVAGIEFDFKSMREALQLLLKELPKS
                     EYRVPLINYTLQNTNSGGEITKFVMEHMSLKDIDQAETFGQDLLNLGFLKYCNGVGNT
                     FVNSKKFQYQWKGYAYKFANLPQPFAESEINIPQMDPKLSNYLQDFTSKMSPGSPIPS
                     TPAASSVTVPSLSDSEKELFRLRKEAELADSKYRQECFKMDSLRCSIEELMVDHLSFM
                     EKCELDRLKAVKKVTFDFCGAIGNKISSLKISVDTMLENNDRMDPTGDLLNLLSQCRT
                     GVFQPRAITYNNYYNPGAFQNFGIDLESRCRLDKKVVPLIASVILSYMDQVYPELPSD
                     KVRTAVWTAPVKLNLTHQLRHLLNQRQLHDDTEVLEVIEDYNGEPSTVASVLKIYLLE
                     LPERLITKDIYDVLKVLYAEYSLPATTDEEEPTSEEVKGQEADKKLEIDNNRITGLAT
                     TLATLPKPHIATLDAIITHFYRLIKILKMGESGALAAAEFTSAISQEFANCIIEVRMP
                     DGNDLGYKIFYDLLTHRKQIFGELKRQGTKKKDNP"
     gene            complement(<38220..>39080)
                     /gene="TDEL0C00280"
                     /locus_tag="TDEL_0C00280"
                     /db_xref="GeneID:11500239"
     mRNA            complement(<38220..>39080)
                     /gene="TDEL0C00280"
                     /locus_tag="TDEL_0C00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680080.1"
                     /db_xref="GeneID:11500239"
     CDS             complement(38220..39080)
                     /gene="TDEL0C00280"
                     /locus_tag="TDEL_0C00280"
                     /inference="similar to DNA sequence:INSDC:YLR079W"
                     /note="similar to Saccharomyces cerevisiae SIC1 (YLR079W);
                     ancestral locus Anc_8.5"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680128.1"
                     /db_xref="GeneID:11500239"
                     /db_xref="UniProtKB/TrEMBL:G8ZQX5"
                     /translation="MTPSTPPASRGRRNSRSVCTFEEALQERKDHEFPQTPHRGSHLR
                     APVTPSTVKPFKHSVPSLKAPLMGNVSKSPFKGFNSPEYTPQTQSSKSKGPLLEPAGE
                     LQNVSRVLFPPSNEELLSVSDRAPLSLLPPRRPVSTRRDLSDQFSSDLEEGEYQESRK
                     LAKQVPGTPSHKVVTFQMAQEWNNSEHESADDLSDSEEIVKGKSLYNPFQSEEVADES
                     IRQQRKQLLLHENPDIEDVITYVNKKGDVVRRRHLSEREKELYKPKRLFAEELNVLET
                     KRKQDIEEEH"
     gene            <39585..>40396
                     /gene="TDEL0C00290"
                     /locus_tag="TDEL_0C00290"
                     /db_xref="GeneID:11500240"
     mRNA            join(<39585..39587,39677..>40396)
                     /gene="TDEL0C00290"
                     /locus_tag="TDEL_0C00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680081.1"
                     /db_xref="GeneID:11500240"
     CDS             join(39585..39587,39677..40396)
                     /gene="TDEL0C00290"
                     /locus_tag="TDEL_0C00290"
                     /inference="similar to DNA sequence:INSDC:YLR078C"
                     /note="similar to Saccharomyces cerevisiae BOS1 (YLR078C);
                     ancestral locus Anc_8.6"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680129.1"
                     /db_xref="GeneID:11500240"
                     /db_xref="UniProtKB/TrEMBL:G8ZQX6"
                     /translation="MNAIYNHGVKQKNQLQVDLGKFEKDPYTSPISLQGSISATLVSF
                     ERTIEQYKDQFKKYQTNNLDGSETENVKYQNRLDSLVSAHKDFAVKFAELKEQYNKSD
                     ARSLLFSGSDAYKVDGESVVNKRSVPQVNSASPRASFDHRAGLPLYNGLQKEQSIFQR
                     GNAQLDLILEMGHQSLDDLVEQNQILRKVQDRMSSSLRTLGVSEGTIQMINRRAFKDK
                     LIFWFAFILMLIGFYFVFKWLR"
     gene            complement(<40433..>42211)
                     /gene="TDEL0C00300"
                     /locus_tag="TDEL_0C00300"
                     /db_xref="GeneID:11500241"
     mRNA            complement(<40433..>42211)
                     /gene="TDEL0C00300"
                     /locus_tag="TDEL_0C00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680082.1"
                     /db_xref="GeneID:11500241"
     CDS             complement(40433..42211)
                     /gene="TDEL0C00300"
                     /locus_tag="TDEL_0C00300"
                     /inference="similar to DNA sequence:INSDC:YLR077W"
                     /note="similar to Saccharomyces cerevisiae YLR077W;
                     ancestral locus Anc_8.7"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680130.1"
                     /db_xref="GeneID:11500241"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:G8ZQX7"
                     /translation="MSGIVVIRRCILQRPHVRGSVRLHFRGFVSGQQLMKSNAPQFDE
                     AELLAPELESKPYKAKKSLMDYEWPDKSPEELEKENQDKTEKLMKLSAILQGLLVLAG
                     VGIGATVYSKWPQIKGWWMTKDMRVDDDTIEKLFKKKAKKSLADIPIIPTTELGFEVP
                     GLYFWGGDGEGLKKSRPGSVFPRRNSLFDGKYLRDVCLTTVNNVQANLAIDEKGNLLK
                     WDNNKCECILADQNLVSVKESNSCAYALNKRGEILIVPLNSGDVRLAHIDMKRSWLLP
                     WRRYTNYGFKLDTKSVFKGSGEKKVRDFDVGKEHLVLISNAGKAYSCATGVKASEGQR
                     PCGQFGVPTLSHFDKFPPPNKLYEIELLNNGLTEDKKVEKRKIEQIACGNFHTLARDS
                     NGNLFVFGLNRYGQLGLPILYDIDQAPYPKVLNRFNSYFSRDIDVKCVDVHCSGDTSY
                     VTMTANNLGDRTTQLPAESISYFAFGSGQYGELGNGNFRNSQSEPTPLKDLPASNKIE
                     EWACGEKHVLCKLHNGDVCAWGLNDHGQLGTGKRIKHGRPVSIPEALTPGAKNSPEEL
                     FKTKLKLLPGQYLAAGGDSSCIYWKK"
     gene            <42339..>42953
                     /gene="TDEL0C00310"
                     /locus_tag="TDEL_0C00310"
                     /db_xref="GeneID:11500242"
     mRNA            <42339..>42953
                     /gene="TDEL0C00310"
                     /locus_tag="TDEL_0C00310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680083.1"
                     /db_xref="GeneID:11500242"
     CDS             42339..42953
                     /gene="TDEL0C00310"
                     /locus_tag="TDEL_0C00310"
                     /inference="similar to DNA sequence:INSDC:YFL046W"
                     /note="similar to Saccharomyces cerevisiae YFL046W;
                     ancestral locus Anc_8.8"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680131.1"
                     /db_xref="GeneID:11500242"
                     /db_xref="InterPro:IPR012439"
                     /db_xref="InterPro:IPR024461"
                     /db_xref="UniProtKB/TrEMBL:G8ZQX8"
                     /translation="MRVVGLLMKKQFHSCRRLLSDFETVHIQHTNNYKKLLMEKGNFT
                     EEQSNAIVGLMSDAIKGGIAHVSQDLAKRERLTQLTYQQRVDFTKLRDQLLSADRSEF
                     HNIQNEYERVRNDLDKLRNKLREEITKANAGFKLDLSLEKGRIREESSHHDVQIKEID
                     TRIDQEVTNIKMQIESVKTQVMQWLIGVCTGTFALVLAYVRLLS"
     gene            complement(<43006..>43770)
                     /gene="TDEL0C00320"
                     /locus_tag="TDEL_0C00320"
                     /db_xref="GeneID:11500243"
     mRNA            complement(<43006..>43770)
                     /gene="TDEL0C00320"
                     /locus_tag="TDEL_0C00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680084.1"
                     /db_xref="GeneID:11500243"
     CDS             complement(43006..43770)
                     /gene="TDEL0C00320"
                     /locus_tag="TDEL_0C00320"
                     /inference="similar to DNA sequence:INSDC:YFL045C"
                     /note="similar to Saccharomyces cerevisiae SEC53
                     (YFL045C); ancestral locus Anc_8.9"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680132.1"
                     /db_xref="GeneID:11500243"
                     /db_xref="GOA:G8ZQX9"
                     /db_xref="InterPro:IPR005002"
                     /db_xref="InterPro:IPR006379"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G8ZQX9"
                     /translation="MPVSEFAYKESPETLVLFDVDGTLTPARLTVSDEVRDTLAQLRK
                     KVCIGFVGGSDLSKQLEQLGPNVLNEFDYAFSENGLTAYRLGEELASQSFINWLGEEK
                     YNKLAAFILKYLGNMELPKRRGTFLEFRNGMINVSPIGRNASTEERNEFERFDKEHQV
                     RAKFVEALKKEFPDLGLTYSIGGQISFDVFPSGWDKTYCLKHVADDGFKEIHFFGDKT
                     SVGGNDYEIYEDPRTIGHSVQTPNDTVRILRELFQL"
     gene            complement(<44047..>44712)
                     /gene="TDEL0C00330"
                     /locus_tag="TDEL_0C00330"
                     /db_xref="GeneID:11500244"
     mRNA            complement(<44047..>44712)
                     /gene="TDEL0C00330"
                     /locus_tag="TDEL_0C00330"
                     /product="60S ribosomal protein L10"
                     /transcript_id="XM_003680085.1"
                     /db_xref="GeneID:11500244"
     CDS             complement(44047..44712)
                     /gene="TDEL0C00330"
                     /locus_tag="TDEL_0C00330"
                     /inference="similar to DNA sequence:INSDC:YLR075W"
                     /note="similar to Saccharomyces cerevisiae RPL10
                     (YLR075W); ancestral locus Anc_8.10"
                     /codon_start=1
                     /product="60S ribosomal protein L10"
                     /protein_id="XP_003680133.1"
                     /db_xref="GeneID:11500244"
                     /db_xref="GOA:G8ZQY0"
                     /db_xref="InterPro:IPR001197"
                     /db_xref="InterPro:IPR016180"
                     /db_xref="InterPro:IPR018255"
                     /db_xref="UniProtKB/TrEMBL:G8ZQY0"
                     /translation="MARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVD
                     EFPLCVHLVSNELEQLSSEALEAARICANKYMTKISGRDAFHLRVRVHPFHVLRINKM
                     LSCAGADRLQQGMRGAWGKPHGLAARVAIGQIIFSVRTKDNNKDVVIEGLRRARYKFP
                     GQQKIILSKKWGFTNLDRPEYVKKRDAGEVKDDGAFVKFLSKKGSLEHNFREFPDYFT
                     QHA"
     gene            <45150..>45635
                     /gene="TDEL0C00340"
                     /locus_tag="TDEL_0C00340"
                     /db_xref="GeneID:11500245"
     mRNA            <45150..>45635
                     /gene="TDEL0C00340"
                     /locus_tag="TDEL_0C00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680086.1"
                     /db_xref="GeneID:11500245"
     CDS             45150..45635
                     /gene="TDEL0C00340"
                     /locus_tag="TDEL_0C00340"
                     /inference="similar to DNA sequence:INSDC:YLR074C"
                     /note="similar to Saccharomyces cerevisiae BUD20
                     (YLR074C); ancestral locus Anc_8.11"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680134.1"
                     /db_xref="GeneID:11500245"
                     /db_xref="GOA:G8ZQY1"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="UniProtKB/TrEMBL:G8ZQY1"
                     /translation="MGRYSVKRYKTKRRTKDLDLIYNELASKDKIQQLLNQPLDETKP
                     GLGQHYCIHCAKYLETAIALKTHLKSKRHKRRVSELKGVPYTQETSDAAAGYNLNKFL
                     NRVEQIKGAVGAEKENNEQLLKEHLDKNLENVSTTEPTLPWANEEPSEVNGDENEVIM
                     G"
     gene            complement(<45661..>46563)
                     /gene="TDEL0C00350"
                     /locus_tag="TDEL_0C00350"
                     /db_xref="GeneID:11500246"
     mRNA            complement(<45661..>46563)
                     /gene="TDEL0C00350"
                     /locus_tag="TDEL_0C00350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680087.1"
                     /db_xref="GeneID:11500246"
     CDS             complement(45661..46563)
                     /gene="TDEL0C00350"
                     /locus_tag="TDEL_0C00350"
                     /inference="similar to DNA sequence:INSDC:YFL044C"
                     /note="similar to Saccharomyces cerevisiae OTU1 (YFL044C);
                     ancestral locus Anc_8.12"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680135.1"
                     /db_xref="GeneID:11500246"
                     /db_xref="InterPro:IPR003323"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8ZQY2"
                     /translation="MKVKISGPQGLNKVLTLGPDDTLEQLVENSGSSLPVIGVRFGYP
                     PQKVECTEETLQASVDSLGVSSGEKITLITEEFPEAKIDDGLDVKLPVTATRIVLPDG
                     QQRVLEVHQVPDDNSCLFHAISYCNYKDISISPQLRSLVSEQVLADPVTYSDAVLDRP
                     NHEYAKWILKKESWGGGIEIAIISKKLGIAIYVLDIDAQQFEKFNEDQFDPFIVIMFN
                     GVHYDAIELDDGKTVFDKRDLFYTELILTGALEIARQMKKTGHSFNTRKDNIICNVCQ
                     KTLVGEREVAKHAESTGHVDFGQA"
     gene            <47010..>47651
                     /gene="TDEL0C00360"
                     /locus_tag="TDEL_0C00360"
                     /db_xref="GeneID:11500247"
     mRNA            <47010..>47651
                     /gene="TDEL0C00360"
                     /locus_tag="TDEL_0C00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680088.1"
                     /db_xref="GeneID:11500247"
     CDS             47010..47651
                     /gene="TDEL0C00360"
                     /locus_tag="TDEL_0C00360"
                     /inference="similar to DNA sequence:INSDC:YLR073C"
                     /note="similar to Saccharomyces cerevisiae YLR073C;
                     ancestral locus Anc_8.13"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680136.1"
                     /db_xref="GeneID:11500247"
                     /db_xref="InterPro:IPR015063"
                     /db_xref="UniProtKB/TrEMBL:G8ZQY3"
                     /translation="MQSTAQLNIEALDYKFFPSTSLKVYLKACVGILDKAQLAFQEGN
                     LKRAYVFYVRYVDLCTNKLSHHPQYLGKDSDQVSEIALHRQEYLQLIRLEVPAVLKIT
                     EDLRKQLDLDYAKHKLSLAKNIARPKQQHHNSIESEVPALAKLPPSFDNGIFNHSLRY
                     YHETTSFGNHSQTPVKKSQNSQAEPTNDAKESKNKPGQFRYYPELPQLSFPTF"
     gene            complement(<47694..>50210)
                     /gene="TDEL0C00370"
                     /locus_tag="TDEL_0C00370"
                     /db_xref="GeneID:11500248"
     mRNA            complement(<47694..>50210)
                     /gene="TDEL0C00370"
                     /locus_tag="TDEL_0C00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680089.1"
                     /db_xref="GeneID:11500248"
     CDS             complement(47694..50210)
                     /gene="TDEL0C00370"
                     /locus_tag="TDEL_0C00370"
                     /inference="similar to DNA sequence:INSDC:YFL042C,YLR072W"
                     /note="similar to Saccharomyces cerevisiae YFL042C and
                     YLR072W; ancestral locus Anc_8.14"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680137.1"
                     /db_xref="GeneID:11500248"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="UniProtKB/TrEMBL:G8ZQY4"
                     /translation="MEPSDVDNWTPVSDGGADDSETTLTRRNRDSSEANLLSPLSDPF
                     VPEVQELPVDDDEAAEAVEGPKSPYTRKSSLRRKSGSSLDAVALNLKSSPADPHLSDV
                     NSISSTASMSAGKNSALSSVNDIISNSEKNSIKSSAEGIQPPSGAATFFDSMMSSLSF
                     KQGSQQSTQQGLDTKKANPPDIITHRRQPSTNNKKTGKKANSPPETSSPLKEVEKPQE
                     MVRRVSLHDNETFDPKRFVGETYLDTPFHYANAERNAEFHSLFKNVPESDRLLDDFSC
                     ALSREFLYQGRIYVSESHLCFSSSLLGWIAKVVTPFKDVTYMEKTSTAGLFPNAISIE
                     TETSKTQFNGFISRDTAFTLLKEVWSRTLLAQGEKQKDESLTKSVSTTSMDRHMVSQP
                     ENRSYTDLVRPSEPPSRTSFVSENDSIIEDAIRSVDDYTPSHYAYDSGVGSEDEDDDE
                     EDDKHEEQSAGKPTSSKTKKIGFKLKPKVNYEYDGPYYAKATSFQYKPEDNKETVLAE
                     LELDAPPGVVFQLLFSETNPKFWLEFFKTQDSSQFSEIGRFDQVNQEGQHYREFTYAK
                     GLHFPVGPKSTKCVVQETILHLDYSDYINVLNITRTPDVPSGGSFSTRTRYMFRWASE
                     TTCALKISYWVEWTASSWIKSMVESSCKSGQLAATKDLVEHIKRYVAENTEKGTVSVY
                     TSPSKVGGRKAKVSTRPPAEKTTGEARSSAQLSNEGRLAEKAAGQPFGGSAYVLPLLL
                     TITLLLALNLFYQMSIKRDMDRIQDFISLQTSGNWGRANHPLIDLPAKAPSAKGGLAG
                     ELKKWLGRTKPQNTTYAESTVEQFLSSLETLLAEMAERSG"
     gene            <50610..>53714
                     /gene="TDEL0C00380"
                     /locus_tag="TDEL_0C00380"
                     /db_xref="GeneID:11500249"
     mRNA            <50610..>53714
                     /gene="TDEL0C00380"
                     /locus_tag="TDEL_0C00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680090.1"
                     /db_xref="GeneID:11500249"
     CDS             50610..53714
                     /gene="TDEL0C00380"
                     /locus_tag="TDEL_0C00380"
                     /inference="similar to DNA sequence:INSDC:YLR071C"
                     /note="similar to Saccharomyces cerevisiae RGR1 (YLR071C);
                     ancestral locus Anc_8.15"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680138.1"
                     /db_xref="GeneID:11500249"
                     /db_xref="GOA:G8ZQY5"
                     /db_xref="InterPro:IPR013947"
                     /db_xref="UniProtKB/TrEMBL:G8ZQY5"
                     /translation="MTTELDLEKMLDGKGATGNVGTKEMPKNDELDGVIPNGKRTNSK
                     DIQVLQTPDSNARRVADPAVTPPPIPHVEINQVSLALIMRNLTVFTMKEISQYMKTNE
                     HVNPQEPGSARKLRFLQLIIFMRNQFLKLYVLIKWCRTIKNNNFHTMIDLLNWFRVAN
                     AQVNNCIWALKSNVTAMSNAKLPNADLVTALEVLSLGRTNLPVHNFRMSGEDDPEAVA
                     GGMKKIPPKLVLHRLRDLNLAVSLKIALIDFPPQFQNYVIKNGRIYITVAEEFEIQLA
                     TIDCHSPLFFVDLQFLFTDRNLPLNKLRTEKVINELLFKSAKPLLALHNFLHKYVLTL
                     QLYMIHSELLDMESGGKFTGGNLVHRYDSKKSVISIKYWIHSKLGRRAKITIGVEKST
                     ESLVLKWNNPIATQSRMPVRYTNILKNLESILDEIMFNHSYLIRADLLAKGVFQEDEE
                     SPDVLLFQVPTTCFSVAPIQLKIDLLSGVFYFKNPTALLLKYVSQINRAENAEDLTKV
                     LHRLKLEKISHILRNMFEKTGWMCSRVIKLDQPIESQTATKNSSNALLQDDIFIRLPN
                     WLANWYLILTVISSNTSCIVEKRIGKVASVKGKWQLVYLGKSTVTTSRLETMTYQKVL
                     HLQKTIFHRVVNHMIIDSLNQLNIRNKICANDLASSTLPHYIADDSIANSNGECYTSI
                     ITLELESFLEGSKALNSILESSMFMKIDYSRSEIKLFGKFKCDTAMIKCKCDELLIHF
                     VPDDALAFYLCEELTNLNFIGQYLTKFKQKLMQMVVLTDVVERLHRNFASEGFKIVAL
                     KPNEISFKYLKDSTDNQDCTISIITSDQTVENMTVQLSPSNPQHIIQPFIDKGHMDYH
                     SIFNYLQFTSSLFIVFKTILSENQNSTNSYTMVSLGLHNLCEYQLLYHNPESGTKITV
                     IVELKNVSHNRRKKIQFYIHFSDEEHVSTKSMAYPLVHQVRNQVFMLETRDNSVATGP
                     RKYPHAIKLVDGISCDPSDVGPILLEIHNILRTDSNVVGSTPAMNGISSINPTTIPAT
                     ATTL"
     gene            <53995..>55056
                     /gene="TDEL0C00390"
                     /locus_tag="TDEL_0C00390"
                     /db_xref="GeneID:11500250"
     mRNA            <53995..>55056
                     /gene="TDEL0C00390"
                     /locus_tag="TDEL_0C00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680091.1"
                     /db_xref="GeneID:11500250"
     CDS             53995..55056
                     /gene="TDEL0C00390"
                     /locus_tag="TDEL_0C00390"
                     /inference="similar to DNA sequence:INSDC:YLR070C"
                     /note="similar to Saccharomyces cerevisiae XYL2 (YLR070C);
                     ancestral locus Anc_8.16"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680139.1"
                     /db_xref="GeneID:11500250"
                     /db_xref="GOA:G8ZQY6"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZQY6"
                     /translation="MASQEAVVLEKKELIQIESRPIPEIKNPHDVKIQIKATGICGSD
                     VHYFTQGSIGDFVVKSPLVLGHESAGVVVEVGDAVSSVKVGDRVAVEPGVPSRYSKET
                     MSGHYNLCPHMAFAATPPYDGTLVKYYLSPEDFVYKLADHISFEEGAVVEPLSVAVHA
                     NRLANTAFGQAVLVLGAGPVGLLAGAVAKAFGATDVVFVDIFESKLEKAKQFGATRTV
                     LFKPDSDENDLVSLVTKSLGGLHPDVVFECSGAEKCIRAAVKSVKRGGTFVQVGMGKD
                     NINFPINEFSQKEATFKGCFRYYEGDFDDAVKLLSTGKVNVKPLITKVFPFEQAVEAY
                     KHNVEHAKDVTKTIITGPQ"
     gene            <55698..>57563
                     /gene="TDEL0C00400"
                     /locus_tag="TDEL_0C00400"
                     /db_xref="GeneID:11500251"
     mRNA            <55698..>57563
                     /gene="TDEL0C00400"
                     /locus_tag="TDEL_0C00400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680092.1"
                     /db_xref="GeneID:11500251"
     CDS             55698..57563
                     /gene="TDEL0C00400"
                     /locus_tag="TDEL_0C00400"
                     /inference="similar to DNA sequence:INSDC:YFL041W"
                     /note="similar to Saccharomyces cerevisiae FET5 (YFL041W);
                     ancestral locus Anc_8.17"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680140.1"
                     /db_xref="GeneID:11500251"
                     /db_xref="GOA:G8ZQY7"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="UniProtKB/TrEMBL:G8ZQY7"
                     /translation="MISSIFGLLVAVILVCSSVVDAKVHTFNFTTGWVDANPDGVHPK
                     KMIGFNGQWPVPDIHVNKGDRVQIYLTNGFEDDTVTSLHFHGMFLRLSDGNKIQMDGP
                     SMVTQCPISPGQTFLYNFTVADQVGTYWYHAHSGAQFGDGMRGAFIIHDEDEPFHYDE
                     DMTIQLSDLYWKPYYDVQDEFLSRFNPTGAEPIPQNLLFNNTLNATLNFEPEKTYLLR
                     FINSGLFVSQYVSLEDHEMTIVEVDGVYVKPNTTDLLYIATGQRMSVLVKAKKADPGK
                     NFAIMQIMDELMLDVVPKDLVRNRTHQISYNENHEKPEPFYIDDFDKATEEFYLRPLD
                     DIELLDHYDTQITFNLSLDNLGDGVNYAMFNGVSYVHPKVPTLTTVLTSGKLATDARI
                     YGDNVNAYVLQKDEIIEIVVNNYDSGKHPFHLHGHNFQLIQKSPEYRPEADYPEEDQD
                     DITVPYNESAPLTPFPDYPVLRDTVVLAPSGHIVIRFKADNPGVWFFHCHLDWHLTQG
                     LGAVFIEDPLAVQEAETLSKTYKDVCSAANIPNQGNAAGHSDDWFNLDGLPRQPKPLP
                     SGFKAKGYIAFIISTLMALYGIYAISDYGLSETIPDDQAVYDTLKNVLDSNGVAY"
     gene            <57769..>60075
                     /gene="TDEL0C00410"
                     /locus_tag="TDEL_0C00410"
                     /db_xref="GeneID:11500252"
     mRNA            <57769..>60075
                     /gene="TDEL0C00410"
                     /locus_tag="TDEL_0C00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680093.1"
                     /db_xref="GeneID:11500252"
     CDS             57769..60075
                     /gene="TDEL0C00410"
                     /locus_tag="TDEL_0C00410"
                     /inference="similar to DNA sequence:INSDC:YLR069C"
                     /note="similar to Saccharomyces cerevisiae MEF1 (YLR069C);
                     ancestral locus Anc_8.18"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680141.1"
                     /db_xref="GeneID:11500252"
                     /db_xref="GOA:G8ZQY8"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004540"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZQY8"
                     /translation="MLLNCSVARGASYPSILSSLARCRAPARDLTRQLLIKKSFHASA
                     SAQSTYEEEKVVLDEMANKLKPSDIQAANKLRNIGISAHIDSGKTTFTERVLYYTGRI
                     KAIHEVRGRDNVGAKMDSMDLEREKGITIQSAATYCSWEKEKQPYHFNLIDTPGHIDF
                     TIEVERALRVLDGASFGCLCCIRCSIDKQLQLIVQMRRYNVPRVTFINKMDRMGSDPF
                     RAIAQINSKLKTPAAAVQVPIGAESDLEGVVDIINRVALYNKGDNGEIIERGPVPESL
                     KDLVEEKRQVLIEALADVDDHMAELFLDEQEPNPEQIVGAIRRATIARKFTPVLMGSA
                     LANTGIQPVLDAIVDYLPNPSEVLNTALDIAHEEAKVNLVPSAQQPFVGLAFKLEEGQ
                     YGQLTYIRVYQGRLRKGGYITNVKTGKKVKVSRLVRMHSNDMEDIDEVGSGEICATFG
                     IDCSSGDTFTDGSVDYSMSSMYVPDAVVSLSIHPKTKDASNFSKALNRFQKEDPTFRV
                     RFDAESKETIVSGMGELHLEIYVERMRREYNVECTTGKPQVSYRESITIPADFDYTHK
                     KQSGGAGQFGRVIGTMSPVEEGNKHNTFETAVVGGRIPDKYLAACGKGFDEACEKGPL
                     IGHKVIGVNMLINDGAIHAVDSNELAFKTATMAAFRDAFLRGQPVILEPIMTVTVTSS
                     NEFQGNVIGSLNKLQAVIQDTDNGPDEFTIKAECPLSNLFGYATSLRASTQGKGEFTL
                     EFSHYAPTGAHVQKELIAEFEKKQSQKK"
     gene            complement(<60175..>60630)
                     /gene="TDEL0C00420"
                     /locus_tag="TDEL_0C00420"
                     /db_xref="GeneID:11500253"
     mRNA            complement(<60175..>60630)
                     /gene="TDEL0C00420"
                     /locus_tag="TDEL_0C00420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680094.1"
                     /db_xref="GeneID:11500253"
     CDS             complement(60175..60630)
                     /gene="TDEL0C00420"
                     /locus_tag="TDEL_0C00420"
                     /inference="similar to DNA sequence:INSDC:YLR068W"
                     /note="similar to Saccharomyces cerevisiae FYV7 (YLR068W);
                     ancestral locus Anc_8.19"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680142.1"
                     /db_xref="GeneID:11500253"
                     /db_xref="InterPro:IPR013730"
                     /db_xref="UniProtKB/TrEMBL:G8ZQY9"
                     /translation="MATAKQQHNRKKFTKEYKVKEIQKNLTQKARLKKEYLKALKEEG
                     YSVPEKNHNGKSKDEIRKLKVGLREKGQKKLDEKKEIKKERKKEQREDAEARRRKELE
                     DIKQVKIKMDERERRKKRLSKKTRTGQPRMGPKIDDLLSKIKEDDTYTR"
     gene            <61427..>64258
                     /gene="TDEL0C00430"
                     /locus_tag="TDEL_0C00430"
                     /db_xref="GeneID:11500254"
     mRNA            <61427..>64258
                     /gene="TDEL0C00430"
                     /locus_tag="TDEL_0C00430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680095.1"
                     /db_xref="GeneID:11500254"
     CDS             61427..64258
                     /gene="TDEL0C00430"
                     /locus_tag="TDEL_0C00430"
                     /inference="similar to DNA sequence:INSDC:YLR067C"
                     /note="similar to Saccharomyces cerevisiae PET309
                     (YLR067C); ancestral locus Anc_8.20"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680143.1"
                     /db_xref="GeneID:11500254"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:G8ZQZ0"
                     /translation="MLRSTIPLARQCRKVDWGPDIPRKIQTILFKPSNGSLNKQDSAA
                     LNACFMGNLKEPPKLSYKERRYIIDFLSDRRAYPDLNKFGRRYLYSQERLYDFVDKVS
                     FIELRQYLHSLLRTKNTILIDQLMSKVIAQFSITQKEAVTNFINSAYVLLHDEAKQEK
                     WLDPTEPLVKWAKWMKLLNGHCNFTDYTHQRKLLKTLMFTLRESRDNEIEIFQKSLDI
                     IKTAQGVSSTSQFASTVIYLSTHNRSFDLAEAIWDYKVENNLPIESSDLTCILKCYCH
                     FKKYNLVEPTHSAYPEAQDEHSQFDYLLIAHSKLENWSALRDQFNALFNIGELPNIKH
                     YGIVMYSMATIGELENVEKLYAQLLRRDMLPTYAVLQSLLYAHYKVGDLNACFAQFEL
                     FDKYSIRPSSSTYTLMFKVFRGLSNIEGALRLLKRITESDVSLISETHFALLIHMCAK
                     FTNPLIAHELFHVMTQHYDIRPTSRSVAALMDVYIESGNPEKALSLFNEYNRDNIEGR
                     ISLFNKAIKAYTTMGDQHQCEVLFGKIVKLKLANDSEFFNVMLRYLVCLKRDYDSAER
                     VIDQMLNHPTIKPDVTHFQVLMDAYDKISFREGIHNLYRKMNENEIPVNSKVLHYLIK
                     ATFKVQMRSQGDLEQSIQLLDRIMKNAAERTLDITFGQLHPSIVAWPMRAVAKYHSPM
                     KALDLLNHYSHLFYPKEDFSINSKFTVMRSLLVVSAEIEQWDEFDSIFERYIARAEAL
                     MKAPSATTRNKKLNSLFKGLLVYKVRHLAATEKIYLLPDLLKKLSSEGYVIDNLSWNE
                     AVKELFQDSRTIESGLQIINEKLIHGFNLIHKYRLLKRHAEETNSANRSWLLRQKKAD
                     PKSFQPTLYLSAETYSKTMEYMDRYLSSLTDLEGTLRTFIKDYPYFMKSYLMKPRTHI
                     NGWDKIEADHASYFAALRQSKRVTLHAQF"
     gene            complement(<64348..>64932)
                     /gene="TDEL0C00440"
                     /locus_tag="TDEL_0C00440"
                     /db_xref="GeneID:11500255"
     mRNA            complement(<64348..>64932)
                     /gene="TDEL0C00440"
                     /locus_tag="TDEL_0C00440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680096.1"
                     /db_xref="GeneID:11500255"
     CDS             complement(64348..64932)
                     /gene="TDEL0C00440"
                     /locus_tag="TDEL_0C00440"
                     /inference="similar to DNA sequence:INSDC:YLR066W"
                     /note="similar to Saccharomyces cerevisiae SPC3 (YLR066W);
                     ancestral locus Anc_8.21"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680144.1"
                     /db_xref="GeneID:11500255"
                     /db_xref="GOA:G8ZQZ1"
                     /db_xref="InterPro:IPR007653"
                     /db_xref="UniProtKB/TrEMBL:G8ZQZ1"
                     /translation="MFSLAQRFQTVSNQVVTYACFIAAFVAITSWLQLAQNDAFSIPA
                     TINNIQPSINVRTSRYYGSQNGKPKQNSKIVFDIDADLSSLFNWNTKQIFVYLTAEYS
                     GSEGRDTLNEVTYWDKIITSKDDAQLSLHNAKSKYSVWDLEEKFDGREANFQLKWNIQ
                     PWVGPLIYGQTEGNKTITFPVIEKTQKKVKQKVV"
     gene            <65197..>66762
                     /gene="TDEL0C00450"
                     /locus_tag="TDEL_0C00450"
                     /db_xref="GeneID:11500256"
     mRNA            <65197..>66762
                     /gene="TDEL0C00450"
                     /locus_tag="TDEL_0C00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680097.1"
                     /db_xref="GeneID:11500256"
     CDS             65197..66762
                     /gene="TDEL0C00450"
                     /locus_tag="TDEL_0C00450"
                     /inference="similar to DNA sequence:INSDC:YFL040W"
                     /note="similar to Saccharomyces cerevisiae YFL040W;
                     ancestral locus Anc_8.22"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680145.1"
                     /db_xref="GeneID:11500256"
                     /db_xref="GOA:G8ZQZ2"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZQZ2"
                     /translation="MFEPIYSAVKITGITFLCGFIMGMDIPSLSMFLGKDHFAEYFNY
                     PSPIMQGLATGASPMGGLFGCLLYNGLARYFGRVSLFRIGSALWIQGSLIGLLSFRLW
                     MVVLSRWIKGLAIGMFSILVAAYISEIIPKHRKGRTMALVQFAFSLAMLAVYYMCVGL
                     NFLGSPLSFRVAWGLEMIPAIATMITTLWLPESPEWLTLQGDYVKAEFVQNELANHFN
                     KTSKTRKITLYNKLELACLHGAKTDGFRYRDLLGPNCWRQTLMGSTLQLLVQFSGINI
                     LMYYIIFICDMVGLKGTVRFVAASMPYIINVPFGLFPIFVMDHVRRKDLTLAGAFPLS
                     IIMFALGIIMATNGHKVDPINGNKSLVWSINNQAAPFVLGLSFLFVAVFTVTLSSTPW
                     IYTNEILPARAKHKGLAVCMLIGWAANFILTLLGPLMMASITWGTFILLGSTTFIIAL
                     SILLFFPDTKDLSSKEIEALYEKNLIKEEQPKTPIESDNESTSGAEPIGMLNADVQSS
                     IEVPTLPKLSNAH"
     gene            <67471..>72429
                     /gene="TDEL0C00460"
                     /locus_tag="TDEL_0C00460"
                     /db_xref="GeneID:11500257"
     mRNA            <67471..>72429
                     /gene="TDEL0C00460"
                     /locus_tag="TDEL_0C00460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680098.1"
                     /db_xref="GeneID:11500257"
     CDS             67471..72429
                     /gene="TDEL0C00460"
                     /locus_tag="TDEL_0C00460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680146.1"
                     /db_xref="GeneID:11500257"
                     /db_xref="GOA:G8ZQZ3"
                     /db_xref="InterPro:IPR001389"
                     /db_xref="InterPro:IPR018789"
                     /db_xref="UniProtKB/TrEMBL:G8ZQZ3"
                     /translation="MRDEIDVPVAHQVKKNKTEMLISQFWLILLALVKLCLCVPTVSD
                     LEKRHWGNKECIRNACPGLDFKWRSTYYGIMNYDMNVIGVNYLGKDSYEVTIHVVGDK
                     QIPLKFLYSLSISNIGGPDRIVPLHHCDKGINKIDNPTDFTATFVVNSRPDLFGRVWM
                     PDFKLDFEYVLGPARQYAKEWKWGKTSFSLASGCDLADFWGRSYADFPGFVWNYKARC
                     GVNPSSTTITSLSFSSKETPSTASVSTSSVRSSEVTSTRSISSGISSSQSSLGPGGFT
                     SRSSGTTASTISSLQPSSSNTEHGSATGTSGSATKSSSSFLSAGISSSAKISSSSNAA
                     ASSSSSPVRPSIISSAATSSSSSKKLSSSSEAAISSTSFERSSITGPSSAAPTKSGIS
                     SKDSVSTSFAQRSSSSSAAASSSGSPVRSSTFSSSSAAPMASSMSSKDSISTKISSSS
                     SAAVSSSSSPVRSSAFSSSSGALRTSSKDSVSTFSSSFKMSYSSSNAAASSSASPMRS
                     SIISSAVTTSESVKRPSSSSAAASSSGSPVRSSIISSAFTSSASAKSPSSSNAAATSS
                     SGVKKSSTSASAAASSSGPGSASPGFSTKDSDATFSSNMKEPSVTFGSSLKTGEYFST
                     SSYLKPSTDSSRNAATSLSTESSAKQLPSSSDSSKRTSTTKPSTPSDTEIITSHSSSS
                     KNAGTTHLDTVTYSTTVYSPWEGAFTSTYFTERRTVPAQSGYVGEEVIYFVETPSARY
                     QNTTVNPSSSRQSSDSAKSTVRTVSXXGMSSLTTSSNTGSTGPSSVISPSAVVSSATS
                     VPSAKGSSTNSGSLTKTQVTTSVASSLASSSNFYPSSVSSAVRSSSAAAPSVASSSIA
                     SASRSSSTVNTPSSSALRSSSASATRSVSRNSVSISSLAGSSSTVSSPSDGNTASSSV
                     VRSSSPATSSIASSSVATSSTPSSAAHSVSSSAVRSSSANASASSTRDSAATASVVSS
                     LRSSSADASRSLTRDSAATSSAVSSLRSSSAVDAPSSSALRASSADASGSLTRDSVST
                     SSAAKSSRSSSTSATRSLTRDSADTSSVWISSISPSAARSSVVTFSRSATTISQPSIS
                     SSDTLRSSTKRSTETPTTVASSLASSASPSTTSNSIKSQSSHHSDESIRVSTTTGSSS
                     FTRDSFGSSSVTQSSSAVRPLSSYSISGSSSRKTTYASSKASNPSSDFTNSAFTVTNL
                     TTKKPQSGSSRTRDQASTEVPSLTRDAGWTETGIASKSSASNAIRSSTMASSNTGMAS
                     CRIPITTTMQSLSRSSSLSEFESKTEESGVSGFGSSTETGSPNKHSISTVTEPFTTAM
                     GPSTPASALTASTKSDSTSTNGASTSEISLLSQETVPPVIASTTASLTRDSISTETSL
                     SSKDLTLITSTSISTISVKSSHLAVNTAATESGFSSKPSTSVLSFTRGITETSLPNKD
                     PTATATISSTTDSVPTETDSSTKEVTSDASYTEDSASALTSPLTNTPASTITSSSSSI
                     VTRIASLSKDSTETRSFTKNVAEIEGTSTSEPTVTATGLVISNSNGAATEVPSDRSFT
                     TAYTESSSDNIAITKSSSSTLASPTDIQINTRSDIVQTTLISSSSAVITTAPTASMHS
                     TLQRTTTKASSHSITTNYQGSGSRLDFRSPWLYLAMIPMAIL"
     gene            complement(<72546..>73938)
                     /gene="TDEL0C00470"
                     /locus_tag="TDEL_0C00470"
                     /db_xref="GeneID:11500271"
     mRNA            complement(join(<72546..73663,73929..>73938))
                     /gene="TDEL0C00470"
                     /locus_tag="TDEL_0C00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680099.1"
                     /db_xref="GeneID:11500271"
     CDS             complement(join(72546..73663,73929..73938))
                     /gene="TDEL0C00470"
                     /locus_tag="TDEL_0C00470"
                     /inference="similar to DNA sequence:INSDC:YFL039C"
                     /note="similar to Saccharomyces cerevisiae ACT1 (YFL039C);
                     ancestral locus Anc_8.23"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680147.1"
                     /db_xref="GeneID:11500271"
                     /db_xref="GOA:G8ZQZ4"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR004001"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="UniProtKB/TrEMBL:G8ZQZ4"
                     /translation="MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIM
                     VGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP
                     VLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVT
                     HVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCY
                     VALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQ
                     TTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPE
                     RKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF"
     gene            <75187..>75723
                     /gene="TDEL0C00480"
                     /locus_tag="TDEL_0C00480"
                     /db_xref="GeneID:11500272"
     mRNA            <75187..>75723
                     /gene="TDEL0C00480"
                     /locus_tag="TDEL_0C00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680100.1"
                     /db_xref="GeneID:11500272"
     CDS             75187..75723
                     /gene="TDEL0C00480"
                     /locus_tag="TDEL_0C00480"
                     /inference="similar to DNA sequence:INSDC:YLR065C"
                     /note="similar to Saccharomyces cerevisiae YLR065C;
                     ancestral locus Anc_8.24"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680148.1"
                     /db_xref="GeneID:11500272"
                     /db_xref="InterPro:IPR008506"
                     /db_xref="UniProtKB/TrEMBL:G8ZQZ5"
                     /translation="MAGKAGKKQAQTNLAVLSRLYQVSLPIVALAILKQFYLGEGFGA
                     LLRFALLHVPMIGCIYVLDKSGRPHFDSKGKLLREGSDLSQTGGLTEYLFDLVYLSLF
                     GDFGKILFSTNKLWYVLLLVPVYAGWKLYGLKNQFMQKQQQQQQQQQQAPQPEAEARS
                     KRQQKREKRGDRPHVKYR"
     gene            complement(<75792..>76418)
                     /gene="TDEL0C00490"
                     /locus_tag="TDEL_0C00490"
                     /db_xref="GeneID:11500273"
     mRNA            complement(<75792..>76418)
                     /gene="TDEL0C00490"
                     /locus_tag="TDEL_0C00490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680101.1"
                     /db_xref="GeneID:11500273"
     CDS             complement(75792..76418)
                     /gene="TDEL0C00490"
                     /locus_tag="TDEL_0C00490"
                     /inference="similar to DNA sequence:INSDC:YFL038C"
                     /note="similar to Saccharomyces cerevisiae YPT1 (YFL038C);
                     ancestral locus Anc_8.25"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680149.1"
                     /db_xref="GeneID:11500273"
                     /db_xref="GOA:G8ZQZ6"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZQZ6"
                     /translation="MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVD
                     FKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMW
                     LQEIDRYATSTVLKLLVGNKCDLEDKRVVEYDVAREFAEANKMPFLETSALDSTNVEQ
                     AFLTMAKQIKDSMAQQHARDGGSNAKDDQGNVNLKGQSLTNNAGNGCC"
     gene            complement(<77747..>78550)
                     /gene="TDEL0C00500"
                     /locus_tag="TDEL_0C00500"
                     /db_xref="GeneID:11500274"
     mRNA            complement(<77747..>78550)
                     /gene="TDEL0C00500"
                     /locus_tag="TDEL_0C00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680102.1"
                     /db_xref="GeneID:11500274"
     CDS             complement(77747..78550)
                     /gene="TDEL0C00500"
                     /locus_tag="TDEL_0C00500"
                     /inference="similar to DNA sequence:INSDC:YLR064W"
                     /note="similar to Saccharomyces cerevisiae YLR064W;
                     ancestral locus Anc_8.26"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680150.1"
                     /db_xref="GeneID:11500274"
                     /db_xref="UniProtKB/TrEMBL:G8ZQZ7"
                     /translation="MARSNVRPRAPLLTVLRARVRQPQFYWFLGHFLTLYHFIRFHLA
                     VYSFASQRYHYTRILLYISATYAIVLYQFYKSGQLQLGQLRPQLRRLDNLQYFCMLAV
                     LYLCSLSGSMVSGALYSPVIFSFFHCLNYFKENLLPFLPVTPLVRAVVNNKIARFIGN
                     YNERFLQMAQVFEIMCGCRSGLLGLPVSLFRVLVRFSAQNAASVIAMLTYVWFFKLRY
                     LQSESMRLIVGQYVARIDLYVNTRLSPQVASIWHAYKQLATAFFQGLPI"
     gene            <78922..>80336
                     /gene="TDEL0C00510"
                     /locus_tag="TDEL_0C00510"
                     /db_xref="GeneID:11500275"
     mRNA            join(<78922..78933,78996..>80336)
                     /gene="TDEL0C00510"
                     /locus_tag="TDEL_0C00510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680103.1"
                     /db_xref="GeneID:11500275"
     CDS             join(78922..78933,78996..80336)
                     /gene="TDEL0C00510"
                     /locus_tag="TDEL_0C00510"
                     /inference="similar to DNA sequence:INSDC:YFL037W"
                     /note="similar to Saccharomyces cerevisiae TUB2 (YFL037W);
                     ancestral locus Anc_8.27"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680151.1"
                     /db_xref="GeneID:11500275"
                     /db_xref="GOA:G8ZQZ8"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:G8ZQZ8"
                     /translation="MREIIHISTGQCGNQIGAAFWETICGEHGLDFNGNYHGVDDLQK
                     ARLGVYFNEASSGKWVPRSVNVDLEPGTIDAVRNSNIGNLFRPDNYIFGQSSAGNVWA
                     KGHYTEGAELVDSVMDVIRREAEGCDSLQGFQITHSLGGGTGSGMGTLLISKIREEFP
                     DRMMATFSVVPSPKTSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICQRTLKLS
                     QPSYSDLNNLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTAI
                     GSQSFRSLTVPELTQQMFDAKNMMAASDPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQ
                     TRNSSYFVEWIPNNVQTALCSVPPKGLDMSATFIGNSTSIQELFKRVGDQFSAMFKRK
                     AFLHWYTSEGMDEMEFSEAESNMNDLVSEYQQYQEATVEDDENIDYATEDQPIAENFE
                     "
     gene            complement(<80893..>81555)
                     /gene="TDEL0C00520"
                     /locus_tag="TDEL_0C00520"
                     /db_xref="GeneID:11500276"
     mRNA            complement(<80893..>81555)
                     /gene="TDEL0C00520"
                     /locus_tag="TDEL_0C00520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680104.1"
                     /db_xref="GeneID:11500276"
     CDS             complement(80893..81555)
                     /gene="TDEL0C00520"
                     /locus_tag="TDEL_0C00520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680152.1"
                     /db_xref="GeneID:11500276"
                     /db_xref="GOA:G8ZQZ9"
                     /db_xref="InterPro:IPR003180"
                     /db_xref="InterPro:IPR011034"
                     /db_xref="UniProtKB/TrEMBL:G8ZQZ9"
                     /translation="MKLSETFYQNTNVTAVARSLLGKYLFTRINGQLTGGYIVETEAY
                     NGIIDKASHAYGNRLTPRTKIMFEDGGVAYVYLCYGIHEMLNVVTSVSGQPHAVLIRA
                     VNPTEGIDIMMTRRNMAVIKPTITAGPGSVCKALGISRKINGISLQSNVLWIEDQGLN
                     IPDDQVAVVPRIGIAYAGEDASLPYRFYVKDNVYVSKRVTKRVTKRVTKRIKEIGDTI
                     GT"
     gene            <81839..>85804
                     /gene="TDEL0C00530"
                     /locus_tag="TDEL_0C00530"
                     /db_xref="GeneID:11500277"
     mRNA            <81839..>85804
                     /gene="TDEL0C00530"
                     /locus_tag="TDEL_0C00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680105.1"
                     /db_xref="GeneID:11500277"
     CDS             81839..85804
                     /gene="TDEL0C00530"
                     /locus_tag="TDEL_0C00530"
                     /inference="similar to DNA sequence:INSDC:YFL036W"
                     /note="similar to Saccharomyces cerevisiae RPO41
                     (YFL036W); ancestral locus Anc_8.28"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680153.1"
                     /db_xref="GeneID:11500277"
                     /db_xref="GOA:G8ZR00"
                     /db_xref="InterPro:IPR002092"
                     /db_xref="InterPro:IPR024075"
                     /db_xref="InterPro:IPR029262"
                     /db_xref="UniProtKB/TrEMBL:G8ZR00"
                     /translation="MLRPFTRSTCRVAAIQRRFISSKGSKLLKPATELHTSLASNQAL
                     AGVNGGLGFLKSSQVSMSPGFDPYDMSHASAVKSMTQSRDVMQLWSLLEACLYSKYMN
                     RAFAILQSLYMVSSHRPYFIDDYNMYLASYVQNGFAHSIADLDRKLSTDLQEKFPACE
                     YDDKTLAIMIHNALRSGESSDTVGNSIHTYLRMNMKGVKSIMSHVDILTVSDYKALLE
                     EFDVIKVYEVPETVRSLVEKEVTQGATDTELVVESDHSISTEQEPTSASTESQLAESI
                     KPRSALESTNSESWLSLDETVKPLEKDAAKLTAVDTLGMRVVRHTLLGLNLNEQQRQN
                     IAQFHFKADENLLNLDQKKSIDFFEVYRSLKSDAERSEFEKSLDQFNQERQRALESRA
                     TDAAKERWKHDFEEARARGDISIEKRLNVKLWKWYNAMLPLLKEEVKFCSEVMSGKPP
                     SRRLSSGEIKQNKTRQDYGAYLSLVDPEKMCVITILELLKLNSTGGVIEGMRTARAVI
                     AVGKAIEMEFRSEQLLKSELQIFKDVNRKSHEFKKYVQRAKNSFRSIKIEESKVVWPQ
                     AARAKIGSIMISMLIHVAKVDLEGIDPVTKQKVHGEAPAFSHGYQYHNGSKLGVLKIH
                     RSLIHQLNGERLVASVQPQLLPMLVKPRPWKSWNSGGYYYTQSSLIRSKDSPEQMAYL
                     KAVSNAGAIDTVYQGLNVLGETAWTVNRRVFDVMSEVWNSGKDFLEIPGIQEKLDLLP
                     APPRESDPSVHREWKLKNKEIANKFSSNRSVRCDSNYKLEIARAFLGEKFYFPHNLDF
                     RGRAYPLSPHFNHLGNDMSRGLLIFWKGKRLGPRGLKWLKVHLSNLFGFDKAPLADRI
                     AYAEAHLKDVKRSAEDPLAGDGWWMKADKPWQALATCIEINEAYKLPNPEDFISHQPV
                     HQDGTCNGLQHYAALGGDIEGATQVNLVPNDRPQDVYAHVAKLVQARLEAAAAKGDEQ
                     AETLKDKITRKVVKQTVMTNVYGVTYVGATFQIEKQLSHIFDDRTYSLELSKYLTKHV
                     FAAVRELFHGAHLIQDWLGECAKRISKSIRLDVDEKSFKNGNKPDFMSSVIWTTPLGL
                     PIVQPYREASKKQVTTNLQTVFISDPFSVNPVNARRQKAGFPPNFIHSLDASHMLLSA
                     AACGEEGLDFASVHDSYWTHACDVDQMNSCLREQFIKLHEVDLIERLKNEFDERYKNY
                     VQIAKIDKQSELAKKIIAIRSNLSVKLGKPATLADEIYMEKRRTQLLESEDPEEQEIG
                     RNMETTVSVTELIDNLEELEVKKTGTTTLMILVPMRLPQIPPKGNFDVQDLRNSKYFF
                     S"
     gene            complement(<85940..>86861)
                     /gene="TDEL0C00540"
                     /locus_tag="TDEL_0C00540"
                     /db_xref="GeneID:11500278"
     mRNA            complement(join(<85940..86762,86842..>86861))
                     /gene="TDEL0C00540"
                     /locus_tag="TDEL_0C00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680106.1"
                     /db_xref="GeneID:11500278"
     CDS             complement(join(85940..86762,86842..86861))
                     /gene="TDEL0C00540"
                     /locus_tag="TDEL_0C00540"
                     /inference="similar to DNA sequence:INSDC:YFL034C-B"
                     /note="similar to Saccharomyces cerevisiae MOB2
                     (YFL034C-B); ancestral locus Anc_8.29"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680154.1"
                     /db_xref="GeneID:11500278"
                     /db_xref="InterPro:IPR005301"
                     /db_xref="UniProtKB/TrEMBL:G8ZR01"
                     /translation="MSFFNFKGFGRNSKKNKIQQHALGSSPAPPVNNVYSSSHNSGSK
                     LSLTKNQSPSRYSQASFPSLQQQHTQQSSSATEQSPERNDSQQIMFLSEPFVRTALVK
                     GSFKTIVQLPKYVDIGEWVALNVFEFFTNLNQFYGVIAEYVTPDAYPTMNAGPHTDYL
                     WLDANSRQVSLPASQYIDLALTWINNKVNDKNLFPTKNGIPFPQVFFKDVQRIMVQMF
                     RIFAHTYHHHFDKIVHLSLEAHWNSFFAHFVSFSKEFNVIERKEMYPLLPLIESLEAQ
                     GKII"
     gene            complement(<87033..>87992)
                     /gene="TDEL0C00550"
                     /locus_tag="TDEL_0C00550"
                     /db_xref="GeneID:11500279"
     mRNA            complement(<87033..>87992)
                     /gene="TDEL0C00550"
                     /locus_tag="TDEL_0C00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680107.1"
                     /db_xref="GeneID:11500279"
     CDS             complement(87033..87992)
                     /gene="TDEL0C00550"
                     /locus_tag="TDEL_0C00550"
                     /inference="similar to DNA sequence:INSDC:YLR063W"
                     /note="similar to Saccharomyces cerevisiae YLR063W;
                     ancestral locus Anc_8.30"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680155.1"
                     /db_xref="GeneID:11500279"
                     /db_xref="InterPro:IPR021463"
                     /db_xref="UniProtKB/TrEMBL:G8ZR02"
                     /translation="MGSEEKSEQLKIYHEITLPPQEIVDLFKVTFDNELYGAEGIDEL
                     QSQIQKVKSDLYNRDYIAAFGNDAKRTAYCCRWSPSRATAYASLFAHLQECAQVIRCK
                     ESDQNVLCIGGGAGGELVALASLFTPTREFITKYSTSKQPTTTKNSLNVHLVDISDWS
                     AVVNRLQSTISGKWLYADESKYFKVHSSNRDILTMSEDDLSLSNLDLITLLFTTNELF
                     SENKQQSIRLLQKFNQFCKKGCLLLIAESAGSYSHITVGTKKFPIQFLIDTVLMGKRG
                     QDESGAWQLVNQSDSTWYRCDPRLDYPMKVENTRIFYRLYRKI"
     gene            complement(<88141..>88748)
                     /gene="TDEL0C00560"
                     /locus_tag="TDEL_0C00560"
                     /db_xref="GeneID:11500280"
     mRNA            complement(join(<88141..88488,88737..>88748))
                     /gene="TDEL0C00560"
                     /locus_tag="TDEL_0C00560"
                     /product="60S ribosomal protein L22"
                     /transcript_id="XM_003680108.1"
                     /db_xref="GeneID:11500280"
     CDS             complement(join(88141..88488,88737..88748))
                     /gene="TDEL0C00560"
                     /locus_tag="TDEL_0C00560"
                     /inference="similar to DNA
                     sequence:INSDC:YFL034C-A,YLR061W"
                     /note="similar to Saccharomyces cerevisiae RPL22B
                     (YFL034C-A) and RPL22A (YLR061W); ancestral locus
                     Anc_8.31"
                     /codon_start=1
                     /product="60S ribosomal protein L22"
                     /protein_id="XP_003680156.1"
                     /db_xref="GeneID:11500280"
                     /db_xref="GOA:G8ZR03"
                     /db_xref="InterPro:IPR002671"
                     /db_xref="UniProtKB/TrEMBL:G8ZR03"
                     /translation="MAPNTSRKQKITKTFTVDVSSPVENGVFDPASYAKYLIDHIKVD
                     GAIGNLGNDVTVEENGNVVTIVSTTKFSGKYLKYLTKKYLKKNQLRDWIRFVSSKTNQ
                     YKLAFYQVTPEDEEDEE"
     gene            <89127..>92087
                     /gene="TDEL0C00570"
                     /locus_tag="TDEL_0C00570"
                     /db_xref="GeneID:11500281"
     mRNA            <89127..>92087
                     /gene="TDEL0C00570"
                     /locus_tag="TDEL_0C00570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680109.1"
                     /db_xref="GeneID:11500281"
     CDS             89127..92087
                     /gene="TDEL0C00570"
                     /locus_tag="TDEL_0C00570"
                     /inference="similar to DNA sequence:INSDC:YFL034W"
                     /note="similar to Saccharomyces cerevisiae YFL034W;
                     ancestral locus Anc_8.32"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680157.1"
                     /db_xref="GeneID:11500281"
                     /db_xref="InterPro:IPR007941"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8ZR04"
                     /translation="MSDSDEDLGIALKGLKLSAKHVQNKAKDKNVNECDKVDPAPEAM
                     DGPEETKEASEGMKLPEEVVSDVDSDSDEDSWRNMEAIASFNVYNDKGELELKTYQAQ
                     AAQTASKEALSGTAGSNGTARSVTFGYTKIAAEEQAQRTSRSNRKTDFLFDHKRLKRL
                     NGSNSSTTGLTEPQTPSDTELHQDSYDEYEEGVEPMNDLNADNQLNVTKNLLDEMEKF
                     AYVAAVNVLANQMCTELATTCLCVDIKSHKKLAQRLNFAQKDSANWKTHVLNSLYDHL
                     QLSPEEVQMIEKLSMHGVHLEDLCKCLKTTQDIENPFEGVNESKQSLESGKEDSKDAE
                     AESVGSHTSKDRSSIDLTTEEEETSKAPKQVIAPENLKEQGQIKIDVAWTIICDLFLV
                     LLHDAVYDARSRTLLMRFAKVLNIENLEICEFERRVTDSLDMEQSTENQEWNEIDHMK
                     SRRKKRKRKKLCYVGLAMVGGSLILGLSGGLLAPVIGAGIAAGLSTIGIGGATGFLTG
                     AGGTAVVAVASTAIGGNIGAKGMGRRMGSVRTFEFRPLHNNRRVNLIISVSGWMIGNE
                     DDVRLPYSTVDPVEGDLYALHWEPEMLKSIGQTIGIVANEIFTQALQQILGATILTAF
                     ISAIQWPMGLSKLGYILDNPWSVSLDRAWAAGLILADTLMSRNLGQRPITLMGFSLGS
                     RVIFSCLVELSRKKALGLVENVYIFGTPVVKKKEHLIMARSAVSGRFVNAFSGRDWML
                     AYLFRAAAGGFNKVMGIAPIEGIESIENYDCTDIVDGHLAYRKNMPKLLKRLGVEVVS
                     EEFVEIEETVDPEQLHRKRQMVQDVDAAQKKLQEKKHHSGWMPKWLKPKKSKWRTMVE
                     DAVEEGTQVEVPDAPDVLHTEEVKPKKKDNALVDNGALMRELQKIKAAIREEQLQQER
                     ASAVADNVDAKKTTLGADTNVQKEVSPPKTPLTTPQSPNNFQLLSAGRPIILEDDDFG
                     KQKKDLTFSFSDDF"
     gene            complement(<92198..>93985)
                     /gene="TDEL0C00580"
                     /locus_tag="TDEL_0C00580"
                     /db_xref="GeneID:11500282"
     mRNA            complement(<92198..>93985)
                     /gene="TDEL0C00580"
                     /locus_tag="TDEL_0C00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680110.1"
                     /db_xref="GeneID:11500282"
     CDS             complement(92198..93985)
                     /gene="TDEL0C00580"
                     /locus_tag="TDEL_0C00580"
                     /inference="similar to DNA sequence:INSDC:YLR060W"
                     /note="similar to Saccharomyces cerevisiae FRS1 (YLR060W);
                     ancestral locus Anc_8.33"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680158.1"
                     /db_xref="GeneID:11500282"
                     /db_xref="GOA:G8ZR05"
                     /db_xref="InterPro:IPR004531"
                     /db_xref="InterPro:IPR005146"
                     /db_xref="InterPro:IPR005147"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="InterPro:IPR020825"
                     /db_xref="UniProtKB/TrEMBL:G8ZR05"
                     /translation="MPTVSVNKKQLFELLGKEYTNEEFDELCFQFGIELDEDTTEEAL
                     KNNEEPELKIDIGANRYDLLCIEGIAQSLNEYLGRSQTPNYKLLEPTTKLTIEASTEQ
                     IRPYAAAAILRNITFTEKSYASFIALQDKLHSNLCRNRTLVAMGTHDYDTIQGPFRYQ
                     ALPPKDIKFVPLNQTKEFDAAELIEFYKQPEQKNNLGRFVHIIEDSPVFPVIKDANDV
                     VCSLPPLINSEHSKISLDTRNVFIEITATDVTKAEIVLDQLLAMFSRYCDEEFTMEPV
                     EIVSDHNGQSRTTPNLKQRQMEVSVDYINSALGLEQSPEEIAQCLKKMSLHAKPSASD
                     SKTLEVSIPITRPDILHPCDIMEDAAVGYGFDNLPRGGKLSNANFIASALPINKISDI
                     FRVASSQATWLEVLPLTLCSHDENFKFLRLEDDGKQVVKLANPKTLEYQVVRTSLLPG
                     ILKTVKENRKHSLPIKVFETGDVVFKNEKLERKAYNERHWGAIYAGKTSGFEIIQGLL
                     GKVMQTFRTEWLPDYGSKSSSRGYWIEEDSSVATFFPGRGAKIMFRSQEGEEPKKIGH
                     LGVLHPEVMNNFDIPYAASYVELNAEVFL"
     gene            complement(<94223..>99031)
                     /gene="TDEL0C00590"
                     /locus_tag="TDEL_0C00590"
                     /db_xref="GeneID:11500283"
     mRNA            complement(<94223..>99031)
                     /gene="TDEL0C00590"
                     /locus_tag="TDEL_0C00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680111.1"
                     /db_xref="GeneID:11500283"
     CDS             complement(94223..99031)
                     /gene="TDEL0C00590"
                     /locus_tag="TDEL_0C00590"
                     /inference="similar to DNA sequence:INSDC:YFL033C"
                     /note="similar to Saccharomyces cerevisiae RIM15
                     (YFL033C); ancestral locus Anc_8.34"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680159.1"
                     /db_xref="GeneID:11500283"
                     /db_xref="GOA:G8ZR06"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8ZR06"
                     /translation="MDNPSAEEQSNLLLRTKSSASSRSTASSDYDKYLQLATGKNPVM
                     LMELDQDGTIRYLSELWETLVGPRTSDQISELIVGSEEDKFVFHRAMEMMLVNESISY
                     TVTFNVLSNGSHQIHDDDGNAGEKEDPQLNEEKIITLEACGILLRDNATQLVTHSMWT
                     VKPFQSVMLGEGVDSILPPDLVNRLGFCAVIFAEYLRDIEDEQILDEADLPPPRMELC
                     RVCETFVPAWWLETHSQNCVCEHKIDSFVHLLHDNLVEQLALLQSATFSEYKSLPIDL
                     QSPTTRMMIEQLKELCEIAININQSEMRVSLENKVSAEDILANPTMLTEANALGSYDF
                     SPGSKWNIENVQTWKLSIKEELSHNTGLNLLVNDTIDLAKKKVDAILRLDNAMTYSLR
                     IKNEIDNWVLQLILLQIENNKIKMQRATDFRNLESGSTAEVMTKAKGPLHEDLQLPSA
                     TAYDSIEMFDSSLKTGNQNAQSTSGTKIASPQPYRAQQREIFSPSYQMNDRITEPAFS
                     GNQTSQRTGRSRSSNGSHSLSNTDIRSKSNSHSRSLTPSQKAPDHQPLLPSRDLSLDP
                     KKDQDFTGSGENMDKSESSHSSLPTIVSTKPNSLTNCSILPRFKSTISLTQGRNSPLP
                     QALTANQMSRKSSGIRLNQEKSPIVSPSALARDFLTPEQHPSLSSLPKQPLSPLLLAT
                     TQMKSTPASIKDYSVLKPISKGAYGSVYLSRKKITGEYFAIKVLKKSDMITKNQTTNV
                     KSERAIMMVQSDKPYVAKLFASFQNKDNLFLVMEYLPGGDLATLIKMMGCLPIEWTKQ
                     YISEVIVGVDDMHQIGIIHHDLKPDNLLIDSDGHIKLTDFGLSRAGLVRRHQNVPSSA
                     RLSFSSTYGNHSSGSPSELKIGKNHHRKKSSTSTTHSNGSSFNFATRSRQNSIMEETS
                     DIHHSTNPTKEAVSREKQREDSVSSSHSNNDISALHRSDSQMSFSYMNISRSSTPTPP
                     VIGPFHARNSSNTSEVLADMNTPSDLALFNPDESRQDKCFFGTPDYLAPETIEGTGKD
                     DNCDWWSVGCIFFELIFGFPPFHANTPEEVFTKILSGKIEWPKFTSPEDEKSFEQSHA
                     KDLIEKLLVVDPSKRLGSNGAQEIKDHPYFKDVDWDRVYQEEASFVPAVEHPEDTDYF
                     DLRGAVLEDFGDDEDEDDVPTAHLPSIDAVTNFGPLLGSEESSKRTPNSLLGNYHEGN
                     AHTPVSKLSISSVLESMSQENSNRSSPTIKHMPLAIPPHMRDRRVSKLNEPQAEFGSF
                     YFRNLSALDKANKDAINRLRNEHCTENVGVHRRTSSASYLSSSSDNSASKARNGKTSA
                     SGSPSGITFGKVMATSDSPYFRTSSPDLTTSIETAGLSRKGSGDNGAQSPASSFFMPG
                     GDESPSGTKLKSPLSPSIATSPTSPTFGPPASSFSARTRLLSSSCHRRSSGDISAEES
                     ERLTAMSKVNSIRGRRRSGRKSSTSSDVNYRMDVLVCEPIPIHRYRVTKDLESLGCTV
                     ISVGAGDELVSRATSGVKFDLIITALKLPKLGAVDIVRLLKHTNSINATTPVVAVTNY
                     YQEAVSGNVFDDVLEKPVAYDQLRKIAAKYTLEKVQQQEDTIVSDSDFSQ"
     gene            <99447..>100199
                     /gene="TDEL0C00600"
                     /locus_tag="TDEL_0C00600"
                     /db_xref="GeneID:11500284"
     mRNA            <99447..>100199
                     /gene="TDEL0C00600"
                     /locus_tag="TDEL_0C00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680112.1"
                     /db_xref="GeneID:11500284"
     CDS             99447..100199
                     /gene="TDEL0C00600"
                     /locus_tag="TDEL_0C00600"
                     /inference="similar to DNA sequence:INSDC:YLR059C"
                     /note="similar to Saccharomyces cerevisiae REX2 (YLR059C);
                     ancestral locus Anc_8.35"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680160.1"
                     /db_xref="GeneID:11500284"
                     /db_xref="GOA:G8ZR07"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:G8ZR07"
                     /translation="MLSRIARCLQVRQLSGRRNWYLRMEKQKSVSNPLVWIDCEMTGL
                     DHQRDRIIEICCIITDGELNVVQDNCYESVIHCDRSVLDGMNEWCIEHHGASGLTKKV
                     LESTKTKEQVEQELLQFIKRYVPDSRVGLLAGNSVHMDRLFMLKDFPSIVDHLFYRIV
                     DVSSIMEVCRRHNPSLSKLAPRKDKNHTAKSDILESIEQLQWYRDHYFKSKQETAEYV
                     KSKEQEKANEQQQEQSNQEKVGEPAAKKSRKV"
     gene            <101031..>101567
                     /gene="TDEL0C00610"
                     /locus_tag="TDEL_0C00610"
                     /db_xref="GeneID:11500285"
     mRNA            <101031..>101567
                     /gene="TDEL0C00610"
                     /locus_tag="TDEL_0C00610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680113.1"
                     /db_xref="GeneID:11500285"
     CDS             101031..101567
                     /gene="TDEL0C00610"
                     /locus_tag="TDEL_0C00610"
                     /inference="similar to DNA sequence:INSDC:YFL031W"
                     /note="similar to Saccharomyces cerevisiae HAC1 (YFL031W);
                     ancestral locus Anc_8.36"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680161.1"
                     /db_xref="GeneID:11500285"
                     /db_xref="GOA:G8ZR08"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:G8ZR08"
                     /translation="MASDSLQIPTDFKTSLPPRKRARTQEEKEQRRIERILRNRKAAH
                     HSREKKRAHLEELEHKCEVMERLLASIDDLDAVVGDNGRESLLEYRNLMGNGFQTGQS
                     SPVAALTPVSLVKDEEDQNRSWDLLLSRSQEVEPQVEPLTLTTPPEWFTGNDNSSFEF
                     DDWRNPAVITATTGIVVR"
     gene            <101933..>103057
                     /gene="TDEL0C00620"
                     /locus_tag="TDEL_0C00620"
                     /db_xref="GeneID:11500286"
     mRNA            <101933..>103057
                     /gene="TDEL0C00620"
                     /locus_tag="TDEL_0C00620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680114.1"
                     /db_xref="GeneID:11500286"
     CDS             101933..103057
                     /gene="TDEL0C00620"
                     /locus_tag="TDEL_0C00620"
                     /inference="similar to DNA sequence:INSDC:YFL030W"
                     /note="similar to Saccharomyces cerevisiae AGX1 (YFL030W);
                     ancestral locus Anc_8.37"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680162.1"
                     /db_xref="GeneID:11500286"
                     /db_xref="GOA:G8ZR09"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR024169"
                     /db_xref="UniProtKB/TrEMBL:G8ZR09"
                     /translation="MSNDTLLIPGPIVISEKVQQALGSPSCSPTVPEFVNLFQGVLKN
                     CRKLFRAHETQGQPIVLVGSGTLGWDVAAANLVDPEDEVLVLGTGYFSDSFQDCLELY
                     GAKVDKLEAPLGDQVPFQEVEQQLKKKQYKAITITQVDTSTGVLSNVQRIAELVHELS
                     PSTFIIVDGVCSIGCEEFEFDKWGIDFCLSASQKAIGAAPGLSISMISQRALEHALDP
                     SRKPRSYYASLKKWIPVMQAYEDQKPKYFATLSVQMVKSLDVALKELLADGLELRWEK
                     HRKTSEWLKKKLTDDLGFKLVTKYPSEAAAHGLTVFYVKDPPKLISYLKQHGTVITGG
                     IHKQIASQCVRIGHMGVSVCSEQLDHIPACYKLIAESNIH"
     gene            <103478..>104887
                     /gene="TDEL0C00630"
                     /locus_tag="TDEL_0C00630"
                     /db_xref="GeneID:11500287"
     mRNA            <103478..>104887
                     /gene="TDEL0C00630"
                     /locus_tag="TDEL_0C00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680115.1"
                     /db_xref="GeneID:11500287"
     CDS             103478..104887
                     /gene="TDEL0C00630"
                     /locus_tag="TDEL_0C00630"
                     /inference="similar to DNA sequence:INSDC:YLR058C"
                     /note="similar to Saccharomyces cerevisiae SHM2 (YLR058C);
                     ancestral locus Anc_8.38"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680163.1"
                     /db_xref="GeneID:11500287"
                     /db_xref="GOA:G8ZR10"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019798"
                     /db_xref="UniProtKB/TrEMBL:G8ZR10"
                     /translation="MPYALSDSHKKLVSSHLSESDPEVEQIIKDEIDRQKHSIVLIAS
                     ENFTSTAVFDALGTPMCNKYSEGYPGARYYGGNEHIDRMELLCQKRALEAFNLTPDRW
                     GVNVQTLSGSPANLQVYQALMKPHERLMGLYLPDGGHLSHGYATENRKISAVSTYFES
                     FPYRVDPATGIIDYDTLEKNAILYRPKILVAGTSAYCRLIDYKRMREIADKCGAYLMV
                     DMAHISGLVAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRRGIRSVNPKTGKEIP
                     YDLENPINFSVFPGHQGGPHNHTISALATALKQANTQEFKDYQNQVLKNAKALEAEFK
                     KLGYRLVSDGTDSHMVLVSLREQGVDGARVEYVCEKINIALNKNSIPGDKSALVPGGV
                     RIGAPAMSTRGMGEEDFTRIVQYINQAVKIAKETQQSLPKEANRLKDFKAKVDQGSDA
                     LTNLKKEIYNWAGEYPLPV"
     gene            complement(<105100..>107439)
                     /gene="TDEL0C00640"
                     /locus_tag="TDEL_0C00640"
                     /db_xref="GeneID:11500288"
     mRNA            complement(<105100..>107439)
                     /gene="TDEL0C00640"
                     /locus_tag="TDEL_0C00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680116.1"
                     /db_xref="GeneID:11500288"
     CDS             complement(105100..107439)
                     /gene="TDEL0C00640"
                     /locus_tag="TDEL_0C00640"
                     /inference="similar to DNA sequence:INSDC:YLR057W"
                     /note="similar to Saccharomyces cerevisiae YLR057W;
                     ancestral locus Anc_8.39"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680164.1"
                     /db_xref="GeneID:11500288"
                     /db_xref="GOA:G8ZR11"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="UniProtKB/TrEMBL:G8ZR11"
                     /translation="MSLYKAFRSLVRRVRSVLILAVTILLLFYYTFENEIDMLNSFAE
                     NEYIPSIKDVARNEGGLDLADIRREGVLKDEPTGLDPTDLKALREKNKYFPLLISDAS
                     KDPSALLETSSDLDPTKFASHKERYPVLNEVSLPVILTPGEGSDLAVQSSVFEDEGVA
                     DEKMLRNIKELFVNTWKQEDLVGKISEFHWPMNLIDALDTLYILKEEEEFESALNAIS
                     EVTFSLPPASIEAVDISDVGSRALGGLMSGYELSGNATLLQKAKEVADFSLRAYDTPN
                     RLPLLNFFWKSKLDNRFPYQKANAGALTSMTLELIKLSQITQENKYFDAAQRIYRTIS
                     LSTNEFDLEYLFPNQVDASGCTPISTDQIQLGRHLSQFKGMKSIDENLQFIHCHQTGK
                     LISFNPKKVKQEQHFDMDAQAQLLYSNLVKSYHLLNGNDLLKFSDNYFEPNDDDIRDD
                     SKIKNSPSGINKNKEKAQSSRHIFTKAMDSVRDLMAFNPATPLKENITLLSSLKTRTH
                     LSPATNEVNVEITRMYDMKFERCSLASTLALGSKLFNMPTFGDFANDLATGCFHLIEE
                     FGGFQPVELYLDPCENEQCNLDVELKVERTKNGHYYRLDSDKAETVQQDEIKVSQQGD
                     VTVPPRRVLAFAYKQGPSFFRSGDLEVDTRKLQWKDDPRRPLWVNKMGQLRVLSPDAV
                     EAIFYLYRTTGDAKWRQMARTMFQMTLETLQNSNGGAKGVWKINELYDDGTGLASSSW
                     LSKTLKYYFLLFSDKNYYSLDDYVFTSGGHLLRKAEVKS"
     gene            <107615..>107854
                     /gene="TDEL0C00650"
                     /locus_tag="TDEL_0C00650"
                     /db_xref="GeneID:11500289"
     mRNA            <107615..>107854
                     /gene="TDEL0C00650"
                     /locus_tag="TDEL_0C00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680117.1"
                     /db_xref="GeneID:11500289"
     CDS             107615..107854
                     /gene="TDEL0C00650"
                     /locus_tag="TDEL_0C00650"
                     /note="ancestral locus Anc_8.39a"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680165.1"
                     /db_xref="GeneID:11500289"
                     /db_xref="UniProtKB/TrEMBL:G8ZR12"
                     /translation="MNESKKRALTLTPNSNMQAIPGKKRMLNGSPQRLTKLQPSSSEA
                     IDWQRQYIVQKSELKRTKKLNQYLELERKCYKSGL"
     gene            complement(<107849..>108952)
                     /gene="TDEL0C00660"
                     /locus_tag="TDEL_0C00660"
                     /db_xref="GeneID:11500290"
     mRNA            complement(<107849..>108952)
                     /gene="TDEL0C00660"
                     /locus_tag="TDEL_0C00660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680118.1"
                     /db_xref="GeneID:11500290"
     CDS             complement(107849..108952)
                     /gene="TDEL0C00660"
                     /locus_tag="TDEL_0C00660"
                     /inference="similar to DNA sequence:INSDC:YFL029C"
                     /note="similar to Saccharomyces cerevisiae CAK1 (YFL029C);
                     ancestral locus Anc_8.40"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680166.1"
                     /db_xref="GeneID:11500290"
                     /db_xref="GOA:G8ZR13"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8ZR13"
                     /translation="MSEPFPQNPENRQLLQATRFARIYKDGCYVIKTITLDFTVPPHN
                     HRAELSILSKLSKLNNPFIIKLINSRSLDGDLELLFPRYRNDLHEFMRKCYKLSTKAV
                     MKINPYYTLSAKVPIPPQGSFQNTFDVNKYAYGFTLQLARGLQFLHQNGIIHRDIKPQ
                     NILVNHADEMKLVITDFGISYDYSDTVQSREEPPTEKITDVSTSIYKAPELLFGVKNY
                     SFAVDIWALMVIVSQWFQESAHNPSRHIPATFDDGSGRFDDNDTGSDIKLILSIFSQL
                     GIPAIKDWPEVAHFGTSDAFSGMFGSEGDGNYFGDDEPESRSKRLDTLLPRLREIQNN
                     DQKAALKDCIVGMLPFESSVRWTSGHLVQRLTL"
     gene            complement(<109223..>110323)
                     /gene="TDEL0C00670"
                     /locus_tag="TDEL_0C00670"
                     /db_xref="GeneID:11500291"
     mRNA            complement(<109223..>110323)
                     /gene="TDEL0C00670"
                     /locus_tag="TDEL_0C00670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680119.1"
                     /db_xref="GeneID:11500291"
     CDS             complement(109223..110323)
                     /gene="TDEL0C00670"
                     /locus_tag="TDEL_0C00670"
                     /inference="similar to DNA sequence:INSDC:YLR056W"
                     /note="similar to Saccharomyces cerevisiae ERG3 (YLR056W);
                     ancestral locus Anc_8.41"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680167.1"
                     /db_xref="GeneID:11500291"
                     /db_xref="GOA:G8ZR14"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:G8ZR14"
                     /translation="MDLVLEVCDSYLFDNLYAKVLPTSLASHFPSKVQSILKLNKGVC
                     NSTFLQESIDTLNALPRVNKDVYGLTPYLMDFTPTTFASLLPRNNFLRELLSLWAVVT
                     VFGWLLYLGAASLSYIFVFDKSIFNHPRYLKNQMSLEIKLAMSAIPFMSLLTCPWFML
                     ELNGHSKLYMEVDWANHGLRKILLEFVCFILFTDCGVYLAHRWLHWPRVYKALHKPHH
                     KWLVCTPFASHAFHPVDGYIQSLPYHVYPVLMPLNKVSYLLLFTAINCWTIMIHDGQH
                     RFNNAVVNGTACHTVHHLYFNYNYGQFTTLWDRLGGSYRRPEDELFDPSLRNKDTMEK
                     QIKEIEEYIQLMDGDDGSYRVYGTEERLKKVN"
     gene            complement(<110674..>111519)
                     /gene="TDEL0C00680"
                     /locus_tag="TDEL_0C00680"
                     /db_xref="GeneID:11500292"
     mRNA            complement(<110674..>111519)
                     /gene="TDEL0C00680"
                     /locus_tag="TDEL_0C00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680120.1"
                     /db_xref="GeneID:11500292"
     CDS             complement(110674..111519)
                     /gene="TDEL0C00680"
                     /locus_tag="TDEL_0C00680"
                     /inference="similar to DNA sequence:INSDC:YFL028C"
                     /note="similar to Saccharomyces cerevisiae CAF16
                     (YFL028C); ancestral locus Anc_8.42"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680168.1"
                     /db_xref="GeneID:11500292"
                     /db_xref="GOA:G8ZR15"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZR15"
                     /translation="MSFAIEVEKLTYKFAECARPSLVDVDLQIPWNTRTLVMGSNGAG
                     KSTLLKVLSGKHLCLDGKILVNGQNPFSPVCTVGEGQEYHVTTYLGTEWCHMSIINRD
                     IGVLELLTSIGLQHFQERGDQLCEILGVDLQWRMFKLSDGQKRRVQLVMGLLKPWKVL
                     LLDEVTVDLDVIARGKLLQFLKWETETRQCSVVYATHIFDGLAQWPDQVLHLKEGRII
                     DRLDCHRDVKFTTANDAGNGTVAFNRQTPVVSISKVSSLHPLAVAWLTDDPNELKQAT
                     PLPDV"
     gene            <111718..>113595
                     /gene="TDEL0C00690"
                     /locus_tag="TDEL_0C00690"
                     /db_xref="GeneID:11500293"
     mRNA            <111718..>113595
                     /gene="TDEL0C00690"
                     /locus_tag="TDEL_0C00690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680121.1"
                     /db_xref="GeneID:11500293"
     CDS             111718..113595
                     /gene="TDEL0C00690"
                     /locus_tag="TDEL_0C00690"
                     /inference="similar to DNA sequence:INSDC:YLR055C"
                     /note="similar to Saccharomyces cerevisiae SPT8 (YLR055C);
                     ancestral locus Anc_8.43"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680169.1"
                     /db_xref="GeneID:11500293"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZR16"
                     /translation="MDEVDDILDQNRAAQQEVEDEEDEEDDEEDETILRNNMDKEADE
                     RGQNDGEGDQEGPEDEEEEDDDEDDGDNDEVGDADNDDDEEDEDEDEDEEDDEVEDDD
                     ENEDEDEDDDEEAKGIKDKENTSRENGKVEGEEMENDENTDDKMDIDSEEEDQTKKVP
                     DGLSDVHNYYTQMLHSAKIASSYKIYPTAAIPIQTEVNAVAMSKGLQYLFLGGSDGFI
                     RKYDFLNTMDGKLSLTILQKHSLAESIQNAGILMSYWENEVPQRRSEMKLSKSNKEYD
                     PKVSPVYAIEVQSECLFLLSGLDNGGITMQGVRYMEGSIGHYFKSKEGHTNVVNQLRL
                     NGDETKFISGSWDKRLLEWDLSSGGIVNEFKGSTSEISSLEMRPLYATVDINDVVREM
                     KQSKDEEDDRNSDDDMGSLFGDEEEEEDVKKDEHNDDFKDKSTKKLNANHLEEISRNT
                     LNVAYDESVFLTSGLNGSVDIWDRRIPTNPVINLERGPKVPPWCQSACWCMDGDRIYA
                     GRRNACVEEFDLKMPSRPSNTLKLPAISGPVTCVRAMPNNKQILCASRDNIRLYNTGN
                     NPHSKGTAVPFLIVPGHHGGAISNMYVDPTCRFLVSTSGNRGWQGNSTDTTFIYEIDL
                     E"
     gene            complement(<113633..>115279)
                     /gene="TDEL0C00700"
                     /locus_tag="TDEL_0C00700"
                     /db_xref="GeneID:11500294"
     mRNA            complement(<113633..>115279)
                     /gene="TDEL0C00700"
                     /locus_tag="TDEL_0C00700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680122.1"
                     /db_xref="GeneID:11500294"
     CDS             complement(113633..115279)
                     /gene="TDEL0C00700"
                     /locus_tag="TDEL_0C00700"
                     /inference="similar to DNA sequence:INSDC:YFL027C"
                     /note="similar to Saccharomyces cerevisiae GYP8 (YFL027C);
                     ancestral locus Anc_8.44"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680170.1"
                     /db_xref="GeneID:11500294"
                     /db_xref="GOA:G8ZR17"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:G8ZR17"
                     /translation="MNIDAYSSTCQKSLSCSDESLHCDFLTESLFDERSLLTFFNDAE
                     QRDIKSRIIRNALADHNLDGLTRLGSSNFGFVTTDLRSDCWLMLLMDQLKLSKKEEEQ
                     FLGECGKEHVDENQVYLDVKRSFTGVTDPDRKEMLRNLLQNIIVRLLRKYPKLRYYQG
                     YHDVVSVFVTVFIEGHEYHGFAQGEENLSLSDMTSKGDENYSASEVGSNHDSSASTEC
                     YEGELSEKTIVSKDKLFRCVEAFTLLYLRDFMMNSLDFPIDQLNVIPQMIKSRDKQLF
                     KKLHLDKIEPFFAISSILTIYSHELKPVENQPNAPIFLIFDYVISSQSMLVPLTMYST
                     LILDNKDKILREIALNVDNFENTVDLVHGVMQQVLTSASYDEGVWEKVLRLVRSTSSK
                     DNASKYKKVFNKFSTILTTASGPKSSMGYNLEYVTDLLDKEINENAKRKAIQRERRLH
                     PRESKPLVRLFLYAHNHTIPFICRVSLLIGLMALLVRAYRGGQVKALMPTAKIFMRKF
                     QGSSIAGLYRGTKIIWLDPLHELLKGSLLSKSSTSSTVSK"
     gene            <116177..>117592
                     /gene="TDEL0C00710"
                     /locus_tag="TDEL_0C00710"
                     /db_xref="GeneID:11500295"
     mRNA            <116177..>117592
                     /gene="TDEL0C00710"
                     /locus_tag="TDEL_0C00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680123.1"
                     /db_xref="GeneID:11500295"
     CDS             116177..117592
                     /gene="TDEL0C00710"
                     /locus_tag="TDEL_0C00710"
                     /inference="similar to DNA sequence:INSDC:YFL026W"
                     /note="similar to Saccharomyces cerevisiae STE2 (YFL026W);
                     ancestral locus Anc_8.45"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680171.1"
                     /db_xref="GeneID:11500295"
                     /db_xref="GOA:G8ZR18"
                     /db_xref="InterPro:IPR000366"
                     /db_xref="InterPro:IPR027458"
                     /db_xref="UniProtKB/TrEMBL:G8ZR18"
                     /translation="MSDSAQNLSDLAFNSSYNPLDSFITFTSIYGDNTAVKFSVLQDM
                     VDVNTNEAIVYGTRCGASVLTQIIMWMISKNRRTPVFIINQVSLTLILIHSALYFKYL
                     LSGFGSVVYGLTAFPQLIKPGDLRAFAAANIVMVLLVASIEASLIFQVKVIFTGDNMK
                     RVGLILTIICTCMGLATVTMYFITAVKSIVSLYRDMSGSSTVLYNVSLIMLASSIHFM
                     ALILVVKLFLAVRSRRFLGLKQFDSFHILLIISCQTLLVPSLLFIIAYSFPSSKNIES
                     LKAIAVLTVVLSLPLSSMWATAANNFTNSSSSGSDSAPTNGGFYGRGSSNLYPEKTDN
                     RSPKGARNALYELRSKNNAEGQADIYTVTDIENDIFNDLSKPVEQNIFSDVQIIDSHS
                     LHKACSKEDPVMTLYTPNTAIEGEERKLWTSDCSCSTNGSTPVKKKSTGEYANLPPHL
                     LRYDENYDEEAGGRRKASLKW"
     gene            complement(<117637..>120750)
                     /gene="TDEL0C00720"
                     /locus_tag="TDEL_0C00720"
                     /db_xref="GeneID:11500296"
     mRNA            complement(<117637..>120750)
                     /gene="TDEL0C00720"
                     /locus_tag="TDEL_0C00720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680124.1"
                     /db_xref="GeneID:11500296"
     CDS             complement(117637..120750)
                     /gene="TDEL0C00720"
                     /locus_tag="TDEL_0C00720"
                     /inference="similar to DNA sequence:INSDC:YFL025C"
                     /note="similar to Saccharomyces cerevisiae BST1 (YFL025C);
                     ancestral locus Anc_8.46"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680172.1"
                     /db_xref="GeneID:11500296"
                     /db_xref="GOA:G8ZR19"
                     /db_xref="InterPro:IPR012908"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8ZR19"
                     /translation="MSALPTSIKEKTHHSISKESKGKRPENTLDVDVDGEPVNGIERD
                     TTYHDKQGKSKLQITSLIGLLMIIVITFSTLLGSFNGSDSPQCRSIYMYPAYARIDGF
                     DSRFTSLAQKYHLYLYREQGKDRNPMENEEIQLDGIPVLFIPGNAGSYKQVRSIAAAS
                     SNIFFEDKESIENMYTKNLDFFAADFNEDFTAFHGRTMIDQAEYLNDAIRYILSLYEQ
                     SKSYIDPLPTSVIVIGHSMGGVVARLLPTLQNHVDYSIRALITLSSPHALAPVTFDGD
                     ILKIYQRTNDYWRNQMNDKSSFLAQNVSLVSITGGILDMMLPADYTAVEDILPIENGF
                     TTYSTTIPEVWTPIDHLAVVWCDQLRSKVARLLLEIVDGTTAEKVRPLRQRMFVSRKM
                     LLSGLEDEMMQDLELIDPKKYSEVYESQDFREAYDLKGSQRLSISRSNKNQFPRYSKF
                     ILPSDGQNTTFSFLTSLQEPQVFFCKLNQQLEEATHSKSSMNCVSAFHDMATVPASSS
                     DLEFPAQSSLDDVTHPFKMLSIDKRILSQYDFIVVENKKAAIQNDQDFIYAGLTSDKI
                     STDVSERPVQLVFSGMQLTLNSSFLYHTFRFPKLWDSLLSYRVSCSSKAYTSDRLIFE
                     PLIRQWIEDPFETKWHVNINNSDIDINMHNVAPFIPLEELHDKSLMLTVIVPPNYGLE
                     LCVRINWTLTLKMLFIRYRLTFLSLPISLACIIVAYQFFNYRQTREFITFNSALASVL
                     KRGLVLALAIILLSPATNSKPLQRILFMLDPIRLNQPFLLEEEHIHTNFYFLGIRSWF
                     MSPLGLFFMVMSVAILYLIASIFDFIESLVIAISVRFAASAIRNEVRLKDRPSINKPR
                     RTITSFLLIGIVFFYVPYQIASAVSLLIQIGTCFRVAIKSTRSGFKNYDNLRNYNFSV
                     FLILSFVVAINAPIIVVFLHNVAIRWETPFRSHHNVLAIAPIIFLVSTNSAFNMPLFK
                     SGKFYENGISAILFGYTGVFCLIYGARNLYWIHHLFNITCAWLLLTIFSNNAQTDNVD
                     KAKITQA"
     gene            complement(<121229..>123694)
                     /gene="TDEL0C00730"
                     /locus_tag="TDEL_0C00730"
                     /db_xref="GeneID:11500297"
     mRNA            complement(<121229..>123694)
                     /gene="TDEL0C00730"
                     /locus_tag="TDEL_0C00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680125.1"
                     /db_xref="GeneID:11500297"
     CDS             complement(121229..123694)
                     /gene="TDEL0C00730"
                     /locus_tag="TDEL_0C00730"
                     /inference="similar to DNA sequence:INSDC:YFL024C"
                     /note="similar to Saccharomyces cerevisiae EPL1 (YFL024C);
                     ancestral locus Anc_8.47"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680173.1"
                     /db_xref="GeneID:11500297"
                     /db_xref="GOA:G8ZR20"
                     /db_xref="InterPro:IPR019542"
                     /db_xref="InterPro:IPR024943"
                     /db_xref="UniProtKB/TrEMBL:G8ZR20"
                     /translation="MPTPTTNGRHIKSRTKSQESNDDGLGSAGSASLESSNSRFRHRK
                     ISVKQRLRIYKPNDLKNLDQDELQQRDVADIETGVEKNEEKEVHLHRILQKGSSHLNN
                     QKKDYIPTPDASTKWKDFDQFYQGEFNEPSTYIKFSATVEDCCGAPYCMDEKDEEFMQ
                     ELAKRYKGENEITEDEFEILCSAFESAIHERQPFLSTDPHSVLSFEELKPTLLKSDYA
                     HINLKTDLAKEIGLESEREFLTQFDAESQIKTRPLAVLLEEFGPDVYGHWKERKIESP
                     STEIFPQLKFERPDEKEEVDPYVCFRRRDVRQPRKTRRVDILNSQKLRLLHQELQHAK
                     ELALLVAKREKVSMDLLEKGLNVFDQRCEVKKLKRSLNVKGEDEDLVNHKRKRLNIFA
                     NQRKLREQAAAEAALATTSDSSVRRGYKNKLSRKELESRSGHKLSKQQILQLQSQSIA
                     AANKQKNSLKVPLAPDEQQQQLQQQQQTVASHVYVRLPSSKVPDLTLEEVDNLLAKKE
                     KNARKFVQDRMEKRKAGDGNVFFNLTDDPYNPVFDITLPKGVSPSNAPFSSIASSKFE
                     ISRSYYSKHLSEYLKGSSKDVKSFSKEGERLPQNNFKVKKVEVYDPFQSNNEVHSREY
                     PVKFRRRTGRHGIQYMDRKPNTLNHNVEFVLSKFLDFDAIEQQEKNADETINVYDSKW
                     DELSRFYDKWKYDSPRNEYGLKISDEPSRLNQISNSTQVIRFGTMLGSKSYEQLREVT
                     IKYRQEYITRMKQQKLNDQKQLQLQHQQEQQLQREQEEEQEQERQDDQTFVNGSSITH
                     SSTPVASPALKSRISAGSNDSKS"
     gene            <124643..>126982
                     /gene="TDEL0C00740"
                     /locus_tag="TDEL_0C00740"
                     /db_xref="GeneID:11500298"
     mRNA            <124643..>126982
                     /gene="TDEL0C00740"
                     /locus_tag="TDEL_0C00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680126.1"
                     /db_xref="GeneID:11500298"
     CDS             124643..126982
                     /gene="TDEL0C00740"
                     /locus_tag="TDEL_0C00740"
                     /inference="similar to DNA sequence:INSDC:YFL023W"
                     /note="similar to Saccharomyces cerevisiae BUD27
                     (YFL023W); ancestral locus Anc_8.48"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680174.1"
                     /db_xref="GeneID:11500298"
                     /db_xref="GOA:G8ZR21"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR024325"
                     /db_xref="UniProtKB/TrEMBL:G8ZR21"
                     /translation="MDPLAESVTRSIKNLKEKNDFLLQQRDHYLDVRQRMLNLRGSKD
                     DEESGTGLVLGDIIISSQKVYTNLGYEYFIEKDVTEVLEYADEKLGLIEEAIEQFEFK
                     IKDGEKTLKDLQNWGDQDALSHDGEDELPSMEIREELDEDGNVINSSVTPTSAERLKE
                     SLKSSKKKEEPENGTLDQVRKNLKGKLAKQEKRPSDDDSQTKETSYNPVDMENAYTFA
                     DLVRQMDEQDEADDEGDIAEVEYDFESFDEKLNSTAQEEDEDENDDDDDDDEGHYSVF
                     PNMASHNAFMDQIKRLREGKGREKPIETSFSNTVGKSTGAPKKSILKKKTDVKSERPK
                     KSVGFASTLDIHEVENLKHENQVNTHMFPRSFMQPLEHGDEGENVEFDSDLFAQLIGA
                     QGPDEIHDKYKDEVAKQQKPEEAETNGRKKRVSRFKKERKARDDESAQDVRSPNELAT
                     NSVITENVIEREESFDNSASDSGIAMTDTITENSFDDIIEAPLNEDVAEREVPMSEVK
                     DREHSTTNEVAKELPGLIVERELDELPDSTEAPSARLAPLSKEMNSLRRPNISQGAKP
                     SKLQELLDSSEDESDDNKPKAKEQISDSFPKEIIDKAEKESVLQRPKVDYNALGEDLD
                     NMARAYALGVYDDDLDDDPGMVLEKVTDFKVYNEQVEKLKNEIEAFKISNPLEQQTEH
                     KTDSDEDGPLMTDVTENDIPENYCKTNPQDDLALDSERLHESIAIEYSRLREVIASRA
                     KPPSRSPDDDEHKQIEPIDEDGQPIKQSRFRSQRFKLTK"
     gene            <127320..>128414
                     /gene="TDEL0C00750"
                     /locus_tag="TDEL_0C00750"
                     /db_xref="GeneID:11500299"
     mRNA            <127320..>128414
                     /gene="TDEL0C00750"
                     /locus_tag="TDEL_0C00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680127.1"
                     /db_xref="GeneID:11500299"
     CDS             127320..128414
                     /gene="TDEL0C00750"
                     /locus_tag="TDEL_0C00750"
                     /note="ancestral locus Anc_8.49"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680175.1"
                     /db_xref="GeneID:11500299"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:G8ZR22"
                     /translation="MAAENDPQVHSDSPPRYIANSLAPLSPTATAGAHLLQLASGKDS
                     VAPPLDDKYLDNSLFHYTSSFQARPQAEYFDFDERYMYHSDEENTQENEENIESNQLN
                     LDDQVEFEPELSHEEENLESIMEKVNICKVELREMIEIIDRSVSCTIPYKSTGDETPA
                     IAKELASMLSLVNYKDILLPLVMEKQRIVHKVDVNSVTGPYVSAQPSNKVGSLLGDDP
                     CANLPNFGVVLVKSPSSIAQLWDEYTKIPSEWPVADILAFTQQQGVADNNSNVDLIAK
                     RKTSIRRLEQLLGSSWRNDDKNLSRQINRRKKIWKAIEEGVQDGLSLQDCFLILENYA
                     QERGKGLSWYYNGVPFRLIDMTSKINRVLS"
     gene            <128594..>130896
                     /gene="TDEL0C00760"
                     /locus_tag="TDEL_0C00760"
                     /db_xref="GeneID:11500300"
     mRNA            join(<128594..128624,128684..>130896)
                     /gene="TDEL0C00760"
                     /locus_tag="TDEL_0C00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680128.1"
                     /db_xref="GeneID:11500300"
     CDS             join(128594..128624,128684..130896)
                     /gene="TDEL0C00760"
                     /locus_tag="TDEL_0C00760"
                     /inference="similar to DNA sequence:INSDC:YLR054C"
                     /note="similar to Saccharomyces cerevisiae OSW2 (YLR054C);
                     ancestral locus Anc_8.50"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680176.1"
                     /db_xref="GeneID:11500300"
                     /db_xref="UniProtKB/TrEMBL:G8ZR23"
                     /translation="MTRERLSCLIVGDTPAAQLLGWRLSLGSSFIILASQYVSSDGLV
                     AWKSSRLGANFYTPNIFVKSVKELPSKLLDSEHGTCRYPIDIMIIAGISIAALEESCH
                     ILSKFVTKDTTVLMSADFGCELEKIALKTMGDRCKCVLSIACDVECRQLSLGSYALVN
                     DDNCEIYFGITYSPQNYANDLLFVQNEEKVLVELNESSGSTISRMISQLEATQWMKVK
                     LLKDSQKMALKLWQLIIPKISLNILSIIYEQFDYEKMLENKSTEIIFKGLVHELLDIC
                     SAQCKSKVEEFLMESEEDLKDREVNFMKVIEQCKTKRMELITTTANEYPEYLFLPFES
                     YCFYHRFEYPAQVLLYQPILLAEEFNVSCSNLNFLYGFYTRLLSLSGLSINGGRLDQD
                     ASRLNDRLAGFSSSSSLSSNKKLKKKQKSRSDKNKARSRDTSSKAYVGQGIFAVASPA
                     GADYKLPLGADQLRNGANFKASNSANGSSVTINDESTGLSDSDSEEVTGNSRIEEREV
                     DGQNSFDPLGPSRRSQIFGSRSNTASVDQFRHFTKSYSQSDLCELSTTTVPQFSRKFY
                     SKPYELMPMSLRGSSSAAQSLNFSRASKPSNMSSLELQLRSSNDLAASGYPDMYKRLS
                     DLSISPEDQAEHNARRKQYGPFEKQLWQFQRRRHIKNGTIPRLKVNPYDDLLSHIEIL
                     CGEHNNEIVRFTTSRYGDLDLYASIQRDKDHIVSLFERGPQLSRKRPIKDSSKDTMGL
                     GKLPHSR"
     gene            <131149..>131664
                     /gene="TDEL0C00770"
                     /locus_tag="TDEL_0C00770"
                     /db_xref="GeneID:11500301"
     mRNA            <131149..>131664
                     /gene="TDEL0C00770"
                     /locus_tag="TDEL_0C00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680129.1"
                     /db_xref="GeneID:11500301"
     CDS             131149..131664
                     /gene="TDEL0C00770"
                     /locus_tag="TDEL_0C00770"
                     /inference="similar to DNA sequence:INSDC:YLR053C"
                     /note="similar to Saccharomyces cerevisiae YLR053C;
                     ancestral locus Anc_8.51"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680177.1"
                     /db_xref="GeneID:11500301"
                     /db_xref="UniProtKB/TrEMBL:G8ZR24"
                     /translation="MSSLEMELVSCLNDSGEFFTNDGDNEFFSKSMTTGMPGEEGVDE
                     KEQMRILNDLFGTPRIPSAEGHEYDAFRRDQVSFDVQGDDCNQETHLRSSIEGTAPCE
                     NTQECTDGKPVLSRRRSNPFYSPSRQIMDLVKKKRKPRPSNLKKSQTSATVMTLNQLC
                     GRYKVEGKTDR"
     gene            complement(<131730..>133223)
                     /gene="TDEL0C00780"
                     /locus_tag="TDEL_0C00780"
                     /db_xref="GeneID:11500302"
     mRNA            complement(<131730..>133223)
                     /gene="TDEL0C00780"
                     /locus_tag="TDEL_0C00780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680130.1"
                     /db_xref="GeneID:11500302"
     CDS             complement(131730..133223)
                     /gene="TDEL0C00780"
                     /locus_tag="TDEL_0C00780"
                     /inference="similar to DNA sequence:INSDC:YFL022C"
                     /note="similar to Saccharomyces cerevisiae FRS2 (YFL022C);
                     ancestral locus Anc_8.52"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680178.1"
                     /db_xref="GeneID:11500302"
                     /db_xref="GOA:G8ZR25"
                     /db_xref="InterPro:IPR002319"
                     /db_xref="InterPro:IPR004529"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:G8ZR25"
                     /translation="MSKFQLEILQKLSDLNEINSTLQCFPAVDPQDVLSALNSLKAHA
                     KLNYTKKDILYYDLSSEGQDILANGSHEMKLLQLVKELGKLQIKDVGAKLGPNGKVGQ
                     ARAFKNGWIIKNKDNELEVSEKVTETPEDETKLLLAKILEGQDSSIDAKTLADLKKRK
                     LIVPRKQTDFSVTKGDDFSLELTKLETEITSEMIVNGSYKDCKFKPYNFNSEGVDVQS
                     GALHPLSKVREEFRQIFFSMGFSEMPANQYVETGFWNFDALYVPQQHPARDLQDTFYI
                     KDPLTSDLPEDKTYMNNIKAVHENGKFDSIGYRYNWKEAECQKLVLRTHSTAISAAML
                     HQLAKDPKPTRLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLINFMEEFFA
                     KMGVTGLRFKPTYNPYTEPSMEIFSWHEGLHKWVEIGNSGMFRPEMLESMGLPRGLRV
                     LGWGLSLERPTMIKYKVQNIRELLGHKVSLDFIETNPAARLDEDLYD"
     gene            complement(<133332..>133961)
                     /gene="TDEL0C00790"
                     /locus_tag="TDEL_0C00790"
                     /db_xref="GeneID:11500303"
     mRNA            complement(<133332..>133961)
                     /gene="TDEL0C00790"
                     /locus_tag="TDEL_0C00790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680131.1"
                     /db_xref="GeneID:11500303"
     CDS             complement(133332..133961)
                     /gene="TDEL0C00790"
                     /locus_tag="TDEL_0C00790"
                     /inference="similar to DNA sequence:INSDC:YLR052W"
                     /note="similar to Saccharomyces cerevisiae IES3 (YLR052W);
                     ancestral locus Anc_8.53"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680179.1"
                     /db_xref="GeneID:11500303"
                     /db_xref="UniProtKB/TrEMBL:G8ZR26"
                     /translation="MDFINDDRQLQYARYAVKRYRKCEPLETAVASNKRHIVNVDDTS
                     RINYEMIKNAPGNLPAVSGTISTVQDNEISRLKTKTYKSRLYELNDEYLERANAQLDH
                     LKKQPKATSVVPLESQQVWLEQIQGNLLQEYKELVEDEKKWIVLKELLLDANVELDLY
                     SAQDQGKKQVKLGSVAVPTHSNANALLFNRPKRPKVKNKGHHDNISPIV"
     gene            <134130..>134699
                     /gene="TDEL0C00800"
                     /locus_tag="TDEL_0C00800"
                     /db_xref="GeneID:11500304"
     mRNA            <134130..>134699
                     /gene="TDEL0C00800"
                     /locus_tag="TDEL_0C00800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680132.1"
                     /db_xref="GeneID:11500304"
     CDS             134130..134699
                     /gene="TDEL0C00800"
                     /locus_tag="TDEL_0C00800"
                     /inference="similar to DNA sequence:INSDC:YLR051C"
                     /note="similar to Saccharomyces cerevisiae FCF2 (YLR051C);
                     ancestral locus Anc_8.54"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680180.1"
                     /db_xref="GeneID:11500304"
                     /db_xref="InterPro:IPR014810"
                     /db_xref="UniProtKB/TrEMBL:G8ZR27"
                     /translation="MDSSVDELFTLLKQQSKKEVEQVPEEQSDELRLDDPVDRDAQEK
                     FEEIDKNLRSLPKLRNEFDSLAHKKDKAQPTKLRSEDDQYKDWFLLPKPDKAARDRAQ
                     RDLLLLKHRSALDPKRHYKKDRWQVPERFALGTVIEGSSSASTRKHSGSTMLDTLLSD
                     QDTQHYFKRKYSQIQQQRSNRRRTVRKRR"
     gene            <134908..>135945
                     /gene="TDEL0C00810"
                     /locus_tag="TDEL_0C00810"
                     /db_xref="GeneID:11500305"
     mRNA            <134908..>135945
                     /gene="TDEL0C00810"
                     /locus_tag="TDEL_0C00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680133.1"
                     /db_xref="GeneID:11500305"
     CDS             134908..135945
                     /gene="TDEL0C00810"
                     /locus_tag="TDEL_0C00810"
                     /inference="similar to DNA sequence:INSDC:YFL021W"
                     /note="similar to Saccharomyces cerevisiae GAT1 (YFL021W);
                     ancestral locus Anc_8.55"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680181.1"
                     /db_xref="GeneID:11500305"
                     /db_xref="GOA:G8ZR28"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="UniProtKB/TrEMBL:G8ZR28"
                     /translation="MKERSLGSKLHEAAIGDSSVEALWKMYSSARASLPNRERMDNLT
                     WRMLGMRVVCREPEVNIVKDEPMCVDPVLVEPGQQQWDGGFDFDVMDPLEDHVLSYSS
                     PALVSETSESMMNSEVLGGQSSNFLDLFLPSEPVQEPPPLPSRLVKKTGQRRSSSGVK
                     KRPNLRNNSTTSLTSLNEPGDSNRDTRCSNCNTRTTPLWRRDPAGNPLCNACGLFLKL
                     HGVVRPLSLKTDVIKKRQRNVKSCSPKPEDVKLKRNITSRRSTTQLRKTSSNSPVPQL
                     ASVHQSTTEVDTDTDDRPLERDFDVLQPTQLSLLYDTDASTHLNSESPANQAPQGTNG
                     ATNWEWLSLSL"
     gene            complement(<135989..>137473)
                     /gene="TDEL0C00820"
                     /locus_tag="TDEL_0C00820"
                     /db_xref="GeneID:11500306"
     mRNA            complement(<135989..>137473)
                     /gene="TDEL0C00820"
                     /locus_tag="TDEL_0C00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680134.1"
                     /db_xref="GeneID:11500306"
     CDS             complement(135989..137473)
                     /gene="TDEL0C00820"
                     /locus_tag="TDEL_0C00820"
                     /inference="similar to DNA sequence:INSDC:YFL018C,YPL017C"
                     /note="similar to Saccharomyces cerevisiae LPD1 (YFL018C)
                     and YPL017C; ancestral locus Anc_8.56"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680182.1"
                     /db_xref="GeneID:11500306"
                     /db_xref="GOA:G8ZR29"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR006258"
                     /db_xref="InterPro:IPR012999"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR016156"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:G8ZR29"
                     /translation="MLRSVIGRRSFSAGAVWRAAKKQHDVVVIGSGPGGYVAAIKAAQ
                     LGFDTACIEKRGKLGGTCLNVGCIPSKALLNNSHLYHQMKSDSKNRGIDIKGSVELNV
                     EQFQKAKDLVVKQLTGGIEMLFKKYGVTYYKGNGSFEDEHNIKVSPVEGLEGSVKEES
                     ILEAKNIIVATGSEVTPFPGIKIDEERIVSSTGALALKEIPKRFAVIGGGIIGLEMGS
                     VYSRIGSKVTVIEFQPKVGASMDGEVATATQKFLKKQGLEFRLSTKVVSAERDGDVVK
                     IVIENAKNGKQETIEADALLVAVGRRPYMQGLNAEKIGLEVDKRGRLVVDEELSTKHP
                     HIKVIGDVTFGPMLAHKAEEEGIAAVEYFKLGHGHVNYNNIPSVMYSHPEVAWVGKTE
                     EQLKEAGIQYKVGKYPFIANSRAKTNLDTEGFVKIIIDAETERILGAHIIGPNAGEMI
                     AEAGLALEYGASAEDISRVCHAHPTLSEAFKEANLAAFSKPINF"
     gene            <137853..>138083
                     /gene="TDEL0C00830"
                     /locus_tag="TDEL_0C00830"
                     /db_xref="GeneID:11500307"
     mRNA            <137853..>138083
                     /gene="TDEL0C00830"
                     /locus_tag="TDEL_0C00830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680135.1"
                     /db_xref="GeneID:11500307"
     CDS             137853..138083
                     /gene="TDEL0C00830"
                     /locus_tag="TDEL_0C00830"
                     /inference="similar to DNA sequence:INSDC:YFL017W-A"
                     /note="similar to Saccharomyces cerevisiae SMX2
                     (YFL017W-A); ancestral locus Anc_8.57"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680183.1"
                     /db_xref="GeneID:11500307"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:G8ZR30"
                     /translation="MVSTPELKRYVDKKVVLQVNGSRKLAGVLRGYDVFLNVVLDDAV
                     ELLKDGSNHALGSQTVVRGNSIVSLEALDTVT"
     gene            complement(<138076..>138594)
                     /gene="TDEL0C00840"
                     /locus_tag="TDEL_0C00840"
                     /db_xref="GeneID:11500308"
     mRNA            complement(<138076..>138594)
                     /gene="TDEL0C00840"
                     /locus_tag="TDEL_0C00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680136.1"
                     /db_xref="GeneID:11500308"
     CDS             complement(138076..138594)
                     /gene="TDEL0C00840"
                     /locus_tag="TDEL_0C00840"
                     /inference="similar to DNA sequence:INSDC:YFL017C"
                     /note="similar to Saccharomyces cerevisiae GNA1 (YFL017C);
                     ancestral locus Anc_8.58"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680184.1"
                     /db_xref="GeneID:11500308"
                     /db_xref="GOA:G8ZR31"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G8ZR31"
                     /translation="MTIKVQQWVILQLQPRQAKMVDGYSIRRIRKSDYEGVVETLKVL
                     TVVGNLSRSEFEKIVEYWDSITVSETTKLYNPLVVVDDTTGAIAATGNVLIERKLIHE
                     GALCGHIEDIAVSRDHQGRQLGRYLIEQLTALAVRAGCYKVILDCDPSNVAFYEKCQF
                     TRAGVEMQFRTT"
     gene            complement(<138626..>139687)
                     /gene="TDEL0C00850"
                     /locus_tag="TDEL_0C00850"
                     /db_xref="GeneID:11500309"
     mRNA            complement(<138626..>139687)
                     /gene="TDEL0C00850"
                     /locus_tag="TDEL_0C00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680137.1"
                     /db_xref="GeneID:11500309"
     CDS             complement(138626..139687)
                     /gene="TDEL0C00850"
                     /locus_tag="TDEL_0C00850"
                     /inference="similar to DNA sequence:INSDC:YLR049C"
                     /note="similar to Saccharomyces cerevisiae YLR049C;
                     ancestral locus Anc_8.59"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680185.1"
                     /db_xref="GeneID:11500309"
                     /db_xref="UniProtKB/TrEMBL:G8ZR32"
                     /translation="MFQYVPPSRRLFKSRHRVSRRELQGLIDWTTTLDESIEEDSLIS
                     YAVPVVGGESRFSVLSSESGESLFEPDLRTQLQSNMSLESLIQENKKRISANQEDLEL
                     FIAARNPSLSNSARDQVSKLQCENAQLFNRGKILQERWAQVRRCNDNGILLIEIGKNG
                     LQWFGIPADLRQQIYRCCLYQVAEACEPRDELYRAILQCCGEKQLAAQIYGNMRRNAP
                     FLMDEKLPVEQSKLVDSRIASLYPGLHYHLTITLQWDLIHDFVRPLLLNSLCAGLRSQ
                     TISWELLDVIVFSAYYRELSRLITDEFLLGTLEQTYYKFFSDEPVQVQQQLQHIRIDL
                     VELLEYLRRKYGQSLMGTT"
     gene            complement(<139829..>140329)
                     /gene="TDEL0C00860"
                     /locus_tag="TDEL_0C00860"
                     /db_xref="GeneID:11500310"
     mRNA            complement(<139829..>140329)
                     /gene="TDEL0C00860"
                     /locus_tag="TDEL_0C00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680138.1"
                     /db_xref="GeneID:11500310"
     CDS             complement(139829..140329)
                     /gene="TDEL0C00860"
                     /locus_tag="TDEL_0C00860"
                     /inference="similar to DNA sequence:INSDC:YLR050C"
                     /note="similar to Saccharomyces cerevisiae YLR050C;
                     ancestral locus Anc_8.60"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680186.1"
                     /db_xref="GeneID:11500310"
                     /db_xref="InterPro:IPR016964"
                     /db_xref="UniProtKB/TrEMBL:G8ZR33"
                     /translation="MARFSLGERKFYYYYFLLHIPITLLIDSSVVVPPEYHPASKLVE
                     WHIAQNNDFLLWEKPNWLYWFVVIELVVQLPLFAKFALALRPSQATNSQEKDEKLEKE
                     NKLNRWLRIYGLNASFTTLICMITIWQRGYHPFFPTQPLQIDEKIQLLLVYLPTFLIP
                     LRLCFL"
     gene            complement(<140420..>141832)
                     /gene="TDEL0C00870"
                     /locus_tag="TDEL_0C00870"
                     /db_xref="GeneID:11500311"
     mRNA            complement(<140420..>141832)
                     /gene="TDEL0C00870"
                     /locus_tag="TDEL_0C00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680139.1"
                     /db_xref="GeneID:11500311"
     CDS             complement(140420..141832)
                     /gene="TDEL0C00870"
                     /locus_tag="TDEL_0C00870"
                     /inference="similar to DNA sequence:INSDC:YFL016C"
                     /note="similar to Saccharomyces cerevisiae MDJ1 (YFL016C);
                     ancestral locus Anc_8.61"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680187.1"
                     /db_xref="GeneID:11500311"
                     /db_xref="GOA:G8ZR34"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:G8ZR34"
                     /translation="MNFISRSSLPRRAFLNAYPLVRAFHSTSIRLQDIKDPYETLGVG
                     KNASSSEIKKAYYKLAKKFHPDINKEPNAEAKFHDLQNAYEILSDDTKKQQYDQFGAA
                     AFNNGAGGPSGAGGFHGFGGANPFGGSAGGFGNFGGINFEDLFGAAFGGGGGRGGPSG
                     GGSSMFREYKGDSVEVIHRMKFKDAVFGAKNANLQFSVLDPCGVCHGSGLKKNAQSST
                     CPSCHGTGTTVHVRGGFQMASTCNQCGGEGTTVRPEDVCSKCHGEGVELNSQRSISVD
                     LPQGLQDGDVVRVPGQGSYPHLAVDPKMKNSVKLHRGDVLVRIRVDKDSRFSIRNKTD
                     IWFTKEIPITTAALGGQVTIPTVDDTQIRLKVQPGTQHDQVISIPNMGVPRIGGERGA
                     MKVQYKIVIKKPQSKAEKCLWEALADVTNDQAARRTETTSHSPESTNSTATTNPDNPS
                     ALGRLEKFISNTFNKIKGDK"
     gene            <142675..>142995
                     /gene="TDEL0C00880"
                     /locus_tag="TDEL_0C00880"
                     /db_xref="GeneID:11500312"
     mRNA            <142675..>142995
                     /gene="TDEL0C00880"
                     /locus_tag="TDEL_0C00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680140.1"
                     /db_xref="GeneID:11500312"
     CDS             142675..142995
                     /gene="TDEL0C00880"
                     /locus_tag="TDEL_0C00880"
                     /inference="similar to DNA sequence:INSDC:YFL014W"
                     /note="similar to Saccharomyces cerevisiae HSP12
                     (YFL014W); ancestral locus Anc_8.62"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680188.1"
                     /db_xref="GeneID:11500312"
                     /db_xref="GOA:G8ZR35"
                     /db_xref="InterPro:IPR007250"
                     /db_xref="UniProtKB/TrEMBL:G8ZR35"
                     /translation="MSDSNRKDFSTKIGESVKPDSQKSYTEAGKEKVTNAADRVAGAV
                     QPESDKGVAQGVHDSAKKGKNDAQADSFADTAKEYVDAAKGKLNDAVEYVSSSVNGGE
                     PSKK"
     gene            <143110..>144018
                     /gene="TDEL0C00890"
                     /locus_tag="TDEL_0C00890"
                     /db_xref="GeneID:11500313"
     mRNA            <143110..>144018
                     /gene="TDEL0C00890"
                     /locus_tag="TDEL_0C00890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680141.1"
                     /db_xref="GeneID:11500313"
     CDS             143110..144018
                     /gene="TDEL0C00890"
                     /locus_tag="TDEL_0C00890"
                     /inference="similar to DNA sequence:INSDC:YPL018W"
                     /note="similar to Saccharomyces cerevisiae CTF19
                     (YPL018W); ancestral locus Anc_8.63"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680189.1"
                     /db_xref="GeneID:11500313"
                     /db_xref="UniProtKB/TrEMBL:G8ZR36"
                     /translation="MDFTSDSVRHSSVASEARNSRSSSRSSSNDLSELDLRTLKLQEQ
                     RNSLLSRRNGLLQEIQSLKSRAHTTHEETDARLLDLVLLTSGKEKASAITIDGSDLEK
                     ELQAKYDTLPLLNMQLRLETLRKLYQYVDLSVSSSDDIVEAHARFYRSTEPFDLDLRL
                     NYKGETLYECGVEVSRNVQWPLRSLLKCKNPSRILLGCFEYDRLRCGRDELFNHIQGE
                     MGRFASLVTITRTESALTLHRFATPEAKLTIRYTIEFEEFLPSSRIQTSLQDGQIDIS
                     AVTSGLLKEYGLRLGLLQLCKACLCL"
     gene            complement(<144013..>145704)
                     /gene="TDEL0C00900"
                     /locus_tag="TDEL_0C00900"
                     /db_xref="GeneID:11500314"
     mRNA            complement(<144013..>145704)
                     /gene="TDEL0C00900"
                     /locus_tag="TDEL_0C00900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680142.1"
                     /db_xref="GeneID:11500314"
     CDS             complement(144013..145704)
                     /gene="TDEL0C00900"
                     /locus_tag="TDEL_0C00900"
                     /inference="similar to DNA sequence:INSDC:YFL013C"
                     /note="similar to Saccharomyces cerevisiae IES1 (YFL013C);
                     ancestral locus Anc_8.64"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680190.1"
                     /db_xref="GeneID:11500314"
                     /db_xref="UniProtKB/TrEMBL:G8ZR37"
                     /translation="MGKRVYDPIHDVFQDREESDAQRSVTGRVVEDEDDSNTESEETN
                     SPQKEAIVPSVATNRKKMKESSKYNRHLKKPDGEFFTRRDLQFHFLTRLLTDDRPLFT
                     NLFKEVYAKSVVPLPTTEGKTVDVTDASYDARTFVFNDKLTFSQLYILTLASSTKCSK
                     VLRDKLLLDHQAAFSTCILALLVNFGRLNTTINFYLEMTSQLRTFHSVPCLQYRVADL
                     KSLQDTPRLKSILKNLSVGNEPLDLAQLYESPGMTNEKANVVNLLFTMCDNVTLVNMK
                     LLSKYVEGHASLFNILDSPDYEPEDRCNVVLWLLYIHTETDLSPESIQQSIKLFTTGD
                     KLPLRRATKEYDQDPQDEYDFGLEQKAKRREFLKRTKHDESDEKEGEEEEEEEEEEQE
                     EEEEEEEEDETIQEMESQEDEVVEPVTPRKRRETGKEKREPKRRKVETVVKQESASED
                     VTRIEGLIELDRKKIVGKLGRHQTKDQQTFVQDLLSAQKPVKMKRRDLGLVRIFNEYE
                     DIPMASVIGIRGKKRKKFKDDVLGFETDYLRSFAAAKKMMLNDQWEEELGDFFQL"
     gene            complement(<145827..>146342)
                     /gene="TDEL0C00910"
                     /locus_tag="TDEL_0C00910"
                     /db_xref="GeneID:11500315"
     mRNA            complement(<145827..>146342)
                     /gene="TDEL0C00910"
                     /locus_tag="TDEL_0C00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680143.1"
                     /db_xref="GeneID:11500315"
     CDS             complement(145827..146342)
                     /gene="TDEL0C00910"
                     /locus_tag="TDEL_0C00910"
                     /inference="similar to DNA sequence:INSDC:YFL010C"
                     /note="similar to Saccharomyces cerevisiae WWM1 (YFL010C);
                     ancestral locus Anc_8.65"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680191.1"
                     /db_xref="GeneID:11500315"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/TrEMBL:G8ZR38"
                     /translation="MSQSKDNVPQVPRGWKAIYDEEYKHWFFVELSSKKSQWEAPKGT
                     SWSNSERSAPPPPAYSSQPQPQQPQQRYAPQPNYQQQPMYPQQQMYPQQPMYPQQPMY
                     QQPQQKRSNGMRNGMLGAGAGMLGGFLLADAMTPDVYVENNNYDYGGGDYGGGDFGGG
                     DFGGGDFGGDF"
     gene            complement(<146475..>147590)
                     /gene="TDEL0C00920"
                     /locus_tag="TDEL_0C00920"
                     /db_xref="GeneID:11500316"
     mRNA            complement(<146475..>147590)
                     /gene="TDEL0C00920"
                     /locus_tag="TDEL_0C00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680144.1"
                     /db_xref="GeneID:11500316"
     CDS             complement(146475..147590)
                     /gene="TDEL0C00920"
                     /locus_tag="TDEL_0C00920"
                     /note="ancestral locus Anc_8.66"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680192.1"
                     /db_xref="GeneID:11500316"
                     /db_xref="GOA:G8ZR39"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR006181"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023209"
                     /db_xref="UniProtKB/TrEMBL:G8ZR39"
                     /translation="MSDHVVIAGAGVIGLTIACQLLLEIQEKSKPRLQSLTIMARNFP
                     NDQPLTHEYTSPWAGAHFRPFPHRPESYESDLRESGYTRVTYKFFQEYAKQHPESTIE
                     FMKGYDWLQEPTAEYLNLGPGYTRESLKNFVYPSKEPLPEGLKYVAEYITWCLNAPEY
                     LKFLQTQVEQLSLRLDIPLEFSRLTLTSLKDAKKWFPKTNVLFNATGTGLSYSGGYDP
                     LSVPIRGQTVLLNVPNPKTIRYANATITHQGKDGLWTFVIKRPAINGDPQYILGGTKQ
                     PGDDLIIPRESDTQALLARARKLFPDLMFPDKTFDVVRTNVGFRPARTGGSRVELETC
                     PDLKIVHAYGFGGMGYEVSVGAAKHAIELYRFRPSKL"
     gene            complement(<147777..>149564)
                     /gene="TDEL0C00930"
                     /locus_tag="TDEL_0C00930"
                     /db_xref="GeneID:11500317"
     mRNA            complement(<147777..>149564)
                     /gene="TDEL0C00930"
                     /locus_tag="TDEL_0C00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680145.1"
                     /db_xref="GeneID:11500317"
     CDS             complement(147777..149564)
                     /gene="TDEL0C00930"
                     /locus_tag="TDEL_0C00930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680193.1"
                     /db_xref="GeneID:11500317"
                     /db_xref="GOA:G8ZR40"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:G8ZR40"
                     /translation="MSIIEEKTRLPASKGGDNVVVENISQEPVSYDQSQGSSTEAHSR
                     WGRFKESFKRAEEMELDPNLTEAERIAIKTAQSPLKHHLKNRHLQMIAIGGAIGTGLF
                     VGSGTALRTAGPAGILIGWGLTGTMIYSMVMAVGELAVVFPVAGGFTTYATRFVDESF
                     GFAANFIYMLQWLVVLPLEIVAASITVNYWGTDPKYRDGFVALFYVVIVIINMFGVKG
                     YGEAEFIFSFIKVITVIGFIIMAIVLICGGGKDHKYIGAQYWYNPGAFVGDTAGQQFQ
                     GFCTVFVTAAFSFAGSELVGLAGSEAEEPRKSVPGAAKQVFWRITLFYILCLLLIGML
                     VPSDSPRLIGASSVDAAASPFVIAIVNHGIKGLPSVVNVVILIAVLSVGNSAIYSCSR
                     TLAALADQGFLPSICGYIDRGGRPLVGIAISAFFGLIAFVAQSKKEGDVFNWLMALSG
                     LSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQAPAGVWGSYWGFFMCILMFIAQFY
                     VGLFPPGTKPNAYDFFLAYLSFCIFIALYAFHKIWKRNWKLFIPLKDLDIDTGRREVD
                     LDVLREELAEERAALAARPFWYRSWKFWC"
     gene            <150797..>152719
                     /gene="TDEL0C00940"
                     /locus_tag="TDEL_0C00940"
                     /db_xref="GeneID:11500318"
     mRNA            <150797..>152719
                     /gene="TDEL0C00940"
                     /locus_tag="TDEL_0C00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680146.1"
                     /db_xref="GeneID:11500318"
     CDS             150797..152719
                     /gene="TDEL0C00940"
                     /locus_tag="TDEL_0C00940"
                     /inference="similar to DNA sequence:INSDC:YFL009W"
                     /note="similar to Saccharomyces cerevisiae CDC4 (YFL009W);
                     ancestral locus Anc_8.67"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680194.1"
                     /db_xref="GeneID:11500318"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8ZR41"
                     /translation="MREVVQYPLLEIAVPYQYRVREDPVGGVKRRRRESAQPDDECKR
                     VKVSTPEARADESRLEVSSPSSLPVAATGAPAVAEVEEVLPLSPLASPGPRDDQTGED
                     DALCASQLYTNELYSMVKRELPPTCYKNLLFQLVSNMDRKELSDLGTLITDNLKRDFL
                     SSLPFEIALKVLTNLSFADIAQCLQTCKSWNSLINSTPHLWRQMLLTESFVSKENFAK
                     YSSKLKAKYPQIKNEEDGYQLDFLENCRVLQNWFNPKFTPQRTTLRGHMTSVVTCLQF
                     EDNYVITGADDKVIRVYDSEKKQFLMELTGHDGGVWALKYDEDGILVSGSTDRSVRVW
                     DIKRGCCTHVFKGHASTVRCLDIVEYKKVKYIVTGSRDNTLHVWKLPLEPVAEGQEWP
                     VVYNTPEENPYFVGVLRGHMASVRTVSGHGNIVISGSYDNNLMVWDIAQMKCLYILTG
                     HTDRIYSTIYDHKRFRCISASMDTTIRVWDLQNIWNNGTCTVVTTSQAPCTKISGSMS
                     TLQGHTQLVGLLRLSDRFLVSAAADGSLRGWDSNDYSRKFAYHHNNLSAITTFYMSDN
                     LLVSGSEGQFNVYNLRSGKLIHSNILRDADQIWSVNFKGGILVAAVEKDGQSYVELLD
                     FSNAGTARNIPIQGHV"
     gene            <152898..>153359
                     /gene="TDEL0C00950"
                     /locus_tag="TDEL_0C00950"
                     /db_xref="GeneID:11500319"
     mRNA            <152898..>153359
                     /gene="TDEL0C00950"
                     /locus_tag="TDEL_0C00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680147.1"
                     /db_xref="GeneID:11500319"
     CDS             152898..153359
                     /gene="TDEL0C00950"
                     /locus_tag="TDEL_0C00950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680195.1"
                     /db_xref="GeneID:11500319"
                     /db_xref="UniProtKB/TrEMBL:G8ZR42"
                     /translation="MTSGVDGPFETSSKSFTGVETQRIRRRSPESRAFGKGIFESRHS
                     SSSRNREGSTISWQLICSSTSVAVSSFLVFLLGVNIVIQYRTMVLEDRAGLIRKSFYL
                     IFSVLAIYAIVQFNVWLLAKLKPSSVRRSRDSVNYERLSSVEANIELDSLN"
     gene            <153572..>157240
                     /gene="TDEL0C00960"
                     /locus_tag="TDEL_0C00960"
                     /db_xref="GeneID:11500320"
     mRNA            <153572..>157240
                     /gene="TDEL0C00960"
                     /locus_tag="TDEL_0C00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680148.1"
                     /db_xref="GeneID:11500320"
     CDS             153572..157240
                     /gene="TDEL0C00960"
                     /locus_tag="TDEL_0C00960"
                     /inference="similar to DNA sequence:INSDC:YFL008W"
                     /note="similar to Saccharomyces cerevisiae SMC1 (YFL008W);
                     ancestral locus Anc_8.68"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680196.1"
                     /db_xref="GeneID:11500320"
                     /db_xref="GOA:G8ZR43"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR024704"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028468"
                     /db_xref="UniProtKB/TrEMBL:G8ZR43"
                     /translation="MGRLLGLELHNFKSYKGTVKVGFGDSNFTSIIGPNGSGKSNMMD
                     AISFVLGVRSRHLRSNVLKDLIYRGVASEEEGDGESDVVNNPTTAYVKAFYSKGDSTI
                     ELSRSISKGGDTTYRMNGKVVDYKRYASFLEDENILIRAKNFLVFQGDVVQIASQSAM
                     ELTQFFEEFSGSIQYKKEYDMLKEKLQTLGQSTAESIKNRRRIHAEMRTYKEGINKNE
                     EFEKQVSHRLELQNHYALWQLYHLEEEKAENNEKLENCKANVRLLKDKIANEEKKLAK
                     LRASFIEESASITKQKSSLTYKIKEKEEIESQLLPIKLSQRAATKRIGNFEKRIDALK
                     RDVERQKSYVERFENQLKVVTKARETFEDEIKKSAQDSNKYHLTDEDLKLYAALNEKY
                     LNSGGFAIEGKIANSQNDSKDVADDIGLVKKRKEISSSRISDELLVTKQSLELQMSDL
                     SSSLNEKNQAHSEQASELKKLQSEIESSNNKEYDLNYKLREALIKIDDLSASQRETNK
                     ERKLRENVSTLKKFFPGIRGLVSDLCQPKKERYALAVSTILGRNFDSIIVDNLAVAQE
                     CIAYLKKQRAGIASFIPLDTIEVETSTLPASESSGCILAINAIEYDPEYERAMRYVCS
                     DSIICNTLEIARDMKWKRNVRSKLVTLEGTLIHRAGLMTGGISKDSSNRWDKEEYQSL
                     MTLKDKILVQIEEVGSHSRACSIRARELEGNISLIYSEASSIRTQISQLKRALEDTNT
                     DIEYHQNLIKQEYDPKIQELEQKLAIINDSRKQLEEEKDSLQTQTFKEFTDKLGFSMK
                     EYETHSGDAKRQQSKELQQLQKQILNVENKLEFEKERLTSTSNRLEKTETDMKKVFIE
                     LQSLQKQEEDVGVQTKKVEKAIKDHKIKLKKVEEELKNKQRTMNLNDEQLIEYNSSLQ
                     SLKRERDEVKDVIEKGDLERICVLKNCKISNMQIPIVSDVDLQSLPIDRIDAEAIRTS
                     NEIEIDYDALPAKYKENGGEAVEKGFERELKQVDEILNVLQPNAKATDRFNEAQQKFG
                     SINDETEQLKKDEKKVLAQFIKIKRKRKSLFEEAFEYVTEHIDPIYRELTKNPNSTSE
                     LAGGSASLTLEDEDEPFNAGIRYHATPPLKRFKDMEYLSGGEKTVAALALLFTVNSYQ
                     PSPFFVLDEVDAALDTTNVERVATYIRRHGNPDLQFIVISLKNTMFEKSDALVGVYRQ
                     QELNTSKIVTLNLRNYAN"
     gene            <157582..>164022
                     /gene="TDEL0C00970"
                     /locus_tag="TDEL_0C00970"
                     /db_xref="GeneID:11500321"
     mRNA            <157582..>164022
                     /gene="TDEL0C00970"
                     /locus_tag="TDEL_0C00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680149.1"
                     /db_xref="GeneID:11500321"
     CDS             157582..164022
                     /gene="TDEL0C00970"
                     /locus_tag="TDEL_0C00970"
                     /inference="similar to DNA sequence:INSDC:YFL007W"
                     /note="similar to Saccharomyces cerevisiae BLM10
                     (YFL007W); ancestral locus Anc_8.69"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680197.1"
                     /db_xref="GeneID:11500321"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021843"
                     /db_xref="UniProtKB/TrEMBL:G8ZR44"
                     /translation="MSGIDDIKAPIPLKNKTVSQLKGFEMKNTRCSSSLGDDSTKRQR
                     LFSPEPGIATQLRARSSTPRAASPRLLNGMDSEDILKQRLKHYNLDFVEDKTEHLKNI
                     YDPSSKWFGRAVKPPFPIEECLPYKTESHKDQARYLCHVLVNLYIAIGSLDIQGLINI
                     SSKDLAELKTEIDNLALSTDLFRLSNDISDSEVANNDIADFDDGEDEDDEYDENEYID
                     TVGPDFNATGKITAKSASIINVNHWTNEFKNCMHFEFPITLRKSIATVYYYLSLVQGQ
                     KVYRQMHVDMFTTLVTTDDDGTNFTDLLLEAGLKLDHKVMLEFLREFLPYPDPDYVRY
                     DVTLKEDLQLLRLLLKLAHSAKAFYDEEDANLLNNVMEILLSSLAPSTMSTVMPVITS
                     FVPYHYHEDSKITDYLPFCFSFWSSINANIGVDTHMYDLMGTVAEDAHWRLLNGTLQP
                     ELIPSVHSGDYLIFTEEQMSFMFNRSQNHLRSDGQIHSFSRTVRPLVFALKGSKSDLF
                     FEKLTALTKSIETFVHPSNSGFWTKPISKFVHGYIKMYHSRVKNEEKTKEGPSDIRLT
                     PQCHSKLVDIFLHLLVLGAQNKNTDVANHYISCFAYLLDLSPSNSNLIYDRILTDIYE
                     ALAGEYVNSTHRLIAALKQFNRVIRYMVEDKLYRVHVTNVLLMMVSKIDMNDIQLTSN
                     IINGIVSIASFIPFENFAKDEEYLTFESHTLPFIEQHYFHFSSTERFEKFAYDEQILQ
                     NAFIASTTIFENILRIYVDKLFLLTDVDLEEGFVTKVNQTTIIMQESMDEKTFNSFAE
                     LLQKRLWDNDFFREKNPKFELITIPLSALVRRNSKLSSPLFHKLIYHIREQIEKGAGS
                     VRGSTEIQQRDLRLVLYLSALNEVLRQAHESILEYSGKLIESMLYIYENITNPPLDVI
                     TSIIIHSSCATLTNTEVVDYRLFPEDSNIPPLERWGGLQFDDRKFSKENIRFKWHTPN
                     SAEISLAMQILETFIEHSISQVDHLMAQPVADANYVDKMQKYILIITHALSGSSLLFD
                     PDFNKNKPHTADSLNYRERLLLLKSIRDCNCDSQELDIDIEQIRSSKGDDDYLDDKEV
                     DLKMLGDETDAIEMRDTTPDNIIMDFGADVSEAPSGIATPEPGSHFEGGVSSMMNSRL
                     VFRDLDIYTCNYPFGITATEKLLHPQYLQVHKIRAKIGRFFRKVYLFLSKKYENNTAI
                     FQILLHGLKVWFTDVGQETIFNEDPSASLDLDFLENIQALANLTEPFTRTCLAVRAND
                     FHQTRVLLRSTNRYPSALETELLKDIINLASSVYPDIHKPAQGTLVHCMKQFVGSYSI
                     IIKSVISSLKSSLDTQDYMKLEVVLKVLMIKKINRKLVSDYKNLKELVLILIRCCKVN
                     DFEIAMHADKILSDVVSGLKIPSSVCILDERALSILSPPDHSINLQVQAVKLAKGKKR
                     DYYFSLIMELQEELIKILNTEENVGWKLPVFIMRFISKIQSNLETKVNREAIEIIFRQ
                     TESRHPDLIHLALKSFLGTFNKVLSLADYNYDITNAYRSTFDPDHIFQIDTSDVKAIS
                     ELELEREDFKDPKFFIDSKMFVGWLCWGAPMKVMKPDTLHLTFEDNELEALTCIGGLI
                     TNEWLDAIVSNLIQDNESHGVFSSGNVSFFVLVLFLISKGFMNMPFSNILQVCRQSYN
                     RYDKASMIMSIEILAALMCSSKYLDSNALAERDSFIEEFLPSCLDHELNQDAFGIWAT
                     VCWWLPTVVDLRRCEPFYHHFSNIEHLLDTKADDPAHQASKLLMLRSIFISLEYRTPG
                     MEQTLELLVMDHPYDQVREAVAKILATIIQNQSCPSWRSISELQENETCDLSGLGTPL
                     RRMPTATDAFIKQLFVHVAEENCKTDGLTPQQILKTKYFYLTSTIIYWIKEMARGPNK
                     ILLVPYIIHYVAPFLMRTLKHKDVCKLTGLEPSMLYVGLSYLPIRKENIHHLVELLCD
                     TSKMTSSHQIKLQLQFVQHFFSTQLLQLTKNERNAILDVVCNYLYHEKFIEVRMKASE
                     VLSDIVHNLGDRNDKLNELVQRFDQGLGQYTWEQKKAISKTNVQVHGSILGLGAIISA
                     FPYVFPLPKWIPKQLSELSSWARTNGVAGAAAKSVISEFKKVRTDTWKFDRLSFSSEE
                     LEDLEGVLWSSYYA"
     gene            <164219..>164866
                     /gene="TDEL0C00980"
                     /locus_tag="TDEL_0C00980"
                     /db_xref="GeneID:11500322"
     mRNA            <164219..>164866
                     /gene="TDEL0C00980"
                     /locus_tag="TDEL_0C00980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680150.1"
                     /db_xref="GeneID:11500322"
     CDS             164219..164866
                     /gene="TDEL0C00980"
                     /locus_tag="TDEL_0C00980"
                     /inference="similar to DNA sequence:INSDC:YFL005W"
                     /note="similar to Saccharomyces cerevisiae SEC4 (YFL005W);
                     ancestral locus Anc_8.70"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680198.1"
                     /db_xref="GeneID:11500322"
                     /db_xref="GOA:G8ZR45"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZR45"
                     /translation="MSGLRTVSASSGTGKSYDSIMKILLIGDSGVGKSCLLVRFVDDK
                     FNPSFITTIGIDFKIKTVDINGKKTKLQLWDTAGQERFRTITTAYYRGAMGIILVYDV
                     TDERTFTNIRQWFKTVNEHANDDAQLLLVGNKSDMDTRTVTYEQGETLAKELGIPFVE
                     SSAKNDDNVNEIFFTLARLIQEKIDNDKLAGGANSGREGNININSGSGSTKSGCC"
     gene            <165162..>167681
                     /gene="TDEL0C00990"
                     /locus_tag="TDEL_0C00990"
                     /db_xref="GeneID:11500323"
     mRNA            <165162..>167681
                     /gene="TDEL0C00990"
                     /locus_tag="TDEL_0C00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680151.1"
                     /db_xref="GeneID:11500323"
     CDS             165162..167681
                     /gene="TDEL0C00990"
                     /locus_tag="TDEL_0C00990"
                     /inference="similar to DNA sequence:INSDC:YFL004W,YPL019C"
                     /note="similar to Saccharomyces cerevisiae VTC2 (YFL004W)
                     and VTC3 (YPL019C); ancestral locus Anc_8.71"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680199.1"
                     /db_xref="GeneID:11500323"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR018966"
                     /db_xref="UniProtKB/TrEMBL:G8ZR46"
                     /translation="MLFGVKLANDVYPPWKESYIDYERLKKLLKEGVIRDRSNGARAK
                     SEDRDFAWNDNDESRFVEALDKELEKVYGFQIKEYNTLLERLSRLESQTNSEESIKNL
                     DADAFQSVLEDLLSEAQELDNFYRLNYTGFVKIVKKHDKLHPKYPSVKSLLEVRLKEL
                     PFHSEELSPLLYRVSFLYNILRSNFSNVSKSLAEAPKLSNVNGSVTGNINFESFKFWV
                     HNDNLMEVKTRILRHLPVLVYASAPTENDDLIDRYEAVDADVAAPSTSSSGENYDNGL
                     RDNKSYDPVITALYFDNERFELYNNKLLKVNSSPTLRLRWMGRLHDKPEIYLEKRMVV
                     EDAESGNTELEETRLQLKPKYISGFIFNGDQKIKAQTLSKLKESGIGENQLTKTANKF
                     DSLQEFVMQEELQPLLRTTYRRTAFQIPGDDRIRVTIDSDILYVREDSFDSDRPIRDP
                     KNWHRTDIDSNVSNPMKFLRNGEYSKFPYSVMEIKVKNNDSQGSSNGSQMSSNRLPRK
                     HGQWISELTNSHLVKEVPKFSLYVQGVASLFGEEEKLDVLPFWLPELDTDIRIDPKQA
                     YEEEKKKMKKQKETQAKIDQMRRLSKISSPGNGDHQQQQQQQQVEQSAQVAPAQREAD
                     LDDHESSDEEDEAQKKRRSRKNKKQRAEATFLRILAGKDSKLTGVDSEDEEISLPPGV
                     QKPTSYIKNAGPVKVEAKVWLANERTFNRWLRVVSLLSILTFSIYNSVKKAEFPQLAE
                     FIAYIFFALTIFTGLWSYWIYIKRLNVIKERSGKHLDAPIGPILVATVVALTLITNFV
                     VAFRESAKNQKNSFSTMSNDELSETLIPIQKFIYRLVGAKE"
     gene            <167919..>169619
                     /gene="TDEL0C01000"
                     /locus_tag="TDEL_0C01000"
                     /db_xref="GeneID:11500324"
     mRNA            <167919..>169619
                     /gene="TDEL0C01000"
                     /locus_tag="TDEL_0C01000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680152.1"
                     /db_xref="GeneID:11500324"
     CDS             167919..169619
                     /gene="TDEL0C01000"
                     /locus_tag="TDEL_0C01000"
                     /inference="similar to DNA sequence:INSDC:YPL020C"
                     /note="similar to Saccharomyces cerevisiae ULP1 (YPL020C);
                     ancestral locus Anc_8.72"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680200.1"
                     /db_xref="GeneID:11500324"
                     /db_xref="GOA:G8ZR47"
                     /db_xref="InterPro:IPR003653"
                     /db_xref="UniProtKB/TrEMBL:G8ZR47"
                     /translation="MSVGAYNTLKTESYFSPSFSPISTYRSSNVPIFSSRRNMSKNGR
                     NVPRKCFSAEEVHSSSEKQSTSHDLRVKGIFDGIASSVYDSGMLIWRKIVGATTTRDE
                     DGQLTKLDGHEAVKKRSNEFDAFQLPRKRRSLKEHQSDETILDITSRAQENDELCTLH
                     FSKDPFNWNDWKTSEIEPREDARQTQQYGTTLIRRSRSPRKLHGNNQLTPRAQSDEVK
                     YLKTIYNGEYQVPKILEDERENQLSLLQRDKDSQLKKTIVDLTQKIKNILVEREGASS
                     ASDDDFMIVSERKVSSLERKRYDFQRRRVNVDRALHQLDIDEEFKTYRQLIEERKHIQ
                     DEVRKKKDGDKGRKLVPDIGQDESNKVKKTLRRSDNGILSNRDNFEVTVRDFKTLTPR
                     RWLNDTVIEFFMKQIEKNSKGIVAFNSFFYTTLSERGYQGVRRWMKRKKAQINDLEKI
                     FVPVNLNQSHWALGMIDISRKRIVYVDSLSNGPNAMSFAILNDLQNYVIEESKNTMDA
                     DFELENLRCPQQPNGFDCGIYLCMNTLYLSQDAPLTFDQHDAVRMRAYIAHLILSKKS
                     "
     gene            complement(<169656..>172274)
                     /gene="TDEL0C01010"
                     /locus_tag="TDEL_0C01010"
                     /db_xref="GeneID:11500325"
     mRNA            complement(<169656..>172274)
                     /gene="TDEL0C01010"
                     /locus_tag="TDEL_0C01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680153.1"
                     /db_xref="GeneID:11500325"
     CDS             complement(169656..172274)
                     /gene="TDEL0C01010"
                     /locus_tag="TDEL_0C01010"
                     /inference="similar to DNA sequence:INSDC:YFL003C"
                     /note="similar to Saccharomyces cerevisiae MSH4 (YFL003C);
                     ancestral locus Anc_8.73"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680201.1"
                     /db_xref="GeneID:11500325"
                     /db_xref="GOA:G8ZR48"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZR48"
                     /translation="MSGSEWSSFLSTKCFDKNTVADISNGTGASNSSVSVALVERASR
                     RESRKSPEVSRTSRRKSRKKLVTSQSRLPTKHHPSRTANTTSGALLVNSPDRVLCSIF
                     EMAKDIGTRIGVCIINYNTGELSISDFMDSQIYIRAIHKIQIHQPTEILLPSSSLNPV
                     VSKLAAIIKFNVSESVKISETTNRNFNSQDGLNAIYKYLMADGQKKMKLDEIADKTFA
                     LSAAAAAVAYTEDIVMNKKNSSLTKFKKFRMTYEATENTMLIDSKTIRGLELVDNVVE
                     KKGLSFFKFLDCTCTKMGQRLLRNSILQPLTDRCSIELRLESVRELRNDPDLLDVLRS
                     ELRGFQDLDRLFAKLLSVNQSAVKSEQKINYSILLKSTIKTAKNIRRLLSEADLTARL
                     LIETKDIFSCEAISKIESYINIYINEDCTWASSNLELENQRSYAVKSGANGLLEISRQ
                     VYKNIIDQIIKHVEDLSKEYSLNLDYAYESNHGFYIKIKRHDMRDLSTLPDVFINRSV
                     KKTRIECTTLDIIKMNARLKEVMSEISLISEQMVEQLLTEVVTEISTLFMISEATSML
                     DLMCCFAHNANKHNYVIPAISDRVVFQNSRHPVLETLVENFVPNEILNTPYSSSVQII
                     TGCNMSGKSVYLRQVVLLCIMAQMGSAVPADYACSKIYSKIHARVCNDSLEICSSNFC
                     YEMKEIAQFLDDTDSSTLVILDELGRGSSIGDGFSISLAVTEYLLSVQCTVFLSTHFQ
                     YIPEILRYKPRVSHFHMKAELENDSSIKMHYQLSQEIKKFENPGLRTVSRIFDPQIIK
                     GAYKICDLLSAQKSTSSGIREDDIDKEAALQNVNQMKQIHNLIEVLYEVMEDSNEVSY
                     QSLKALQEEFIKSFEQ"
     gene            complement(<172271..>173242)
                     /gene="TDEL0C01020"
                     /locus_tag="TDEL_0C01020"
                     /db_xref="GeneID:11500326"
     mRNA            complement(<172271..>173242)
                     /gene="TDEL0C01020"
                     /locus_tag="TDEL_0C01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680154.1"
                     /db_xref="GeneID:11500326"
     CDS             complement(172271..173242)
                     /gene="TDEL0C01020"
                     /locus_tag="TDEL_0C01020"
                     /inference="similar to DNA sequence:INSDC:YPL015C"
                     /note="similar to Saccharomyces cerevisiae HST2 (YPL015C);
                     ancestral locus Anc_8.74"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680202.1"
                     /db_xref="GeneID:11500326"
                     /db_xref="GOA:G8ZR49"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR017328"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:G8ZR49"
                     /translation="MPTMEKASSIKKFADHLKKYPDAKVIFMVGAGISTSCGIPDFRS
                     PKTGLYHNLAKLDLPFAEAVFDVDYFEENPKPFYTLAQELYPGTFQPSRFHNLMKLFE
                     DKKRLQRVYTQNIDTVEHQALISSEYVIEAHGSFASNHCIKCAKKYPLEKFKSKLNPK
                     KSSSKDKKAPEFDYARCDECDGLVKPAIVFFGEGLPSRFFDTWEQDQQWLLDEKDKRH
                     LVMVVGTSLTVYPFASLPQEVPETVLRALINKELVGDFKAYPREKDIIFHGEADLAAE
                     LLAEEMGWLPELQALATEQQETKASEQVDKIVSDLEKLNLDKKTSKE"
     gene            complement(173327..173400)
                     /gene="TDEL0Ctrna4N"
                     /locus_tag="TDEL_0Ctrna4N"
                     /db_xref="GeneID:11500327"
     tRNA            complement(173327..173400)
                     /gene="TDEL0Ctrna4N"
                     /locus_tag="TDEL_0Ctrna4N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:11500327"
     gene            complement(<173571..>174584)
                     /gene="TDEL0C01030"
                     /locus_tag="TDEL_0C01030"
                     /db_xref="GeneID:11502018"
     mRNA            complement(<173571..>174584)
                     /gene="TDEL0C01030"
                     /locus_tag="TDEL_0C01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680155.1"
                     /db_xref="GeneID:11502018"
     CDS             complement(173571..174584)
                     /gene="TDEL0C01030"
                     /locus_tag="TDEL_0C01030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680203.1"
                     /db_xref="GeneID:11502018"
                     /db_xref="GOA:G8ZR50"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZR50"
                     /translation="MTEPAPSFSRLSTYSGIWQGIYPGKPAYLPQQYPDLTGKTAIVT
                     GANTGIGFEVVKLLYEKNCNVIAVVRTESKGLEAREKILADVKSKGTIGVIGGCDFMD
                     LNTIKSAATKIINVLGDNSLNIIIHNAGLMAPNSDGTSEQGYEAMFSSNVLGPQLLQH
                     FLDDAFLKKDGDLKRIVWVSSCTHLMAFREYGINWENPTFKDVPIEKRPDHQTLYGQS
                     KAANILQAKAWATKKADMVTDIGCVSVSCFPGILRTQLTRGWGSLTKRMISWMGYDSV
                     YGAYSELFAALSPKLTTNDQGAYIIPFGQVGEPRTDVKAGLTNGTDLKMWDMVEDMIK
                     PFF"
     gene            <175089..>178139
                     /gene="TDEL0C01040"
                     /locus_tag="TDEL_0C01040"
                     /db_xref="GeneID:11500328"
     mRNA            <175089..>178139
                     /gene="TDEL0C01040"
                     /locus_tag="TDEL_0C01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680156.1"
                     /db_xref="GeneID:11500328"
     CDS             175089..178139
                     /gene="TDEL0C01040"
                     /locus_tag="TDEL_0C01040"
                     /inference="similar to DNA sequence:INSDC:YPL009C"
                     /note="similar to Saccharomyces cerevisiae YPL009C;
                     ancestral locus Anc_8.75"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680204.1"
                     /db_xref="GeneID:11500328"
                     /db_xref="InterPro:IPR008532"
                     /db_xref="InterPro:IPR021846"
                     /db_xref="UniProtKB/TrEMBL:G8ZR51"
                     /translation="MKQRISALDIQILAEELRAHLEGHRLSNIYNIADSSRQFLLKFN
                     KPDSKFSVVVDCGLRIHLTDYDRPIPPGPSSFVVKLRKHLKSKRLSALRQVKNDRILV
                     LQFADGLFYLVLEFFSAGNVILLDENKKILSLQRIVHEHENKVGETYTMFDDSLFNVN
                     NSSQSADQTIKSKSYDVELVRVWLEEAQSKFSLQSSMQADAMKVKQSSKKKALKPLTI
                     HKLLLSKEPHLSSDLLSKNLKMRKINPSSPCIEFLAKEDVLVDLLNYTEIEYHDVLSN
                     KDSRGFILAKKNVNYTLGKDSEDLEFIFENFHPFKPFIEEQDQGRSRITEVPGEYNKT
                     LDTFFSTIESSKYALRIQQQEQLAKKKIEDARLENQKRIQALLDVQSSNEQKGHAIIA
                     NADLVEEAKIAVQGLIDQQMDWQTIEKLIRNEQLKKNKIAMVIDLPLNLKENAVNILV
                     PVSHDDEHNNESESDESFVESSSDESDSDEGTDSDDSEVSDFETEESRNESRTSKRKV
                     ENKLKIRIDLGLSAYANASKYFTVKKTSADKQKKVEKNVEKAMKNIEQRIDKQLKQKL
                     KESHSVLKRARSPYFFEKHFWFYSSEGFLVLMGRSPLETDQIYSKYIEDDDIYMCSSF
                     DTQVWIKNPNRTEVPPNTLMQAGVFCMAASEAWSKKVSSSPQWCFAKNITKFDHTNKG
                     VLDPGLYRIKKESEMSHLPPAQLVMGFGFLWKVANKNGDNEEAEEPVSEGGDDEEAGE
                     PVREGDDEREEEEEHITEEIAFVNEQDPKEATGESEQAAEISQKFNDMEIEISHNAGP
                     ESNAGLTDATSVLPQINKGVRGKKGKLKKMQKKYADQDEDERLMRLEALGTLKGLEKT
                     QLKEQEELARQQNRDYKKARREKQKELQTLRFTKNEKIKVNYQKIASELKSNPDKDDE
                     VVDAIPVFAPWPALLKYKYKVKVQPGSAKKTKTLNDILHYFCNRTVDSTMTDKEADWP
                     REHEAITQLKPQDLVLTICSDKLKVTLPGQASSGKGKPKQKKKK"
     gene            complement(<178209..>178778)
                     /gene="TDEL0C01050"
                     /locus_tag="TDEL_0C01050"
                     /db_xref="GeneID:11500329"
     mRNA            complement(<178209..>178778)
                     /gene="TDEL0C01050"
                     /locus_tag="TDEL_0C01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680157.1"
                     /db_xref="GeneID:11500329"
     CDS             complement(178209..178778)
                     /gene="TDEL0C01050"
                     /locus_tag="TDEL_0C01050"
                     /inference="similar to DNA sequence:INSDC:YPL010W"
                     /note="similar to Saccharomyces cerevisiae RET3 (YPL010W);
                     ancestral locus Anc_8.76"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680205.1"
                     /db_xref="GeneID:11500329"
                     /db_xref="GOA:G8ZR52"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="UniProtKB/TrEMBL:G8ZR52"
                     /translation="MSSLSLYSVQAVLILDNKGDRIHAKYYQSPHVAEDARKGLMQNV
                     KRQKEFEKRLFQKTHKQDSEIMVFEDRLVFYREYLDVTLCLIGSMDENEIVLQQAFTA
                     FKDSLDLILNSGIDKRNIQEHYDMVLLAIDETVDNGIILETDPATIASRVTKPPTNEP
                     QMSLDLDKGLLGAWGFAKSKLQERLQQGM"
     gene            <179005..>180072
                     /gene="TDEL0C01060"
                     /locus_tag="TDEL_0C01060"
                     /db_xref="GeneID:11500330"
     mRNA            <179005..>180072
                     /gene="TDEL0C01060"
                     /locus_tag="TDEL_0C01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680158.1"
                     /db_xref="GeneID:11500330"
     CDS             179005..180072
                     /gene="TDEL0C01060"
                     /locus_tag="TDEL_0C01060"
                     /inference="similar to DNA sequence:INSDC:YPL011C"
                     /note="similar to Saccharomyces cerevisiae TAF3 (YPL011C);
                     ancestral locus Anc_8.77"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680206.1"
                     /db_xref="GeneID:11500330"
                     /db_xref="InterPro:IPR006565"
                     /db_xref="UniProtKB/TrEMBL:G8ZR53"
                     /translation="MGSSSDFYFGLLRVSMIQLLKSHGFDRARPTTVDVLTDLYIKYF
                     ALLTEEIVRSAQSRKDWDETVALQDITLALQNLGVVKPMDVLDVYDENPNLPSDRGMQ
                     KFKNWCVNDRQPADARTVALPTGDLLRSSSKPAKPLSLIPEYINQLQHESQRDSKGSE
                     DDKLIEELINNGDVDDWIRLVFARQRINYARRISGKEPHNIQALPSISGLKHSVLERP
                     NDINLSNNQVLPNSWEPSDDEDNEASRKATELLQRLPAMRPEWKLDNVSLSYDQGLIN
                     EDAQDENNNEENMHISAIDDVPTTLASDENLESPSSSNFILDIDADTQFAEMEDMDNT
                     FQRRESLDFGGASQDFDFNGF"
     gene            complement(<180176..>183835)
                     /gene="TDEL0C01070"
                     /locus_tag="TDEL_0C01070"
                     /db_xref="GeneID:11500331"
     mRNA            complement(<180176..>183835)
                     /gene="TDEL0C01070"
                     /locus_tag="TDEL_0C01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680159.1"
                     /db_xref="GeneID:11500331"
     CDS             complement(180176..183835)
                     /gene="TDEL0C01070"
                     /locus_tag="TDEL_0C01070"
                     /inference="similar to DNA sequence:INSDC:YPL012W"
                     /note="similar to Saccharomyces cerevisiae RRP12
                     (YPL012W); ancestral locus Anc_8.78"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680207.1"
                     /db_xref="GeneID:11500331"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012978"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZR54"
                     /translation="MDADQVAGWLELEEKLAKIRQQIGSKLENQKHVAIILSAVEENI
                     DQSQEKEISENIVKYLVALMSLLDQAVVAETGEIGNLQLAISSCYLLDVIFQYAPKML
                     LRSKFAEILTKVAPFITDAEAEAPLVRPAIGCLTSLLIAQDAQAWNNTQDLSITPERG
                     LQGLLELSLDPRPKVRKRAVDGVNTILQNPPAAPTAGHVASVQIAMFAANHLREALEE
                     ASTLSNKKMKAQNGGSDDLNSRMIRILRLINAIVSTGEWPSQQIEGLCDLLLAVTKSS
                     DQYLVTAAFDCFEKLFKVISELSANSNLAEDKQVRLLDVIFALTPSNSDVNVVGSWIA
                     VLVKGLSAYATHQPLQCLTRIPGVFKLMSQYLASETPEVYYSASQCLVAILADAVKDE
                     VLLYPPAVDETTFETVDQVLADISESLVELLSVRYSHCAKEVLTVLASAIAKFRYRSN
                     PDFIKPLEIVGEWRTNEESYLEFRSEAEGVIGAAISAMGPDTVLSALPLNLEQPSDNK
                     PGRAWLLPLIRDYTRNTEMSTFTKQLIPVIQAFEARCGTLSKESVQLKIFQTVIDQLW
                     STLPHFCELPTDLETSFTDELATELSSLLYQKVELRTTICHAFRVLVESNLAYINGAL
                     ADDILLQQHFSVARAQETLTYLKGKAANLLAVLFNVYTQTAPNARGYILETIEAYLKI
                     ASAEDLEKTFNNVCALLKNAMEEETDKSTKGKPQLSATLLDLVVCMSKYLPTSSYPAL
                     FSIFGITVSSKDALTQKRAYRIIIRLSEPDTGVEALSSYVADIEKIILDNSETVQTSS
                     KSARLAAIRAVIELLPPNHLDFIVRMVAEVILATKDVNEKSREAGFETLIAMGKKMND
                     PNGIIMLSKVPGYDEQTPDQPSSISEFFKIMAAGLIGESQHMVSSTITAFACLVFEFK
                     DQLDIAVLLDIYDTIELYLTSNSREIAKSAIGFAKVCVLGLPDELMRPKVPSLIVKLL
                     RWSHEHTGHFKAKVKHIIERLIRKYGYEFVEANFPEDDLKLLTNIRKTRNRNKRKEGD
                     ADETTRAASSTKSSRFMNAFDEAIYQSDREDEGDEEADQDKGKSQAKQFIVESGENPL
                     DLLDSQTLAHISSTRPKKFTKDQKRRMLQDDMFNFDAEGKLIMKGTGKSSNNEEDPLK
                     SVTSGINAYLDAVKNGPIRGQKNRLKFKKRSRAGADQSDDEEDVVKDKPKRAIGNRIG
                     KNTKKGPKFKSKRKL"
     gene            <184059..>184418
                     /gene="TDEL0C01080"
                     /locus_tag="TDEL_0C01080"
                     /db_xref="GeneID:11500332"
     mRNA            <184059..>184418
                     /gene="TDEL0C01080"
                     /locus_tag="TDEL_0C01080"
                     /product="mitochondrial 37S ribosomal protein MRPS16"
                     /transcript_id="XM_003680160.1"
                     /db_xref="GeneID:11500332"
     CDS             184059..184418
                     /gene="TDEL0C01080"
                     /locus_tag="TDEL_0C01080"
                     /inference="similar to DNA sequence:INSDC:YPL013C"
                     /note="similar to Saccharomyces cerevisiae MRPS16
                     (YPL013C); ancestral locus Anc_8.79"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS16"
                     /protein_id="XP_003680208.1"
                     /db_xref="GeneID:11500332"
                     /db_xref="GOA:G8ZR55"
                     /db_xref="InterPro:IPR000307"
                     /db_xref="InterPro:IPR020592"
                     /db_xref="InterPro:IPR023803"
                     /db_xref="UniProtKB/TrEMBL:G8ZR55"
                     /translation="MAIGLVRIRLARFGRTNSPVYNIVVANAQKARDAKPIEVLGTYN
                     PIPRPRTVKQKKQGVLATKDVQLDFDRAKYWIGVGAQPSEMVTKLLKKCGILDESWGK
                     TFATSRKVVTPRQEVIE"
     gene            complement(<184500..>185612)
                     /gene="TDEL0C01090"
                     /locus_tag="TDEL_0C01090"
                     /db_xref="GeneID:11500333"
     mRNA            complement(<184500..>185612)
                     /gene="TDEL0C01090"
                     /locus_tag="TDEL_0C01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680161.1"
                     /db_xref="GeneID:11500333"
     CDS             complement(184500..185612)
                     /gene="TDEL0C01090"
                     /locus_tag="TDEL_0C01090"
                     /inference="similar to DNA sequence:INSDC:YPL014W"
                     /note="similar to Saccharomyces cerevisiae YPL014W;
                     ancestral locus Anc_8.80"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680209.1"
                     /db_xref="GeneID:11500333"
                     /db_xref="UniProtKB/TrEMBL:G8ZR56"
                     /translation="MLLDRFHRKFYHSRHRSSGNAVNQDDGSKDEDEDVLMDVEVQQP
                     VPMSICGQGCRFEETGEMVYVDPGVQTPVATTPVGYGGRQDVPDGLTGPFPPYLQMQD
                     RQNSVSSLASSISDFHGGLRQQAFANAAVSGSGNFTPQFMALLMEVYQNVYCDPTVTP
                     FDTTNPPSAILNRTAKIALEQCKIREVEIGCERNSWLLTLVRRRLLEEVRKDGYLSRT
                     NSNVSLPPPPPQFMEMMYNSTFQSSKPSTPDCSTKGSQDYFGNMLTTNNRSGLMRSRS
                     NSSQVLLARTRSNSNGLFALTPTSSETGLAPGFNGTGLTININHTNLLSRQRSNTATG
                     SPATTPVTACCNQSQMDESVFSETLRKKRDALRLKR"
     gene            <186170..>188617
                     /gene="TDEL0C01100"
                     /locus_tag="TDEL_0C01100"
                     /db_xref="GeneID:11500334"
     mRNA            <186170..>188617
                     /gene="TDEL0C01100"
                     /locus_tag="TDEL_0C01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680162.1"
                     /db_xref="GeneID:11500334"
     CDS             186170..188617
                     /gene="TDEL0C01100"
                     /locus_tag="TDEL_0C01100"
                     /inference="similar to DNA sequence:INSDC:YPL008W"
                     /note="similar to Saccharomyces cerevisiae CHL1 (YPL008W);
                     ancestral locus Anc_8.81"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680210.1"
                     /db_xref="GeneID:11500334"
                     /db_xref="GOA:G8ZR57"
                     /db_xref="InterPro:IPR006554"
                     /db_xref="InterPro:IPR006555"
                     /db_xref="InterPro:IPR010614"
                     /db_xref="InterPro:IPR013020"
                     /db_xref="InterPro:IPR014013"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZR57"
                     /translation="MGKESFNHPYEPYGIQLELMQCIYDTLSLGKKLAILESPTGTGK
                     TLSLICSVVTWLRQNKADLVASGGHNVGGLSGSESDDDEPDWVNDAFKTSVLDAKMQK
                     LREYEVYLGQLGVGSKPTSLEAANEPRKRRKRVEVSLDESDFLPQAYVSDSEEKDELV
                     GERNRSLLAQEVSGLLAKLDHSKGSERDPIESQNPVKIYYASRTHSQLNQFASQLRLP
                     SFPSSFADQQVPAERLKYVPLASRKQLCINENVKKWKTVDAINDACADLLKSKKGCPY
                     HQPSSTSSNLFRDHTFTQVQDIEELAELGRSLHICPYYATRGSLENAEIITLPYQYLL
                     SESTRTSLGINLKDSIVVIDEAHNLIETINSIHSAQIALTDLLSCNEGLRKYFERFRN
                     RLNPGNRVNLMKLMELCNTLARYIKINYKKPGQEISSSDIFGSSNMDTLNIHKLNKYI
                     KKSKIASKIDTYIHSFEDEKNASEVKSSSTPLLFKVASFLSCLSNPAQEGRFFFEKGQ
                     VIKYMLLEPGKSFQSVLEDARCVILAGGTMQPISDLMENLFAGVPEEKISILSCDHVI
                     PDANLRTYITQEPAFEFTFEKRQAPSLVNGALYNFFDKLSRSVPRSGGIVGFFPSYQY
                     LDYVVDSWQREGLFDKLDHVRKIYFESKNGAEPLSAYSEAVAGGKGALLFAVVGGKLS
                     EGINFQDDLCRAVVIAGLPFPNVFSGELLIKTRHLETKILRNGGSNHDAKNAAREFYE
                     TICMKAVNQSIGRAIRHANDYSLIFLLDKRYAKLEINSKLSKWVSKRLQPQSSVTDIM
                     ADTQRFFSLHSARQSGR"
     gene            complement(<188642..>190381)
                     /gene="TDEL0C01110"
                     /locus_tag="TDEL_0C01110"
                     /db_xref="GeneID:11500335"
     mRNA            complement(<188642..>190381)
                     /gene="TDEL0C01110"
                     /locus_tag="TDEL_0C01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680163.1"
                     /db_xref="GeneID:11500335"
     CDS             complement(188642..190381)
                     /gene="TDEL0C01110"
                     /locus_tag="TDEL_0C01110"
                     /inference="similar to DNA sequence:INSDC:YPL007C"
                     /note="similar to Saccharomyces cerevisiae TFC8 (YPL007C);
                     ancestral locus Anc_8.82"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680211.1"
                     /db_xref="GeneID:11500335"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR024764"
                     /db_xref="UniProtKB/TrEMBL:G8ZR58"
                     /translation="MKLLKDLVITRKELQGWEKNLVWARDGTLYITSYPDICIGQPTY
                     RKEVGNNSKHLFHIKEYPLIFENKFEFDSTARNTLLSSQPVSFARLVRPSPCDSLLAV
                     LNSNLNVHVYREQKLVCNLDESEKHLEQRSYHCMEWSPDGSCLAIGNESGEVTVYAIQ
                     RANDGSVSFAPKRTFVLNSGLPSPWVTHICWKGDEIVAFLDDNSIYLIDDRQVESVKQ
                     AKNSSRFKIVDYCVMGDFLLFTDSCQFNKLNLKSGELSSLTLGPGDEVSIVPLQKAKK
                     VILISNKTSCQVQIDRDFTLIPDDIIAPHLERKFRRWSAVNNELNKYESSLLIYGISL
                     SPDGYSVAINYSMERVCMKYKIASEHQMYITFIPLYESWSITKKATGLAWYQTYKIYQ
                     SLLPSFESQNREDTHARCDIHMPLELYIQTFLSSTEMNNLRFFNLIEEHPSIKPFRKA
                     IFDYAVARSPELTNAIDKASVQSLAAILGFPSPVEAGIVELRSQFITETFNFEKNGAQ
                     EPIISEQQHAWKRCAVTLLPILTTKVKVCPISNQRIIDIRADTLNDYGWFTRTLLEVL
                     KDESVYSGTTMTL"
     gene            <190593..>194114
                     /gene="TDEL0C01120"
                     /locus_tag="TDEL_0C01120"
                     /db_xref="GeneID:11500336"
     mRNA            <190593..>194114
                     /gene="TDEL0C01120"
                     /locus_tag="TDEL_0C01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680164.1"
                     /db_xref="GeneID:11500336"
     CDS             190593..194114
                     /gene="TDEL0C01120"
                     /locus_tag="TDEL_0C01120"
                     /inference="similar to DNA sequence:INSDC:YPL006W"
                     /note="similar to Saccharomyces cerevisiae NCR1 (YPL006W);
                     ancestral locus Anc_8.83"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680212.1"
                     /db_xref="GeneID:11500336"
                     /db_xref="GOA:G8ZR59"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR003392"
                     /db_xref="UniProtKB/TrEMBL:G8ZR59"
                     /translation="MLLITLLVCVAGLCNLVQAAASRCALYDNCGKKSVFGAELPCPV
                     SDSRFRPPPVTDELMDLVVEVCGEEWKDETELCCTLDQVQNLQKNLKKAQNIIASCPA
                     CVKNFNNLFCHFTCSPEQVDFVNVTRIQKSTSKKDIVAEVDVYMNSSWASVFYDSCKD
                     VKFSATNGYAMDLIGGGAKNYSQFLKFLGDEKPLLGGSPFQINYLYELDGAKDDFILF
                     DDSVYECNDPKYKCACADCGLSCPELKPLKEGSCKVGKLPCFSFAVLMIYAVLIVAVV
                     IWHIHLFRSKSRISLITSDEDGSAYNSQMTSDDRLFDTYDTSSYDFNNKVATSFATLS
                     KYSALNPYLTTALTAVIVAFFGFLLYRYGDLEREPINLWVSKDSQKYQEKRYFDENFG
                     PFYRVEQVFVVNETGPVLSYDTMRWWSEVEHNISQTIMSQDNATYQDLCFRPTAESTC
                     VLESFIQYFPNGLPGQNTWREELQLCTDSPVNCLPSFQQPLKKNLLFSDDEVFESNAF
                     VTTFLMSNHSSTAVDWETELEKFLLNLEVPKGLRISFNTEMSLEKELNKNNDVLTICM
                     SYLFMFFYASWALKRHGGGSRWLLGFVGILIVASSVLCAAGLLSALGIKSTLIIAEVI
                     PFLILAVGIDNIFLITHEYDRLSTDDVTIDIDRRIYLAVKRICPSILLSFICQAGCFL
                     IAAFVSMPAVRNFALYSALAVLFNVLLQMTAYVAFLALYERKYATISKDSEKDVHLFG
                     DSYFSFISKKGKILGLFVSWTMISLLFLPEIQLGLNQTFAVPQTSYLVDYFRDAYQYL
                     NVGPPVYFVVKGLDLTKRENQQKVCGKFTTCDDDSLANVLEMERERSTIIDPLANWFD
                     DYMQFLNPDLDECCRFKKGTSDVCPPFFPSRRCETCFHEGEWNYDMSGFPEGKEFMDY
                     LAIWIDSPSDPCPLGGKAPYSSSVAFNKTGVKASVFRTAHKPLTSQEDLIAAYDDSVR
                     ISNSLKDLDVFAYSPFYIFFVQYQTILWLTISLIGAALVLIFAATTLFLGSVQTAAAL
                     TLTVLMILIDIGAFMAWFGISLNAVSLVNLVICVGLAVEFCVHIARAFTLLPEGVKND
                     RDSRVHYAMTTVGGSVFRGITMTKFIGVCVLAFAQSKIFQVFYFRMWFSLIVIASVHA
                     LVFLPVLLSLAGGKSYVDEPISGTLEE"
     gene            <194297..>196159
                     /gene="TDEL0C01130"
                     /locus_tag="TDEL_0C01130"
                     /db_xref="GeneID:11500337"
     mRNA            <194297..>196159
                     /gene="TDEL0C01130"
                     /locus_tag="TDEL_0C01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680165.1"
                     /db_xref="GeneID:11500337"
     CDS             194297..196159
                     /gene="TDEL0C01130"
                     /locus_tag="TDEL_0C01130"
                     /inference="similar to DNA sequence:INSDC:YPL005W"
                     /note="similar to Saccharomyces cerevisiae AEP3 (YPL005W);
                     ancestral locus Anc_8.84"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680213.1"
                     /db_xref="GeneID:11500337"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:G8ZR60"
                     /translation="MNVLATLSQVLSRNGIKSPRLRHEKFMLSMFETATKPDKPKTVE
                     GVIEKARNSLKKVKDRKKCIPKDNMKVVGKGSNFQKKVVKEYLSPLQVHDFARHNIQN
                     DYDNKKATRMHQNAKLIDKSKNRQEILFSNSRQFVGDLLGALVACNPKHVELSSDFVL
                     RQFPRWTMNEVPRIPNFNSNPHLFEDYIGILTHTKFLYKNSSSTNGIVPMILRNLMHP
                     ANLKTLYLRTTRTYNDLIYYFCERFDFASCREIFAQMKIEGVPRNTLTYNLMLRSVLK
                     NSHIRKSKPIDGEVLYYLRNMAKNQIEADAVTWTTCYNFLNENVSRSIYVEKMQERNV
                     PVTEAFVYTVLRNGTYSSKQCLQFLASNNVPLSSKIFKLSIDRLLQEERANVAWLFLE
                     HTVLKRDKDFTIGTDTLNAFLRHFASRGRLDMAITTFNTCVQDYHMRPNDQTFEMLFK
                     ALTTNGYTKNFALILDYFRKLRKAHKLGERNNYWLVRANAISKFNVRRLDTFTKEKFN
                     EAKALLDGLKWSSTSGGFTTKIWKGNGSSIRKICRLLGCVPTPLKKGSTVKVNAAART
                     KKKRYRKRIRCIAIQSAMRKRVPFAKDWYGSLRQELELRKVIDTSEQVDHGSTS"
     gene            complement(<196259..>197224)
                     /gene="TDEL0C01140"
                     /locus_tag="TDEL_0C01140"
                     /db_xref="GeneID:11500338"
     mRNA            complement(<196259..>197224)
                     /gene="TDEL0C01140"
                     /locus_tag="TDEL_0C01140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680166.1"
                     /db_xref="GeneID:11500338"
     CDS             complement(196259..197224)
                     /gene="TDEL0C01140"
                     /locus_tag="TDEL_0C01140"
                     /inference="similar to DNA sequence:INSDC:YPL004C"
                     /note="similar to Saccharomyces cerevisiae LSP1 (YPL004C);
                     ancestral locus Anc_8.85"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680214.1"
                     /db_xref="GeneID:11500338"
                     /db_xref="InterPro:IPR028245"
                     /db_xref="UniProtKB/TrEMBL:G8ZR61"
                     /translation="MHRTYSLRNSRAPTASQMVSPPPPPSSTKSKFFGKASIATSFRK
                     NAAGNFGPELARKLSQLVTTEKGVLRSMEVVANERRAAARQLSLWGVDNDDDVSDVTD
                     KLGVLIYELGELQDQFIDKYDQYRVTLKSIRNIEASVQPSRDRKEKITDEIAHLKYKD
                     PQSAKIPVLEQELVRAEAESLVAEAQLSNITREKMKAAFNYQFDSIRELAEKFALIAG
                     YGKALLELLDDSPVTPGETRAAYDGYEASRQIIMDAEVALESWTLDIAAVKPTLSFHQ
                     TVDDVYDEDEDQHDEIAGEGDEWANEAEVSEETGLPAHSQHSTAA"
     gene            <197471..>198778
                     /gene="TDEL0C01150"
                     /locus_tag="TDEL_0C01150"
                     /db_xref="GeneID:11500339"
     mRNA            <197471..>198778
                     /gene="TDEL0C01150"
                     /locus_tag="TDEL_0C01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680167.1"
                     /db_xref="GeneID:11500339"
     CDS             197471..198778
                     /gene="TDEL0C01150"
                     /locus_tag="TDEL_0C01150"
                     /inference="similar to DNA sequence:INSDC:YPL003W"
                     /note="similar to Saccharomyces cerevisiae ULA1 (YPL003W);
                     ancestral locus Anc_8.86"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680215.1"
                     /db_xref="GeneID:11500339"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZR62"
                     /translation="MERYDRQIRIWGAKAQEVLEDAKVAIFAKNYGEPLVQEVVKNLG
                     LANVGSIILVLKEVHDEGLTENNGFFLSISSMLMGISTDVEVTDWNTFVNKGLPVSIV
                     VTLNLEDPKDIQYISQLRREPLISANVKNEDGIVQLIKLPEPHIIMDTHPDYLVPYLW
                     IDRPWPELKRFYESFDMSQLAENGQLAKVPYPVILYHIVKDRPDGDTWDSNDVKQKID
                     EKFPNQRDYLNVIEARRFAHLALRTAENDCRQLHEMLDCVCSEMVGKTKWFDLYNHTL
                     AILCLCLKQLLSSSSFCLPSAKDLPDMESSTDIYSRFRSIYQAKEDEDVETFSKLLRT
                     RPESEDISDSTAREFLSSLRRLGVLSCKKYNGEYRIPDPKGPINSPIVVNLAKVSERP
                     TACNYFHASCFIGGLVSQEIIKLITHQHVPIDDVYTYSPDQLR"
     gene            complement(<198802..>200613)
                     /gene="TDEL0C01160"
                     /locus_tag="TDEL_0C01160"
                     /db_xref="GeneID:11500340"
     mRNA            complement(<198802..>200613)
                     /gene="TDEL0C01160"
                     /locus_tag="TDEL_0C01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680168.1"
                     /db_xref="GeneID:11500340"
     CDS             complement(198802..200613)
                     /gene="TDEL0C01160"
                     /locus_tag="TDEL_0C01160"
                     /inference="similar to DNA sequence:INSDC:YFL002C"
                     /note="similar to Saccharomyces cerevisiae SPB4 (YFL002C);
                     ancestral locus Anc_8.87"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680216.1"
                     /db_xref="GeneID:11500340"
                     /db_xref="GOA:G8ZR63"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZR63"
                     /translation="MAESLSWEQLNYPVQDWIQRAIEVLGFDAMTPVQASTIPLFSRN
                     KDVVVESVTGSGKTVAFVVPILERIISDGANSTAFKKGHFHSLIVTPTRELSNQIQSV
                     IQSFLDHYPGDSYPIKSQLLVGTSQKTVRDDVTKFLEERPQILVGTPGRVLDFLQMPS
                     VKTLSCNMVVLDEADRLLDSDFFKDVEKILRTLPKQRRTGLFSATISEAGNQIFKTGL
                     RNPVKVTVNSSKKGPASLGLFYTVIDPQEKLLQLINILNNYKFKKCIAYFPTCISVTF
                     FYSFLQYLQREKKLLSDEVMVYSLHGKLQTASRMKTLENFTDTVNKAVLLTTDVAARG
                     IDISDVDLVVQLDPPTDTSVLLHRCGRTGRANRIGKAITFINEGREEDLIPFLEVKDV
                     HLQKMTLKKDELLKEGIYEVFKEWILQDRARFDLSVRSYVAFIKYYSKHSASSIFRLQ
                     SLDYVGLAKMYGLFRLPRMPEITKYFKSDTIKDGWLVDQPIDMDRFAYKDKKHEAARL
                     EKLKDLENIKDKKKLKFELKKKNMAWSNKTESKETKAERKMKVELKRKAIEEQIEKEE
                     GNARDEVTEDWKDIVLKNKKRKQMQSSGGMQGSFDDL"
     gene            <200995..>202308
                     /gene="TDEL0C01170"
                     /locus_tag="TDEL_0C01170"
                     /db_xref="GeneID:11500341"
     mRNA            <200995..>202308
                     /gene="TDEL0C01170"
                     /locus_tag="TDEL_0C01170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680169.1"
                     /db_xref="GeneID:11500341"
     CDS             200995..202308
                     /gene="TDEL0C01170"
                     /locus_tag="TDEL_0C01170"
                     /inference="similar to DNA sequence:INSDC:YFL001W"
                     /note="similar to Saccharomyces cerevisiae DEG1 (YFL001W);
                     ancestral locus Anc_8.88"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680217.1"
                     /db_xref="GeneID:11500341"
                     /db_xref="GOA:G8ZR64"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020094"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:G8ZR64"
                     /translation="MSFWQRLMRAVEKPFRTKQSMPIAESSKYADWSKEQLVERLLQL
                     ENEITYQPGKLKPSLASSETKASKNRKPSREFDFSKYSRRFIALKFAYLGWNYNGLAV
                     QKEPTPLPTVEGVIIEALNKCKLVPSLDPHDFRFSRCGRTDKGVSAMSQVISLFVRSN
                     LSEEEQSDPKNDSKEIQYVNILNQLLPEDIRVSAVSLRPPKGFDARFSCQYRHYRYLF
                     HKDGLDVGRMDQAAALFKGEHDFRNFCKLDGSKQITNYARNIISAKIIPLSGDFYCFD
                     LIGSAFLWHQVRCMMANLFLVGQGLENVSLISDMLDVDKTPRKPIYDMASDIPLILYD
                     CKFPDIEWVETNVDDYKAIKYGKAVSALTLSYHLKATVAQIFKEVLPSTATELSGKTR
                     INLGDGKGKVVTSYEKMLKRNVMETAEVVNEKFRHRKRTKFEAQN"
     gene            complement(<202833..>203537)
                     /gene="TDEL0C01180"
                     /locus_tag="TDEL_0C01180"
                     /db_xref="GeneID:11500342"
     mRNA            complement(<202833..>203537)
                     /gene="TDEL0C01180"
                     /locus_tag="TDEL_0C01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680170.1"
                     /db_xref="GeneID:11500342"
     CDS             complement(202833..203537)
                     /gene="TDEL0C01180"
                     /locus_tag="TDEL_0C01180"
                     /inference="similar to DNA sequence:INSDC:YPL002C"
                     /note="similar to Saccharomyces cerevisiae SNF8 (YPL002C);
                     ancestral locus Anc_8.89"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680218.1"
                     /db_xref="GeneID:11500342"
                     /db_xref="InterPro:IPR007286"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016689"
                     /db_xref="UniProtKB/TrEMBL:G8ZR65"
                     /translation="MKRYGLAAFDGKQKNERYQGTSTAVLDRQSIELDEQLAVFQERL
                     LQFAKKHNSEIKANPEFRSKFMRMCTSIGIDPLSLFDKNEHLFNLNDFYYEVCVKIVE
                     ICRQTKDMNGGIVSFDELEKGFFKGLNVTIADLEKSIDMLKSLDGGFDVFEIRGKKFL
                     RSIPNELTGDQTKILEICSILGYASISLLRANLDWKPVRSRAVLNEMVANGLLWIDEQ
                     ADAETLYWDPSWITMK"
     gene            <203792..>204961
                     /gene="TDEL0C01190"
                     /locus_tag="TDEL_0C01190"
                     /db_xref="GeneID:11500343"
     mRNA            <203792..>204961
                     /gene="TDEL0C01190"
                     /locus_tag="TDEL_0C01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680171.1"
                     /db_xref="GeneID:11500343"
     CDS             203792..204961
                     /gene="TDEL0C01190"
                     /locus_tag="TDEL_0C01190"
                     /inference="similar to DNA sequence:INSDC:YPL001W"
                     /note="similar to Saccharomyces cerevisiae HAT1 (YPL001W);
                     ancestral locus Anc_8.90"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680219.1"
                     /db_xref="GeneID:11500343"
                     /db_xref="GOA:G8ZR66"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR013523"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR017380"
                     /db_xref="InterPro:IPR019467"
                     /db_xref="UniProtKB/TrEMBL:G8ZR66"
                     /translation="MSITDFQPAVWTTSSNNALKVSLVSDNAIQFSPTFTYPIYGESE
                     QIFGFQDLLIHLAFDSVTFRPFVNVKYGAKLDEEADDVEGKLLSFLPKDDVVIKDESE
                     WIDGFQKEQEGYKLPSSKFEIGRYKHDGDQFVIFKMSIAEDFTKKLHRRVQIFSLLFI
                     EAASYIDEEDPNWEIFWLFNERTKQCAGYVSTYKLWRYLGSDDFDSSADLKYRARISQ
                     FIIFPPYQGKGHGSHLYSAIFSHWLADDSVTEITVEDPNESFDDLRDRNDLEKLYELK
                     VFSQVPRAGEITSHWIEETRVQLKIEKRQFNRLIEMILAYSNAKNFRIQVKRRLYIKN
                     YDALFDMPDSERKDALQKSFLLLADDYKRIISLCRFNKRPANRSDEETPSKKIKN"
     gene            <205482..>206081
                     /gene="TDEL0C01200"
                     /locus_tag="TDEL_0C01200"
                     /db_xref="GeneID:11500344"
     mRNA            <205482..>206081
                     /gene="TDEL0C01200"
                     /locus_tag="TDEL_0C01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680172.1"
                     /db_xref="GeneID:11500344"
     CDS             205482..206081
                     /gene="TDEL0C01200"
                     /locus_tag="TDEL_0C01200"
                     /inference="similar to DNA sequence:INSDC:YFR001W"
                     /note="similar to Saccharomyces cerevisiae LOC1 (YFR001W);
                     ancestral locus Anc_8.91"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680220.1"
                     /db_xref="GeneID:11500344"
                     /db_xref="UniProtKB/TrEMBL:G8ZR67"
                     /translation="MSPPKRSKNQNQKREVVPEVFQDSQARNQLANAPQLTEKSRVRK
                     ASRTAVSKEQAKVRLYGKKKDRKYDEKELDIPSLNRAIIPGVKIKKGKKGKKLMDDHD
                     SLKLNRLIKTIGDKYDDLDESKLEKSRRLEEIRDLKRQEIEKKEAEKKEVLEDKKDEI
                     KRKASVARSMRRKQKRDSSRTFENKPVEKSKTKKSVSFA"
     gene            <206571..>208016
                     /gene="TDEL0C01210"
                     /locus_tag="TDEL_0C01210"
                     /db_xref="GeneID:11500345"
     mRNA            <206571..>208016
                     /gene="TDEL0C01210"
                     /locus_tag="TDEL_0C01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680173.1"
                     /db_xref="GeneID:11500345"
     CDS             206571..208016
                     /gene="TDEL0C01210"
                     /locus_tag="TDEL_0C01210"
                     /inference="similar to DNA sequence:INSDC:YPR001W"
                     /note="similar to Saccharomyces cerevisiae CIT3 (YPR001W);
                     ancestral locus Anc_8.92"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680221.1"
                     /db_xref="GeneID:11500345"
                     /db_xref="GOA:G8ZR68"
                     /db_xref="InterPro:IPR002020"
                     /db_xref="InterPro:IPR016141"
                     /db_xref="InterPro:IPR016142"
                     /db_xref="InterPro:IPR019810"
                     /db_xref="UniProtKB/TrEMBL:G8ZR68"
                     /translation="MISALRSLTTKRTFHTTRCVASSGPDLRSALKELIPARKQELLE
                     IKKNHSDVKVGDITVGSVIGGMRGNSSMFWQSTSLDPEEGIRFQGKTIQECQALLPSD
                     PEEHDAKKSFLPESMLWLLMTGDIPSETQAANLTRELASRGRTIPKNTNKLMENLPRD
                     MHPMTQLAIGLASMNQSSQFAKRYEQGALSKTDYWEYTLDDALNLIAALPALSGKIYS
                     NIVNDGKPLGEFREDRDWSYNISSLLGMTTKDSCNRQNLSEEQANDFVNLMRLYTGIH
                     VDHEGGNVSAHTTHLVGSALGDPFLSYSSGIMGLAGPLHGLAAQEVVRFLIEMNSEIS
                     SETSTDEIEKYLWKLLDSKRVVPGYGHAVLRKPDPRFTAMLEFAEARPQEFEKDKNVK
                     LMQILSKIAPEVLKKHGKTKNPYPNVDSASGILFYHYGIQEMLFFTVIFGCSRSMGPM
                     TQLVWDRIFGLPIERPKSLDMNALKSLCHMS"
     gene            <208503..>210053
                     /gene="TDEL0C01220"
                     /locus_tag="TDEL_0C01220"
                     /db_xref="GeneID:11500346"
     mRNA            <208503..>210053
                     /gene="TDEL0C01220"
                     /locus_tag="TDEL_0C01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680174.1"
                     /db_xref="GeneID:11500346"
     CDS             208503..210053
                     /gene="TDEL0C01220"
                     /locus_tag="TDEL_0C01220"
                     /inference="similar to DNA sequence:INSDC:YPR002W"
                     /note="similar to Saccharomyces cerevisiae PDH1 (YPR002W);
                     ancestral locus Anc_8.93"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680222.1"
                     /db_xref="GeneID:11500346"
                     /db_xref="GOA:G8ZR69"
                     /db_xref="InterPro:IPR005656"
                     /db_xref="InterPro:IPR012705"
                     /db_xref="UniProtKB/TrEMBL:G8ZR69"
                     /translation="MLARPVTSRTIGRVPLMNLLGKRSYVDPAKNERPEPDVILKRIA
                     SYVHKTPIESPLAFETAKLCLLDTLGCGLAALKYEQARNIIKPIVPGTTVPNGTRILG
                     TGYEMDPVKGAFAIGTLIRWLDYNDCWLAAEWGHPSDNLGGVLAVADYLTRLSNATNG
                     DEGKQFLVKDVLEGMIKAHEIQGVIALENSFNKVGLDHVVLVKVATAAVVSRMLGLNE
                     NQTIETISQAFVDGQSLRTYRHAPNTGSRKSWAAGDAVSRAVNLAYLVKNANVGTIPS
                     VLTAKTWGFYDVLFKGKAFSFNQRSDFGSYVMENILFKISFPAEFHSQTAAEAAIKAQ
                     QILKNTGKSYKDIKSIRIRTQEAAVRIIDKSGPLYNYADRDHCIQYMIAIPLIHGRLT
                     ADDYTDDVAKNPAIDELRAKMYCEKDEQFTADYHDPQKRSIANALLIELNDGTTLDEI
                     VVEYPIGHKFRRSEGIPLLMEKFQRHVEEHFAQSPEKGQKIIHASNDPNFLQMPINEY
                     VDLFWHNK"
     gene            <210206..>212764
                     /gene="TDEL0C01230"
                     /locus_tag="TDEL_0C01230"
                     /db_xref="GeneID:11500347"
     mRNA            <210206..>212764
                     /gene="TDEL0C01230"
                     /locus_tag="TDEL_0C01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680175.1"
                     /db_xref="GeneID:11500347"
     CDS             210206..212764
                     /gene="TDEL0C01230"
                     /locus_tag="TDEL_0C01230"
                     /inference="similar to DNA sequence:INSDC:YFR002W"
                     /note="similar to Saccharomyces cerevisiae NIC96
                     (YFR002W); ancestral locus Anc_8.94"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680223.1"
                     /db_xref="GeneID:11500347"
                     /db_xref="GOA:G8ZR70"
                     /db_xref="InterPro:IPR007231"
                     /db_xref="UniProtKB/TrEMBL:G8ZR70"
                     /translation="MTSAVDLSPLNANKQSEGGSARTLNELIETSKKIPTSSSELGSI
                     QLSVNEIRRRAHELRKKNAVEHDRTKAHYLLAGSGLAFEDVDTSLKQLRSKQLIEQTV
                     PNKQIEGEVDTYLQTKKDENILSSIEHLLSAAAKDFDSFVNQNLKLDWAQRKDEVRES
                     FGILVQKKAKLDGTDVAPFNPKLPTWGNRGSSILNSGASSLNVNENYMVREKFEKYAK
                     VIHRFNNARQAGQLFTLSNELIGVLGNSSDSKNRQLLESWKILNELKDSKDIVATAKA
                     YLQNQFFDYVNLLYQKNLNEGLPTNINKIKSFIQCKLKNANSTWKLTNLTVVNGVPIW
                     ALIFYLLRAGLLHEALEVAVTNKASFKKVEQSFLTYLKAYVSSSDNRLPVEFSARLHT
                     EYTQHIKSSLDGDPYRLAVYKIIGRCDLTRKNIPAVTLSIEDWLWMHFMLIKKDESDD
                     DPVYERYSLEDFQNIIVSYGPATSANHYLQILIMSGLYELAVQYAYTISEIDAVHLAI
                     GLVHGNLLSITSSPQSGQSNSEGTGEFLVIREGKRTIDFARILGNYTKSFRYSDPRIA
                     AEYLILIALNGSQEQVELCHEALRELILETKEFTILLGKINRDGTRIPGVIEERLPLM
                     HLKNEKDFLHKITENAASRADEEGRIHDSLLLYQLSEEYNIVITIVNGMLSELLSNTD
                     LDQPLVTLDDNNETNPILMAKKLVSIYVENLEISQKVHTKNKETCILFLKLADARKTY
                     HARQWQNALAQIEELDILPFSDEISARKKAQEFTTLDDQLIRNIPNLLIMTMSCISHL
                     INDLNKSDYKSVAKTQQINALKSVSKNCMIYAGMIQYKMPRETYSTLIRLDVGV"
     gene            complement(<212874..>213350)
                     /gene="TDEL0C01240"
                     /locus_tag="TDEL_0C01240"
                     /db_xref="GeneID:11500348"
     mRNA            complement(<212874..>213350)
                     /gene="TDEL0C01240"
                     /locus_tag="TDEL_0C01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680176.1"
                     /db_xref="GeneID:11500348"
     CDS             complement(212874..213350)
                     /gene="TDEL0C01240"
                     /locus_tag="TDEL_0C01240"
                     /inference="similar to DNA sequence:INSDC:YFR003C"
                     /note="similar to Saccharomyces cerevisiae YPI1 (YFR003C);
                     ancestral locus Anc_8.95"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680224.1"
                     /db_xref="GeneID:11500348"
                     /db_xref="InterPro:IPR011107"
                     /db_xref="UniProtKB/TrEMBL:G8ZR71"
                     /translation="MMTDGNGNSGSQLLEGSQTISVEELRPVLQLRAEESTNSREEQS
                     QPTRPSVRWQSDVIDNENMNKKKTKICCIFHPQQEFDIDEEECHSDHSGHSSSSSSSS
                     SSSESESEKDLNLTERRQRRVARRHRRLKENKGKSPNAYEIQPDYTQDRARREQRH"
     gene            <213600..>214520
                     /gene="TDEL0C01250"
                     /locus_tag="TDEL_0C01250"
                     /db_xref="GeneID:11500349"
     mRNA            <213600..>214520
                     /gene="TDEL0C01250"
                     /locus_tag="TDEL_0C01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680177.1"
                     /db_xref="GeneID:11500349"
     CDS             213600..214520
                     /gene="TDEL0C01250"
                     /locus_tag="TDEL_0C01250"
                     /inference="similar to DNA sequence:INSDC:YFR004W"
                     /note="similar to Saccharomyces cerevisiae RPN11
                     (YFR004W); ancestral locus Anc_8.96"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680225.1"
                     /db_xref="GeneID:11500349"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR024969"
                     /db_xref="UniProtKB/TrEMBL:G8ZR72"
                     /translation="MERLQRLMMNSKAGMTDANRDDTKETVYISSIALLKMLKHGRAG
                     VPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRNQ
                     MVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRLID
                     TGALINNQEPRQTTSNAGLLNKANIQALIHGLNRHYYSLNIDYHKTPTETKMLMNLHK
                     EQWQSGLKMYDYKEKEQENLEATQKLVKIAEQYSKRVEEEKELTEEQLKTRYVGKQDP
                     KKHLAETSDAVLENNIVSLLTASVNSVAIK"
     gene            complement(<214580..>215959)
                     /gene="TDEL0C01260"
                     /locus_tag="TDEL_0C01260"
                     /db_xref="GeneID:11500350"
     mRNA            complement(<214580..>215959)
                     /gene="TDEL0C01260"
                     /locus_tag="TDEL_0C01260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680178.1"
                     /db_xref="GeneID:11500350"
     CDS             complement(214580..215959)
                     /gene="TDEL0C01260"
                     /locus_tag="TDEL_0C01260"
                     /inference="similar to DNA sequence:INSDC:YFR005C"
                     /note="similar to Saccharomyces cerevisiae SAD1 (YFR005C);
                     ancestral locus Anc_8.97"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680226.1"
                     /db_xref="GeneID:11500350"
                     /db_xref="GOA:G8ZR73"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G8ZR73"
                     /translation="MQPENRGRRLSTKGDSNVKRVKVNEPSYAFLETVNRKKLDFDAE
                     KACSVTLSTLNVYCCLVCGKYLQGRRANSPAFLHSVNDNHHVFVDFITLKFYLLPDGI
                     EIEDNGRIQLLNSIRYAIRPQFTKNEISQFPTGCQDLNDNTYFNGFIGVNNSARNKSV
                     NVVLLALAHLRPLRDYCLLAKIDQEDEFTRRLALFIRKIWSVKLFKQHVSVDEFLAFV
                     TVNDKRSAKNLNDPRKCLLWLLECIQTSAPKLKSILSEACQGKVLVTKTGVKVIYDED
                     ENVKDFTREKSSKSTSVPFWSLTLDLPPRPLFKGQINVNDLPQVRLEDLMCKFNGIKE
                     KQMSHHIMQYKILKLPKYLVLHVDRFDSTDAQPVKNRNHTLVEFPLTMKVEGSTYKLL
                     ANIVHQVSRTAGTTRVEKDDQSNWIIQLYNSAIDQWVEIDGSNVRTKDKELLFLNEIY
                     IQIWELETA"
     gene            <216217..>217806
                     /gene="TDEL0C01270"
                     /locus_tag="TDEL_0C01270"
                     /db_xref="GeneID:11500351"
     mRNA            <216217..>217806
                     /gene="TDEL0C01270"
                     /locus_tag="TDEL_0C01270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680179.1"
                     /db_xref="GeneID:11500351"
     CDS             216217..217806
                     /gene="TDEL0C01270"
                     /locus_tag="TDEL_0C01270"
                     /inference="similar to DNA sequence:INSDC:YFR006W"
                     /note="similar to Saccharomyces cerevisiae YFR006W;
                     ancestral locus Anc_8.98"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680227.1"
                     /db_xref="GeneID:11500351"
                     /db_xref="GOA:G8ZR74"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001131"
                     /db_xref="InterPro:IPR007865"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:G8ZR74"
                     /translation="MSFPLVVGLILGCSVCLFSFRKHKSFYSLPICKTEINKLCEKPS
                     RMDREIADANEIPIALKGHKYPAKMHNLNVKKHLLKRNQKLSTESTAVFIVGEELEGV
                     KYCDITKEFRQDRYFYYLSGVNIPGCSLLYNFVSDKLTLFLPNVDWDDVIWSGLPLSI
                     EGALKEFDVDEVYHSDKLEEVFDKELRGYTIFTTDLDNVHSEKLREKLTPSAEEFFYA
                     LDESRIIKDWFEIETIRKACNISDKCHLAVMQALPIELNEVQIQAEFSYHATRQGARS
                     MGYDPICCSGPACGTLHYVKNSEDLAYKSSILIDAGAEWKNYTSDVTRCFPISGRFTK
                     EHRDIYETVRDMQNQVMEKIKPGASWESLHILSHKVLIKNLRRLGIFKKEFSEEEIFE
                     RKASCGFYPHGLGHLLGLDVHDVGGQPNYEDADPYFRYLRLRRQLEQNMVVTNEPGCY
                     FNVFLIKEFLEKFPERAEVVDKQVLKKYMYIGGVRIEDDILVTANGYENLNKITSDPD
                     EIEKIVSNGLSRKRSEFHVVV"
     gene            complement(217911..218004)
                     /gene="TDEL0Ctrna2F"
                     /locus_tag="TDEL_0Ctrna2F"
                     /db_xref="GeneID:11502029"
     tRNA            complement(join(217911..217947,217967..218004))
                     /gene="TDEL0Ctrna2F"
                     /locus_tag="TDEL_0Ctrna2F"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /db_xref="GeneID:11502029"
     gene            complement(<218824..>221007)
                     /gene="TDEL0C01280"
                     /locus_tag="TDEL_0C01280"
                     /db_xref="GeneID:11502015"
     mRNA            complement(<218824..>221007)
                     /gene="TDEL0C01280"
                     /locus_tag="TDEL_0C01280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680180.1"
                     /db_xref="GeneID:11502015"
     CDS             complement(218824..221007)
                     /gene="TDEL0C01280"
                     /locus_tag="TDEL_0C01280"
                     /inference="similar to DNA sequence:INSDC:YPR003C"
                     /note="similar to Saccharomyces cerevisiae YPR003C;
                     ancestral locus Anc_8.99"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680228.1"
                     /db_xref="GeneID:11502015"
                     /db_xref="GOA:G8ZR75"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="InterPro:IPR018045"
                     /db_xref="UniProtKB/TrEMBL:G8ZR75"
                     /translation="MSSSHLLSKGEAFSRPNSTGSNYSAINPNSFADGTRRVLDRQVN
                     HQRVDSVLSNASKMNSRRLDHAVIDSKPSFRDVLPYYLPCFSWIPEYTWSKFMGDLVA
                     GITLASFQIPLALSYATSLAHVEPLCGLYSLAFTPFIYAIFGSVPQMIVGPESAISLV
                     VGQAVEKLRAHNHEISTMSISVLVTFISGMFLFVFGICRFGFLGNVLSRALLRGFISS
                     VGVVMIVNSLISELKLHKLLLETKGHFHTPFQKIRFIIKYAPANYHIPTAVLSLTCFI
                     ILVTARVIKKKLMRRRRWPVFVPEILILIITTIILSHKFKFKKHYEISIVGDFDTDGL
                     VNFYNPISKSNRELAPNLMNAGFIVAILGFFESTTAAKSLGSAYEFAISSNRELVALG
                     SMNLCASVLGALPAFGGYGRSKINSFSGAQTVMSGVCMGVIVLLTVKFFLSQIRYIPV
                     CILSVITTIVGISLLEEAPADLRFHFNSRGYDELLVFAVTVLTTFFYSLEMGVCIGCG
                     YSVISIIKHSAKSRIQILARVESTGQFINSDEYLSSATHPDDLPNIEELEGCLVVKIP
                     EPLTFTNMEDLKERLTRLERFGSAIVHPGAKGSRERESIKYLVFDLNGMTFMDSSAAQ
                     IMLEIVKSYNRRRVKVFLARVPLDEQVRSRLETSNILNYVERNHIKTPTPALDSPGGS
                     NAIPSPYFATIQDSLQVMDERELSNESMNDQASFISTTLVNSNLV"
     gene            complement(<221260..>222294)
                     /gene="TDEL0C01290"
                     /locus_tag="TDEL_0C01290"
                     /db_xref="GeneID:11500353"
     mRNA            complement(<221260..>222294)
                     /gene="TDEL0C01290"
                     /locus_tag="TDEL_0C01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680181.1"
                     /db_xref="GeneID:11500353"
     CDS             complement(221260..222294)
                     /gene="TDEL0C01290"
                     /locus_tag="TDEL_0C01290"
                     /inference="similar to DNA sequence:INSDC:YPR004C"
                     /note="similar to Saccharomyces cerevisiae YPR004C;
                     ancestral locus Anc_8.100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680229.1"
                     /db_xref="GeneID:11500353"
                     /db_xref="GOA:G8ZR76"
                     /db_xref="InterPro:IPR001308"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014730"
                     /db_xref="InterPro:IPR014731"
                     /db_xref="InterPro:IPR018206"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:G8ZR76"
                     /translation="MIRFAGKNLQNMKPWIRSSRLASTLAFIETTKEGAIVPSSLSAL
                     NAAQQLGNDITAILLGSQASAAANTLKSSIQCSKLNKVLVSGDAAYDHYLPEKVTPLI
                     VNLLEGEDYSHFVVASSAVGKNLLPRVGALLDYQPVCDITKILDPKTFVRPIYAGNAI
                     ETVENTQAKTLLSVRASAFDAIIAGKSDKATIEDVGSEEHSGGDVKWENAKLVESERP
                     DLSSASTIVAGGRALKDKATFDKILLPLADTLKAGIGATRAAVDSGFCDNSLQIGQTG
                     KVVAPDLYIAVGISGAIQHLAGMKDSKKIVAINSDPDAPIFKVADYGLEGDIYEIVPE
                     LTEKLKQLQH"
     gene            <222485..>223504
                     /gene="TDEL0C01300"
                     /locus_tag="TDEL_0C01300"
                     /db_xref="GeneID:11500354"
     mRNA            <222485..>223504
                     /gene="TDEL0C01300"
                     /locus_tag="TDEL_0C01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680182.1"
                     /db_xref="GeneID:11500354"
     CDS             222485..223504
                     /gene="TDEL0C01300"
                     /locus_tag="TDEL_0C01300"
                     /inference="similar to DNA sequence:INSDC:YFR007W"
                     /note="similar to Saccharomyces cerevisiae YFR007W;
                     ancestral locus Anc_8.101"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680230.1"
                     /db_xref="GeneID:11500354"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZR77"
                     /translation="MVNINDLADEAIQLLNDTSHANYRIAVMIVGPPGSGKSTVANKL
                     CRELNGRFQQYLQETKLSGHSLNDSNEDIDLISNISDISPELIGKLQRDDGIFVESVE
                     DVNFKPIKRVRSDGKVEILGRGGQSNAFTISKQPLSRRDNISIAQTIPMDGFHLSRRC
                     LDYFEDPKKAHLRRGSPPTFDSNNFLQLCKVLAKTCTIKPPACESSGCFDFISKTFLS
                     NMPTITIPGFDHKMKDPTPNQYSIDGYTRILIFEGLYLLYDNENWRSIHKTLLDTGAL
                     LVWNLYIEEGVIEERVAKRHLEAGLVATLEDGMQKFQLNDLVNARLIKEHLIKDKRIV
                     NIRND"
     gene            complement(<223561..>224388)
                     /gene="TDEL0C01310"
                     /locus_tag="TDEL_0C01310"
                     /db_xref="GeneID:11500355"
     mRNA            complement(<223561..>224388)
                     /gene="TDEL0C01310"
                     /locus_tag="TDEL_0C01310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680183.1"
                     /db_xref="GeneID:11500355"
     CDS             complement(223561..224388)
                     /gene="TDEL0C01310"
                     /locus_tag="TDEL_0C01310"
                     /inference="similar to DNA sequence:INSDC:YPR005C"
                     /note="similar to Saccharomyces cerevisiae HAL1 (YPR005C);
                     ancestral locus Anc_8.102"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680231.1"
                     /db_xref="GeneID:11500355"
                     /db_xref="InterPro:IPR005012"
                     /db_xref="UniProtKB/TrEMBL:G8ZR78"
                     /translation="MVVSVGSHINGYTVIETLYNHDHLDIFEVVDIQQKRHVLKMYKK
                     EISPRADQIEEASINRFLWHGIRCAVHNDECIAKKDYFNLKGSDESSRAGPVRRQSGG
                     IVRTPMPCEQSREEEDEEEEDEDDDEDEEEDEEEEDEDDDEDEEDEDEEDDEDEDEDE
                     DAQDSEEGEESEDDEELSPVVHIVTPGDSDRPRPILLHGNGTHQRESSRVNIQSPVQK
                     AFHLRHRDLPRTPMPGVLRTDDPSETQRSIDQEKCRFQLKMISSSMLKRRSAKSMAM"
     gene            complement(<224778..>226448)
                     /gene="TDEL0C01320"
                     /locus_tag="TDEL_0C01320"
                     /db_xref="GeneID:11500356"
     mRNA            complement(<224778..>226448)
                     /gene="TDEL0C01320"
                     /locus_tag="TDEL_0C01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680184.1"
                     /db_xref="GeneID:11500356"
     CDS             complement(224778..226448)
                     /gene="TDEL0C01320"
                     /locus_tag="TDEL_0C01320"
                     /inference="similar to DNA sequence:INSDC:YPR006C"
                     /note="similar to Saccharomyces cerevisiae ICL2 (YPR006C);
                     ancestral locus Anc_8.103"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680232.1"
                     /db_xref="GeneID:11500356"
                     /db_xref="GOA:G8ZR79"
                     /db_xref="InterPro:IPR006254"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018523"
                     /db_xref="UniProtKB/TrEMBL:G8ZR79"
                     /translation="MYGWNFSRCFNKRHYSHDLQNVFKEEVKKVNEWWATPRFRHIHR
                     PYSAEDVVKHRGSLPLEVTRYPSSYQAQRLFQLLDEKFHKREPLHTLGVIDPVQMSQL
                     ARCKDIHVAYISGWACSSTLVGSTNEVSPDFGDYPYDTVPNQVERIFKAQQMHDRKLM
                     LEKLGPHKKEIEETNYLKPIIADADMGHGGTTTVMKVAKLFAEKGAAGIHLEDQLVGG
                     KRCGHLSGAVIVPTSTHVSRLVATRFQWDLMGTENLLIARTDSCNAKLLSSSSDPRDH
                     QYIKGVINPQAVAWSEILTQLESGATESTAIAEAETEWYEQNKIMTFDEAVEQQVNRD
                     QYDTYLEKKANKMSKLNRVYLSLAEMRKLAALAAPKQQIFFDWDKPRTKEGHYMFQGC
                     MEAAIGRSLAFARYADMLWLETKTPDLKQAGSFASTIHNVYPEARLVYNLSPSFNWSS
                     HGYTAEALQSFIWDLAKHGFILQLVSLAGLHVDALSFWQLARRFQKDGMRAYVEQVQR
                     IEKAENCDILTHQKWSGVEYIDSLSKVLDGSSSHTSSTSGDSYTESQF"
     gene            complement(<226756..>228741)
                     /gene="TDEL0C01330"
                     /locus_tag="TDEL_0C01330"
                     /db_xref="GeneID:11500357"
     mRNA            complement(<226756..>228741)
                     /gene="TDEL0C01330"
                     /locus_tag="TDEL_0C01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680185.1"
                     /db_xref="GeneID:11500357"
     CDS             complement(226756..228741)
                     /gene="TDEL0C01330"
                     /locus_tag="TDEL_0C01330"
                     /inference="similar to DNA sequence:INSDC:YPR007C"
                     /note="similar to Saccharomyces cerevisiae REC8 (YPR007C);
                     ancestral locus Anc_8.104"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680233.1"
                     /db_xref="GeneID:11500357"
                     /db_xref="InterPro:IPR006910"
                     /db_xref="UniProtKB/TrEMBL:G8ZR80"
                     /translation="MSNIVTLAHYSNNNEAATNPLYKGVTTVWLLSTLGSSRLGGNGS
                     DSNSSFSSVLKKKDIVNVSIPKTCKVIQNNELELPLRYVSNLLYGVTVCYHRKAEYVL
                     SDVTSLLTQLQKKFYVAPFQRKKNDKSHHVATIFDVNDASAANGLLNDDPLFDINQIN
                     NFANVFEPGKQQATTEALTIRRQDFMNELTNSNNFDDAKNLTNSSDRINRPLTLEDIP
                     IDVDFNFDIDDVISQQGTSYHSKTSSQRGDNDFQIDYNKQEFNLNFEGNEDAQVPADE
                     TGIDLGIEDDDASLEDEEANTKEGMPPLKKLKVSGSSANSYQLIQIDERTGLSTDILR
                     SNHDHYFEIMDSKRRKKRKNSTTINSSWQTIMRLDEEANFVQRCWNLAFANPGKSDLS
                     FLTSKEPISDYRSIERGRKRARSLQSERSSSSISSEEQGRRAVLTRDGSLEPDNNLLL
                     NLEQINEELDEDESTNRSDLLQINLDLPPSSFGRTDTRDNVTGSDSRGASFAQGLDVV
                     DELRQVKSRRRKGGDTSTIVSDSSDSGSDHLSYQVERHSLGSMVLDSHTRKFYDYVKE
                     RSSYVGKTTRSNPPFQKKMLFEDVVPSSLSLSGTGTDSQNVSVTDKKIAASAFLSLLN
                     LASKDLIDIKGYHDHEESDRGFKPFELMNGDDIVVYA"
     gene            <228931..>229584
                     /gene="TDEL0C01340"
                     /locus_tag="TDEL_0C01340"
                     /db_xref="GeneID:11500358"
     mRNA            <228931..>229584
                     /gene="TDEL0C01340"
                     /locus_tag="TDEL_0C01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680186.1"
                     /db_xref="GeneID:11500358"
     CDS             228931..229584
                     /gene="TDEL0C01340"
                     /locus_tag="TDEL_0C01340"
                     /inference="similar to DNA sequence:INSDC:YFR008W"
                     /note="similar to Saccharomyces cerevisiae FAR7 (YFR008W);
                     ancestral locus Anc_8.105"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680234.1"
                     /db_xref="GeneID:11500358"
                     /db_xref="UniProtKB/TrEMBL:G8ZR81"
                     /translation="MSNAMSGNDRTHGQQQQPLYMSPQTENLSQMYVLVDRLVRQLQA
                     NRKEKEQVLRKVDVLSKQLNKQSPAEEGKNDAVLFDRFLSQRVALSQKDINETANDSD
                     TVKILQRQNEQLRKVLGAKTNLNKETMDVLRVHEDALEQVVALLRDDVANSHQSFVNR
                     VRSKLNDELIPLEDKEFSLYLDNINDVEQLIQVSEIYRSVLRLSDSADNTHLRNSPN"
     gene            229687..229757
                     /gene="TDEL0Ctrna6G"
                     /locus_tag="TDEL_0Ctrna6G"
                     /db_xref="GeneID:11500359"
     tRNA            229687..229757
                     /gene="TDEL0Ctrna6G"
                     /locus_tag="TDEL_0Ctrna6G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11500359"
     gene            <230326..>232209
                     /gene="TDEL0C01350"
                     /locus_tag="TDEL_0C01350"
                     /db_xref="GeneID:11502020"
     mRNA            <230326..>232209
                     /gene="TDEL0C01350"
                     /locus_tag="TDEL_0C01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680187.1"
                     /db_xref="GeneID:11502020"
     CDS             230326..232209
                     /gene="TDEL0C01350"
                     /locus_tag="TDEL_0C01350"
                     /inference="similar to DNA sequence:INSDC:YGL166W,YPR008W"
                     /note="similar to Saccharomyces cerevisiae CUP2 (YGL166W)
                     and HAA1 (YPR008W); ancestral locus Anc_8.106"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680235.1"
                     /db_xref="GeneID:11502020"
                     /db_xref="GOA:G8ZR82"
                     /db_xref="InterPro:IPR001083"
                     /db_xref="UniProtKB/TrEMBL:G8ZR82"
                     /translation="MVLINNVKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPSTTCD
                     HCKELRKNKNANPSGVCTCGRLEKKRLAQKVKEEARAKAKEERKNQECRCDQNEPCKC
                     HSTRRRSRKISINDTHHFNHSQAGSGHVTSPISVETYNDNYLDSDGGGKISKEYHHIP
                     SLASISSLHSTHSLDQKFNFPQSPTLGNFGGSGTNGQFDNSSICSSARSDSRANLSDM
                     VGSSFEPTKRAPGXRSRVGEVTVPLEEYIPSDINGIGRINDVNAFDDWSPETSATNMN
                     PSVSATYAQSSSNSINHNLHAQDQNRSDSNNSNRNNGLLDMFLDSSTIPAFHDKSNTL
                     PSGMAKRYSFHSPQDAYNHHKENNSFKSNNTTNNITNNKNWESTEGSVDNESVKSVEV
                     LSLTPSFMDIPERRPQHHQLTHRYSQDSQLSQQRSSSVSRNHRYGGSHVSQPAYNMRS
                     PPMTVNPSNVSNIDDNVSLNSLQSPSSSVVEHGLMTNSTDPSLMKNLPDTIRHPRTMN
                     LPERSASTSHFQPSFQWSQPPLPRQGSQTLSTTTDTNSEFDHLMAFDSSINRSDSAQL
                     STKNDTDKPAYQDGPAPFGNGLARRTLQDTSPASSNQTSSPPSQLLTERGFADLDNFM
                     SIL"
     gene            complement(<232336..>233655)
                     /gene="TDEL0C01360"
                     /locus_tag="TDEL_0C01360"
                     /db_xref="GeneID:11500360"
     mRNA            complement(<232336..>233655)
                     /gene="TDEL0C01360"
                     /locus_tag="TDEL_0C01360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680188.1"
                     /db_xref="GeneID:11500360"
     CDS             complement(232336..233655)
                     /gene="TDEL0C01360"
                     /locus_tag="TDEL_0C01360"
                     /inference="similar to DNA sequence:INSDC:YGL164C"
                     /note="similar to Saccharomyces cerevisiae YRB30
                     (YGL164C); ancestral locus Anc_8.107"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680236.1"
                     /db_xref="GeneID:11500360"
                     /db_xref="InterPro:IPR008812"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZR83"
                     /translation="MDELLAKAGSQAVTFAIKSGISIASTYALRTITNFVIQIPKSDA
                     RRIERLKAKLENRIEIVSSAIDLIKLVAARGNTNLESTLRLTRDLKNELDAFDEHTRE
                     LIEKVERSRSAKSQKQAIESVERYIIDLLQRIDEVTPFINLSLTTSGANLNSSLPQQV
                     SPGLLLQASNHINRSNTNQMGQVGPDFQVTLYSVFYHMDQENSKSKTRVDWKEDMKKA
                     FVKVMRTPSDTDAYSYELQIEQDFDDGRYHNEDEKCQTMTLNLNQIVKLYFSVSGNLL
                     KLPEQDNPVLVLKVDKNIAGKHPGTSTEDIVWYALGQNQEQDEEEEEEEEEEEEEEEE
                     EEEGEEEEEEEEEEEEEEEEEKEEEEKEEKRTDHVVEDSPISSSIALLEYIIRLASLQ
                     TSDDKSILEVSDERLSIYLNDENPNSIREKRANVEQVTKDLKKVTLD"
     gene            complement(<233761..>236370)
                     /gene="TDEL0C01370"
                     /locus_tag="TDEL_0C01370"
                     /db_xref="GeneID:11500361"
     mRNA            complement(<233761..>236370)
                     /gene="TDEL0C01370"
                     /locus_tag="TDEL_0C01370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680189.1"
                     /db_xref="GeneID:11500361"
     CDS             complement(233761..236370)
                     /gene="TDEL0C01370"
                     /locus_tag="TDEL_0C01370"
                     /inference="similar to DNA sequence:INSDC:YGL163C"
                     /note="similar to Saccharomyces cerevisiae RAD54
                     (YGL163C); ancestral locus Anc_8.108"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680237.1"
                     /db_xref="GeneID:11500361"
                     /db_xref="GOA:G8ZR84"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR013967"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZR84"
                     /translation="MVAKRRLPDRPPNGIGAGQSPRLVPRPLNIQGSLVTLTRPFKVP
                     FKGKKQPLQSRSTNQEYLDGGGRSLRKRSQTVSYAGLDTENELPPMSQGHHVRKDALS
                     SRRLAEDPTRLSSIETVLRRSFTVPIKGYVQRHSLPLTLGTKKKIALEPRPLHDPTDE
                     FAIVLYDPTIDGSMIIQDTTDVPVDTRSQSVGPEEKDNKEIPRKQPKYLSNGLKNKTL
                     KELLGEDEDTQVKKKYANIPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDFLDQE
                     TVKNGSAEVGTEVGKEVVINRGAYGCIMADAMGLGKTLQCIALMWTLLRQGPQGKKLI
                     DKCIIVCPSSLVNNWANELVKWLGPNVLTPLAIDGKKTTSVSESIRVWAQAQGRNIVK
                     PVLIISYETLRRNVEQLKNTRVGLMLADEGHRLKNADSLTFTSLDSIDCPRRVILSGT
                     PIQNDLSEYFALLNFSNPGLLGTRSDFRKNFENPILLSRDADATDDQIKKGQEQLQKL
                     SYVVSKFIIRRANDILAKYLPCKYEHVIFVNLRPFQKDLYERSVKSREITKMVKGNEA
                     GSQPLKAIGQLKKLCNHPDLLNFEEDLDNLDGLNIPDDYEIPSSSNTNFRRNVQTEFS
                     GKFAILERFLKTIRSQSDDKIVLISNYTQTLDLIERLCRHKHYASLRLDGTMNINKRQ
                     KLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDG
                     QKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAQEDVERLFTTDNLRMLFKYNG
                     NTICDTHETYHCKRCDAKSGKQFIKSSAMLYGDATTWNHLNHDALQKTNDHLLRNEYN
                     HPDISYAFQYISH"
     gene            <237170..>237949
                     /gene="TDEL0C01380"
                     /locus_tag="TDEL_0C01380"
                     /db_xref="GeneID:11500362"
     mRNA            <237170..>237949
                     /gene="TDEL0C01380"
                     /locus_tag="TDEL_0C01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680190.1"
                     /db_xref="GeneID:11500362"
     CDS             237170..237949
                     /gene="TDEL0C01380"
                     /locus_tag="TDEL_0C01380"
                     /inference="similar to DNA sequence:INSDC:YGL162W,YPR009W"
                     /note="similar to Saccharomyces cerevisiae SUT1 (YGL162W)
                     and SUT2 (YPR009W); ancestral locus Anc_8.109"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680238.1"
                     /db_xref="GeneID:11500362"
                     /db_xref="GOA:G8ZR85"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8ZR85"
                     /translation="MSSSITVVNRNRTLPPLLLPDLRSVHERHPYVGPQMLSGLKRTN
                     GSDLESLASVATKRLKLSSHLVTPPPTAPVSAAISPSPSYVTFEETTTTNNNNNNSNN
                     NTAQRKGTSPPPEGKTTAKRQRIGPSCDECRLKKIKCDASIEILLQDDALIEQVSEQL
                     HHVFTPEEVRAQSETILKNVSLPELDESTVLIKHIDKIVLFRPCTSCRKRRATNTQPT
                     CCLFSKGFTRADINVFSRIASRIKGKKMAEMDVHDYRAAGF"
     gene            complement(<237987..>238871)
                     /gene="TDEL0C01390"
                     /locus_tag="TDEL_0C01390"
                     /db_xref="GeneID:11500363"
     mRNA            complement(<237987..>238871)
                     /gene="TDEL0C01390"
                     /locus_tag="TDEL_0C01390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680191.1"
                     /db_xref="GeneID:11500363"
     CDS             complement(237987..238871)
                     /gene="TDEL0C01390"
                     /locus_tag="TDEL_0C01390"
                     /inference="similar to DNA sequence:INSDC:YGL161C"
                     /note="similar to Saccharomyces cerevisiae YIP5 (YGL161C);
                     ancestral locus Anc_8.110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680239.1"
                     /db_xref="GeneID:11500363"
                     /db_xref="UniProtKB/TrEMBL:G8ZR86"
                     /translation="MTDNGGNRRDSFLEFDDGLEGADDFTTEPNPFDDVVSDDMSKKG
                     KPPGYEGTTDTATLPPGYDEAINEPTPTASQPSRETLPPGLLNYLSQYFQLNDQELKT
                     NLYDSLKFKLTQETDQENRGDLDTKPDLYGPVWIFATIVAANFVGSKLFAVILGGILA
                     GVRDTTDTFGGNRLIHSFWLYLTYSFFIPAIIAKMYLHRKDNIAELISAFGYSTLVWI
                     PVGLIIDLIQTLHSAMPIYVLSIVKWVLVALAFAKSSQFLYRKMNTEDSSDQLVKFPI
                     IGFNAIMCVVARLLLYSS"
     gene            complement(238975..239045)
                     /gene="TDEL0Ctrna7G"
                     /locus_tag="TDEL_0Ctrna7G"
                     /db_xref="GeneID:11500364"
     tRNA            complement(238975..239045)
                     /gene="TDEL0Ctrna7G"
                     /locus_tag="TDEL_0Ctrna7G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11500364"
     gene            <240226..>241170
                     /gene="TDEL0C01400"
                     /locus_tag="TDEL_0C01400"
                     /db_xref="GeneID:11502023"
     mRNA            <240226..>241170
                     /gene="TDEL0C01400"
                     /locus_tag="TDEL_0C01400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680192.1"
                     /db_xref="GeneID:11502023"
     CDS             240226..241170
                     /gene="TDEL0C01400"
                     /locus_tag="TDEL_0C01400"
                     /inference="similar to DNA sequence:INSDC:YEL029C"
                     /note="similar to Saccharomyces cerevisiae BUD16
                     (YEL029C); ancestral locus Anc_1.471"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680240.1"
                     /db_xref="GeneID:11502023"
                     /db_xref="GOA:G8ZR87"
                     /db_xref="InterPro:IPR004625"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:G8ZR87"
                     /translation="MPRLLATQSHVVHGYVGNKAATFPLQCLGWDVDCCNSVQFSNHT
                     GYGMDRVFGNITEERDLDQLLTGVLGNFPHDYEALLSGYLPKKESVSCMGRHYVAYKK
                     NNPGSVWLMDPVMGDEGQLYVDKDVIFEYKKLALSQDSEVDIITPNHFELEIMYGEKI
                     DTTEQLRTAFQKLHKTVPVVIVTSCDPKMFGDSEYVYCVASMRGQSPMVLRVPLIKSY
                     FTGVGDLFSALLLDRIYKLLSSSNTSLKLEDQVNDVLNVIQNVLKMTLNYAPNNHTAK
                     IGNPMDMKDAELRIIESRDFYNSNTTPVVKRDFIYRKL"
     gene            complement(<241263..>241682)
                     /gene="TDEL0C01410"
                     /locus_tag="TDEL_0C01410"
                     /db_xref="GeneID:11500365"
     mRNA            complement(<241263..>241682)
                     /gene="TDEL0C01410"
                     /locus_tag="TDEL_0C01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680193.1"
                     /db_xref="GeneID:11500365"
     CDS             complement(241263..241682)
                     /gene="TDEL0C01410"
                     /locus_tag="TDEL_0C01410"
                     /inference="similar to DNA sequence:INSDC:YJR044C"
                     /note="similar to Saccharomyces cerevisiae VPS55
                     (YJR044C); ancestral locus Anc_1.473"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680241.1"
                     /db_xref="GeneID:11500365"
                     /db_xref="InterPro:IPR007262"
                     /db_xref="UniProtKB/TrEMBL:G8ZR88"
                     /translation="MDFKVSPLTKIISLSGFLALGFLLVILSCALFHNYYPLFDILVF
                     LLAPLPNALFSKSSTDSANFMSDTVSNTQDTGSFLTGVFVTSGLALPLVFYHCQLIGS
                     LSCIMSTLGGLIIYSSIVVFSWFFHSSWEQEEDTLFG"
     gene            complement(<241918..>243864)
                     /gene="TDEL0C01420"
                     /locus_tag="TDEL_0C01420"
                     /db_xref="GeneID:11500366"
     mRNA            complement(<241918..>243864)
                     /gene="TDEL0C01420"
                     /locus_tag="TDEL_0C01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680194.1"
                     /db_xref="GeneID:11500366"
     CDS             complement(241918..243864)
                     /gene="TDEL0C01420"
                     /locus_tag="TDEL_0C01420"
                     /inference="similar to DNA sequence:INSDC:YEL030W,YJR045C"
                     /note="similar to Saccharomyces cerevisiae ECM10 (YEL030W)
                     and SSC1 (YJR045C); ancestral locus Anc_1.474"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680242.1"
                     /db_xref="GeneID:11500366"
                     /db_xref="GOA:G8ZR89"
                     /db_xref="InterPro:IPR012725"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:G8ZR89"
                     /translation="MLAAKNLLRKSAIAGPSRVAARFQSTAKVQGSVIGIDLGTTNSA
                     VAIMEGKVPKIIENAEGSRTTPSVVAFTKDGERLVGIPAKRQAVVNPENTLFATKRLI
                     GRRFEDIEVQRDIKQVPYKIVKHSNGDAWVEARGETYSPAQIGGFVLNKMKETAEAYL
                     GKAAKNAVVTVPAYFNDSQRQATKDAGQIVGLNVLRVVNEPTAAALAYGLEKSESKVV
                     AVFDLGGGTFDISILDIDNGVFEVKSTNGDTHLGGEDFDIYLLREIVSRFKTESGIDL
                     EGDRMAIQRIREAAEKAKIELSSTVSTEINLPFITADASGPKHINMKFSRAQFETLTE
                     PLIKRTVDPVKKALKDASLSTSEVSDVLLVGGMSRMPKVVETVKQLFGKEPSKAVNPD
                     EAVAIGAAIQGAVLAGEVTDVLLLDVTPLSLGIETLGGVFTRLIPRNTTIPTKKSQIF
                     STAAAGQTSVEIRVFQGERELVRDNKLIGNFTLSGIPPAPKGVPQIEVTFDLDADGII
                     NVSARDKASNKDASITVAGSSGLSESEIEQMVNDAEKYRSQDEAKRQAIETANKADQL
                     ANDTENSLKEFEGKVDKAEAQKVQDLITSLRETVARVQAGEEVNADDLKAKTEELQNS
                     SMKLFEQMYKNDSSNNAQSGEPKQ"
     gene            <244093..>245847
                     /gene="TDEL0C01430"
                     /locus_tag="TDEL_0C01430"
                     /db_xref="GeneID:11500367"
     mRNA            <244093..>245847
                     /gene="TDEL0C01430"
                     /locus_tag="TDEL_0C01430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680195.1"
                     /db_xref="GeneID:11500367"
     CDS             244093..245847
                     /gene="TDEL0C01430"
                     /locus_tag="TDEL_0C01430"
                     /inference="similar to DNA sequence:INSDC:YJR046W"
                     /note="similar to Saccharomyces cerevisiae TAH11
                     (YJR046W); ancestral locus Anc_1.475"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680243.1"
                     /db_xref="GeneID:11500367"
                     /db_xref="UniProtKB/TrEMBL:G8ZR90"
                     /translation="MSAGYRLPVVDLDLISDEQALLPEVERIIRRNDTFLLKNYANKG
                     LLDGLMDILQHEDVPDVEEGFDANFTGVLELQDDILLEQYIFNTDQTLKFDRECTNES
                     LRKLYVRLFKVGLFFLQLCMKSVGAPELVTEKDYSSIFSRYYRQDSTTQVLPNGETFE
                     YVLNRAFRDFVCPGILTIFPVARGIKIKPPTVSADDNTWMTIDEPDCLLIHTGTLLAQ
                     YSGGVCSSSRIQISPESNAVYLTLAPPLAAVIDSTGKTVAEGLLKQQILELPEVAKKF
                     YPREAALMQITKMIGFYKELFSITETVLSLYAMSRTSFSAPKLDSLLPQISNMMRKKI
                     SQQDFLKMIFLWPECYVLEADSRGDLTVKLPRRENLLISKSRRLEFVEKADKWLNGVS
                     GMAKIPTDVPVLRSSKRRGSGGSDPEPTQLMKARSPTNAVPPSSNYISNSKDKFMYAE
                     KKTDSQSNLLERLRERERRSAALLSQRQRQYDQFLAVKMKQVFEILYSLPQSKPYTAT
                     HLSSLIVDSLQDSNNPIGTEEAVMILDKLQTLLGAQLIAQTVDGGLKVYRWNSLDKGL
                     VLARIEDALDQSMHIDHL"
     gene            complement(<245945..>249589)
                     /gene="TDEL0C01440"
                     /locus_tag="TDEL_0C01440"
                     /db_xref="GeneID:11500368"
     mRNA            complement(<245945..>249589)
                     /gene="TDEL0C01440"
                     /locus_tag="TDEL_0C01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680196.1"
                     /db_xref="GeneID:11500368"
     CDS             complement(245945..249589)
                     /gene="TDEL0C01440"
                     /locus_tag="TDEL_0C01440"
                     /inference="similar to DNA sequence:INSDC:YEL031W"
                     /note="similar to Saccharomyces cerevisiae SPF1 (YEL031W);
                     ancestral locus Anc_1.476"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680244.1"
                     /db_xref="GeneID:11500368"
                     /db_xref="GOA:G8ZR91"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006544"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:G8ZR91"
                     /translation="MAPKSFVSSPLVKDSRLLVPKPVFSRPYALFFFPLYAAFAHLYF
                     QQYDRYIQGSEWTFVYLGGIISLNVLVMLMPAWNVGIAAGFNYATAGDLNEATHVLIH
                     TTPNNGSDGIVEIQRVQEAGELQIFFQFQKKRFLWHPEEGVFSSPKFLIDEAPKISNF
                     QDFKGHSGDLTHLRRLYGENSFDIPIPTFLELFKEHAVAPLFVFQVFCVALWLLDEFW
                     YYALFNLFMIVSMEGAAVFQRLTTLREFRTMGIKPYTINVFRNKKWSEIQTDQLLPMD
                     VVSITRTAEDSAIPCDLVLVDGSCIVNEAMLSGESTPLLKESIRLRPRCDDLQVDGVD
                     KNSVLHGGTKALQVTAPEIKSDIPLSPDGGALAIVTKTGFETSQGSLVRVMIYSAERV
                     SVDNKEALYFILFLLIFAIVASWYVWVEGTRMGRTQSKLILDCILIITSVVPPELPME
                     LTMAVNSSLAALSKFYVYCTEPFRIPLAGRVDVCCFDKTGTLTGEDLVFEGLAGLSQD
                     PAQIRHMFTADDAPAKTALVIGAAHALVRLDDGEIVGDPMEKATLRSLNWKVEAKDTV
                     NKMGAGKIQILRRFQFSSALKRSSSIAVHDKKYFAAVKGAPETIRQRLVSVPENYDEI
                     YKSFTRSGSRVLALASKTLPSLSSKQLEDITREEIEHQLEFSGFLIFHCPLKDDATET
                     IKMLNESAHRSIMITGDNPLTAVHVAKEVGIVDRETLILDREGENEKGGLVFRNVEET
                     ITIPFDPATGKFDRATLFDKYDIAVTGHSLGALEEHHQLRELIRHTWVYARVSPLQKE
                     FILNTLKDMGYQTLMCGDGTNDVGALKQAHVGVALLNGTEEGLKKMADSRRTENMKAM
                     YIKQCGFFEKWGQPQPPVPEPIAHLFPPGPKNPHYLKALEKNGTTITPEIRKLVTEAN
                     NKPAETIKSEKDSGAKSGADLASMLLNTAGDSQEEEAPTLKLGDASCAAPFTSKLANV
                     SAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSVIYLAGVKFGDGQATVSGLLLS
                     VCFLSISRGKPLQKLSKQRPQAGIFNVYIMGSILSQFAVHIVTLIYITLEIYKLEPRE
                     PQVDLEKTFEPSLLNTGIFIIQLVQQVSTFAVNYQGEPFRENITSNKGMYYGLLGVTG
                     LALAGATEFIPELNEAMKFVPMDESFKLKLTTTLLIDFFGSWGCEYVFKYFFMDARPA
                     DIASRNVEII"
     gene            complement(<249883..>250698)
                     /gene="TDEL0C01450"
                     /locus_tag="TDEL_0C01450"
                     /db_xref="GeneID:11500369"
     mRNA            complement(<249883..>250698)
                     /gene="TDEL0C01450"
                     /locus_tag="TDEL_0C01450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680197.1"
                     /db_xref="GeneID:11500369"
     CDS             complement(249883..250698)
                     /gene="TDEL0C01450"
                     /locus_tag="TDEL_0C01450"
                     /inference="similar to DNA sequence:INSDC:YER106W"
                     /note="similar to Saccharomyces cerevisiae MAM1 (YER106W);
                     ancestral locus Anc_7.402"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680245.1"
                     /db_xref="GeneID:11500369"
                     /db_xref="InterPro:IPR018847"
                     /db_xref="UniProtKB/TrEMBL:G8ZR92"
                     /translation="MRPKNETRRLRSGSLVIKDANAISNAHSDRKRKVPSSFDGYGKE
                     NNILDDIAVEAPSEAELTVILESNFEAQLNPRNLTVLQKEILNNESNNISCGHSLCSG
                     DHRHQVQLRLWLFIRDGIIADGHSNFRSLCYYDQVYKRVDPNWIMHIEPISSEKIPQG
                     YEDFPIQQLSIPTIEINHITQEPRIQDLQVDIGDVLENEHTRIPSSLLAKRNLKSIFD
                     QTPIKAEKILSQGSTSSSEDLREELIAPNEKRCTIFKRLGIMGGLDIPRLPGS"
     gene            <250979..>255313
                     /gene="TDEL0C01460"
                     /locus_tag="TDEL_0C01460"
                     /db_xref="GeneID:11500370"
     mRNA            <250979..>255313
                     /gene="TDEL0C01460"
                     /locus_tag="TDEL_0C01460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680198.1"
                     /db_xref="GeneID:11500370"
     CDS             250979..255313
                     /gene="TDEL0C01460"
                     /locus_tag="TDEL_0C01460"
                     /inference="similar to DNA sequence:INSDC:YBL079W,YER105C"
                     /note="similar to Saccharomyces cerevisiae NUP170
                     (YBL079W) and NUP157 (YER105C); ancestral locus Anc_7.401"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680246.1"
                     /db_xref="GeneID:11500370"
                     /db_xref="GOA:G8ZR93"
                     /db_xref="InterPro:IPR004870"
                     /db_xref="InterPro:IPR007187"
                     /db_xref="InterPro:IPR014908"
                     /db_xref="UniProtKB/TrEMBL:G8ZR93"
                     /translation="MYSTPLKSRIDYNNGPFAGLSQTVSQNNANIAGNNNAKGDILPS
                     LSSQTSQIAQGAGINGGASLAPDLSIVDEHLRVTSLGTTKPLELASQYIDHLERRDGS
                     SPVLDERSYYNNGVNYNFSKEIGGLGAFTPFERQQVISIPDEILKEASKTEIKSDMGI
                     FPEISRCWITIDNKLILWNIKDSTDYQSIDEIKHTILKVALVKPKQSTFVDYINHLLL
                     IATPFDIYLLAISHNEETGELSVFNTGMCVSVHGLDVGEIVCYEKTGQIFFTGKTNGL
                     NIWGLQYSGSDDWFNSKCSKICLTQSAWSSLLPTNLITKIPGSGFMQSFFEEDSKYAQ
                     ETILQLTVDQSRGIIYSLSSKSNVKAYLINGNSLEGPMSIEPAYIRRIIGTTTARGAA
                     ILGPKFLKISRIVPVTQQENHNLFFVAITIGGVRLYFNGSLGRSGIEALRLESIKFPP
                     SSVTPEVIQQELQSQQLEQQKKGLRFYSNLNTSESVLLKFQKKSSVLLETTSASTIIS
                     PGVFFSAIAKAPPAQDKQNGLNVNSSQTLNQATQHKLYVSVPDYGILKNHGRYIENCT
                     LLDTTGTIKQIATLTPTFNATQKPEGYANQFATQYNAENMRVAVLTNNALEIYRYRTP
                     DEVFESLIDNPLPFLINYGVPEACSTALFVTCKLNKSEMLRSAALTFFTVGIPGIIDI
                     KPKYNKYMVSTVSSLFKKPSIEATPRKTLSGALQDASTTATSLVADPRANFSLDDVTL
                     SPRFYGIALLITRLFRDIWGKQIFLNNDEVNSKATTKDKNLITGISISKSDVEYYLSS
                     ITILNEFFSTYGSSLTVVYPLSSSELGGKSVDKSEEVANQAENIAINSLIKLIQSIME
                     ALSFLNVLYEESEVEGFEQQYIAFEDIIKFLTREVQTDLTKLKFKDLFAPNEDTRVLV
                     REILSSIINRNITRGASIEYTATALQERCGSFCSSSDILGFRAIEHLRKAKEIGLRDY
                     ETLRYHLNNAIKLFERIVDDLSFDKLKEAVSIMLELNYFPKTIGFLLNIANAVDKAKL
                     AYQYVADGCLEHDGRKVYYDKRLVVYDLVFETLVMVDNLAAKETSNVSGNLSVANEMS
                     ALREESYSVALTYDDKLFHYKLYDWLVSQKCEDKLLQLDTEFVLPYLREKSKSSLEIS
                     NLLWVYLSKRSKFFEAAEILYSLAGSDFKLKLGERIECLSRANGFCNGVCAPSHKQRM
                     VQLATMIQEIFDVAAVQDDLLSLVATDNRIDSTTKVDLMNQLDGKVLPVSDLFNDFAV
                     PLGYYEVCLVIFKVSDFRNQEEIKAKWDELFESLKKELNGGNKLDESTNFINLLSNVV
                     IKVGKQIHTSEFVFPISDLFTTISNLFYEALPQDHIQKGSIASIFLSAGVPYGKLYYI
                     LKDLIETSDSPYTLYKSEMVWLLKEWYKCDRKIRDIITYDEVSDLDDYNIDTDPVEKY
                     MKRTGNSI"
     gene            complement(<255559..>255915)
                     /gene="TDEL0C01470"
                     /locus_tag="TDEL_0C01470"
                     /db_xref="GeneID:11500371"
     mRNA            complement(<255559..>255915)
                     /gene="TDEL0C01470"
                     /locus_tag="TDEL_0C01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680199.1"
                     /db_xref="GeneID:11500371"
     CDS             complement(255559..255915)
                     /gene="TDEL0C01470"
                     /locus_tag="TDEL_0C01470"
                     /inference="similar to DNA sequence:INSDC:YBL078C"
                     /note="similar to Saccharomyces cerevisiae ATG8 (YBL078C);
                     ancestral locus Anc_7.400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680247.1"
                     /db_xref="GeneID:11500371"
                     /db_xref="GOA:G8ZR94"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8ZR94"
                     /translation="MKSTFKSEYPFEKRKAESERISQKFSNRIPVICEKAEKSDIPEI
                     DKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKD
                     GFLYVTYSGENTFGSL"
     gene            complement(<256081..>256623)
                     /gene="TDEL0C01480"
                     /locus_tag="TDEL_0C01480"
                     /db_xref="GeneID:11500372"
     mRNA            complement(<256081..>256623)
                     /gene="TDEL0C01480"
                     /locus_tag="TDEL_0C01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680200.1"
                     /db_xref="GeneID:11500372"
     CDS             complement(256081..256623)
                     /gene="TDEL0C01480"
                     /locus_tag="TDEL_0C01480"
                     /inference="similar to DNA sequence:INSDC:YER104W"
                     /note="similar to Saccharomyces cerevisiae RTT105
                     (YER104W); ancestral locus Anc_7.399"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680248.1"
                     /db_xref="GeneID:11500372"
                     /db_xref="UniProtKB/TrEMBL:G8ZR95"
                     /translation="MSHDLHSSPATEPSWPPSPTTPNLVESGRRSETPLRWATSWTDD
                     ERDKSQESITETIIRTRRDKHKTSFPSYTASPTKSRLEDQYRHMKGLRDNKRNGKASQ
                     QRGGLDKMESFVMNSELTQELQRLSLQAEEYTISPDLAEEIEQQQQEDLEDDALIDYI
                     NLRDQLDQELDSMIAELSLN"
     gene            complement(<256744..>259965)
                     /gene="TDEL0C01490"
                     /locus_tag="TDEL_0C01490"
                     /db_xref="GeneID:11500373"
     mRNA            complement(<256744..>259965)
                     /gene="TDEL0C01490"
                     /locus_tag="TDEL_0C01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680201.1"
                     /db_xref="GeneID:11500373"
     CDS             complement(256744..259965)
                     /gene="TDEL0C01490"
                     /locus_tag="TDEL_0C01490"
                     /inference="similar to DNA sequence:INSDC:YBL076C"
                     /note="similar to Saccharomyces cerevisiae ILS1 (YBL076C);
                     ancestral locus Anc_7.398"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680249.1"
                     /db_xref="GeneID:11500373"
                     /db_xref="GOA:G8ZR96"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002301"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR023586"
                     /db_xref="UniProtKB/TrEMBL:G8ZR96"
                     /translation="MSENSSSHFSFPKEEERVLAFWEEIDAFHTSLELTKDKPEFSFF
                     DGPPFATGTPHYGHILASTVKDIVPRYATMTGHHVSRRFGWDTHGLPIEHIIDKKLNI
                     SSKEDVFKLGLDKYNDECRAIVMTYADEWRKTIGRLGRWIDFDDDYKTMYPSFMESEW
                     WAFKELFNKGQVYRGFRVMPYSTGCTTPLSNFEAQQNYKDVNDPAVTIGFNVIGQDKT
                     QLVAWTTTPWTLPSNVSLCVNPDFEYVKIYDETKDRYFILMESLIKSLYSKPAKEKFK
                     VVEKFRGTDLVGLKYEPLFPYFAKQFGETAFRVICDDYVTNDSGTGIVHNAPAFGEED
                     FNACLKNGIFKEGDAIPNPVGDAGEFTAEVTDFSGQYVKDADKAIIKYLTASGNLLLA
                     TQIRHSYPFCWRSDTPLIYRSVPAWFVRVKEIVPKMLDSVMNSHWVPNVIKEKRFANW
                     IANARDWNISRNRYWGTPIPLWVSDDMEEMVCIGSVAELEELSGVTGIEDLHREFIDK
                     ITIPSKQGKGQLKRIEEVFDCWFESGSMPYASQHYPFENKEQFANRVPANFISEGLDQ
                     TRGWFYTLSVLGTHLFGEVPYQNVVVTGIILAADGRKMSKSLKNYPDPNIVLDKYGAD
                     ALRLYLINSPVLKAETLKFKEEGVKEVVSKVLLPWWNSYKFLEGQIALLKKTSEIDFK
                     YDPSIQSDNVMDRWILASMQSLVQYIHREMAVYELYAVVPRLLHFIDELTNWYIRFNR
                     RRLKGENGVDDCLKALNTLFEALFTFVRAMAPFTPYLSDSIYLRLKEFIPEKVLANFG
                     KDFRSVHFLSYPEVRQELFDEAIETSVSRMQSVIEMGRNIREKKTISLKTPLKSLVIL
                     HSDAAYLKDIEDLKDYILEELNIRDIIITSDEKAYGVEYRAVADWPVLGKKLKKDAKK
                     VKDALPSVTSEQVRSYLETGHIEVAGIALVKGDLNAIRGLPESQAQEGLETRTDQEVL
                     IILDTKIYPELKTEGLARELVNRIQKLRKKCGLQATDDVVVQYELVKDTINFEDIVKQ
                     HMEMLSKTCRSEIIPADDSQKEAIADEEQSINDTVFKLKILRL"
     gene            complement(<260222..>262159)
                     /gene="TDEL0C01500"
                     /locus_tag="TDEL_0C01500"
                     /db_xref="GeneID:11500374"
     mRNA            complement(<260222..>262159)
                     /gene="TDEL0C01500"
                     /locus_tag="TDEL_0C01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680202.1"
                     /db_xref="GeneID:11500374"
     CDS             complement(260222..262159)
                     /gene="TDEL0C01500"
                     /locus_tag="TDEL_0C01500"
                     /inference="similar to DNA sequence:INSDC:YBL075C,YER103W"
                     /note="similar to Saccharomyces cerevisiae SSA3 (YBL075C)
                     and SSA4 (YER103W); ancestral locus Anc_7.397"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680250.1"
                     /db_xref="GeneID:11500374"
                     /db_xref="GOA:G8ZR97"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:G8ZR97"
                     /translation="MSKAVGIDLGTTYSCVAHFSNDRVEIIANDQGNRTTPSYVAFTD
                     TERLIGDAAKNQAAINPQNTVFDAKRLIGRKFDDPEVVSDAKHFPFKVVNKEGKPVVQ
                     VEYKGETKTFTPEEISSMVLGKMKETAEGFLGTTVKDAVVTVPAYFNDSQRQATKDAG
                     TIAGLNVLRIINEPTAAAIAYGLDKKGRAEHNVLIFDLGGGTFDVSLLSIDEGIFEVK
                     ATAGDTHLGGEDFDNRLVNHLANEFKRKNKKDITSNQRSLRRLRTAAERAKRALSSSS
                     QTSIEIDSLFEGIDFYTSLTRARFEELCADQFRSTLDPVEKVLRDSKLDKSQIDEIVL
                     VGGSTRIPKIQKLVSDFFNGKEPNKSINPDEAVAYGAAVQAAILTGDQSSKTQDLLLL
                     DVAPLSLGIETAGGIMTKLIPRNSTIPTKKSETFSTYADNQPGVLIQVFEGERTKTKD
                     NNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAIEKGTGKSNKITITNDKGRL
                     SKEDIEKMVSEAEKYKAEDEKEAERVQTKTKLESYAFSLKNSAAEAGFKEKVGEEDAK
                     KIETTAQETIDWLDASQAASTDEYKDRQKELEATANPIMTKFYGAGGAAPGGAGPMPG
                     AGPTPGGPAGGESGPTVEEVD"
     gene            complement(<262502..>263527)
                     /gene="TDEL0C01510"
                     /locus_tag="TDEL_0C01510"
                     /db_xref="GeneID:11500375"
     mRNA            complement(<262502..>263527)
                     /gene="TDEL0C01510"
                     /locus_tag="TDEL_0C01510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680203.1"
                     /db_xref="GeneID:11500375"
     CDS             complement(262502..263527)
                     /gene="TDEL0C01510"
                     /locus_tag="TDEL_0C01510"
                     /inference="similar to DNA sequence:INSDC:YBL074C"
                     /note="similar to Saccharomyces cerevisiae AAR2 (YBL074C);
                     ancestral locus Anc_7.396"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680251.1"
                     /db_xref="GeneID:11500375"
                     /db_xref="InterPro:IPR007946"
                     /db_xref="UniProtKB/TrEMBL:G8ZR98"
                     /translation="MRAIIFGSKVQPRDVTIGIDQFSFEVKAGNPFCGVKNIPDGIHV
                     IHFSSSDEETECVRYGYWFEETKGRYLQFDETSGAYSVLKESDDAKYDTMIEMHSHLM
                     VSYPKIEETNWYELTSCITYEQIQTLTGNEPPYVDSSMTTQEESRVLNDKLKNRYDQQ
                     SAPHFDYTNIQFKSHDAIRDTHRMEDYTDKSHYLNHVIVARSYKGHINRLLGELQFAF
                     CNALLFGNYGSSLQWHSIVELVTFSTQVSTSLIKRLDSILALQLETLPDEYCATLINQ
                     EMWLRCLTVSHMSNKLPRTKRVYDNKFNSTSSDEDSESDHQLPNIDSDEDEDEPTVVS
                     GVYYVRS"
     gene            complement(<263973..>264578)
                     /gene="TDEL0C01520"
                     /locus_tag="TDEL_0C01520"
                     /db_xref="GeneID:11500376"
     mRNA            complement(<263973..>264578)
                     /gene="TDEL0C01520"
                     /locus_tag="TDEL_0C01520"
                     /product="40S ribosomal protein S8"
                     /transcript_id="XM_003680204.1"
                     /db_xref="GeneID:11500376"
     CDS             complement(263973..264578)
                     /gene="TDEL0C01520"
                     /locus_tag="TDEL_0C01520"
                     /inference="similar to DNA sequence:INSDC:YBL072C,YER102W"
                     /note="similar to Saccharomyces cerevisiae RPS8A (YBL072C)
                     and RPS8B (YER102W); ancestral locus Anc_7.395"
                     /codon_start=1
                     /product="40S ribosomal protein S8"
                     /protein_id="XP_003680252.1"
                     /db_xref="GeneID:11500376"
                     /db_xref="GOA:G8ZR99"
                     /db_xref="InterPro:IPR001047"
                     /db_xref="InterPro:IPR018283"
                     /db_xref="InterPro:IPR022309"
                     /db_xref="UniProtKB/TrEMBL:G8ZR99"
                     /translation="MGISRDSRHKRSATGAKRAQFRKKRKFELGRQSANTKIGTKRIH
                     TVRTRGGNKKFRALRIETGNFSWASEGFAKKTRIVGVAYHPSNNELVRTNTLTKAAIV
                     QIDATPFRQWYEGHYGATLGKKKNTKGDEEVVAASKSTEKKWAARAGSAKIESSVESQ
                     FGAGRLYAAISSRPGQSGRCDGYILEGEELAFYLRRLTAKK"
     gene            <265181..>265429
                     /gene="TDEL0C01530"
                     /locus_tag="TDEL_0C01530"
                     /db_xref="GeneID:11500377"
     mRNA            <265181..>265429
                     /gene="TDEL0C01530"
                     /locus_tag="TDEL_0C01530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680205.1"
                     /db_xref="GeneID:11500377"
     CDS             265181..265429
                     /gene="TDEL0C01530"
                     /locus_tag="TDEL_0C01530"
                     /inference="similar to DNA sequence:INSDC:YBL071W-A"
                     /note="similar to Saccharomyces cerevisiae KTI11
                     (YBL071W-A); ancestral locus Anc_7.394"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680253.1"
                     /db_xref="GeneID:11500377"
                     /db_xref="InterPro:IPR007872"
                     /db_xref="UniProtKB/TrEMBL:G8ZRA0"
                     /translation="MSTYDQVEIEDMTFDVDTQTFTYPCPCGDRFQIFIDDMYDGENI
                     AVCPSCSLMIEVVFEKEDLTEYYEEAGSQPPEPVAVAS"
     gene            <265711..>266949
                     /gene="TDEL0C01540"
                     /locus_tag="TDEL_0C01540"
                     /db_xref="GeneID:11500378"
     mRNA            <265711..>266949
                     /gene="TDEL0C01540"
                     /locus_tag="TDEL_0C01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680206.1"
                     /db_xref="GeneID:11500378"
     CDS             265711..266949
                     /gene="TDEL0C01540"
                     /locus_tag="TDEL_0C01540"
                     /inference="similar to DNA sequence:INSDC:YBL069W,YER101C"
                     /note="similar to Saccharomyces cerevisiae AST1 (YBL069W)
                     and AST2 (YER101C); ancestral locus Anc_7.393"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680254.1"
                     /db_xref="GeneID:11500378"
                     /db_xref="GOA:G8ZRA1"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZRA1"
                     /translation="MDVPHPSPPPKELPVEPTSLKRVARPIRHVKYVATKALIFYSKD
                     GPMEFTYEKRIKTPISKNKLVVEVRHVGLNPIDMKIRNGYKNGVYGEIGLGREYSGVV
                     NMVGENLQSQWHEGDEVCGIYFHPHSGSGTLQSSILVDPSEDPILLKPENISSQEAAG
                     SMYCLGTAFNILDKLQRSGKLKPDSNILINGGTSSVGMFAVQLLKNYYHVVKKIVIVT
                     TSTGSNVYSENFPDFVDDMIFINYLNCRGKSSKPLRQMIKEQKAIEYDDAGSEIKIDY
                     NQGKFDIVLDFIGGYDILSHSSSLIHSGGAYVTTVGDYVEDYKGDVFDSWDNPSANAR
                     KMFGSVLWSYSYTHFHFDTNAKSASKNDWINRCGEFLEKGVVKCVIDKNYHWKEHKEA
                     FSYMGTQRAQGKLIMEVEKF"
     gene            complement(<267010..>267756)
                     /gene="TDEL0C01550"
                     /locus_tag="TDEL_0C01550"
                     /db_xref="GeneID:11500379"
     mRNA            complement(<267010..>267756)
                     /gene="TDEL0C01550"
                     /locus_tag="TDEL_0C01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680207.1"
                     /db_xref="GeneID:11500379"
     CDS             complement(267010..267756)
                     /gene="TDEL0C01550"
                     /locus_tag="TDEL_0C01550"
                     /inference="similar to DNA sequence:INSDC:YER100W"
                     /note="similar to Saccharomyces cerevisiae UBC6 (YER100W);
                     ancestral locus Anc_7.392"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680255.1"
                     /db_xref="GeneID:11500379"
                     /db_xref="GOA:G8ZRA2"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:G8ZRA2"
                     /translation="MATKQAHKRLTKEYKLMVENPPPYILARPNENNILEWHYIITGP
                     ADTPYFEGQYHGTLTFPSDYPYKPPAIRMVTPNGRFRENTRLCLSMSDYHPNTWNPSW
                     SVSTILNGLLSFMTGDEATTGSIATTDQQKKILAARSMDYNTHQNLRFKMVFPEVVES
                     NMKELEARRASGKITEKDLSKDKEDAIVQAAKEKAITIEEILDPEDRIRAEEALKSIN
                     GKQSEDNRKSSSLLYIGLAVLLFCVGLSMK"
     gene            <268152..>269108
                     /gene="TDEL0C01560"
                     /locus_tag="TDEL_0C01560"
                     /db_xref="GeneID:11500380"
     mRNA            <268152..>269108
                     /gene="TDEL0C01560"
                     /locus_tag="TDEL_0C01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680208.1"
                     /db_xref="GeneID:11500380"
     CDS             268152..269108
                     /gene="TDEL0C01560"
                     /locus_tag="TDEL_0C01560"
                     /inference="similar to DNA sequence:INSDC:YBL068W,YER099C"
                     /note="similar to Saccharomyces cerevisiae PRS4 (YBL068W)
                     and PRS2 (YER099C); ancestral locus Anc_7.391"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680256.1"
                     /db_xref="GeneID:11500380"
                     /db_xref="GOA:G8ZRA3"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:G8ZRA3"
                     /translation="MSSNSIKLLAGNSHPELAEVISKRLGIPLSKVGVYQYSNKETSV
                     TIGESIRDEDVYIIQTGTGEQEINDFLMELLIMIHACKTASVRRVTAVIPNFPYARQD
                     KKDKSRAPITAKLIANLLQTAGCDHVITMDLHASQIQGFFHIPVDNLYAEPSVLNYIK
                     TKTDLANAILVSPDAGGAKRVASLADKLDLNFALIHKERQKANEVSKMVLVGDVTGKS
                     CLLIDDMADTCGTLVKATNTLMDHGAKEVIAIVSHGIFSGAARERLKNSRLSRIVCTN
                     TVPVDLDLDILDQIDISPTLAEAIRRLHNGESVSYLFTHAPL"
     gene            complement(<269169..>271466)
                     /gene="TDEL0C01570"
                     /locus_tag="TDEL_0C01570"
                     /db_xref="GeneID:11500381"
     mRNA            complement(<269169..>271466)
                     /gene="TDEL0C01570"
                     /locus_tag="TDEL_0C01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680209.1"
                     /db_xref="GeneID:11500381"
     CDS             complement(269169..271466)
                     /gene="TDEL0C01570"
                     /locus_tag="TDEL_0C01570"
                     /inference="similar to DNA sequence:INSDC:YBL067C,YER098W"
                     /note="similar to Saccharomyces cerevisiae UBP13 (YBL067C)
                     and UBP9 (YER098W); ancestral locus Anc_7.390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680257.1"
                     /db_xref="GeneID:11500381"
                     /db_xref="GOA:G8ZRA4"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G8ZRA4"
                     /translation="MLKRWLSKSNKKKSVRDDLDANSQLTPEVEDRDEAYESTDSLSK
                     PLPVRINERRKTSATLVNNQAHDPPFNDRLAMLDGYTGSDTMQSLLSTSVDTAIDLNS
                     SGLLFTKITESMPFGDGSNKVFGYENFGNTCYCNSVLQCLYNLTEFRLLLLQHLERDP
                     KIKRKRKSEMPGNNPRFFTEGSFQPASNGNSGHDNGSNGHPHHAHGHHHQQQSNGRSI
                     DGSTINPGSNGNVHHESNDHHNGSEGPSENEDHTKNHSNSDNSKPNFLQRRNSSFLLK
                     KFEFSGKETMTIPIDTSSKSQTHGPEPVHATLMASDVISEKLHEDSRNVVVGRPLPSK
                     TEPAETSQSVPISTVKPAETMTRLGSEEVVTNNVPTNSHTTQKVFSSEQRKKAALIRG
                     PILNVDHLLNESKVSNLYNSLKDIFECITENHSLTGVVSPISFVETLKRENLLFNTTM
                     HQDAHEFLNFLLNELSEYIQKDIDSIQDPAKKYDNFINGLFQGTLTYRIKCLTCDNVT
                     SRDEPFLDFPIEVQDDEETDIQALLRSYQQREMLSGSNKFYCDECCGLQEAERKVGLK
                     QLPHTLALHLKRFKYSEEQNCNIKLFNKIHYPLKLDVCSSFCSSVSKKYELTGIVVHM
                     GGGPQHGHYVSLCKNDNFGWLLFDDETVEAVHESTVSKFIGDRDSLTTAYVLFYKEIA
                     QSENQDLSREPKDYEDNIEQLIKCDDLIRSTSLKAAAQKESSPGVEETQEYDKVSQNA
                     ERKTSSSSSKKSRPKSKLFNFMRNT"
     gene            complement(<272178..>275687)
                     /gene="TDEL0C01580"
                     /locus_tag="TDEL_0C01580"
                     /db_xref="GeneID:11500382"
     mRNA            complement(<272178..>275687)
                     /gene="TDEL0C01580"
                     /locus_tag="TDEL_0C01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680210.1"
                     /db_xref="GeneID:11500382"
     CDS             complement(272178..275687)
                     /gene="TDEL0C01580"
                     /locus_tag="TDEL_0C01580"
                     /inference="similar to DNA sequence:INSDC:YBL066C"
                     /note="similar to Saccharomyces cerevisiae SEF1 (YBL066C);
                     ancestral locus Anc_7.389"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680258.1"
                     /db_xref="GeneID:11500382"
                     /db_xref="GOA:G8ZRA5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G8ZRA5"
                     /translation="MGTPPEFKREDPDAGNDPEVGSATTSVELRKLKRQSSPDFQSDL
                     PHRAKKPQRSKSEDLENVSGSPSPTHLELKPQNTNNGSQQMTTGHRPVTSCTHCRQHK
                     IRCNASENFPAPCSRCERMGLHCEIDPQFRPKKGSQLQNLRRDVDELKLKIEYLTRNE
                     SLIAKALQGNELGQELTKTLKAIDISKINQLFIKPRQRLLQRPLRKNVLEQKPPERKV
                     SVQTFLAREPHLLQEDPKPSSTSSPNDGHSIRCDTSMKQPYLLNDSAPHKDSLPPVLQ
                     MALQRNTSVCETSTDASELNSPANSSISSHSASKKSTHSRLSDEKSGDKDASIANKKS
                     PVVATTNAIPLLPSPYASIDEFVIGDVRISIDKANELHRIFVTKYLPYFPIFSSNSAT
                     ELYSQSQLLFWTVMLTACLSDPEPSLYMKLSSLIKQLAIETCWIRTPRSTHISQALLI
                     LCIWPLPNQKVLDDCSYRFVGLAKSLSYQLGLHRGEFISEFTRTQTSMPDAEKWRTRT
                     WLGIFFAELCWASILGLPPTSQTDFLIENARFGQDEEDSDTSQNHSDKDLKNNQEGTN
                     SEDQSSTGGNTNAKNGSGDQQKQEKSLESDGNKLPRSFRRLICLANFQAKLCKVMGSS
                     VVSVDGLMESRDRASSLAILERELELLDRKLNFEQDTGVQIYHLYVKLMVCCFAFLPG
                     TPTEDQSQYVTEAYLGATKIVTLLTSLLETRQLIELPIYIRHSTTFAALILFKLQLTP
                     LLLNKYLDSARQSIVTVHRVYRNQLSAWATAVENDISRTASVLEKLNFVLITHPTVFV
                     EEDGIISRMRSHLTDSLFYDLVWCIHEARRREMDPKYNEEALAKASSKRKTNGDDFLP
                     TTDRKLHPLPFYNQISKEDFETIIQTTPNGTTVTKLVPTKTALKNARQLAKANKDSDG
                     AIVEINGIPLSMLDETGSVNLESIPNYVNRQAFTVGLDKPAQPVGSSNFPSTLQVANK
                     TPLGSTEPISQQPSPSVVPRNAESDNEESRATSFDIAAVKVAKDNMSMQRSSSTSAAH
                     VPHRVDSGITSMKPHSNSLFVMNNSLASNLTLNRSIPQSQRPSQSAAARSTSLSEATA
                     RSPNSDSFTNLSMFLQSASPNFNPAETAHVGSGNNSVNRPAIGQLSDLETFFQQQSTG
                     WIEGNSVNDDFLGWFDMNMEPEF"
     gene            complement(<275920..>276669)
                     /gene="TDEL0C01590"
                     /locus_tag="TDEL_0C01590"
                     /db_xref="GeneID:11500383"
     mRNA            complement(<275920..>276669)
                     /gene="TDEL0C01590"
                     /locus_tag="TDEL_0C01590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680211.1"
                     /db_xref="GeneID:11500383"
     CDS             complement(275920..276669)
                     /gene="TDEL0C01590"
                     /locus_tag="TDEL_0C01590"
                     /inference="similar to DNA sequence:INSDC:YBL064C"
                     /note="similar to Saccharomyces cerevisiae PRX1 (YBL064C);
                     ancestral locus Anc_7.388"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680259.1"
                     /db_xref="GeneID:11500383"
                     /db_xref="GOA:G8ZRA6"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR019479"
                     /db_xref="InterPro:IPR024706"
                     /db_xref="UniProtKB/TrEMBL:G8ZRA6"
                     /translation="MFSRALFQSRQSLLQRQQPLKIAVRTLRNFKQEDQPRLRINTVV
                     PNFDAETTKGKINFHDYLGDSWGVFFSHPADFTPVCTTELGAFSKLKPEFDKRGVKLI
                     GLSAEDVESHKKWIKDIEEVNGLNKFEFPIIADVDKEIAFLYDMVDEEGFKQLGKAPV
                     ATIRSVFIIDPSKKLRISFTYPPSVGRNTSEVLRVIDALQKADAKGVVTPINWQEGED
                     VIIPPTVSDADASKKFGDYKTVKPYLRYTKA"
     gene            <276912..>280229
                     /gene="TDEL0C01600"
                     /locus_tag="TDEL_0C01600"
                     /db_xref="GeneID:11500384"
     mRNA            <276912..>280229
                     /gene="TDEL0C01600"
                     /locus_tag="TDEL_0C01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680212.1"
                     /db_xref="GeneID:11500384"
     CDS             276912..280229
                     /gene="TDEL0C01600"
                     /locus_tag="TDEL_0C01600"
                     /inference="similar to DNA sequence:INSDC:YBL063W"
                     /note="similar to Saccharomyces cerevisiae KIP1 (YBL063W);
                     ancestral locus Anc_7.387"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680260.1"
                     /db_xref="GeneID:11500384"
                     /db_xref="GOA:G8ZRA7"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:G8ZRA7"
                     /translation="MKGSTSGMSGIGESTRRKTVFGAPLARPRESEQQEGRVSSNMRV
                     YVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAGSLSHSKRTYTFDQVFGAESDQ
                     ETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISILGDLDSQDKILLGEH
                     SGIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLLAESEQEEENIRIFDNNSG
                     FNCNKNVKQLVKLDGSSHRTSSASSSSSSIMVKGMEEFYIKSAHEGLELLMTGSLKRK
                     VAATKCNDLSSRSHTVFTITTNVARTDPVSNEQYIKIGKLNLVDLAGSENINRSGAEN
                     KRAQEAGLINKSLLTLGRVINALVDNSQHIPYRESKLTRLLQDSLGGKTKTCIIATIS
                     PAKISMDETVSTLEYATRAKSIKNTPQVNQSMSKNSCLGEYIHEIERLRQELKASRQK
                     EGMYITEDQFQLYESNSILVEEQKVRIQNMEDQILKFKAKYVEQTNLSKDAEKRLKQS
                     QLLCKKLSIEKAEMSENFQSFRQTCTEYVDSVEDIHRSNLELIRSLKDERDDLFGKSV
                     ESGNMISSLIADNIRQGKNLSKLNSSLQAYSSKYDQVSAGVFEEMESNVIFHKNAIVG
                     QLSSISLDTFMTNIRSMHSALIKVFSELQTYRFDEKGIIFSAHRSILNQCYRRVCHFM
                     TMLDSSFSGLVHGLRQASELSLDEVDKLGDSYSGRACEVIEAQKRHIEDMENKLCRKS
                     QALEKSNAHILSLQEYFAENIMKQRSKIFDDLKKAVETAEGHQLSLEEDVLKKSIDTL
                     QIVKNEMCTEHVTSLHEMAELGTSSLNSFSELVKSFRNKLSQLSHGSTDRLSHLLATN
                     SITKELHDFKKAIVIECSDHKSQSLVEKIDELNTRISSHVEAVILESSDAISESSNKV
                     SAASGQAKQRLENAVSELDALCEYLMANYKENFNQITKTQDRIISDHCADVQLSIATL
                     ENFAQHFDVPTQPRIKVEVSNSFGSQLPKLRSPGKSDKQEEWQNGTENENVCSPTRNH
                     LIFNPSTPVPVPDQPLSKVLLPRSINSNAKRPTMLPIDLKKPQITYNNNLKRRFTTEP
                     VIERDDAQEKRPRSGGT"
     gene            complement(<280415..>282232)
                     /gene="TDEL0C01610"
                     /locus_tag="TDEL_0C01610"
                     /db_xref="GeneID:11500385"
     mRNA            complement(<280415..>282232)
                     /gene="TDEL0C01610"
                     /locus_tag="TDEL_0C01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680213.1"
                     /db_xref="GeneID:11500385"
     CDS             complement(280415..282232)
                     /gene="TDEL0C01610"
                     /locus_tag="TDEL_0C01610"
                     /inference="similar to DNA sequence:INSDC:YBL061C,YER096W"
                     /note="similar to Saccharomyces cerevisiae SKT5 (YBL061C)
                     and SHC1 (YER096W); ancestral locus Anc_7.386"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680261.1"
                     /db_xref="GeneID:11500385"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G8ZRA8"
                     /translation="MHPYKRHLLQSSNCTLEKPEGEDQPSAYGSMVSLHNPSEPVDTR
                     ERWVQEVAEPPNKVSERQATSSPSSNGSSLNVGSVRSKRTRSVDLSHMYLLNGSLDTQ
                     LTFTNESVADMSHQAVSKYLGEDSNTSLVPRLKTIEMYRENVKKSKDANLLFQFAQYM
                     LQTALTMDDNEQPVGGSESMNQSELKRKFLKEAVHYLRKLSVKGYADAQYLLGDVCAS
                     GALGKVENKEAFTLFQAAAKHGHIESAYRTAYCFEEGLGTTRDSRKALDFLKFAASRN
                     HPSAMYKLGLYSFYGRMGLPTDVNTKQNGIKWLSRAAARANELTCAAPYELAKIYQNG
                     FIDIIIPDEKYATELYIQAATLGHAPSSTLLGQIYETGNDTIQQDTSLSVHYYTQAAL
                     KGDPVAMLGLCAWYLIGAEPAFAKDENEAFQWALRAATAGFPKAQFTLGYFYEKGKGC
                     ESNMDNAWKWYEKAAKNKDPRALAKMKQREPVKDQLSLNKKHKKSKSVSTINLFKSFD
                     GSSSENWDDQTKPSGLFTDPDQSNQGNSSANEIVQAQPGPQINSTTVPIKQALNPSQN
                     VPQEKKNLKKLKIRQRLCLDVEDILQCIYGYKTRHINGL"
     gene            complement(<282411..>283595)
                     /gene="TDEL0C01620"
                     /locus_tag="TDEL_0C01620"
                     /db_xref="GeneID:11500386"
     mRNA            complement(<282411..>283595)
                     /gene="TDEL0C01620"
                     /locus_tag="TDEL_0C01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680214.1"
                     /db_xref="GeneID:11500386"
     CDS             complement(282411..283595)
                     /gene="TDEL0C01620"
                     /locus_tag="TDEL_0C01620"
                     /inference="similar to DNA sequence:INSDC:YER095W"
                     /note="similar to Saccharomyces cerevisiae RAD51
                     (YER095W); ancestral locus Anc_7.385"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680262.1"
                     /db_xref="GeneID:11500386"
                     /db_xref="GOA:G8ZRA9"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010995"
                     /db_xref="InterPro:IPR011941"
                     /db_xref="InterPro:IPR013632"
                     /db_xref="InterPro:IPR016467"
                     /db_xref="InterPro:IPR020587"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZRA9"
                     /translation="MSQTREAFQDTPSQNQQLSLMSTAPADPSSVAQSPVRFTPSGAA
                     NGEYVESSEGPAALENNEQEEEEDVALVSFVPLEKLQINGITSADLKKLRESGLHTVE
                     AVAYAPRKHLMEIKGISEAKADRLLGEAARLVPMGFVTAADFHLRRSEMICLTTGSKN
                     LDTLLGGGIETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTF
                     RPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQIRLLDAAAQMMSESRFSLIVVDSV
                     MALYRTDFSGRGELSARQMHLAKFMRALQRLADQFGVAVVVTNQVVAQVDGGMSFNPD
                     PKKPIGGNIMAHSSTTRLGFKKGRGCQRLCKVVDSPCLPEADCVFAIYEDGVGDPREE
                     DE"
     gene            <285367..>287142
                     /gene="TDEL0C01630"
                     /locus_tag="TDEL_0C01630"
                     /db_xref="GeneID:11500387"
     mRNA            <285367..>287142
                     /gene="TDEL0C01630"
                     /locus_tag="TDEL_0C01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680215.1"
                     /db_xref="GeneID:11500387"
     CDS             285367..287142
                     /gene="TDEL0C01630"
                     /locus_tag="TDEL_0C01630"
                     /inference="similar to DNA sequence:INSDC:YBL060W"
                     /note="similar to Saccharomyces cerevisiae YBL060W;
                     ancestral locus Anc_7.384"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680263.1"
                     /db_xref="GeneID:11500387"
                     /db_xref="GOA:G8ZRB0"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR023394"
                     /db_xref="UniProtKB/TrEMBL:G8ZRB0"
                     /translation="MGAGGRSYMVESPKISDIHGLVNEERSEGVAVQIAQGTFDEVDY
                     RDYANYLGAEDMLETLRSFIGILRPLPESLLESLRRLVSEIYFIAEAQNIDRILEELS
                     RQWVEEHPHSFWGCHYKLCHIVFFSLLILNSDLYNDNSVGKFSRSQFIENTLYALNKE
                     AKATGYTLDEVEFLIEEQLGAYYDQLKSAGLPLCTREASRPSSRSNLQLHRRSSRFSM
                     RSATLNTLEITESNNASLGSGSSSKAIQRESNFTSNWKFHHNKPLPRLYYVEAFGHPG
                     SGPLWSIDAMIRLCDGDLTRSKPEDETRRDPKALFKWFARSKPKSLFEDIKLPMAFLD
                     GRTRWIKTRVRVFEGRIYIFRLKSASGPRAEAQQDLDCLRRNSSQYFVYNLFEAVATV
                     VQENVVQSHGLLTKDHCLRGNFTLTLPSGLQTGTTVLEFQTHTVSEAYDFVQCINCWA
                     ARITSVPTTQLEIVSNEEYGWSQQLLTSGIEPQNLDKLRLSHWKPLLSMGALYDELND
                     TTDQPDLETRLSDLKNFTQILQQEIDNHNRIKSSMIDLWGQSKQFDTALENWNKKYLY
                     LNEISEKSSKYLQALQLAHNTFQQQ"
     gene            <287368..>287985
                     /gene="TDEL0C01640"
                     /locus_tag="TDEL_0C01640"
                     /db_xref="GeneID:11500388"
     mRNA            <287368..>287985
                     /gene="TDEL0C01640"
                     /locus_tag="TDEL_0C01640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680216.1"
                     /db_xref="GeneID:11500388"
     CDS             287368..287985
                     /gene="TDEL0C01640"
                     /locus_tag="TDEL_0C01640"
                     /inference="similar to DNA sequence:INSDC:YER094C"
                     /note="similar to Saccharomyces cerevisiae PUP3 (YER094C);
                     ancestral locus Anc_7.383"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680264.1"
                     /db_xref="GeneID:11500388"
                     /db_xref="GOA:G8ZRB1"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8ZRB1"
                     /translation="MSDPSSINGGIVVAMAGKDCVAIASDLRLGSQSLGVSNKFEKIF
                     HYGHVFLGITGLATDVTTLSETFRYKTNLYKLREDRPIEPETFTQLVSSTLYERRFGP
                     YFVGPVVAGINSKTEKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEA
                     EDLFETISQALLNAADRDALSGWGAVVYIIKKDKVVKRYLKTRQD"
     gene            complement(<288055..>288438)
                     /gene="TDEL0C01650"
                     /locus_tag="TDEL_0C01650"
                     /db_xref="GeneID:11500389"
     mRNA            complement(join(<288055..288347,288405..>288438))
                     /gene="TDEL0C01650"
                     /locus_tag="TDEL_0C01650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680217.1"
                     /db_xref="GeneID:11500389"
     CDS             complement(join(288055..288347,288405..288438))
                     /gene="TDEL0C01650"
                     /locus_tag="TDEL_0C01650"
                     /inference="similar to DNA sequence:INSDC:YBL059C-A"
                     /note="similar to Saccharomyces cerevisiae YBL059C-A;
                     ancestral locus Anc_7.382"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680265.1"
                     /db_xref="GeneID:11500389"
                     /db_xref="InterPro:IPR013892"
                     /db_xref="UniProtKB/TrEMBL:G8ZRB2"
                     /translation="MHPQLESKRFNSCYDLIVALDKCHQKEYYKRIFGLCNNEKDALT
                     KCLHDARLAGERDLIKQRREERKAVENKWKKIDEEEYGEDAILKKILERHQAKKSVSS
                     KPADSK"
     gene            <288552..>289072
                     /gene="TDEL0C01660"
                     /locus_tag="TDEL_0C01660"
                     /db_xref="GeneID:11500390"
     mRNA            join(<288552..288717,288777..>289072)
                     /gene="TDEL0C01660"
                     /locus_tag="TDEL_0C01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680218.1"
                     /db_xref="GeneID:11500390"
     CDS             join(288552..288717,288777..289072)
                     /gene="TDEL0C01660"
                     /locus_tag="TDEL_0C01660"
                     /inference="similar to DNA
                     sequence:INSDC:YBL059W,YER093C-A"
                     /note="similar to Saccharomyces cerevisiae YBL059W and
                     YER093C-A; ancestral locus Anc_7.381"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680266.1"
                     /db_xref="GeneID:11500390"
                     /db_xref="UniProtKB/TrEMBL:G8ZRB3"
                     /translation="MSEAITTPTITERQISTFSDEYKKRRKQQMLRFFGATALTLISC
                     RLAYRGVKSRKYVPNMFQLNYKSPPFSYQAEAASALVFGTGLAVGGFSMLVFGSCWLS
                     DISSFPEFSLKAKQLMGQDPISDSKLTNMPLDDDTAKVVDQLERLLEGKNK"
     gene            <289258..>293388
                     /gene="TDEL0C01670"
                     /locus_tag="TDEL_0C01670"
                     /db_xref="GeneID:11500391"
     mRNA            <289258..>293388
                     /gene="TDEL0C01670"
                     /locus_tag="TDEL_0C01670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680219.1"
                     /db_xref="GeneID:11500391"
     CDS             289258..293388
                     /gene="TDEL0C01670"
                     /locus_tag="TDEL_0C01670"
                     /inference="similar to DNA sequence:INSDC:YER093C"
                     /note="similar to Saccharomyces cerevisiae TSC11
                     (YER093C); ancestral locus Anc_7.380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680267.1"
                     /db_xref="GeneID:11500391"
                     /db_xref="GOA:G8ZRB4"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR028267"
                     /db_xref="InterPro:IPR028268"
                     /db_xref="InterPro:IPR029451"
                     /db_xref="InterPro:IPR029452"
                     /db_xref="InterPro:IPR029453"
                     /db_xref="UniProtKB/TrEMBL:G8ZRB4"
                     /translation="MPSLHSSPVDDLVRPRSNTVNTTNGDCLGIGNTHSGKKNRQNLV
                     LSTSFISTQRLDNNATESPASPLQARRPRTSVSKALLAIRNEIGELQQQLVQARKNKE
                     DTERIRDSTPSEIYKGIYSTDHLHKHSMRIRANSQIREQDKTIRKLERQIADRKQQYE
                     QAKGAKELSVRNSDRLQVEPTFSASTGQWGKSQDDLDERSALDEDRKLVGTDTLTGEE
                     GEDEDEDDVVFEHVNEPDEQTPSDGDASPLPKRGAGEVSNTSHIETATWLVSDYMQSL
                     QDTNLTPEFVVKKANGLVSLLKDQPEIRTNLVLSSFMSSLQNLLLCDSKTIASAAYRV
                     CRYLINDVSFIEWLLLLRLDSFIVISLAKDNSYQVEREQALKLVRAFLDYGAEIPKGI
                     VQAIISCVEKQDDSLRHMALETLLEMCFIDPDVVNKCDGMRVLEGILREYSLFPLASI
                     ILDTVFELMSVNATRKYFLGDFNISVLTSVFSDTNTKDSLNLERMQNASVLISKALKD
                     YNGLMLFSMDNFKPLKELLSFFQVPFCAQFLVDIFLDVLRIKKIPYKGSKGPFKLVAS
                     HFAHESMLLNQHVALLVLIMYQGGFIDQIGKLISRYENDNSSSILISKVRYLLSEYLN
                     LAMNLLTTDISFANKVTPAWKVSQYNEAFEFGKISYSMNKHRNTLGMTGIDYGKNVRE
                     FSQSMKGKAMGREVDDAKFRKMVYDSRVLQTKDFSKWNWNLIMELVEGPLLNVKQLDE
                     LVKSTKFIRRLLIFYRPLRLRFSAIDKGARLSQRYIQVGCEFFRMLTSTSVGLKILMD
                     DTKIISQLALLLYRAMDGHTSGNIINDYTLDKKLVSGYFKFIGVLTQSSNGIQVLKRW
                     NFFTVFYKMFQADSPISVRFLQLTLPELDLKYSGHCKTIVGKALVIPNEEIRIKATEN
                     LGEKLMELSKFNRNIDDVGMIDERTNLQRYVMDMLTRQLYDLSPKVVAAADQSLYDCM
                     MVDECSQEIISSLKTSLKQMVFIRSPLLFELLGTPHGFQLLNEINFIEAERKSWLESK
                     NKEYVLLAEDFLTANQYTTFHARSREIGQNERLPQHFYGSLAKTEDGIALIGKSGDLL
                     YFINTIKRYTNDLNTQTFENGDEILELKSAIWCVGYIGSTELGVGLLDNYELVEELTQ
                     IAYGASETMVRFTAFSALGLLSKTLEGCEILDETGWTCCCNVQGTPIGISLPKRLDKL
                     LSFSEKPWSMQGEYKEEMIEFDSRHGELVGEVQPIKLNLELLLTEKNKIENPLDDDTY
                     AGDSIREAEHYFTAEQAGTISKNYETEEEKVLDEILETVSQLGNHILSNNAINGITEM
                     NNKYGPKLFESEIIFLKIMDMMAKYRFKPHVRKFLCDLFINKKALENVIRRDRKRN"
     gene            complement(<293385..>293717)
                     /gene="TDEL0C01680"
                     /locus_tag="TDEL_0C01680"
                     /db_xref="GeneID:11500392"
     mRNA            complement(<293385..>293717)
                     /gene="TDEL0C01680"
                     /locus_tag="TDEL_0C01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680220.1"
                     /db_xref="GeneID:11500392"
     CDS             complement(293385..293717)
                     /gene="TDEL0C01680"
                     /locus_tag="TDEL_0C01680"
                     /inference="similar to DNA sequence:INSDC:YER092W"
                     /note="similar to Saccharomyces cerevisiae IES5 (YER092W);
                     ancestral locus Anc_7.379"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680268.1"
                     /db_xref="GeneID:11500392"
                     /db_xref="GOA:G8ZRB5"
                     /db_xref="InterPro:IPR020366"
                     /db_xref="UniProtKB/TrEMBL:G8ZRB5"
                     /translation="MEGEFKKLLSRNDELSKQEATLKKEYSTLLRKISSLACVLGKTE
                     AEVETDEPRLISEAAVARAPALQWYNEQISLIQSLSQEDGNVPIPPELAESYKLSRDT
                     PLLHRDLH"
     gene            <294416..>296722
                     /gene="TDEL0C01690"
                     /locus_tag="TDEL_0C01690"
                     /db_xref="GeneID:11500393"
     mRNA            <294416..>296722
                     /gene="TDEL0C01690"
                     /locus_tag="TDEL_0C01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680221.1"
                     /db_xref="GeneID:11500393"
     CDS             294416..296722
                     /gene="TDEL0C01690"
                     /locus_tag="TDEL_0C01690"
                     /inference="similar to DNA sequence:INSDC:YER091C"
                     /note="similar to Saccharomyces cerevisiae MET6 (YER091C);
                     ancestral locus Anc_7.378"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680269.1"
                     /db_xref="GeneID:11500393"
                     /db_xref="GOA:G8ZRB6"
                     /db_xref="InterPro:IPR002629"
                     /db_xref="InterPro:IPR006276"
                     /db_xref="InterPro:IPR013215"
                     /db_xref="UniProtKB/TrEMBL:G8ZRB6"
                     /translation="MVQSAILGFPRIGPNRELKKITEAYWKGKTTVDELFKVGKEIRS
                     ANWKLQKDAGVDIIPSNDFSFYDQVLDLSLLFNVIPERYAKYDLPSIDTLFAMGRGLQ
                     RKATETEKAVDVTALEMVKWFDSNYHYVRPTFSHSTQFKLNGQKPVDEFLEAKQLGIQ
                     TRPVLLGPVSYLFLGKADKDSLDLEPLSLLEKLLPLYVEILSKLKEAGATEVQLDEPI
                     LVLDLPQEVQSAIKKAYEFFGSKAGSLPNITLATYFGTVVPNLNALKNLPIAGLHFDF
                     VRAPQQFDDVLSIVGANQKLSVGVVDGRNIWKNDFAKSSELVNKAIKKLGADRVVVAT
                     SSSLLHTPVDLENEAKLNPEIKDWFSFATQKVKEVVVVAKNVSGQDVSAELQANAKSV
                     AARASSKITNNDTVQKRVAAIDDNMAKRAAPFDARLAEQKKRFHLPLFPTTTIGSFPQ
                     TKDIRINRNKFNKGTITAEEYEKFINAEIETVIRFQEEIGLDVLVHGEPERNDMVQYF
                     GEQIDGYTFTTNGWVQSYGSRYVRPPIIVGDLSRPKPMSVKESVYAQSITTKPVKGML
                     TGPVTCLRWSFPRNDVDQETQALQLALALRDEVNDLEAAGIRVIQVDEPAIREGLPLR
                     AGAERSAYLKWAAEAFRVATSGVANDTQIHSHFCYSDLDPNHIKALDADVVSIEFSKK
                     DDPNYIAEFKSYPNHIGLGLFDIHSPRVPSTEEFISKIQAILNSYPAEKFWVNPDCGL
                     KTRDWEETKLSLTHMVEAAKHFREQYKK"
     gene            <297260..>298432
                     /gene="TDEL0C01700"
                     /locus_tag="TDEL_0C01700"
                     /db_xref="GeneID:11500394"
     mRNA            <297260..>298432
                     /gene="TDEL0C01700"
                     /locus_tag="TDEL_0C01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680222.1"
                     /db_xref="GeneID:11500394"
     CDS             297260..298432
                     /gene="TDEL0C01700"
                     /locus_tag="TDEL_0C01700"
                     /inference="similar to DNA sequence:INSDC:YBL058W"
                     /note="similar to Saccharomyces cerevisiae SHP1 (YBL058W);
                     ancestral locus Anc_7.377"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680270.1"
                     /db_xref="GeneID:11500394"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR012989"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8ZRB7"
                     /translation="MSGVSDDSIQQFMALANCSLAVAQKYLEEFGDLTEALNAYYAAE
                     SDPTSGERARHTPVPERTPISRAASTTSTQSAAGTNRSGSGGSGNRSKFMSFADMVKG
                     QTDDDDDDPNRNTFAGGETSGLEVTDPNDSNSLIKDLLEKDQKRTPSNNQMNHQWRRN
                     LVHHFTGRGYKLGSAVDAPSEVTADVAEEALPARPQKVTREITFWKEGFQVGDGPLYR
                     YDDPANSFYLNELNQGRAPLKLLDVQFGQEVDVNVYKKLEESYQPPKRKIGGFTGHGQ
                     RLGSPIPGDFGSTSVEPGQPQAETSPNTQEEVKKEEPKGDSSVQIRYASGKREVYRCY
                     STDTVQSLYDHVRENTQDNTRKFTLNYAFPVKPLENFGASLKEAGLINTVVVQRWV"
     gene            complement(<298509..>299144)
                     /gene="TDEL0C01710"
                     /locus_tag="TDEL_0C01710"
                     /db_xref="GeneID:11500395"
     mRNA            complement(<298509..>299144)
                     /gene="TDEL0C01710"
                     /locus_tag="TDEL_0C01710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680223.1"
                     /db_xref="GeneID:11500395"
     CDS             complement(298509..299144)
                     /gene="TDEL0C01710"
                     /locus_tag="TDEL_0C01710"
                     /inference="similar to DNA sequence:INSDC:YBL057C"
                     /note="similar to Saccharomyces cerevisiae PTH2 (YBL057C);
                     ancestral locus Anc_7.376"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680271.1"
                     /db_xref="GeneID:11500395"
                     /db_xref="GOA:G8ZRB8"
                     /db_xref="InterPro:IPR002833"
                     /db_xref="InterPro:IPR023476"
                     /db_xref="UniProtKB/TrEMBL:G8ZRB8"
                     /translation="MNHLNSNFPVFFAVAAASLVTGYYLGQILPSASRTSQVQEILRQ
                     CKQKAELNSQEQQNESSDYDGDEETEEEEDEDYEINSISLNDVPGEVRMALVIRQDLG
                     MQKGKVAAQCCHAALSCFRMIACDSGRESYNPQMVQRWLRCGQAKITLKCPDKETMDE
                     LYAKAISLGVNACVIHDAGRTQIAAGSATVLGVGPAPKAVLDQITGELKLY"
     gene            complement(<299296..>300816)
                     /gene="TDEL0C01720"
                     /locus_tag="TDEL_0C01720"
                     /db_xref="GeneID:11500396"
     mRNA            complement(<299296..>300816)
                     /gene="TDEL0C01720"
                     /locus_tag="TDEL_0C01720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680224.1"
                     /db_xref="GeneID:11500396"
     CDS             complement(299296..300816)
                     /gene="TDEL0C01720"
                     /locus_tag="TDEL_0C01720"
                     /inference="similar to DNA sequence:INSDC:YER090W"
                     /note="similar to Saccharomyces cerevisiae TRP2 (YER090W);
                     ancestral locus Anc_7.375"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680272.1"
                     /db_xref="GeneID:11500396"
                     /db_xref="GOA:G8ZRB9"
                     /db_xref="InterPro:IPR005256"
                     /db_xref="InterPro:IPR005801"
                     /db_xref="InterPro:IPR006805"
                     /db_xref="InterPro:IPR015890"
                     /db_xref="InterPro:IPR019999"
                     /db_xref="UniProtKB/TrEMBL:G8ZRB9"
                     /translation="MISSVKVQPDLDTLRQLQDDNDASVNMYPVYAFLSGVDLTPHVA
                     YLRLAQLNDPKRSESFLLESAKSATELDRYSFIGVAPRKVIKTGPLEGVEVDPLDVLE
                     KEMSGYKLAENVPGLPKLSGGAIGYISYDCVRYFEPKTRKPLKDVLQVPEAYFMMSDT
                     VVAFDHVFQRFQIIHNINIDETTLEEGYKTAQEKIIDIVKRLTDFNSPVPYPVQPPIK
                     LNQDFVSNVGQEGYEAHVTKLKGHIKKGDIIQAVPSQRVARPTSLHPFNIYRHLRTVN
                     PSPYLFYIDCLDFQIIGASPELLCKSDNKNKVITHPIAGTVKRGKTTEEDDILAAQLS
                     SSLKDRAEHIMLVDLARNDVNRICDPKTTNVDKLLTVQRFSHVQHLVSQVSGTLREDK
                     TRFDALRSIFPAGTVSGAPKVKAMELIAELEGERRGVYAGAVGNWSYDGKTMDTCIAL
                     RTMVFKDGVAYLQAGGGIVYDSDEYDEYIETMNKMMANNATIVQAEEVWASRVGSV"
     gene            <301202..>302608
                     /gene="TDEL0C01730"
                     /locus_tag="TDEL_0C01730"
                     /db_xref="GeneID:11500397"
     mRNA            <301202..>302608
                     /gene="TDEL0C01730"
                     /locus_tag="TDEL_0C01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680225.1"
                     /db_xref="GeneID:11500397"
     CDS             301202..302608
                     /gene="TDEL0C01730"
                     /locus_tag="TDEL_0C01730"
                     /inference="similar to DNA sequence:INSDC:YBL056W,YER089C"
                     /note="similar to Saccharomyces cerevisiae PTC3 (YBL056W)
                     and PTC2 (YER089C); ancestral locus Anc_7.374"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680273.1"
                     /db_xref="GeneID:11500397"
                     /db_xref="GOA:G8ZRC0"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:G8ZRC0"
                     /translation="MGQILSNPVIDKEHHSGEDRLTAFGLCAMQGWRMSMEDAHVVQP
                     NVLNASHKDHIALYSIFDGHGGSSVAQYCGEKIMSILQRQESFKKGDLAQALIDTYLQ
                     TDEDLLKDPVLRNDYSGCTATSILVSRLQNKLVCGNSGDSRTVISVNGRAKALSYDHK
                     PTLASEKSRIVAAKGFVEMDRVNGNLALSRAIGDFEFKSNSDLPPHEQIVTAVPDVIE
                     HKLDYNDDEFVVLACDGIWDCLSSQECVDLVHYGISQGDMSLNDISSRIIDVCCSPTT
                     EGTGIGCDNMSISVVALLRDEETPEQWFERIRAKNYHIATSFESRRRQVFAYYQFPKD
                     NASVFEVTTKKPQDRFSQDNAAQALSTSVDNDHDNVEINDTDTDSDAVTSNNKRKGGP
                     AASGSNGPVDLFSLEALLGAGGIQVSQGPNNVSYIHGSALSEMLASLSNAAAGEMVPE
                     EDDEDDDSNKNEKKIEEI"
     gene            complement(<302712..>303842)
                     /gene="TDEL0C01740"
                     /locus_tag="TDEL_0C01740"
                     /db_xref="GeneID:11500398"
     mRNA            complement(<302712..>303842)
                     /gene="TDEL0C01740"
                     /locus_tag="TDEL_0C01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680226.1"
                     /db_xref="GeneID:11500398"
     CDS             complement(302712..303842)
                     /gene="TDEL0C01740"
                     /locus_tag="TDEL_0C01740"
                     /inference="similar to DNA sequence:INSDC:YBL055C"
                     /note="similar to Saccharomyces cerevisiae YBL055C;
                     ancestral locus Anc_7.373"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680274.1"
                     /db_xref="GeneID:11500398"
                     /db_xref="GOA:G8ZRC1"
                     /db_xref="InterPro:IPR001130"
                     /db_xref="UniProtKB/TrEMBL:G8ZRC1"
                     /translation="MMSQRYYDIGLNLTDPMYRGVYNGKQYHGADVHTVISRAFERGV
                     KAALLTGSSLKESREAIALASDSELSDRGVRLKYTLGVHPCCVNEFADHDATIDNPSH
                     DEEWNQSLHLQVLQNLEPTKLKLKELYDLCQQQIMIDGGNFGAVGEIGLDYDRFYYSG
                     KEMQKIFFEEQLKMSCLVSNPKMPLFLHMRNCCDDFLAIMNKFVQGFSDVQDTFGWRS
                     IAGRNDQKPIFYQFDPERKFVTHSFTGSIDDLQRILALSSNSYIGMNGCSLKSSENLQ
                     CADQVPVDRLLLETDAPWCDIRRTHDSFKFLGDYTLPFKSVKRDKLDKVTPEDKARTM
                     VKGRNEPCNMEQVAIVVANVKDMPLNDLIETIWKNSVTVYGE"
     gene            <304284..>306029
                     /gene="TDEL0C01750"
                     /locus_tag="TDEL_0C01750"
                     /db_xref="GeneID:11500399"
     mRNA            <304284..>306029
                     /gene="TDEL0C01750"
                     /locus_tag="TDEL_0C01750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680227.1"
                     /db_xref="GeneID:11500399"
     CDS             304284..306029
                     /gene="TDEL0C01750"
                     /locus_tag="TDEL_0C01750"
                     /inference="similar to DNA sequence:INSDC:YBL054W,YER088C"
                     /note="similar to Saccharomyces cerevisiae YBL054W and
                     DOT6 (YER088C); ancestral locus Anc_7.372"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680275.1"
                     /db_xref="GeneID:11500399"
                     /db_xref="GOA:G8ZRC2"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:G8ZRC2"
                     /translation="MTVSKSTAVSSASPHLSILGTHPHPQLHSHHLKSGALASVTKAT
                     VDTTTTMGSGVESEKGPVLVDGKISKNPSSWDPQDDILLRHLKEVKKLGWKDISQYFT
                     NRTPNACQFRWRRLKSGNLKSNRTANVDVSDYPGKTNASVQEPVGPPAVASGPVPVPV
                     NSSFTSAIAIPASSSMKDHAALISAPNSASATPSLTYSRSPFSLAPPTGTNNNYSLGS
                     NNGAGSKYLKARSNSHSFTLNSFNNPASSNNGVKPSTEGENIGFIPKIIVRSRRSSFA
                     QPMATPSATTSHLTSALNTTLNTTKTRKSSFVGRSRRSSFNLSGTPSRRSSIIIAPTS
                     MNGSFSLATGSSTPKGSRRDSTVRTHRSASSSTSSSSASFMDFPPAAIQHLPRGPARV
                     HVKLQQKAQQHLQQQLPSAASWSTEEDQLLSESGSRNLSVMELSILLPNRSEREIQWR
                     LDTLSNSNSPTGSNEAAESPLHSPRKSVTAEDTAIDEDTCDEAEQGNDDDYEESVDPL
                     HHSLSPPLISKENTPASIISSTTTNDDVSSMSTDHHLHREHSNDDNKTIRNFSAQKTP
                     HISHHLLLLLPHCQA"
     gene            complement(<306152..>308440)
                     /gene="TDEL0C01760"
                     /locus_tag="TDEL_0C01760"
                     /db_xref="GeneID:11500400"
     mRNA            complement(<306152..>308440)
                     /gene="TDEL0C01760"
                     /locus_tag="TDEL_0C01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680228.1"
                     /db_xref="GeneID:11500400"
     CDS             complement(306152..308440)
                     /gene="TDEL0C01760"
                     /locus_tag="TDEL_0C01760"
                     /inference="similar to DNA sequence:INSDC:YBL052C"
                     /note="similar to Saccharomyces cerevisiae SAS3 (YBL052C);
                     ancestral locus Anc_7.371"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680276.1"
                     /db_xref="GeneID:11500400"
                     /db_xref="GOA:G8ZRC3"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G8ZRC3"
                     /translation="MKKVPNSQHSEHNEDQDDSVGAQRLQDGLGAMRANKLLRSLEIS
                     DNIHSKVARHAFDNPNGTRSTRSRHDVVEQLKPEIAIQKHINGGLEDSRTTLDTVKSF
                     KSQTSIRGIPSNIEEANLLNPNVQFISDNVGESISADFSTVKIRYNPLKFLNFQRLLR
                     ASSELQDREKNSHYRHDFNVNEPEDLAYMLDNDSAVPYRCAIANKSDYSTSKTLPSSE
                     DRELFERLLIQSSTAAYYNSNQLLANHDKMECEDDAPSRSKSKRRSIFFQSRKPQVKQ
                     TTKAAAIECIFIRDYEIETWYTTPYPEEYNRNKLLYICEFCLKYMSSRYVFHRHQLKC
                     RLFRPPGNEIYRDGKLSVWEIDGRENVIYCQNLCLLAKLFLNSKTLYYDVEPFIFYVL
                     TEREDLPQQSPRFHLVGYFSKEKLNSTDYNLSCILTIPIYQRKGYGQFLMDFSYLLSR
                     REFKWGTPEKPLSDMGLLSYRNYWGVKCAQVLMELKDLSKCDEEEYLQITLEDISNLT
                     GMIPTDVVFGLEQLRVLQQSSNNELPRYVIKIDSWEMIEKEANSWKSRGYQTLNPQKL
                     VWKPMIFGPSCGVNAVGTMVETTGATRTTLGTGNTTEDFFKRSISMLTNFLQDDIPDS
                     RPMEVGAWQKIVDREPVFLPKIQSDRYYFQDPYGIKNTFVPYEGRTASRDLSSSIEEP
                     TDISSNPVKGGFDDEQSIESEVNGTDTGQVSLPPTAFKNNQTNIGISSVEDDEPTIIG
                     GFQEDSLAEPENPQRLLRSRVV"
     gene            complement(<309215..>311113)
                     /gene="TDEL0C01770"
                     /locus_tag="TDEL_0C01770"
                     /db_xref="GeneID:11500401"
     mRNA            complement(<309215..>311113)
                     /gene="TDEL0C01770"
                     /locus_tag="TDEL_0C01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680229.1"
                     /db_xref="GeneID:11500401"
     CDS             complement(309215..311113)
                     /gene="TDEL0C01770"
                     /locus_tag="TDEL_0C01770"
                     /inference="similar to DNA sequence:INSDC:YBL051C"
                     /note="similar to Saccharomyces cerevisiae PIN4 (YBL051C);
                     ancestral locus Anc_7.370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680277.1"
                     /db_xref="GeneID:11500401"
                     /db_xref="GOA:G8ZRC4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8ZRC4"
                     /translation="MSGTDFNGSGMGVEEASMIQDSLNDIQQTMGGEDLVSNDDDVIP
                     TAIVIKNIPFAIKKEQLLDVIANLDLPLPYAFNYHFDNGVFRGLAFANFTNTNETTQV
                     LNSLNGKEIGGRKLRVEFKKMLPQAERERIEREKREKRGQLEEQHKSLSNLSLHSLGK
                     GTAGNGNMSSASNSQLFASFLNEGANANGNKSSLVTDPSLLQASGSSVSYYSNAAQQP
                     SQPSSQPSQVQQQQLPQQQQRQASAAAAAPPPLGAERFFAPLPSSATLPLPPQQLDFN
                     DPDTLEIYSQLLLFKDRERFYYELAYPLGISATHKRVINVLCSFLGLVEVYDPTFIII
                     RRKFLDQATLQSHLQQQGQGSMMNTLQPNSTGGSMNRSHSYTSLLQAHASASVAAANP
                     TTSSMASPNPNSNTAITPPGCSTSTNKMSGQPQVPSQQMTQPQSHGSQMTSSPSQLMQ
                     PTALHNPETQQSQQQSFLRQQASLTPSSRIPSGYMSNHSQLSAVNPLLRNTNISPPAG
                     NVQPNTAQHRVPPSFYSSATTSLQMPDQQQQQQQQQQQQQQQQPNALLPQHTNGSIHS
                     NFSVQSFHDDGLASVNGSEMVYTSLEHSNFGNGLEEGLSRSLSGLDLQANANGANHNN
                     PNARKALW"
     gene            <311515..>311781
                     /gene="TDEL0C01780"
                     /locus_tag="TDEL_0C01780"
                     /db_xref="GeneID:11500402"
     mRNA            <311515..>311781
                     /gene="TDEL0C01780"
                     /locus_tag="TDEL_0C01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680230.1"
                     /db_xref="GeneID:11500402"
     CDS             311515..311781
                     /gene="TDEL0C01780"
                     /locus_tag="TDEL_0C01780"
                     /inference="similar to DNA
                     sequence:INSDC:YER019C-A,YER087C-B"
                     /note="similar to Saccharomyces cerevisiae SBH2
                     (YER019C-A) and SBH1 (YER087C-B); ancestral locus
                     Anc_7.369"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680278.1"
                     /db_xref="GeneID:11500402"
                     /db_xref="InterPro:IPR016482"
                     /db_xref="UniProtKB/TrEMBL:G8ZRC5"
                     /translation="MSSTPPGGQRTLQKRRQAQNVKDKQLKQTPASTRQAGHGGSSSS
                     ILKIYTDEANGLRVDPLVVLFLAVAFIFSVVAMHVISKVTGKLF"
     gene            complement(<311853..>313538)
                     /gene="TDEL0C01790"
                     /locus_tag="TDEL_0C01790"
                     /db_xref="GeneID:11500403"
     mRNA            complement(<311853..>313538)
                     /gene="TDEL0C01790"
                     /locus_tag="TDEL_0C01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680231.1"
                     /db_xref="GeneID:11500403"
     CDS             complement(311853..313538)
                     /gene="TDEL0C01790"
                     /locus_tag="TDEL_0C01790"
                     /inference="similar to DNA sequence:INSDC:YER087W"
                     /note="similar to Saccharomyces cerevisiae YER087W;
                     ancestral locus Anc_7.368"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680279.1"
                     /db_xref="GeneID:11500403"
                     /db_xref="GOA:G8ZRC6"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002316"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004500"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:G8ZRC6"
                     /translation="MLRLPPAYRSYHVFQPRKLSKETLKSLPTHELLQTLGFVRQSQS
                     GLVNWLPMGLRSLTKIENIIRRRMNNDGKAMEVQLSTLSPKSLWETTGRWSNTELFKL
                     KDAKKASYCLTPTCEEDITALMKNYISSYKDLPLLVYQITKKYRDELRPRGGLLRGRE
                     FLMKDAYSFATSKEEAIGIFERVNSVYAKIFTDLKIPFLSAWADSGDIGGDLSKEYHY
                     IHPSGEDTLMKCEDCGMSSNVEKCESFPIENGEHLGDVDVQYTLSKDHGTLVCLYYPR
                     GRQLNWNLALESLDHDLDSSIREKSNKDILEIFQESNEDVMFAKVLRVMDCRLNSRSN
                     FPDFPLKQYLKNNFGKIDDVSLVDAIENEVCGSCNEGHLKAFKTIEVGHTFHLGTKYS
                     KLLEAKFTDRENKSSIIEMGCFGIGVSRLLGAIGEITRDERGFRWPTSVAPYTVSVCV
                     APGNESLSHQIKEQLDMSFEDDVMYSFNDKMGLGARINYSHAIGIPICVIAGPKNWPN
                     VELEIRGNNYGNESWKQEYETAKDTLKWQITGDKHIVPIESLRKVISIIARDL"
     gene            complement(<313699..>315408)
                     /gene="TDEL0C01800"
                     /locus_tag="TDEL_0C01800"
                     /db_xref="GeneID:11500404"
     mRNA            complement(<313699..>315408)
                     /gene="TDEL0C01800"
                     /locus_tag="TDEL_0C01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680232.1"
                     /db_xref="GeneID:11500404"
     CDS             complement(313699..315408)
                     /gene="TDEL0C01800"
                     /locus_tag="TDEL_0C01800"
                     /inference="similar to DNA sequence:INSDC:YER086W"
                     /note="similar to Saccharomyces cerevisiae ILV1 (YER086W);
                     ancestral locus Anc_7.367"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680280.1"
                     /db_xref="GeneID:11500404"
                     /db_xref="GOA:G8ZRC7"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001721"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR005787"
                     /db_xref="UniProtKB/TrEMBL:G8ZRC7"
                     /translation="MLVSPIRTAMNRQVGRPLLLQLRANFHQQQHLSPELVKLHSELK
                     LDELQPDNTPDYVRLVLRSSIYDVISESPISHGVGLSSRLNTNVQLKREDLLPVFSFK
                     LRGAYNMIAKLDDSQKNQGVIACSAGNHAQGVAFAAKHMSIPATIVMPVSTPSIKYQN
                     VSRLGSQVVLYGNDFDEAKAECTRLSEERGLTNIPPFDHPYVIAGQGTVAMEILRQVR
                     NSAKIGAVFVPCGGGGLVAGIGAYLKRIAPHIKIIGVETFDSATLHTSLKNGKRTPLA
                     SVGTFADGTSVRMIGEETFRIAQDVVDEVVLVGTDEICAAIKDIFEDTRGIVEPSGAL
                     AVAGMKKYVTQLHPEIEHSKHTYVPILSGANMNFDRLRFVSERAVLGEGKEVFMLVTI
                     PDVPGSFKKLQKVIHPRAVTEFSYRYNEHRHESTSEVPKAYIYTSFSVVDREKEIKQV
                     MQQIHSLGFEAVDISDNEMAKSHGRYLVGGASKVPNERVISFEFPERPGALTRFLGGL
                     TESWNLTMFHYRNHGADIGKVLVGISVPPRENLTFQKFLEDLGYRYQDESDNMVYQKF
                     LKY"
     gene            <316946..>318418
                     /gene="TDEL0C01810"
                     /locus_tag="TDEL_0C01810"
                     /db_xref="GeneID:11500405"
     mRNA            <316946..>318418
                     /gene="TDEL0C01810"
                     /locus_tag="TDEL_0C01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680233.1"
                     /db_xref="GeneID:11500405"
     CDS             316946..318418
                     /gene="TDEL0C01810"
                     /locus_tag="TDEL_0C01810"
                     /inference="similar to DNA sequence:INSDC:YLR190W"
                     /note="similar to Saccharomyces cerevisiae MMR1 (YLR190W);
                     ancestral locus Anc_7.366"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680281.1"
                     /db_xref="GeneID:11500405"
                     /db_xref="InterPro:IPR013712"
                     /db_xref="UniProtKB/TrEMBL:G8ZRC8"
                     /translation="MNSPPLKPEQLSPTLSPMAFSLDDPSNGNGFSHLLASPTKLKLD
                     SGCGGPNMNNNGGSNGHSLIYRTSLSKLSELSRTGRSRQRSNSDTLRSNSPIRFQLFN
                     NAPKMLKPEYMSQQPSTLPLLSTLMKQSATGMASNSNKEAKNHQAEIATRAGIRETLK
                     KYQDQQLQLSKQTDESKQQRQVDAKVEQQPKVPEAMIQPVPERNISESASAISGMTLC
                     DKQRDPDETMKVKATTPKPNEEEVRVISSSSLVSSAVSIDFNNLPKELDLDALASDKN
                     GFVQSDDFKRCSFISSTSTDYDADWYNNQPVITHEETAKLDHRIKQLELEIEEMKLQN
                     EKLIQSITTSRTVEDIFVYDAIHEIKSSRQEAQRGVQRKVMQLEKKVENYRKVMKTLG
                     DSPIKKAASKDKRSTYPMGENPQISTLRKRISRISSTELRQIEEQGSSSSSDDEKEIQ
                     QHEPNHDDTPLLRPQQDASLSFRRKAGFQLNIQVEPLGES"
     gene            <318850..>320019
                     /gene="TDEL0C01820"
                     /locus_tag="TDEL_0C01820"
                     /db_xref="GeneID:11500406"
     mRNA            <318850..>320019
                     /gene="TDEL0C01820"
                     /locus_tag="TDEL_0C01820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680234.1"
                     /db_xref="GeneID:11500406"
     CDS             318850..320019
                     /gene="TDEL0C01820"
                     /locus_tag="TDEL_0C01820"
                     /inference="similar to DNA sequence:INSDC:YLR191W"
                     /note="similar to Saccharomyces cerevisiae PEX13
                     (YLR191W); ancestral locus Anc_7.365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680282.1"
                     /db_xref="GeneID:11500406"
                     /db_xref="GOA:G8ZRC9"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007223"
                     /db_xref="UniProtKB/TrEMBL:G8ZRC9"
                     /translation="MSANAKPRPKPWETSAPLDGGVSSPDLGSMTRVATGANDHDVPD
                     SSPDAPPRPAAMNTENLNDPMSSSYRNGQYGGNYGAGIYGNSMMGNGLYGGNSMFGGG
                     YGSMHGSGYGSMYGGGTYGSLYGNGYGGGYMGGMNGAQGLGESTQATFQLIESLIGAV
                     AGFAQMLESTYMATHNSFFSMISVAEQFSYLKEILGSFFGIFAMMKFLRRGLYYLTRG
                     RIGTPPKSISNKSKDGKSKNSRMLEEFERFKNNEKGEPKKKRISWKPLIFLLAAVFGF
                     PYLLNKFIAKVQSMQNMRIGSQPNQQIDPSKLEFARALYDFTPENPQMEVTLKKGDLM
                     AIMSKQDSLGRDSEWWKVRTKSGDIGYVPFNYIEIIRRQKKIERVQDELNELQQI"
     gene            complement(<320092..>320538)
                     /gene="TDEL0C01830"
                     /locus_tag="TDEL_0C01830"
                     /db_xref="GeneID:11500407"
     mRNA            complement(<320092..>320538)
                     /gene="TDEL0C01830"
                     /locus_tag="TDEL_0C01830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680235.1"
                     /db_xref="GeneID:11500407"
     CDS             complement(320092..320538)
                     /gene="TDEL0C01830"
                     /locus_tag="TDEL_0C01830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680283.1"
                     /db_xref="GeneID:11500407"
                     /db_xref="UniProtKB/TrEMBL:G8ZRD0"
                     /translation="MLSRSYLNVSRTVLYRPSMVIAQRSAFHTTRFTQKSATEVVKEK
                     LDTLNKKIGQVAAEGIEKTQEATHKAGDVAQEAKEKASQKLGETEELSRSSKAELKDK
                     AQSTMGRAEDKAEDLGKKAENVGKDVKKGAARNIEDAQDYVDKKTK"
     gene            complement(<320888..>322624)
                     /gene="TDEL0C01840"
                     /locus_tag="TDEL_0C01840"
                     /db_xref="GeneID:11500408"
     mRNA            complement(<320888..>322624)
                     /gene="TDEL0C01840"
                     /locus_tag="TDEL_0C01840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680236.1"
                     /db_xref="GeneID:11500408"
     CDS             complement(320888..322624)
                     /gene="TDEL0C01840"
                     /locus_tag="TDEL_0C01840"
                     /inference="similar to DNA sequence:INSDC:YDL174C"
                     /note="similar to Saccharomyces cerevisiae DLD1 (YDL174C);
                     ancestral locus Anc_7.364"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680284.1"
                     /db_xref="GeneID:11500408"
                     /db_xref="GOA:G8ZRD1"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR016171"
                     /db_xref="UniProtKB/TrEMBL:G8ZRD1"
                     /translation="MISKKALLLGYKTVTRGSFGNFRFSRAYSQGSTGGSGSSKRWFG
                     YCLAGAVGYAVADTVEYNSKVRELLGVKTTSEPEIGSTLPLNQLGPAEYCTDEKKLEQ
                     VVSELKKVFKDDKEHFTETKSDLDDHSDTYFNTHHPSADQRPRIVLFPSTTEEVSRLM
                     KICYDNNVPVVPYSGGTSLEGHYISTRGRSTVMIDVSKFMNHIVKLNKTDLDVEVQAG
                     VPWEDLNDFLGDHGLLFGCDPGPGAQIGGCVANSCSGTNAYRYGTMKENVVNLTIVLP
                     DGTVVKTKGRPRKSSAGYNLNGLFIGSEGTLGLVTEATVKCHVKPVLETVVVAAFPTV
                     GDAAACSSNITQEGIQLNAMELLDDEMMKLINSSGATFRTDWKEHPTMFFKIGARNDN
                     IAQQVIKELQRIAEKHKASSFEFATEDDEKLELWEARKVALWSVIDASKTKNKNANVW
                     TTDVAVPLSNFAQVIEETKEEMNKSPLINAIVGHAGDGNFHAFIVYNNDQEKKICEEI
                     VDNMVRRAIDAEGTCTGEHGVGIGKRKFLLEELGDAPVDLMRKIKLAIDPKRILNPDK
                     IFKIDPNEPEVH"
     gene            complement(<322863..>323669)
                     /gene="TDEL0C01850"
                     /locus_tag="TDEL_0C01850"
                     /db_xref="GeneID:11500409"
     mRNA            complement(<322863..>323669)
                     /gene="TDEL0C01850"
                     /locus_tag="TDEL_0C01850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680237.1"
                     /db_xref="GeneID:11500409"
     CDS             complement(322863..323669)
                     /gene="TDEL0C01850"
                     /locus_tag="TDEL_0C01850"
                     /inference="similar to DNA sequence:INSDC:YLR192C"
                     /note="similar to Saccharomyces cerevisiae HCR1 (YLR192C);
                     ancestral locus Anc_7.363"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680285.1"
                     /db_xref="GeneID:11500409"
                     /db_xref="GOA:G8ZRD2"
                     /db_xref="InterPro:IPR013906"
                     /db_xref="InterPro:IPR023194"
                     /db_xref="UniProtKB/TrEMBL:G8ZRD2"
                     /translation="MSWDDDVIGGSAATGDDNVLLASWDDELGDEPVMESWDAPEEPK
                     SEPKPKSKPASGKKSKAKSVEPEQKLMAIDVLDEKTRQELIKKAELDSDLNNAADLFA
                     GLGVAEEHPRAAALRREQEALAAAAATALTKDTPIENHPLFQTAETKKDYQDLRKAVS
                     TAVVSMHEKSSLNYASSLAIDLIRDVAKPMSIESIRQTIATLNILMKDKEREERQARL
                     ARVKGGTAQGGAGKKKAKGAKANLGGAFKKDQQFDMGEVEFDDFGDDDFM"
     gene            <324240..>324758
                     /gene="TDEL0C01860"
                     /locus_tag="TDEL_0C01860"
                     /db_xref="GeneID:11500410"
     mRNA            <324240..>324758
                     /gene="TDEL0C01860"
                     /locus_tag="TDEL_0C01860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680238.1"
                     /db_xref="GeneID:11500410"
     CDS             324240..324758
                     /gene="TDEL0C01860"
                     /locus_tag="TDEL_0C01860"
                     /inference="similar to DNA sequence:INSDC:YDL173W"
                     /note="similar to Saccharomyces cerevisiae YDL173W;
                     ancestral locus Anc_7.362"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680286.1"
                     /db_xref="GeneID:11500410"
                     /db_xref="InterPro:IPR022024"
                     /db_xref="UniProtKB/TrEMBL:G8ZRD3"
                     /translation="MTTYNVSTGRGGAGNIQKTNAKASPRLVPQGSQTPSILQPVFST
                     GRGGAGNMRRNVDAKLTRRAQDVEDEEDDFIGPQGEDDYIEPLSGDNIEVAVSNALSS
                     RSRGASSRDNVHKVRSKANSALDERPAIVVGRGGAGNIISPVASRKGQTKKKKQTQEK
                     KGLWSSLKKLFS"
     gene            complement(<324830..>331252)
                     /gene="TDEL0C01870"
                     /locus_tag="TDEL_0C01870"
                     /db_xref="GeneID:11500411"
     mRNA            complement(<324830..>331252)
                     /gene="TDEL0C01870"
                     /locus_tag="TDEL_0C01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680239.1"
                     /db_xref="GeneID:11500411"
     CDS             complement(324830..331252)
                     /gene="TDEL0C01870"
                     /locus_tag="TDEL_0C01870"
                     /inference="similar to DNA sequence:INSDC:YDL171C"
                     /note="similar to Saccharomyces cerevisiae GLT1 (YDL171C);
                     ancestral locus Anc_7.361"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680287.1"
                     /db_xref="GeneID:11500411"
                     /db_xref="GOA:G8ZRD4"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR002489"
                     /db_xref="InterPro:IPR002932"
                     /db_xref="InterPro:IPR006005"
                     /db_xref="InterPro:IPR006982"
                     /db_xref="InterPro:IPR009051"
                     /db_xref="InterPro:IPR012220"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="InterPro:IPR028261"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8ZRD4"
                     /translation="MRTMMLKSDRFDPLEEAYEGGTPLRQQAAASGSTTNKSWANTMP
                     GRCGLYEPDYEKDACGVGFVANIRGTPSHKIVADARFLLCNMTHRGAVSSGGNGDGAG
                     ILVGIPHEFMKREFMLDLGVEVPSSGEYAVGNVFFKRDQELEQLQQAKDVFEEMADSL
                     DLKVLGWRNVPRDSTILGEVALSREPAIWQPMVVLKSGEFNERVFQTKLYILRKQVTE
                     RIGIENWFYACSLSNRTIVYKGQLTPAQVYSYYYDLNNAHFESHMALVHSRFSTNTFP
                     SWDRAQPLRWLAHNGEINTLRGNKNWMRAREGVLSSETFKEQLDLLYPIIEEGGSDSA
                     ALDNVLELLTINGTLSLPEAIMMMVPEAYHKDMDSNLKAWFDWAACLMEPWDGPALLT
                     FTDGRYCGAMLDRNGLRPCRYYVTSDDRVICASEVGVIHIDNSIVLQKGKLKPGDLFL
                     VDTDKGEIVDTKKLKCEFAKRKDFKSWLSKVIKLDDLLIKNKKLIPAQFITDVSNVKV
                     QTDPRLLANGYTFEQVSLLLTPMALTGKEALGSMGNDAPLACLNEDPVLVYDYFKQLF
                     AQVTNPPIDPIREANVMSLECYVGPQGNLLEMHPSQCDRLLLKSPILHWNEFHALQNI
                     ERVHPSWSIANIDITFPKTDGLLGYTATIEHITQLASDSIEQGKKILILSDRNLGPQR
                     ISISSLVAVGAIHHHLIRNKQRSQVAIILETSEAKEVHHFCVLLGYGCDGIFPYLAME
                     TLVRMNHEGLIRNNDDDDVRVDDFTLLENYKHAIDGGILKVMSKMGISTLASYKGAQI
                     FEALGVDNSVIDVCFAGTASRIKGVTFEYLAQDAFSLHERGYPSRSIVNKSVALPESG
                     DYHWRDGGYKHVNDPTAIASLQDSVRNKNENAWEMYVRKEMEAIRDCTLRGLLELDYE
                     SSTAIPLEQVEPWTEIARRFATGAMSYGSISMEAHSTLAIAMNRLGAKSNCGEGGEDA
                     ERSIVHENGDTMRSAIKQVASARFGVTSYYLSDADEIQIKIAQGAKPGEGGELPAHKV
                     SKDIAKTRHSTPYVGLISPPPHHDIYSIEDLKQLIYDLKCSNPRAGISVKLVSEVGVG
                     IVASGVAKAKADHILVSGHDGGTGAARWTSIKNAGLPWELGLAETHQTLVLNDLRRNV
                     VVQTDGQLRTGFDIAVAVLLGAESFTLATIPLIAMGCVMLRRCHLNSCAVGIATQDPY
                     LRSKFEGQPEHVINFFYYLIQDLRKIMAKLGFRSIDEMVGHSEKLRKRANVNTKSINI
                     DLSPILTPAHIIRPGVDTRFRKKQDHKLHTRLDNKLIDEAEVTLDRGLPVTIDAEIIN
                     TDRALGSTLSYRVSKRFGENGLPQDTVVVNIQGSAGQSFGAFLTRGITFILDGDANDY
                     VGKGLSGGTLVIRPPKGSNFKSDENVIVGNTCFYGATSGTAFISGNAGERFAVRNSGA
                     TIVVEKIMGNNAFEYMTGGRAVVLSQMESLNAFSGATGGIAYCLTSDYDDFVGKINHD
                     TVELETLSDPVEIAYVKNLILEHYNYTKSELASKILGNFNYYLKNFVKVIPTDYKKVL
                     LKQAADKIKEKQLSTSEYLKRFQRTANGKADATNGEVDAMVSAKKKENSISYKSTAVE
                     PKVVDLEDAIPNADQLGKNADKVEKLEKNRGFMKYKVRHESKRSPAARTKDWKEFANT
                     LGKKDAKYQTARCMECGTPFCQSDTGCPVSNIIPKFNDLVFKNQWKLAYDKLTETNNF
                     PEFTGRVCPAPCEGACTLGIIEDPVGIKSIERLIIDNAFKEGWVQPTPPESRTGRSVA
                     IIGSGPAGLACADQLNKAGHYVTVYERADRCGGLLMYGIPNMKLDKSVVERRVQLLAA
                     EGIQFVTNTEIGKDVAIEELKSQFDAVVYAIGSTIPRDLPIKGRELKNIDFAMTLLKN
                     NTSAFLQKDMETIRQSLAGKKVIVIGGGDTGNDCLGTSVRHGAASVLNFELLPEPPKQ
                     RAKDNPWPQWPRVMRVDYGHAEVKEHYGRDPREYCILSKEFIGNDEGEVTAIKTVRVE
                     WKKSESGVWQMVEIPGSEEIFEADVVLLSMGFVGPELFEDPSVNKTKRGTIGTLNDAS
                     YSVDGASTYAAGDCRRGQSLIVWAIQEGRKCAASIDENLMGDTYLPGSGGIVRRDYKL
                     LEELAATV"
     gene            <332932..>334554
                     /gene="TDEL0C01880"
                     /locus_tag="TDEL_0C01880"
                     /db_xref="GeneID:11500412"
     mRNA            <332932..>334554
                     /gene="TDEL0C01880"
                     /locus_tag="TDEL_0C01880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680240.1"
                     /db_xref="GeneID:11500412"
     CDS             332932..334554
                     /gene="TDEL0C01880"
                     /locus_tag="TDEL_0C01880"
                     /inference="similar to DNA sequence:INSDC:YDL170W"
                     /note="similar to Saccharomyces cerevisiae UGA3 (YDL170W);
                     ancestral locus Anc_7.360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680288.1"
                     /db_xref="GeneID:11500412"
                     /db_xref="GOA:G8ZRD5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:G8ZRD5"
                     /translation="MAGPRKHSRTGCVTCKVRKKRCSEDRPICNDCDRLGFTCVYLPK
                     TSNRQVLSRYKAQVEQELLGKKNHRRVDEDEVALDGEIVSLGEDPYLSQPLADPLMSQ
                     LDPVGVHLYSYYRTHLAQIISIAPTRQNYYLQVFLPMAHQHAGILNGIMAWSAHHLSI
                     TTENGEGAEQQRDSSYLELANKYTLKSLERLRSEETNSETFLWTLAQVLVLCAAEICQ
                     GDVKKWKILLKFGAGLIEKNVGSDISKLLSLRSSQSTMPHLDSRTRYWLLANFIYHDI
                     MCSQGTFFATEQYRKVLYQQEQETPSVSTETLHLDPLHGINRPILLYLGDITNLMRKM
                     KQSSLPFNKDHPQFREYMEAAHDLEMKLHQAVPNVTDLKAYRETSSDNDLCLHLFRLM
                     QTAALIHLKTTCLKYSKYCLEIQYLWTLLSDRLDLVLGTKLEGSLCFPMFICGINCMD
                     KEQRDLVEWRFNNIMKRYKCYNFQRARIIMRKVWNHENVDVSDLRSDSVSSHSSDNSE
                     FMFDLTNKDWYDIVDEMGWDISLPKVSICHII"
     gene            complement(<334629..>335159)
                     /gene="TDEL0C01890"
                     /locus_tag="TDEL_0C01890"
                     /db_xref="GeneID:11500413"
     mRNA            complement(<334629..>335159)
                     /gene="TDEL0C01890"
                     /locus_tag="TDEL_0C01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680241.1"
                     /db_xref="GeneID:11500413"
     CDS             complement(334629..335159)
                     /gene="TDEL0C01890"
                     /locus_tag="TDEL_0C01890"
                     /inference="similar to DNA sequence:INSDC:YLR193C"
                     /note="similar to Saccharomyces cerevisiae UPS1 (YLR193C);
                     ancestral locus Anc_7.359"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680289.1"
                     /db_xref="GeneID:11500413"
                     /db_xref="InterPro:IPR006797"
                     /db_xref="UniProtKB/TrEMBL:G8ZRD6"
                     /translation="MVLWHKNTHVFDNDFATVSLAFFNRYPNPYASHVLSIDTLSRET
                     DSNGHLHTTRLIKKSGKLPRWSKTFLGKITDSWIIERSVVDPSRAVMKTYTKNLDHTR
                     IIQVEEYTTYHREENSSKTFVTSEVKFSSGFQLGVKNKIEDWSRSKFDENIKKSRLGM
                     AFVMQQLQNRGEFLSS"
     gene            complement(<335287..>335898)
                     /gene="TDEL0C01900"
                     /locus_tag="TDEL_0C01900"
                     /db_xref="GeneID:11500414"
     mRNA            complement(<335287..>335898)
                     /gene="TDEL0C01900"
                     /locus_tag="TDEL_0C01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680242.1"
                     /db_xref="GeneID:11500414"
     CDS             complement(335287..335898)
                     /gene="TDEL0C01900"
                     /locus_tag="TDEL_0C01900"
                     /inference="similar to DNA sequence:INSDC:YLR194C"
                     /note="similar to Saccharomyces cerevisiae YLR194C;
                     ancestral locus Anc_7.358"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680290.1"
                     /db_xref="GeneID:11500414"
                     /db_xref="UniProtKB/TrEMBL:G8ZRD7"
                     /translation="MKIFRQILFSTLLTFTTATNFGMLGQNPQNSDDSTSASASTKEK
                     SSTSIDPTTTEHTSSVEKSISPETTPETTPDSTTMEKTITYADDPLTTIVTTDEMGRT
                     TTKPVWWLPSTTAISSESASASESESGSSKIVTTVPKTIESTVSGKLTTITTQQVLTT
                     LASHQSVSTSSNSTVSIHSNAGKNLVVNCGLAGSLAMAIVHLL"
     gene            complement(<336087..>337451)
                     /gene="TDEL0C01910"
                     /locus_tag="TDEL_0C01910"
                     /db_xref="GeneID:11500415"
     mRNA            complement(<336087..>337451)
                     /gene="TDEL0C01910"
                     /locus_tag="TDEL_0C01910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680243.1"
                     /db_xref="GeneID:11500415"
     CDS             complement(336087..337451)
                     /gene="TDEL0C01910"
                     /locus_tag="TDEL_0C01910"
                     /inference="similar to DNA sequence:INSDC:YLR195C"
                     /note="similar to Saccharomyces cerevisiae NMT1 (YLR195C);
                     ancestral locus Anc_7.357"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680291.1"
                     /db_xref="GeneID:11500415"
                     /db_xref="GOA:G8ZRD8"
                     /db_xref="InterPro:IPR000903"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR022676"
                     /db_xref="InterPro:IPR022677"
                     /db_xref="InterPro:IPR022678"
                     /db_xref="UniProtKB/TrEMBL:G8ZRD8"
                     /translation="MSAEQNQKLAELLELLKLNNGDISKLTQEQRKEMKDYKFWKTQP
                     VTRLDESVDKEGPIDRKKTPEEISELPLPLLGDFEWCTVDVTDQNQLEDVFLLLNENY
                     VEDRDSTFRFKYTREFFNWSLRSPGWKKDWHVGVRVRSSKKLVAFISAIPVDLKVREN
                     TVRSVEINFLCVHKQLRGKRLTPVLIKEITRRVNRCDIWYALYTSGTVLPSPVSVCRY
                     THRPLNWGKLHEVGFTHMPSHATRMQMNAKYALPEKTNTDGLRPMEEKDLAQAHQLLE
                     AYQARFDLVQTFTKEEFKHWFLGNDEGTENTEKVIFSYVVEKDGKITDFFSFYSLPFT
                     ILNNSVHKELGIGYLFYYASDADLEYSDRFSKEATETLKKRLCSLMNDACILARDAKM
                     DVFNALTSQDNTLFLDPLKFGPGDGFLNFYLFNYRAFPITGGIKEDKTYDTQKRSNVG
                     VVML"
     gene            <337685..>339376
                     /gene="TDEL0C01920"
                     /locus_tag="TDEL_0C01920"
                     /db_xref="GeneID:11500416"
     mRNA            <337685..>339376
                     /gene="TDEL0C01920"
                     /locus_tag="TDEL_0C01920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680244.1"
                     /db_xref="GeneID:11500416"
     CDS             337685..339376
                     /gene="TDEL0C01920"
                     /locus_tag="TDEL_0C01920"
                     /inference="similar to DNA sequence:INSDC:YLR196W"
                     /note="similar to Saccharomyces cerevisiae PWP1 (YLR196W);
                     ancestral locus Anc_7.356"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680292.1"
                     /db_xref="GeneID:11500416"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8ZRD9"
                     /translation="MISATTWVPRGFASEFPEKYELDDEEMERINQLAQLNLEDARAD
                     LQEAEEEEVNTDKLNDELALDDDLKEYDLENYDADEQEGGAEVSMFPGLSNEDVTFHE
                     GEDGKDPYISLPTQEETAEDRQELQVYPTDNMILATRTEDDVSYLDVYVYDDGAGFHD
                     NSIPVEQGDEADPDVKRGLVRDSALYVHHDLMLPAFPLCVEWLNYKPGSNSEDPANFA
                     AIGSFDPQIEIWNLNCVEKAFPDVILGEPEDQTAPTKKKKKSKGGKKHITTHHTDAVL
                     SLTHNKQFRSVLASTSADHTVKLWDLNSATAARSMASIHSGKNVSSSEWHTTNGSVLL
                     TGGYDSRIALSDVRIPDETKMSKYWSVVPGEDVETVTFADENIMLCGTDSGNIYSFDI
                     RNNENSKPVWTLKAHDAGISSLCANRYIPGLMSTGAMGEKTVKLWKFPLTNESNKGPS
                     MVLSRDFDVGNVLSVSYAADIEVAGNMVVGGVNKGLKLWDVFTNRTVRRMFSNELGAL
                     QQRARGEANQLGKSSRIARKYTKNDNPETMITVDDQRDDDPDEEKDDGDDWESMN"
     gene            complement(<339450..>340010)
                     /gene="TDEL0C01930"
                     /locus_tag="TDEL_0C01930"
                     /db_xref="GeneID:11500417"
     mRNA            complement(<339450..>340010)
                     /gene="TDEL0C01930"
                     /locus_tag="TDEL_0C01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680245.1"
                     /db_xref="GeneID:11500417"
     CDS             complement(339450..340010)
                     /gene="TDEL0C01930"
                     /locus_tag="TDEL_0C01930"
                     /inference="similar to DNA sequence:INSDC:YDL169C"
                     /note="similar to Saccharomyces cerevisiae UGX2 (YDL169C);
                     ancestral locus Anc_7.355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680293.1"
                     /db_xref="GeneID:11500417"
                     /db_xref="UniProtKB/TrEMBL:G8ZRE0"
                     /translation="MSRCFLSKLMRESETCMVYSGAYHSNLPNTNNFSIASSQSQGFT
                     WNQDLFASQYQQMCKVVYDGHEDTLEELIETIKEKYKLLGSHCAEDDDKMVYEDDDEA
                     LTDCENDEFNHGRTLRFFRRSNSGYSLRPRISEEFNRPRRISERSISFVSDSKNGNYN
                     RSDIAVIDVEADTPENNHLKWLISPS"
     gene            <340658..>342190
                     /gene="TDEL0C01940"
                     /locus_tag="TDEL_0C01940"
                     /db_xref="GeneID:11500418"
     mRNA            <340658..>342190
                     /gene="TDEL0C01940"
                     /locus_tag="TDEL_0C01940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680246.1"
                     /db_xref="GeneID:11500418"
     CDS             340658..342190
                     /gene="TDEL0C01940"
                     /locus_tag="TDEL_0C01940"
                     /inference="similar to DNA sequence:INSDC:YLR197W"
                     /note="similar to Saccharomyces cerevisiae SIK1 (YLR197W);
                     ancestral locus Anc_7.354"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680294.1"
                     /db_xref="GeneID:11500418"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR012974"
                     /db_xref="InterPro:IPR012976"
                     /db_xref="UniProtKB/TrEMBL:G8ZRE1"
                     /translation="MAPIQYLLFEEPTGYAIFKVKLQQDNIGSRLGEVQEQINDFGSF
                     TKLVELVSFAPFKGAAEALENANDISEGLVSESLKAILDLNLPKGSKKETVTLGISDR
                     NLGPSIKEEFPYVDSVSNELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRA
                     KVKFSVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQL
                     VLFVKDKASLNDESLHDLAAILNDDAAIAQRVIDNARISMGQDLSETDMENVCVFAER
                     VASLADYRRQLYEYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQI
                     LGAEKALFRALKTKGNTPKYGLIYHSGFIAKAATKNKGRISRYLANKCSMASRIDNYS
                     DEPTNVFGTVLRKQVEQRLEFYSTGQPTLKNELAIKEAMDLYNEGKPEEEPKVEEKKS
                     KKRSKDESEDEEEQENKKVKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKDKKK
                     KD"
     gene            complement(<342242..>343121)
                     /gene="TDEL0C01950"
                     /locus_tag="TDEL_0C01950"
                     /db_xref="GeneID:11500419"
     mRNA            complement(join(<342242..343057,343116..>343121))
                     /gene="TDEL0C01950"
                     /locus_tag="TDEL_0C01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680247.1"
                     /db_xref="GeneID:11500419"
     CDS             complement(join(342242..343057,343116..343121))
                     /gene="TDEL0C01950"
                     /locus_tag="TDEL_0C01950"
                     /inference="similar to DNA sequence:INSDC:YLR199C"
                     /note="similar to Saccharomyces cerevisiae PBA1 (YLR199C);
                     ancestral locus Anc_7.353"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680295.1"
                     /db_xref="GeneID:11500419"
                     /db_xref="InterPro:IPR018855"
                     /db_xref="UniProtKB/TrEMBL:G8ZRE2"
                     /translation="MLFKQWNEIAEPRHQLDSPVIIANEGTLQTSVLPQVTLPPIDLQ
                     NFSRVILTSAIMNPLFPEKLLKSTILGDLKVILDLSSGKMALDHPMHSWNFDENFPNE
                     VDPAYVVEERSKTFELCAPIVSFGRTLLISVKENFLKTSPIFLNQIAKSVVCKLAQGA
                     FEGEVVVLGTSDQITELKPVSDKETTLNPPEFVTSFVGAVITQLIEKSLPFQGLIAPS
                     EGPVGFEKLNLVTMEELITLCHQWVDSNKEIYRNECYRRWRLDGAALGAQSGLYI"
     gene            <343261..>343584
                     /gene="TDEL0C01960"
                     /locus_tag="TDEL_0C01960"
                     /db_xref="GeneID:11500420"
     mRNA            <343261..>343584
                     /gene="TDEL0C01960"
                     /locus_tag="TDEL_0C01960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680248.1"
                     /db_xref="GeneID:11500420"
     CDS             343261..343584
                     /gene="TDEL0C01960"
                     /locus_tag="TDEL_0C01960"
                     /inference="similar to DNA sequence:INSDC:YLR200W"
                     /note="similar to Saccharomyces cerevisiae YKE2 (YLR200W);
                     ancestral locus Anc_7.352"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680296.1"
                     /db_xref="GeneID:11500420"
                     /db_xref="GOA:G8ZRE3"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="UniProtKB/TrEMBL:G8ZRE3"
                     /translation="MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKE
                     DTQVYKLTGNVLLPVEQSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIK
                     LRGAQ"
     gene            complement(<343645..>344427)
                     /gene="TDEL0C01970"
                     /locus_tag="TDEL_0C01970"
                     /db_xref="GeneID:11500421"
     mRNA            complement(<343645..>344427)
                     /gene="TDEL0C01970"
                     /locus_tag="TDEL_0C01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680249.1"
                     /db_xref="GeneID:11500421"
     CDS             complement(343645..344427)
                     /gene="TDEL0C01970"
                     /locus_tag="TDEL_0C01970"
                     /inference="similar to DNA sequence:INSDC:YLR201C"
                     /note="similar to Saccharomyces cerevisiae COQ9 (YLR201C);
                     ancestral locus Anc_7.351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680297.1"
                     /db_xref="GeneID:11500421"
                     /db_xref="GOA:G8ZRE4"
                     /db_xref="InterPro:IPR012762"
                     /db_xref="InterPro:IPR013718"
                     /db_xref="UniProtKB/TrEMBL:G8ZRE4"
                     /translation="MISKRLIAGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYK
                     VLSHTLAKSVPMYGFNERAIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKF
                     HLVDKRLNLTENISLETPVDQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLV
                     DYSMPELHRLSDDMIYFSTEKDHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETF
                     EFAREKLHRVSTLGEYYNNTEEFAWYTLLSTINLVKSQLARG"
     gene            <344639..>345796
                     /gene="TDEL0C01980"
                     /locus_tag="TDEL_0C01980"
                     /db_xref="GeneID:11500422"
     mRNA            <344639..>345796
                     /gene="TDEL0C01980"
                     /locus_tag="TDEL_0C01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680250.1"
                     /db_xref="GeneID:11500422"
     CDS             344639..345796
                     /gene="TDEL0C01980"
                     /locus_tag="TDEL_0C01980"
                     /inference="similar to DNA sequence:INSDC:YDL168W"
                     /note="similar to Saccharomyces cerevisiae SFA1 (YDL168W);
                     ancestral locus Anc_7.350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680298.1"
                     /db_xref="GeneID:11500422"
                     /db_xref="GOA:G8ZRE5"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR014183"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZRE5"
                     /translation="MSGAATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKI
                     EYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAEC
                     QKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTVVAD
                     VSVVAVDPSAPLESICLLGCGVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAK
                     VRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFD
                     CTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVTGRVWKGSAFGGIKGR
                     SEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHAGDCLRTVLDLKK"
     gene            complement(<345897..>347717)
                     /gene="TDEL0C01990"
                     /locus_tag="TDEL_0C01990"
                     /db_xref="GeneID:11500423"
     mRNA            complement(<345897..>347717)
                     /gene="TDEL0C01990"
                     /locus_tag="TDEL_0C01990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680251.1"
                     /db_xref="GeneID:11500423"
     CDS             complement(345897..347717)
                     /gene="TDEL0C01990"
                     /locus_tag="TDEL_0C01990"
                     /inference="similar to DNA sequence:INSDC:YDL167C"
                     /note="similar to Saccharomyces cerevisiae NRP1 (YDL167C);
                     ancestral locus Anc_7.349"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680299.1"
                     /db_xref="GeneID:11500423"
                     /db_xref="GOA:G8ZRE6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8ZRE6"
                     /translation="MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQ
                     IPLISLDQQGSISFQESIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGF
                     LLPSYLQHPRVFDLWKEYDRWCANHPEVLTLRKSCRTGIKRVKDQTEILKVLEMSTEE
                     ITEKPVLGYTVDILLQLCERCTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLP
                     PDTTQSELESWFTQFGARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVV
                     FQTHEEATEVLVLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQS
                     KNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQVNNKQYMNYNGNINSTNQGGN
                     IYITKVGGSPTQSHYQINTQLPQTQAVRTNANYNDQNSLKHSNSAYRFNGNNGGNSPI
                     MNYSNNRFNGQQVNNSNVNNGGSNVPFRAGDWKCPTCTYHNFAKNLVCLRCGAAKVSI
                     SDSNNDDNSVARSISNGNNNNNNNNNGNNGSIYNRYGNGSLGNLVSTASSTASSAATH
                     DLGSNKRGNGYFTKRVGNLNENELGITLNTRSSSEPKWQK"
     gene            complement(<347930..>348571)
                     /gene="TDEL0C02000"
                     /locus_tag="TDEL_0C02000"
                     /db_xref="GeneID:11500424"
     mRNA            complement(<347930..>348571)
                     /gene="TDEL0C02000"
                     /locus_tag="TDEL_0C02000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680252.1"
                     /db_xref="GeneID:11500424"
     CDS             complement(347930..348571)
                     /gene="TDEL0C02000"
                     /locus_tag="TDEL_0C02000"
                     /inference="similar to DNA sequence:INSDC:YDL166C"
                     /note="similar to Saccharomyces cerevisiae FAP7 (YDL166C);
                     ancestral locus Anc_7.348"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680300.1"
                     /db_xref="GeneID:11500424"
                     /db_xref="GOA:G8ZRE7"
                     /db_xref="InterPro:IPR020618"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZRE7"
                     /translation="MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAK
                     EHDCHDGYDEARKSYIVDEDKLLDELEPLLREGAAIVDWHVNDVFPERLIDLVVVLRC
                     DNTILYDRLKSRDYHDAKIQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEAN
                     VDRIVSWEKLWLKQHKDGQTNELLERTKGDSEEDNESEQSSEEKSPSDEEDTQ"
     gene            <348737..>349312
                     /gene="TDEL0C02010"
                     /locus_tag="TDEL_0C02010"
                     /db_xref="GeneID:11500425"
     mRNA            <348737..>349312
                     /gene="TDEL0C02010"
                     /locus_tag="TDEL_0C02010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680253.1"
                     /db_xref="GeneID:11500425"
     CDS             348737..349312
                     /gene="TDEL0C02010"
                     /locus_tag="TDEL_0C02010"
                     /inference="similar to DNA sequence:INSDC:YDL165W"
                     /note="similar to Saccharomyces cerevisiae CDC36
                     (YDL165W); ancestral locus Anc_7.347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680301.1"
                     /db_xref="GeneID:11500425"
                     /db_xref="GOA:G8ZRE8"
                     /db_xref="InterPro:IPR007282"
                     /db_xref="UniProtKB/TrEMBL:G8ZRE8"
                     /translation="MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIP
                     RDSKRHRVLDTFQSPWAETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQ
                     RVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSD
                     GLSERGSYVFFDPQRWEKCQREFLLFYNAIM"
     gene            complement(<349453..>350730)
                     /gene="TDEL0C02020"
                     /locus_tag="TDEL_0C02020"
                     /db_xref="GeneID:11500426"
     mRNA            complement(<349453..>350730)
                     /gene="TDEL0C02020"
                     /locus_tag="TDEL_0C02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680254.1"
                     /db_xref="GeneID:11500426"
     CDS             complement(349453..350730)
                     /gene="TDEL0C02020"
                     /locus_tag="TDEL_0C02020"
                     /inference="similar to DNA sequence:INSDC:YLR203C"
                     /note="similar to Saccharomyces cerevisiae MSS51
                     (YLR203C); ancestral locus Anc_7.346"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680302.1"
                     /db_xref="GeneID:11500426"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="UniProtKB/TrEMBL:G8ZRE9"
                     /translation="MMLSATSRFPSLRAQRCGKVFNQRRFIIGFVRNALGLDPPPSPD
                     DPTPENRFHPWDQSPVGDLRERAARIRTLARCPVTGKEINYTCPLSGIPTHHSREAWE
                     QDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQDFDRTVNMTNWDLFFYTRQ
                     FYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYP
                     LENKTISSTKDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQMFELHFVGPECLLNKE
                     KHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYLDVFFCFHPGFGAPE
                     TSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVDVLMEPVKNVFGS
                     TKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV"
     gene            complement(<351368..>352303)
                     /gene="TDEL0C02030"
                     /locus_tag="TDEL_0C02030"
                     /db_xref="GeneID:11500427"
     mRNA            complement(<351368..>352303)
                     /gene="TDEL0C02030"
                     /locus_tag="TDEL_0C02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680255.1"
                     /db_xref="GeneID:11500427"
     CDS             complement(351368..352303)
                     /gene="TDEL0C02030"
                     /locus_tag="TDEL_0C02030"
                     /inference="similar to DNA sequence:INSDC:YLR205C"
                     /note="similar to Saccharomyces cerevisiae HMX1 (YLR205C);
                     ancestral locus Anc_7.344"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680303.1"
                     /db_xref="GeneID:11500427"
                     /db_xref="GOA:G8ZRF0"
                     /db_xref="InterPro:IPR002051"
                     /db_xref="InterPro:IPR016053"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="UniProtKB/TrEMBL:G8ZRF0"
                     /translation="MTSVAKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFAL
                     KHGFIYRQGILAFYHIFDAVEQELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIF
                     KDLEVLYSPEYSDSESLRNFVEHQPLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLA
                     LFAGGKVMRSNLYRHTGLFPKFEYLTPKELVIRGTNFFTFSDEGSDAENKLRWKYKEG
                     YELATRQELSESQKTRILQVSSQIFDWNMDVIGEIGEMNRNELMSKFSFKLLTYLSEE
                     WKYSTILSKRSKDSIIVMAILIQFLVAYIVLRKFI"
     gene            complement(<352579..>354696)
                     /gene="TDEL0C02040"
                     /locus_tag="TDEL_0C02040"
                     /db_xref="GeneID:11500428"
     mRNA            complement(<352579..>354696)
                     /gene="TDEL0C02040"
                     /locus_tag="TDEL_0C02040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680256.1"
                     /db_xref="GeneID:11500428"
     CDS             complement(352579..354696)
                     /gene="TDEL0C02040"
                     /locus_tag="TDEL_0C02040"
                     /inference="similar to DNA sequence:INSDC:YDL164C"
                     /note="similar to Saccharomyces cerevisiae CDC9 (YDL164C);
                     ancestral locus Anc_7.343"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680304.1"
                     /db_xref="GeneID:11500428"
                     /db_xref="GOA:G8ZRF1"
                     /db_xref="InterPro:IPR000977"
                     /db_xref="InterPro:IPR012308"
                     /db_xref="InterPro:IPR012309"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR016059"
                     /db_xref="UniProtKB/TrEMBL:G8ZRF1"
                     /translation="MFRVVGRPLVELLINKGMSSGKKQATLARFFSAVQKDDTKEKVN
                     GDVKIIESRDNQDEPVTKKFKSSSPVKLQTSSLSPVKSAGVESGDKPVSPDLYYSKVP
                     YSDVCNVFQEIEGTSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPGL
                     ELGLGEGLLMKTISEACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGE
                     VFENLRAIAHSQGKDSQTRKIKLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLI
                     SLSKALLTNEGETGKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHC
                     RLRPGIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRN
                     GENMTERYPEISIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEA
                     KDVKVRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEE
                     LQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLG
                     AYYGRGKRTGTYGGFLLGCYNQDSGEFETCCKIGTGFSDEMLQQLYERFSKTTLDGPK
                     ATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDD
                     KSVEDATSSAQIVELYQDQSHVA"
     gene            <355071..>356576
                     /gene="TDEL0C02050"
                     /locus_tag="TDEL_0C02050"
                     /db_xref="GeneID:11500429"
     mRNA            <355071..>356576
                     /gene="TDEL0C02050"
                     /locus_tag="TDEL_0C02050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680257.1"
                     /db_xref="GeneID:11500429"
     CDS             355071..356576
                     /gene="TDEL0C02050"
                     /locus_tag="TDEL_0C02050"
                     /inference="similar to DNA sequence:INSDC:YDL161W,YLR206W"
                     /note="similar to Saccharomyces cerevisiae ENT1 (YDL161W)
                     and ENT2 (YLR206W); ancestral locus Anc_7.342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680305.1"
                     /db_xref="GeneID:11500429"
                     /db_xref="InterPro:IPR001026"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:G8ZRF2"
                     /translation="MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAE
                     KTYDSVEFFEIMDMIDKRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVI
                     KTLMEFRNDDDGGVDQGQIIRVKAKELTNLLSDDERLREEREMNRKGRKNGTRRRRRT
                     TGEQDGFDDDLQRALDESRLTAEEDERRRKMLGSEDDDLQAALQLSKEEEELKRLQEM
                     QKLQQQQTQQQPSQYYDIFGNPISPEEYFQYQQQQDLLAQQQREQELLAQQQEQQRLA
                     EQQYWAMQQEALAQQQALAEQQALAQQQAALQQNQWYQQQQASGYYQQPMATGSNNPF
                     ALNNLQLQQARPAQSSPVPNFTSTQAQSPPKPQPQAQPQKQAPLPQQPQQALKPVRTG
                     DLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGEPK
                     KNPFLQSQYTGIPSSNIVPAHTGYGFGNQPSQQNQAQQHQTADQGVSLIDL"
     gene            complement(<356665..>356931)
                     /gene="TDEL0C02060"
                     /locus_tag="TDEL_0C02060"
                     /db_xref="GeneID:11500430"
     mRNA            complement(<356665..>356931)
                     /gene="TDEL0C02060"
                     /locus_tag="TDEL_0C02060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680258.1"
                     /db_xref="GeneID:11500430"
     CDS             complement(356665..356931)
                     /gene="TDEL0C02060"
                     /locus_tag="TDEL_0C02060"
                     /inference="similar to DNA sequence:INSDC:YDL160C-A"
                     /note="similar to Saccharomyces cerevisiae YDL160C-A;
                     ancestral locus Anc_7.341"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680306.1"
                     /db_xref="GeneID:11500430"
                     /db_xref="GOA:G8ZRF3"
                     /db_xref="InterPro:IPR018552"
                     /db_xref="UniProtKB/TrEMBL:G8ZRF3"
                     /translation="MVDKIPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVRE
                     AVLRSSANKEQIKVEHSGAQRNSNEIVLTHEDLENITGLLLLDM"
     gene            <357422..>359851
                     /gene="TDEL0C02070"
                     /locus_tag="TDEL_0C02070"
                     /db_xref="GeneID:11500431"
     mRNA            <357422..>359851
                     /gene="TDEL0C02070"
                     /locus_tag="TDEL_0C02070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680259.1"
                     /db_xref="GeneID:11500431"
     CDS             357422..359851
                     /gene="TDEL0C02070"
                     /locus_tag="TDEL_0C02070"
                     /inference="similar to DNA sequence:INSDC:YLR207W"
                     /note="similar to Saccharomyces cerevisiae HRD3 (YLR207W);
                     ancestral locus Anc_7.339"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680307.1"
                     /db_xref="GeneID:11500431"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G8ZRF4"
                     /translation="MRITRVLSIGLALVHLASATDPWDQAKEMLRQAVKRTDPIGESI
                     KGEGSHWEHRDAALYIPMDYYQEEEERRYVLFWNEKSTEWQRTVYNLLVESSNEYDNA
                     EATYALAQLHLWGDYDFPHNKTLAFKYADKFNNLTRWTNSSILFDLAVMHSTGLFGEI
                     PVEPLKAVLCYQRAASLGDIRAKNALAYKYYTGSNVPRDCNRALLLYREIADEIRESF
                     TDEEWNVYFPYVESFDVRIPDFSDGLLGKGISLMTLSTKRMASARPDITSSFLTRMNG
                     GQIILNFGSGSNGAAFANDDDESDDRLVDIYYTAWDEYRGTYTKNRNCDAARRLLEVT
                     FTAYDSQVPYMDNLQRFFYARCLDLLGHIYFTGEAQESQNIALAEKYLKRSIEVIGKS
                     SSVRCRSNIDLGLINQYVYGNETEAIRYYKRMGSSQSNDGTVEFQLSKLSKKYPTLHL
                     GDPFALMQTAYLRGHSPSVYEFAVMTEQSINNRYSCEDTTYLLKRFVEENEVIMAPQL
                     KIAYGELLRGNAEVALWAYAQAAEQGFEAAQVSAAYILYQLPFNFEDPPRTIPERKLM
                     AISYYIRAFKQDNVDAGVVAGNIFYDMGNHTKAMSMYQSASLKFSPQAIWNLGYMYEH
                     GLGTDVDFHLAKRYYDQVLEHNPKHYLSVKLSVLKLRLKSWLTWLTGGRLKYGTIEED
                     DRTSSMAESWFSKLTSSFKKAGRENSGLPRDSESSRESRTTAAQEQQQQQQQQQESDD
                     DSIWDTLESFGLQLEDLMTIGFVLFIFLFSLVIRTLAARRGWNVRNNGMRIQINGQRP
                     RGNFDIQVFAI"
     gene            <360056..>360940
                     /gene="TDEL0C02080"
                     /locus_tag="TDEL_0C02080"
                     /db_xref="GeneID:11500432"
     mRNA            <360056..>360940
                     /gene="TDEL0C02080"
                     /locus_tag="TDEL_0C02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680260.1"
                     /db_xref="GeneID:11500432"
     CDS             360056..360940
                     /gene="TDEL0C02080"
                     /locus_tag="TDEL_0C02080"
                     /inference="similar to DNA sequence:INSDC:YLR208W"
                     /note="similar to Saccharomyces cerevisiae SEC13
                     (YLR208W); ancestral locus Anc_7.338"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680308.1"
                     /db_xref="GeneID:11500432"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZRF5"
                     /translation="MPTIANAHNNLIHDAILDYYGKRLATCSSDKTIKIFEVEGENHK
                     LVETLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWAQIAVHAVHSASV
                     NSVQWAPHEYGALLLAASSDGKVSVVEFKENGTIAPLVIDAHAIGVNAASWAPSTIQE
                     GPGAQQLRRFVTGGADNLVKIWKYNHDAQSYVLEDTLEGHSDWVRDVAWSPSVLLRSY
                     IASVSQDRTCIIWSQEHDGGPWKKSLLQQEKFPDVLWRASWSLSGNILALSGGDNKIT
                     LWKEDLQGKWEPAGEVQE"
     gene            complement(<361064..>361993)
                     /gene="TDEL0C02090"
                     /locus_tag="TDEL_0C02090"
                     /db_xref="GeneID:11500433"
     mRNA            complement(<361064..>361993)
                     /gene="TDEL0C02090"
                     /locus_tag="TDEL_0C02090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680261.1"
                     /db_xref="GeneID:11500433"
     CDS             complement(361064..361993)
                     /gene="TDEL0C02090"
                     /locus_tag="TDEL_0C02090"
                     /inference="similar to DNA sequence:INSDC:YLR209C"
                     /note="similar to Saccharomyces cerevisiae PNP1 (YLR209C);
                     ancestral locus Anc_7.337"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680309.1"
                     /db_xref="GeneID:11500433"
                     /db_xref="GOA:G8ZRF6"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR001369"
                     /db_xref="InterPro:IPR011268"
                     /db_xref="InterPro:IPR018099"
                     /db_xref="UniProtKB/TrEMBL:G8ZRF6"
                     /translation="MSSFNIDEQRQLIHSATDYLKSRLNAHFKDFGEFAPRTLIICGS
                     GLGGITTRLTTSNPEPLAITYGEIPGFKKSTVEGHTGTLIFGLMKGSPVVLMNGRLHS
                     YEGHSMHDATFPIRVLNHMGDVKTLIVTNAAGGLNPAYNSAELMCIYDHINLPGFSGL
                     HPLKGPNFDEVGPRFLPMSDAYDLELRKLLFKKKEELKIERPLHEGTYVFVSGPTFET
                     RAESRMLRSIGGDAVGMSTVPEVIIARHSGWRVLALSLVTNNCVMDKPPSVHDEHPKS
                     MDEGIASHEEVLENGKKASLDVERLIENVVTEL"
     gene            complement(<362760..>364199)
                     /gene="TDEL0C02100"
                     /locus_tag="TDEL_0C02100"
                     /db_xref="GeneID:11500434"
     mRNA            complement(<362760..>364199)
                     /gene="TDEL0C02100"
                     /locus_tag="TDEL_0C02100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680262.1"
                     /db_xref="GeneID:11500434"
     CDS             complement(362760..364199)
                     /gene="TDEL0C02100"
                     /locus_tag="TDEL_0C02100"
                     /inference="similar to DNA sequence:INSDC:YDL160C"
                     /note="similar to Saccharomyces cerevisiae DHH1 (YDL160C);
                     ancestral locus Anc_7.336"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680310.1"
                     /db_xref="GeneID:11500434"
                     /db_xref="GOA:G8ZRF7"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZRF7"
                     /translation="MSDDQSWKAQLNLPKRDTRPQTDDVLNTKGNSFEDFYLKRELLM
                     GIFEAGFEKPSPIQEESIPVAIAGRDILARAKNGTGKTAAFVIPALEKVKPKLNKIQA
                     LIMVPTRELALQTSQVVRTLGKHCGVSCMVTTGGTNLKDDIMRLNETVHILVGTPGRV
                     LDLASRKLADLSECSLFIMDEADKMLSRDFKTIIEQILIFLPQSHQSLLFSATFPLTV
                     KEFMVKHLHKPYEINLMEELTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCN
                     STNRVELLAKKITDLGYSCYYSHARMRQQERNRVFHEFRQGKVRTLVCSDLLTRGIDI
                     QAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIA
                     AIPATIDKSLYVADDASAVPVPFPIQQQHQQSQQQVHQQQYMPPQQQQQAMPPQHGYP
                     MQGIPQQGIPPQGIPPPQMQAHFAAQPQY"
     gene            <364853..>366340
                     /gene="TDEL0C02110"
                     /locus_tag="TDEL_0C02110"
                     /db_xref="GeneID:11500435"
     mRNA            <364853..>366340
                     /gene="TDEL0C02110"
                     /locus_tag="TDEL_0C02110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680263.1"
                     /db_xref="GeneID:11500435"
     CDS             364853..366340
                     /gene="TDEL0C02110"
                     /locus_tag="TDEL_0C02110"
                     /inference="similar to DNA sequence:INSDC:YDL159W"
                     /note="similar to Saccharomyces cerevisiae STE7 (YDL159W);
                     ancestral locus Anc_7.335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680311.1"
                     /db_xref="GeneID:11500435"
                     /db_xref="GOA:G8ZRF8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZRF8"
                     /translation="MMNPEVPNVFQGKSLQKRNFKQLSLATLEGRNKSTEILEPMATG
                     ATASVSLNLSLPKNDASNLYLRRGLKKKLNLDSQSIAAPMVTFDRALSTENLVAPQQQ
                     SFVVSSPTNSSPSTSTSLTQVFTPMEDDNMQKQFGETDASMGGVIRNAEPMTINSSIQ
                     LQDLVQLGKIGSGNSGTVIKALHVPDSKIVAKKVIPVENNNHLVVNQLVRELTIMKSV
                     HPHENIVSFYGAYYTQSGSNEIVILMEYMNCGSLDKILSVYGRYCQRRQNLREEPWFN
                     GLVISKISYAVLNGLSYLYEKYKIIHRDIKPSNVLINSRGQVKICDFGVSKKLINSIA
                     DTFVGTSTYMSPERIQGNVYSTKGDVWSLGLMIIELVTGEFPLGGRNDTANGILDLLQ
                     RIVNEPSPRLPSGGGYNFSREMIDFVNRCCVKDETERSSINELLCHDFIGKYRTKDKE
                     FRHWCKKVKFCLKEDKQIRREDNERAKLEKKQLEKAAEAATTARR"
     gene            complement(<366396..>366719)
                     /gene="TDEL0C02120"
                     /locus_tag="TDEL_0C02120"
                     /db_xref="GeneID:11500436"
     mRNA            complement(<366396..>366719)
                     /gene="TDEL0C02120"
                     /locus_tag="TDEL_0C02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680264.1"
                     /db_xref="GeneID:11500436"
     CDS             complement(366396..366719)
                     /gene="TDEL0C02120"
                     /locus_tag="TDEL_0C02120"
                     /inference="similar to DNA sequence:INSDC:YDL157C"
                     /note="similar to Saccharomyces cerevisiae YDL157C;
                     ancestral locus Anc_7.334"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680312.1"
                     /db_xref="GeneID:11500436"
                     /db_xref="UniProtKB/TrEMBL:G8ZRF9"
                     /translation="MSSNIVSVFNPPPQRTLSTEETMDCVPCQVMATMFSVGFGGYLA
                     AGQPFKYTDKERKKGISLQEFEKQNPKWWKNGVRGFGGALVIFGLFRGTEGWLWNKNK
                     EYKKF"
     gene            <366855..>368435
                     /gene="TDEL0C02130"
                     /locus_tag="TDEL_0C02130"
                     /db_xref="GeneID:11500437"
     mRNA            <366855..>368435
                     /gene="TDEL0C02130"
                     /locus_tag="TDEL_0C02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680265.1"
                     /db_xref="GeneID:11500437"
     CDS             366855..368435
                     /gene="TDEL0C02130"
                     /locus_tag="TDEL_0C02130"
                     /inference="similar to DNA sequence:INSDC:YDL156W"
                     /note="similar to Saccharomyces cerevisiae YDL156W;
                     ancestral locus Anc_7.333"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680313.1"
                     /db_xref="GeneID:11500437"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8ZRG0"
                     /translation="MSELSEFQKRRLENIKRNNDLLKKLNLTGAATKIKREAGINEDH
                     HPKKKKAARKPAEKRSVSPKVPKVPTRRSSRLRGQAAEGNGVPNVSDNHLMKMGRSNS
                     PDQALVDEMKDTKIVGDVKLSDLLKGEDEEELINKFKLYADRNFSSGDFFQEIRKHQG
                     KSKPQLDELQKDFDLQPYDVFQPNEIKITHDRITSMYFHPTVDKKLIIGGDTSGNIGL
                     WNVRDEPLAENGADDLEEPDITRVQLFTKNVGKIDCFPSDTSKILAASYDGFIRSIDL
                     NTLKSDQLLTLANEYGEALGVSDCQFSYEDPNILFMTTLTGEFTTMDIRSKPSKCELK
                     RLSDKKIGSFNINPSRPHEIATGSLDRTLRIWDVRKIVDKPEWSQYEDFPSYHVISTY
                     DSRLSVSAVSFSPTDNTLVCNGYDDTINLFDVSANTLPESLEPKTTIKHNCQSGRWTS
                     ILKARFKPDKNVFAIANMKRAIDIYDSQGEQLAHLNTATVPAVLGWHPLRNWIAGGNS
                     SGKVFLFTDEQDIKIEEA"
     gene            <368786..>370105
                     /gene="TDEL0C02140"
                     /locus_tag="TDEL_0C02140"
                     /db_xref="GeneID:11500438"
     mRNA            <368786..>370105
                     /gene="TDEL0C02140"
                     /locus_tag="TDEL_0C02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680266.1"
                     /db_xref="GeneID:11500438"
     CDS             368786..370105
                     /gene="TDEL0C02140"
                     /locus_tag="TDEL_0C02140"
                     /inference="similar to DNA sequence:INSDC:YDL155W,YLR210W"
                     /note="similar to Saccharomyces cerevisiae CLB3 (YDL155W)
                     and CLB4 (YLR210W); ancestral locus Anc_7.332"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680314.1"
                     /db_xref="GeneID:11500438"
                     /db_xref="GOA:G8ZRG1"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:G8ZRG1"
                     /translation="MHYSTRSMNSAVASEYSKDNKTAVDENYAGFANVKDRSNRERGY
                     QQHRVALSDVTSQISNKLHTIPSKNDITDNPDNGPIKPRVMMRNETYLTDENINSDAR
                     LESRRIDEDMNVGVVADEDEADEEEPEESDDEVKEPLSPIFDAKSKRILDQAYKECHR
                     VAPDPMDDDTYDVVMVVELSTEIFQYMRELELKYRPNANYMEDQPELKWSYRSTLIDW
                     IVQVHSRFQLLPETLYLTVNIIDRFLSKKAVTLNRFQLVGAAALFIAAKYEEINCPTL
                     KDIVYMLDNAYSRDDIIKAEKFMIDTLEFEIGWPGPMSFLRRISKADDYEYDIRTLAK
                     YLLETTIMDAKLTAAPPSWLASGAYFLSRVILGSNDWTYKHIYYSGYTQEQIFSLATV
                     MLENCRYAESRHQAIWKKYSERRQHRSAQVVAKWIALAEKKVDQSMA"
     gene            <370261..>372897
                     /gene="TDEL0C02150"
                     /locus_tag="TDEL_0C02150"
                     /db_xref="GeneID:11500439"
     mRNA            <370261..>372897
                     /gene="TDEL0C02150"
                     /locus_tag="TDEL_0C02150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680267.1"
                     /db_xref="GeneID:11500439"
     CDS             370261..372897
                     /gene="TDEL0C02150"
                     /locus_tag="TDEL_0C02150"
                     /inference="similar to DNA sequence:INSDC:YDL154W"
                     /note="similar to Saccharomyces cerevisiae MSH5 (YDL154W);
                     ancestral locus Anc_7.331"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680315.1"
                     /db_xref="GeneID:11500439"
                     /db_xref="GOA:G8ZRG2"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZRG2"
                     /translation="MSTANWGMPNNDHGNGMQMGDITVDYENEIIICIEVKMRKLGAS
                     IYDCRSKTLRILNQDYILNVSIDSTDGEDCSPGKFVDEVNMVLESLILANNPTLCLVS
                     TRLEEGSWNFVETLCQSIGCRVDLQPNQHFKSDGMLESLEMNHFRNVTLLNDISSTSS
                     SNTFITADTVSCILKVLHGCHENNADCSSSNVVISGSSSRSNMISHIESLQLKDRLFM
                     DRDTLYSLNIFPESHRPNNEKVLRGGSLSVFELFQQYLSEMGRRLLRQWMFNPLSEYR
                     LIKERHDIITILNDKTNSVIFENLRSTMKGFPDIFKIMDQFRTGKSTYNTWHSLTVFL
                     KKGIESYHLISTFRFDSETDNLFSKLGDRVNPLALQGLIDQVENIIDIETSKETKLVV
                     INDGIDENLDKYKKLYNNLENILSDVARNAERVLVQLIERQRGVSAQIEIKDYVNAVY
                     IPQLGYLVTLDVLIEEVLPDVNPAGWEEIFRTTTNIYFKNNSVLNLDEQVGDVFGIIS
                     DLEIEFLQAFQEHILEQRHVLTEYQKLLLEVEVLLSFAYVSQIRSYVEPEISETECVL
                     EITQGRHPIYETLVESYIPNDINLNGGYFSEKGQDYSNNVWSQKEFNRIAIVTGANQS
                     GKTVFLTQNALIVFLAHIGCFVPAEKAKIGLVDKILTRIKTRESVSKNQSSFALDSQQ
                     MAKCLSLMTERSLLFLDEFGKGTDVIDGPAIFGSIIKFLAEPRSCPRVLACTHFHELF
                     KKDVLTTSIPGVKHYATEIILDTSRLYSPFDFTKHEENQGITFLFKIKEGISSQSFGV
                     YCAKICGLNPKIVERAQELSSLIDKGYDLVSYCGRLTEEDIKRFEVSQRKVKAFISWD
                     LDVEFNTPNNELKQKLKYILEN"
     gene            complement(<372984..>374852)
                     /gene="TDEL0C02160"
                     /locus_tag="TDEL_0C02160"
                     /db_xref="GeneID:11500440"
     mRNA            complement(<372984..>374852)
                     /gene="TDEL0C02160"
                     /locus_tag="TDEL_0C02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680268.1"
                     /db_xref="GeneID:11500440"
     CDS             complement(372984..374852)
                     /gene="TDEL0C02160"
                     /locus_tag="TDEL_0C02160"
                     /inference="similar to DNA sequence:INSDC:YDL153C"
                     /note="similar to Saccharomyces cerevisiae SAS10
                     (YDL153C); ancestral locus Anc_7.330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680316.1"
                     /db_xref="GeneID:11500440"
                     /db_xref="InterPro:IPR007146"
                     /db_xref="InterPro:IPR018972"
                     /db_xref="UniProtKB/TrEMBL:G8ZRG3"
                     /translation="MARKAGKRSNKKHQMTGETGDSYGLNEIDDFASKRDQILLENSN
                     LGTQGADDYESNPDDEEEEVMAMSNEETSSEEEDEEEEEEQEQTDEELDGEQAYRKVF
                     GRKLELHRDPAEDEGGMLGNDNAWGSTKGDYYGADDIDDEETAKEVEKEALRQKKKHL
                     EELNMNDYLDDDLDEEWSKSAKEFDVGEFKESTKQDDKTASIKDILNMDSEAKKNHLQ
                     TLFPEFIPLSKEMIQLSDLLEELKSEEESEITKLKICALSTYLGTLSSYFGILLHELN
                     NNDTFATMRDHPVMEMILTSKEVWRQASSLTQKFDQENESQDDDDEDMADPGLEQFDE
                     GKLDGLRSGNSEDVEESDQEEKASEVEDQEEAEDDDSEDDDDVDLDDFEEYVAQSRIS
                     KSKINGKQESARTDDYVEGEMADVDSQEKKARKRTLRFYTSKIDQSENKKLDKFKGDD
                     DIPYKERFFERQQRLLEEARKRGQQGPSGADLDTKDYNSGDEATSKAMNNESEKDYFN
                     LTQKRRQERKGARQQAHKEAVKAARHGKLAELVGKVGEDGKRAINYQILKNKGLTPKR
                     KKDDRNSRVKKRKKYEKAQKKLKSVRAVYSGGQSGVYEGEKTGIKKNLTKSVKFKN"
     gene            <375087..>376334
                     /gene="TDEL0C02170"
                     /locus_tag="TDEL_0C02170"
                     /db_xref="GeneID:11500441"
     mRNA            <375087..>376334
                     /gene="TDEL0C02170"
                     /locus_tag="TDEL_0C02170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680269.1"
                     /db_xref="GeneID:11500441"
     CDS             375087..376334
                     /gene="TDEL0C02170"
                     /locus_tag="TDEL_0C02170"
                     /inference="similar to DNA sequence:INSDC:YDL150W"
                     /note="similar to Saccharomyces cerevisiae RPC53
                     (YDL150W); ancestral locus Anc_7.329"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680317.1"
                     /db_xref="GeneID:11500441"
                     /db_xref="GOA:G8ZRG4"
                     /db_xref="InterPro:IPR007811"
                     /db_xref="UniProtKB/TrEMBL:G8ZRG4"
                     /translation="MSGESGSGRLPSLSSSTGKPSLKFKPKAVARRTKEEREASAPKI
                     KAEENPKSFHDKKKDGRKNTGTNNQQRRMAKFLNNTHVISSGPLAAGNFVSEKGSDMR
                     RGFIKSEGGMSSLVQTGLRNIDNGDTISDDEDDEDKDKEHGAKGRSKFNMGREYVVHE
                     IPDDDDEVESDNSGELDEEALQARRVEELFPVRPLRIRHDDLEVVEKKVQEALSDVTT
                     REATPAPGVKREENELKDILTEHESTLKEKLKSLNLQNQFQSLDENETLLEMKSLVAD
                     QFSIAKKINKLNDKPNRFILFQLPSKLPHFEDVTPQANEDTAMPDASEETDSKEKKQD
                     ASKKNEPVQVSQEALTGNIGSIRVHKSGKISVKIGNVIMDVSRGAETTFLQDVVALNN
                     AGETPSIEALGRVDGRVVVTPRF"
     gene            <376535..>379315
                     /gene="TDEL0C02180"
                     /locus_tag="TDEL_0C02180"
                     /db_xref="GeneID:11500442"
     mRNA            <376535..>379315
                     /gene="TDEL0C02180"
                     /locus_tag="TDEL_0C02180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680270.1"
                     /db_xref="GeneID:11500442"
     CDS             376535..379315
                     /gene="TDEL0C02180"
                     /locus_tag="TDEL_0C02180"
                     /inference="similar to DNA sequence:INSDC:YDL149W"
                     /note="similar to Saccharomyces cerevisiae ATG9 (YDL149W);
                     ancestral locus Anc_7.328"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680318.1"
                     /db_xref="GeneID:11500442"
                     /db_xref="InterPro:IPR007241"
                     /db_xref="UniProtKB/TrEMBL:G8ZRG5"
                     /translation="MDKNNSPLPQNARDTFLSRVFGLQSEEVSSSIHTEEMSNFAEER
                     AQESQNGTPRNHSPTEDEDQTSGDEELRIPESDQGTTTEEEDLHTEDVELDATSAYND
                     VVAKKAPVIEDSMLKVGQLSSDEEYRDETEEEDDEGAADDTPLFDKTLRTAKQPDHVS
                     HSLLFQRILQHNQGKRKNQQLFTSSKDGHKKGELREPDLEAGRAENFRKQELRGTSNT
                     AFKLKRPNLINNISVLNNTPISRLNTLSPKERALWKWANVENLDTFFQDVYRYYLGNG
                     YFCIVLEKILNIATLIFVVFISTYMGYCIDYSKLPDSHKLAEVTVEHCYSRNITGTTK
                     FLLWVFYIFVVLKVAQLYFDVQNLRDIHNFYNYLLNISDKELQTIPWQNIIQQIMYLK
                     DQNALTANVVEVKAKNRIDAHDIANRIMRKENYLIAMYNNDVLNLSLPVPLYRTSTLT
                     KTLEWNINLCIMGYAFNESSFIKQSFLKASQQEYLKEELQKRFMLAGFLNIILSPFLV
                     AYFLLLYFFRYFNEYKTSPGSLGARQYTPMADWKFREYNELYHLFQRRIGLSAGLADK
                     YINQFPKEGTNIFLRFVAFVSGSFVAVLALLTIFDPENFFNFEITHERTALFYITILG
                     AVWTVCKNSVSDDYNVFDPEKTINELASYTHYLPDEWNGRYHTEEVKNEFCKLYNLRI
                     IILLRELASLVLTPFILWFSLPKSADKIVEFFRETSVYVDGLGYVCKYAMFGVNEPKE
                     FPEGKVQQGSSKQARAQSTSTSDNAQVNSEPEESDEEENGNAINKMMQSYLYFIDDYE
                     NSDNAVGKHQVPLKRFDELKKVPDLSNSYSWKKQFQPGQRPELFRIGKHSLERRSSVP
                     QPTAQEGASKGTANKKSFTQSGDRNRTLGESFINSVPSGNRDNSGGREGNSREQGGGV
                     LGLVKEFYKNQI"
     gene            complement(<379631..>382075)
                     /gene="TDEL0C02190"
                     /locus_tag="TDEL_0C02190"
                     /db_xref="GeneID:11500443"
     mRNA            complement(<379631..>382075)
                     /gene="TDEL0C02190"
                     /locus_tag="TDEL_0C02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680271.1"
                     /db_xref="GeneID:11500443"
     CDS             complement(379631..382075)
                     /gene="TDEL0C02190"
                     /locus_tag="TDEL_0C02190"
                     /inference="similar to DNA sequence:INSDC:YDL148C"
                     /note="similar to Saccharomyces cerevisiae NOP14
                     (YDL148C); ancestral locus Anc_7.327"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680319.1"
                     /db_xref="GeneID:11500443"
                     /db_xref="GOA:G8ZRG6"
                     /db_xref="InterPro:IPR007276"
                     /db_xref="UniProtKB/TrEMBL:G8ZRG6"
                     /translation="MGGSQLKSLKAALKAHNLTGQTNGGKTKKGSKRKPKQYDREERE
                     KVIANIREQFNPFEVKKVRNKHVDGSQNDNKAVGKPGISKQVGEEQRKRAFEAKMAYK
                     TKRNGFLDKRFGERSKDLSEEDKMLERFTRERQSQSRGKNSLFDLNDDEDDEGADMFG
                     GELTHLGEALKDDFDEGDLGLENGDRSPDNFKRPMFEDEQDALGESSEPARKKTKAEV
                     MKEVIAKSKFYKHERQKAQEKLEDQIDELDENFEDVFSELRASIPKGSKTPDNKLIEE
                     TTDKAYDMKVRELTMDRRAVPSDRTKTEEELKTEAEEKKAQLEKQRLERMSGMLEVET
                     GEEKGVEDLEDEFWANSDEEKADDIANSDDDVNLEGAASDEEEVDGKRILPRSVPCPE
                     HHEDFLKFLQNYSLTEQPKQVRKIINAYQPKLAEGNNERLGKFTRVLLRHILFLSDQN
                     YIKNVEEFAKVQNLLLNILKSLSEKYNQALSTECRNIISEMQERFKAKQYNVLMASDL
                     VFFAVIGTIFSTSDQYHLVVTPSSILIAELLEQMKYDSMGKLAFGAILARISLQYQRI
                     SKRYVPELVYYYEKCLGSLLPKSKNDTLPQVKLDSDELHINHIENIIDAESSILHLHQ
                     VFDDNSDNDEFSTTVLLNVLESVDNTVSLIWKELPAFQEITLNIVTLLNELTTKCPKL
                     QVTQRILEKTKRLESFSDHTPLTLQHHRPMSIPSHAPKFEENFNPDKKSYDPDKTRSE
                     INKMKSLLKKERKFTMKEIRKDTKFEARQRITSQKESAGRYHSKMAHIINTISTEEGA
                     EKNKYDREKRLRSGKK"
     gene            <382328..>383665
                     /gene="TDEL0C02200"
                     /locus_tag="TDEL_0C02200"
                     /db_xref="GeneID:11500444"
     mRNA            <382328..>383665
                     /gene="TDEL0C02200"
                     /locus_tag="TDEL_0C02200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680272.1"
                     /db_xref="GeneID:11500444"
     CDS             382328..383665
                     /gene="TDEL0C02200"
                     /locus_tag="TDEL_0C02200"
                     /inference="similar to DNA sequence:INSDC:YDL147W"
                     /note="similar to Saccharomyces cerevisiae RPN5 (YDL147W);
                     ancestral locus Anc_7.326"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680320.1"
                     /db_xref="GeneID:11500444"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:G8ZRG7"
                     /translation="MSRDAPIKAERDYTELLKEELPKIEQLSINDWRGGLDQLLALEK
                     KTRQASDLASSKQIISSIVDLLVSKGQWDELDDQLTLLSKKHGQLKLSIQYMVQRIMK
                     HLEDDKNIALETKIKAIESIRTVTENKIFVEVERARVTRELAHIRRQQGKIEEAADIL
                     CELQVETYGSMEMSEKIEFILEQMELSILKGDYSQATVLSRKILKKTFKNVKYESLKL
                     RYYELLIKIGLHKRDYLEVAQYFQEIYQTESVKKEENLWKPALSHMVYFLILSPCGNL
                     QNDLIHKVQLDNNLKKLETQESLVKMFTTPELMRWVIIKKKFEPVLSKDEVAFGGKDN
                     LHHWDELHKRLTEHNLRVISKYYLKITLPRLNELLDLTESETETFISDLVNQGIIYAK
                     INRPAKVVNFEKPKNSSELLNEWSQNVDHLLEHIETIGHLITKEEIMYGLKAK"
     gene            complement(<383710..>384520)
                     /gene="TDEL0C02210"
                     /locus_tag="TDEL_0C02210"
                     /db_xref="GeneID:11500445"
     mRNA            complement(join(<383710..384390,384473..>384520))
                     /gene="TDEL0C02210"
                     /locus_tag="TDEL_0C02210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680273.1"
                     /db_xref="GeneID:11500445"
     CDS             complement(join(383710..384390,384473..384520))
                     /gene="TDEL0C02210"
                     /locus_tag="TDEL_0C02210"
                     /inference="similar to DNA sequence:INSDC:YLR211C"
                     /note="similar to Saccharomyces cerevisiae YLR211C;
                     ancestral locus Anc_7.325"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680321.1"
                     /db_xref="GeneID:11500445"
                     /db_xref="InterPro:IPR007330"
                     /db_xref="UniProtKB/TrEMBL:G8ZRG8"
                     /translation="MSYAVLLPRNMTSLGEAYKYIDGAEQESRNGNLSEALEKYRHAL
                     DNLIVKEEGAEEVRLGPEVVEAIKLLRQDINDRVRDIEALVELQRPTTARSTSLSGTI
                     LTNLNSSSQNVASVRPWDVVRGGNPAAGMQVDPLLLKILNKLQNEIIAKLEEKIVEKD
                     YHKGQSIESIVNQSLMQFGKDLAIYEQKNYKEFNARLEKANNENKKLSNQIVKLRERW
                     DSLVESAKQRRTRQQDNLNGNNSG"
     gene            <384716..>386182
                     /gene="TDEL0C02220"
                     /locus_tag="TDEL_0C02220"
                     /db_xref="GeneID:11500446"
     mRNA            <384716..>386182
                     /gene="TDEL0C02220"
                     /locus_tag="TDEL_0C02220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680274.1"
                     /db_xref="GeneID:11500446"
     CDS             384716..386182
                     /gene="TDEL0C02220"
                     /locus_tag="TDEL_0C02220"
                     /inference="similar to DNA sequence:INSDC:YDL146W"
                     /note="similar to Saccharomyces cerevisiae LDB17
                     (YDL146W); ancestral locus Anc_7.324"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680322.1"
                     /db_xref="GeneID:11500446"
                     /db_xref="InterPro:IPR018556"
                     /db_xref="UniProtKB/TrEMBL:G8ZRG9"
                     /translation="MILDPSAPHPEKHDELEVREFWNSMEKIVTQHAESGNDEQVNSQ
                     LVGYIKTACDSYMKFINSDRDLCHMAVILTESTAFKEHREFCLSKLLSLLNIDLLEMN
                     MKFIIAYVLLWESKNNLNWLETMLEYQGFNVFYNTLYTQFAYLNKYGEDKNIGQERIT
                     NPDLAELTDIEYKIVDEMKQISTVLMDLLFQVLKYCKCSVKNIQLVDDFFVYFLMTSI
                     RSDTMTDIFNNAQFKLLLALNEQYMILNKEYEFENKVFQYLTSDSVHTRFTELLLLKF
                     NRVQDKSLQVMMCKIIYLILTAEDGSVAMNFFYLNDLHVFVDVLLRELENIPENEETL
                     RNYFLRILIPLLKNTELSKTHYRKDDLIKTLSYLSSVENFCGSAKVTKEHETTAKLAN
                     KLLTKVDWLGCVRAETDTSGSDTSRKSSVSTLGITPTTTLQSYVDRKPGFYKSPEPRH
                     SAESLGKRKSRPPPPLPPSRKIGLCRTVSHSAPASPAK"
     gene            complement(<386307..>387716)
                     /gene="TDEL0C02230"
                     /locus_tag="TDEL_0C02230"
                     /db_xref="GeneID:11500447"
     mRNA            complement(<386307..>387716)
                     /gene="TDEL0C02230"
                     /locus_tag="TDEL_0C02230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680275.1"
                     /db_xref="GeneID:11500447"
     CDS             complement(386307..387716)
                     /gene="TDEL0C02230"
                     /locus_tag="TDEL_0C02230"
                     /inference="similar to DNA sequence:INSDC:YLR212C"
                     /note="similar to Saccharomyces cerevisiae TUB4 (YLR212C);
                     ancestral locus Anc_7.323"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680323.1"
                     /db_xref="GeneID:11500447"
                     /db_xref="GOA:G8ZRH0"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002454"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:G8ZRH0"
                     /translation="MAGEIITIQVGQCGNQIGKHFWLQLAKEHGIDKDGQGITNNEEV
                     RDDDTNPFFKLNDSNRYTPRALMLDLEPSAIQDVQNTFPGVFNPRNTWISPEELGAGN
                     SWSKGYDYGLANQETFMNMIDREIDATENFEGFQLLHSVAGGTGSGLGSSLLEAISDS
                     YPKKFLTTYSVFPSDESEVVIQPYNTILTLRRLEENSDASIVFDNNALLNLTSRVFRD
                     PYTSYLHTNQLISATMSAITNPIRFPSYMYNSLPSIFSTLVPTPELHFLVPAFTPFTS
                     DYVSGGKEPKNNTAYDVLLDLIDGSSSLVSNTIDNPTYYNVLCSLVGAVEQNDVLRAI
                     IKAQQRLQFAPWSFSSVHVNVGRRSPYLSAQTHHNHINGLMLANTSAITSLFTKTCKT
                     FDKIFSKGAFLNTFRDGKMFQNGWDEFAESRQVVQDLTEEYLAAEQETYLDGVLLEEE
                     NMVGRHDGRLDADGDDNIV"
     gene            complement(<388060..>391665)
                     /gene="TDEL0C02240"
                     /locus_tag="TDEL_0C02240"
                     /db_xref="GeneID:11500448"
     mRNA            complement(<388060..>391665)
                     /gene="TDEL0C02240"
                     /locus_tag="TDEL_0C02240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680276.1"
                     /db_xref="GeneID:11500448"
     CDS             complement(388060..391665)
                     /gene="TDEL0C02240"
                     /locus_tag="TDEL_0C02240"
                     /inference="similar to DNA sequence:INSDC:YDL145C"
                     /note="similar to Saccharomyces cerevisiae COP1 (YDL145C);
                     ancestral locus Anc_7.322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680324.1"
                     /db_xref="GeneID:11500448"
                     /db_xref="GOA:G8ZRH1"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006692"
                     /db_xref="InterPro:IPR010714"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016391"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8ZRH1"
                     /translation="MKMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGT
                     LLHRFEDHEGPVRGIDFHPTQPIFVSAGDDYSIKVWSLETNKCLYTLNGHLDYVRTVF
                     FHRELPWIISASDDQTIRIWNWQNRKELACLTGHNHFVMCAQFHPTEDLVVSASLDET
                     IRVWDIAGLRKRHSAPGASSFEDQMASQQNLLDAGFGDCVVKFILEGHTRGVNWASFH
                     PTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKT
                     LRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFKLDRERPCSVTHQ
                     NELIFVNKEKQVQAFDYNNKVSSLPFVSLKHLGQAWNSFKSISYNPSQHSILVNEGND
                     RFALVLLPKKPTGAVEPSGVLEDAGSFALFVARNRFVVYSKSTESLEVRTLDNKVTKT
                     VKIEGPVNDVVNSGPGCVLLLQPKRVVLLDVQQGKKLAEIALKNVKYVSWSLDGQYAA
                     LMSKHTITTVTKRLELINSMHDTIRIKSACWDETGVLIYSTLNHIRYSLLNGERGIIK
                     TLENTLYINKVQGKLIYALDRYGEVKILTIDPTEYRFKKALANKNFPEVLRIIKNSNL
                     VGQNIISYLQKSGFPEIALQFVQDPQTRFDLALEYGNLDVALEEAKKLNNNAVWDKLS
                     KEALMQGDTSLVEMIYQTQKSFDKLSFLYLITGDHVKLSKMQAIAENRGDYASLVANT
                     FFSDSASLRANVFSQLGSLPLAYAISKARGDKAAAASFLEQAEISEEDVVLPDNSSTQ
                     GFAKVPVLNEPIKKWPLKKAEPSYFEKALANRMDELSVEEPEELEPTEEESKSATEGD
                     LFDDEALGGEDGAWDLGEEELDIGEEEHGKEEESTEEGAQVDGNMVSTWIKNSKLPGV
                     LVAAGAFDAAAQALNKQAGIVNFEPLRSNFVDIFEGCRTYLASTPSELPAIVGYICED
                     AEEEDPSAIFPHTPDVNAVTELMNEGFRFFKANKLELAIDSFRKAIYTITLLVVRNDE
                     DEQTARKALEKAKEYILGLSIELKRRSLPTEDVKRNLELAAYFTKAKLSPIHRSNALQ
                     VAMSQSFKHKNYVQASFFAAELLKIVPSGPRAEQARKVKDKADSLAYDAIEIDFDPYA
                     DFDLCASTYTPIYKGTANVLDPLTGARYHASEKGKIDTIALISKIGAPASGLRIR"
     gap             392080..392099
                     /estimated_length=20
     gene            complement(<392252..>393682)
                     /gene="TDEL0C02250"
                     /locus_tag="TDEL_0C02250"
                     /db_xref="GeneID:11500449"
     mRNA            complement(<392252..>393682)
                     /gene="TDEL0C02250"
                     /locus_tag="TDEL_0C02250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680277.1"
                     /db_xref="GeneID:11500449"
     CDS             complement(392252..393682)
                     /gene="TDEL0C02250"
                     /locus_tag="TDEL_0C02250"
                     /inference="similar to DNA sequence:INSDC:YLR213C"
                     /note="similar to Saccharomyces cerevisiae CRR1 (YLR213C);
                     ancestral locus Anc_7.321"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680325.1"
                     /db_xref="GeneID:11500449"
                     /db_xref="GOA:G8ZRH2"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:G8ZRH2"
                     /translation="MQGKLTAFLILNFLTFKALAQGEFYRPETPIKCGSSQKCPEAWP
                     CCSPYGQCGTGPICLGGCNPRFSYNETSCAPMPALVPPNNIEYFAGPLSYFDGDENEK
                     QLKSRGFLHFNKYLISGDDEEVQFMLDNIDFTYSGPVKIEENSGDVVLQMPKRSSGCL
                     LATTKSFLYGKSSVRLKTARSQGVITSVVVMSAAGDEIDLEFRGSELDKVQSNYYYRG
                     ELIYNKMKEITVSSDTWANYHDYGIDWTADRIHWTVDGEIVRTLEKEETWDENLKIYK
                     YPETPMRLEVGLWPGGSENNHPGTIDWAGGLIDWENSPDMIENGQFSAAVRSMEVTPY
                     SNRYIPAMQSCLEEEDCITYDYVKKPNEIFDETSLALYCGLAPNLSGWSQTGSSISRD
                     PFLLAKSFGKAQDREKEFVQNMNSTVTQNMNNTTTQNMNNTVTQATNVTTSYNATNHG
                     PEPIKVETSGQSSLYQRNPLFQIKGS"
     gene            complement(<393928..>395001)
                     /gene="TDEL0C02260"
                     /locus_tag="TDEL_0C02260"
                     /db_xref="GeneID:11500450"
     mRNA            complement(<393928..>395001)
                     /gene="TDEL0C02260"
                     /locus_tag="TDEL_0C02260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680278.1"
                     /db_xref="GeneID:11500450"
     CDS             complement(393928..395001)
                     /gene="TDEL0C02260"
                     /locus_tag="TDEL_0C02260"
                     /inference="similar to DNA sequence:INSDC:YDL144C"
                     /note="similar to Saccharomyces cerevisiae YDL144C;
                     ancestral locus Anc_7.320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680326.1"
                     /db_xref="GeneID:11500450"
                     /db_xref="GOA:G8ZRH3"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZRH3"
                     /translation="MSEKSLPNVIVIGAGGVGVITAVSLCHRGRSHVSLVVRSDYEHV
                     KEHGYSISSCDYGQLMGWKPHNLVKSVEGASNDGKFYDFVVVTTKNIPDGPVGSTVPE
                     VIRPVIESNHRLNSSRQTNVLLVQNGLDIEKDIHKAYDSHDYNLVVLSGIQLIGSTKI
                     GKGVIEQVGKDHLSVGPFDPKDDRAIAAAYVFIDLYNNEGHNRVTFDSEVRYARWRKL
                     MYNAVINTTTALVGMDVPRCLQFGVDKVGTEENIFRPGMREIIAIAASEGITLNEKDL
                     DFFCNISKDLMFKPSMCVDFLNGQLMELETILGNPLRIAKKNGVSTPVLFMLYHLLYM
                     VQNKLKESKGLLKFDEKKARIVE"
     gene            <395333..>397414
                     /gene="TDEL0C02270"
                     /locus_tag="TDEL_0C02270"
                     /db_xref="GeneID:11500451"
     mRNA            <395333..>397414
                     /gene="TDEL0C02270"
                     /locus_tag="TDEL_0C02270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680279.1"
                     /db_xref="GeneID:11500451"
     CDS             395333..397414
                     /gene="TDEL0C02270"
                     /locus_tag="TDEL_0C02270"
                     /inference="similar to DNA sequence:INSDC:YLR214W"
                     /note="similar to Saccharomyces cerevisiae FRE1 (YLR214W);
                     ancestral locus Anc_7.319"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680327.1"
                     /db_xref="GeneID:11500451"
                     /db_xref="GOA:G8ZRH4"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="UniProtKB/TrEMBL:G8ZRH4"
                     /translation="MKLAYLISLVLTVLPFCHSLVLVDSTLASACIYYELQYDWGCKS
                     HSNGMKAYACRCANINWLGTVTNCIKNNSDSKRLIDHALRHLSTRCLQKGNFHYTVDD
                     LYRFAENGTHYMRDPTEQDRTVTVNTTLNVNQTDYDWYYKKFKDYTFSVERSQWFGWG
                     LVFYWAAIIGFATFFNICKRVLGHPFVNNRLKKHLVLPSTFRDYRERTYLLCNVLPLN
                     FQTRLNGLVVAVFLILTIISCGVGYELTLPHPYLTTRWYANLTLVSYRTDLLSISLFP
                     VIYMFGIRNNPLIYISGISFSTFQFYHRWCAYTCVVLLFIHSIIWTVYAIHGGGGYKV
                     WAMDSYWNWGIAATTLSVLLVFHSEKLIRDLAYEVFLVMHQFMNIAFIIAMYYHCVDL
                     GWLGWIWAMAGILCFDRFMRILRIVISGGVHTATLTDCGNRSVIKMVMKKPKYFKYVA
                     GSHAFIYFLSPTDSWYYFFQSHPFTILTDPEEDEKNPDHLVFLFKANKSVTKAMLKKI
                     LKSGKPTVTCKVLLEGPYGVTLPKRVKDNRKVVAVSAGQGVCAVYPHLRQILSSNQTG
                     EFRHKLVWIINDLSSLDWFGLEIKWLRDRQCDVTILYTKADDRDLESSSLESEVKESK
                     HGVKRLYCRPNLQKLISSEVEQASKESVDLTILSCGPASFNDDLRHSVVSSMNCDLKI
                     SVDLEEESFTW"
     gene            complement(<397457..>398524)
                     /gene="TDEL0C02280"
                     /locus_tag="TDEL_0C02280"
                     /db_xref="GeneID:11500452"
     mRNA            complement(<397457..>398524)
                     /gene="TDEL0C02280"
                     /locus_tag="TDEL_0C02280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680280.1"
                     /db_xref="GeneID:11500452"
     CDS             complement(397457..398524)
                     /gene="TDEL0C02280"
                     /locus_tag="TDEL_0C02280"
                     /inference="similar to DNA sequence:INSDC:YLR215C"
                     /note="similar to Saccharomyces cerevisiae CDC123
                     (YLR215C); ancestral locus Anc_7.318"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680328.1"
                     /db_xref="GeneID:11500452"
                     /db_xref="InterPro:IPR009772"
                     /db_xref="InterPro:IPR016525"
                     /db_xref="UniProtKB/TrEMBL:G8ZRH5"
                     /translation="MGEKYTPLEPLLVKKEHVERCRFSNWSKLFPGQVPKSRVIKPLP
                     REFIKYLEQDGIKLPDFDQEKSTYTSEIARNEDNEYSDWEDDDGVDDTKVVRVDPIKD
                     FPKLHEEISLAINDLGSVAPKLNWSAPRDATWMLPNNTMKCTEINEVYLLLNASNYIM
                     HDLQHAFEGCEDFTTDDRRPEYELVLRQWFDINPALEFRVFIRNGKVLGATQRDLNYY
                     TFLEPLVDDFKDTIDEFVYDTFLTKFSEKSCVIDIYIPRPYNKLFLIDVNPFSRKTDA
                     LMFSWNELLTKEVNENEDYELRIVPENNVARFATKEHSENHVPKDVLEASLNPEAIKE
                     LSEKWQELLRCQELEDDSDNE"
     gene            <398784..>400370
                     /gene="TDEL0C02290"
                     /locus_tag="TDEL_0C02290"
                     /db_xref="GeneID:11500453"
     mRNA            <398784..>400370
                     /gene="TDEL0C02290"
                     /locus_tag="TDEL_0C02290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680281.1"
                     /db_xref="GeneID:11500453"
     CDS             398784..400370
                     /gene="TDEL0C02290"
                     /locus_tag="TDEL_0C02290"
                     /inference="similar to DNA sequence:INSDC:YDL143W"
                     /note="similar to Saccharomyces cerevisiae CCT4 (YDL143W);
                     ancestral locus Anc_7.317"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680329.1"
                     /db_xref="GeneID:11500453"
                     /db_xref="GOA:G8ZRH6"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012717"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:G8ZRH6"
                     /translation="MAAKISSNATFQTREKPQEVRKANIIAARAVADAIRTSLGPKGM
                     DKMIKTSRGEIIISNDGHTILKQMAILHPVAKMLVEVSAAQDSEAGDGTTSVVILTGA
                     LLGAAERLLGKGIHPTIIAESFQSAAQKSVEILLEMSHKVSLEDKDDLVRAASTSLSS
                     KIVSQFSSFLAPLAVDSVLKISDEKSKTVDLNDIRLIKKVGGTIDDTAMVDGVVLTQN
                     VIKSAGGPTRVEKARIGLVQFQISPPKPDTENNIVVSDYRQMDKILKEERAYLLNICK
                     KIKKSKCNVLLIQKSILRDAVNELALHFLAKLNIMVIKDIEREEIEFLSKSLGCKPIS
                     DIELFTEDRLGSADLVEEIESDGSKIVEFTGVKSDKAKPTVSVIIRGANQMILDETER
                     SLHDALCVIRCLVKQRGLIAGGGAPEIEISRRLTKESRAMEGVEAFIWQEFAQALEVI
                     PTTLAENAGLNSIKVVTELRSRHEGGEVNDGISVRRSGTANTFEEHILQPVLVSTSAI
                     TLASECVKSILRIDDICFSR"
     gene            complement(<400482..>401279)
                     /gene="TDEL0C02300"
                     /locus_tag="TDEL_0C02300"
                     /db_xref="GeneID:11500454"
     mRNA            complement(<400482..>401279)
                     /gene="TDEL0C02300"
                     /locus_tag="TDEL_0C02300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680282.1"
                     /db_xref="GeneID:11500454"
     CDS             complement(400482..401279)
                     /gene="TDEL0C02300"
                     /locus_tag="TDEL_0C02300"
                     /inference="similar to DNA sequence:INSDC:YDL142C"
                     /note="similar to Saccharomyces cerevisiae CRD1 (YDL142C);
                     ancestral locus Anc_7.316"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680330.1"
                     /db_xref="GeneID:11500454"
                     /db_xref="GOA:G8ZRH7"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="UniProtKB/TrEMBL:G8ZRH7"
                     /translation="MLLLTPRASSVLKPTLLLRYPRFGASRITCRLHVRGITSDIKQT
                     TLKTSVFTLPNILTMTRIGCTPFICHYILTNNLTPALGLFAYSCVTDFLDGYIARKYK
                     LKSVAGTILDPLADKLLMIATTISLAFPPGPQLIPLPIAGLILGRDVLLGISALYFRY
                     ASMRQKYSTISWSSYWDFFHYPSAEVKPTQISKYNTFFQMIYLGFGVIMLIFNNEESK
                     KEDEEKTGSFNKLSQYFSWMGYFVAATTVLSGSSYVFSKDAVKFLKK"
     gene            <401694..>403778
                     /gene="TDEL0C02310"
                     /locus_tag="TDEL_0C02310"
                     /db_xref="GeneID:11500455"
     mRNA            <401694..>403778
                     /gene="TDEL0C02310"
                     /locus_tag="TDEL_0C02310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680283.1"
                     /db_xref="GeneID:11500455"
     CDS             401694..403778
                     /gene="TDEL0C02310"
                     /locus_tag="TDEL_0C02310"
                     /inference="similar to DNA sequence:INSDC:YDL141W"
                     /note="similar to Saccharomyces cerevisiae BPL1 (YDL141W);
                     ancestral locus Anc_7.315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680331.1"
                     /db_xref="GeneID:11500455"
                     /db_xref="GOA:G8ZRH8"
                     /db_xref="InterPro:IPR003142"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR004408"
                     /db_xref="InterPro:IPR019197"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:G8ZRH8"
                     /translation="MNVLVYNGPGTTPGSVKHTTETLRHFLEPYYAVSTVSAKALQTE
                     PWMSKASALVFPGGADLPYVKECKTAIPKIKDFVRRQGGLFIGFCAGGYFGSGRVEFS
                     QGNLEMEVTGNRELKFFPGIARGPAYDGFKYNSEDGAKAAPLVLPDGTEFATYFNGGS
                     LFVDADHYDNVEVLARYKEPTDVRYQDSSSGTDRVGPAAVVLCSEGKGKALLTGPHPE
                     FIPRLLSKSDDKHFLSRVVNVLIENEEQRLRFLKDIFTKAGLNCNNEFANVRAPNLTP
                     LLVSASETRQQLVKNFQDNLFTITSDPTKFDDCVEIDGGNDKVRLYEGFKQPYYKAAD
                     FLRHGEPDEIPKTIIFPGEGELFPDSTLTSNYDIAKYFKYLNPDNTVGSMLMYGEVVT
                     STSSFLNENKNVLSSIPDSSMLHVGTIQVSGRGRGGNVWVNPKGVSACTAVISLPSRS
                     PRTNKPVSIVFVQYLSMLAYCQAITSYGPGYEDLPVRIKWPNDLYALSPKYYQNNKLS
                     LVGKALGQGSESQIVPITDIEPAYLKISGLLVNSNFFNDKFTLLLGCGLNVSHDGPTT
                     SLNSWINILNREREAARLDRLAPIEVEKLHALYMNRLEILIRAFVDTGAASILPEYYR
                     LWLHSNQIVTLKDHQNARAKITGITEDYGLLIAKELQSGSNTQFTGAVYHLQPDGNSF
                     DIFKGLISKKAV"
     gene            complement(<403851..>409034)
                     /gene="TDEL0C02320"
                     /locus_tag="TDEL_0C02320"
                     /db_xref="GeneID:11500456"
     mRNA            complement(<403851..>409034)
                     /gene="TDEL0C02320"
                     /locus_tag="TDEL_0C02320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680284.1"
                     /db_xref="GeneID:11500456"
     CDS             complement(403851..409034)
                     /gene="TDEL0C02320"
                     /locus_tag="TDEL_0C02320"
                     /inference="similar to DNA sequence:INSDC:YDL140C"
                     /note="similar to Saccharomyces cerevisiae RPO21
                     (YDL140C); ancestral locus Anc_7.314"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680332.1"
                     /db_xref="GeneID:11500456"
                     /db_xref="GOA:G8ZRH9"
                     /db_xref="InterPro:IPR000684"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007073"
                     /db_xref="InterPro:IPR007075"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="UniProtKB/TrEMBL:G8ZRH9"
                     /translation="MVAQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDET
                     QTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHIGFITKIKKV
                     CECVCMHCGKLLLDDHNEQMRQACKIKDSKKRFNAIWTLCKTKMICESDVPSEEDPTK
                     LISRGGCGNAQPTVRKDGLKLVGSWKKEKNTGDPEEPEQRILTMEEILNIFKHISKED
                     SNRLGFNEEFARPEWMILTVLPVPPPPVRPSISFNESQRGEDDLTFKLADILKANISL
                     ETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEG
                     RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTFLV
                     RNGPNEHPGAKYVIRDNGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSL
                     HKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVP
                     LQIVSPQSNKPCMGIVQDTLCGIRKLTLRDNFIELDQVLNMLYWVPDWDGVIPTPAII
                     KPKPLWTGKQILSIAIPKGIHLQRFDEGTTLLSPKDNGMLIIDGKIIFGVVDKKTVGS
                     SSGGLIHVVTREKGPQICARLFGNIQKVVNYWFLHNGFSTGIGDTIADGQTMREITET
                     IADAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLKDL
                     NNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKG
                     FVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDSTT
                     RNSLGNVIQFVYGEDGMDASHIEKQAIDTIGGSDSAFEKRYRIDLLNPDHLLDPSLLE
                     SGSEIVGDLKLQVLLDEEYKQLVEDRFFLRSVFVDGEPNWPLPVNIRRIVQNAQQTFR
                     IDHTKPSDLSIRDVYFAVKNLQDKLLVLRGNSEIIKNAQQDAVSLFCCLMRSRLATRR
                     VIEEYRLTKQAFEWVLNNIEIQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAG
                     VASKKVTSGVPRLXXXXEKAKFIRSAIEHTTLKSVTVASEIYYDPDPRSTVIAEDEEI
                     IQLHFSLLDDETEKSLDQQSPWLLRLELDRAAMNDKDLTMGQVGEKIKETFKNDLFVI
                     WSEDNAEKLIIRCRVVRPKSMDIETEAEEDHMLKKIENTMLENITLRGVENIERVVMM
                     KYDRKVPSATGEYHKVPEWVLETDGVNLSEVMTVPGVDSKRIYTNSFIDIMEVLGIEA
                     GRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSATGALMRCS
                     FEETVEILFEAGACAEMDDCRGVSENVILGQMAPIGTGSFDVMIDEESLVKYMPEQKV
                     TELEDGQDGGATPYSNESGLVNTEIDVKDELMFSPLVDSGASDAMAGGFTAYGGGDYG
                     GGFGEAPSSPGFGGVSSPGFSPSSPAYSPTSPSYSPTSPSYSPSSPNYSPTSPSYSPT
                     SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPRLH
                     HILLHHQATVQPLRAIALHHQVIVQLHQAIVRHHQATAQLHHLILQLLQVTLLHLQAT
                     ALGRLHILQELTRNKIKTIMKITTNDGALKFMNLTMFNYLYYNLKFSVSSESVNWLVK
                     H"
     gap             405720..405731
                     /estimated_length=12
     gene            complement(<409804..>410925)
                     /gene="TDEL0C02330"
                     /locus_tag="TDEL_0C02330"
                     /db_xref="GeneID:11500457"
     mRNA            complement(<409804..>410925)
                     /gene="TDEL0C02330"
                     /locus_tag="TDEL_0C02330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680285.1"
                     /db_xref="GeneID:11500457"
     CDS             complement(409804..410925)
                     /gene="TDEL0C02330"
                     /locus_tag="TDEL_0C02330"
                     /inference="similar to DNA sequence:INSDC:YLR216C"
                     /note="similar to Saccharomyces cerevisiae CPR6 (YLR216C);
                     ancestral locus Anc_7.313"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680333.1"
                     /db_xref="GeneID:11500457"
                     /db_xref="GOA:G8ZRI0"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:G8ZRI0"
                     /translation="MARSKTYFDISIGGTPKGRIVFELYNDVVPKTAENFLELCKGDF
                     GMAKSKPDVPLSYKGSIFHRVIKDFMLQFGDFTNSDGTGGESIYGEKFEDENFTLKHD
                     KPFLLSMANAGPNTNGSQAFITCVPTPHLDGKHVVFGEVIQGKRLVRLIESQQTDQGN
                     DKPMRDVKIEDCGVLPDDYEVPANAEDTPTDEYGDNYEESLKEDSKVDVNDVKSVLKA
                     TEFVKQIGTDQFKKQNYTVALEKYQKCDKFLKEYTPEDLPEEDIKKINDLKVSLPLNI
                     ALCALKCKDYRKVLVAGSEVLYAEAADDKAKAKALYRRGLAYNALNDIDMALTDLEMA
                     TTFQQNDAAILNAIKDVKVKKKANKRQTEEVSIQDVFLS"
     gene            complement(<411065..>411700)
                     /gene="TDEL0C02340"
                     /locus_tag="TDEL_0C02340"
                     /db_xref="GeneID:11500458"
     mRNA            complement(<411065..>411700)
                     /gene="TDEL0C02340"
                     /locus_tag="TDEL_0C02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680286.1"
                     /db_xref="GeneID:11500458"
     CDS             complement(411065..411700)
                     /gene="TDEL0C02340"
                     /locus_tag="TDEL_0C02340"
                     /inference="similar to DNA sequence:INSDC:YDL139C"
                     /note="similar to Saccharomyces cerevisiae SCM3 (YDL139C);
                     ancestral locus Anc_7.312"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680334.1"
                     /db_xref="GeneID:11500458"
                     /db_xref="GOA:G8ZRI1"
                     /db_xref="InterPro:IPR018465"
                     /db_xref="UniProtKB/TrEMBL:G8ZRI1"
                     /translation="MRSKGKSSKKVALKKLHGALKSILGSSEEELKKRKDKGIVEILP
                     GAEAKKISSRKKSPPVAVEKRNGLTYIVSREKQLIPMLTDDEIMQRHKLADENMKTAW
                     TSIINKYESVEDQGDVIDLRTGEVVEDYGHLRGLSHELPQDSSHYRSTLTSLLGVKDE
                     GDTRRDLWQDGDDDEDDEEYNSENEAREEEGTDTDSQTSEYEKVLNTKIRD"
     gene            complement(<411791..>412036)
                     /gene="TDEL0C02350"
                     /locus_tag="TDEL_0C02350"
                     /db_xref="GeneID:11500459"
     mRNA            complement(<411791..>412036)
                     /gene="TDEL0C02350"
                     /locus_tag="TDEL_0C02350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680287.1"
                     /db_xref="GeneID:11500459"
     CDS             complement(411791..412036)
                     /gene="TDEL0C02350"
                     /locus_tag="TDEL_0C02350"
                     /inference="similar to DNA sequence:INSDC:YLR218C"
                     /note="similar to Saccharomyces cerevisiae YLR218C;
                     ancestral locus Anc_7.311"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680335.1"
                     /db_xref="GeneID:11500459"
                     /db_xref="UniProtKB/TrEMBL:G8ZRI2"
                     /translation="MSEESRYYQEALQEYNDLKKESDPDVWDKRISETGCYVENLALQ
                     LCHAETNDWRQCMKEMALFRKCWDTKGNRDRVRTVDR"
     gene            <412482..>416276
                     /gene="TDEL0C02360"
                     /locus_tag="TDEL_0C02360"
                     /db_xref="GeneID:11500460"
     mRNA            <412482..>416276
                     /gene="TDEL0C02360"
                     /locus_tag="TDEL_0C02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680288.1"
                     /db_xref="GeneID:11500460"
     CDS             412482..416276
                     /gene="TDEL0C02360"
                     /locus_tag="TDEL_0C02360"
                     /inference="similar to DNA sequence:INSDC:YDL195W"
                     /note="similar to Saccharomyces cerevisiae SEC31
                     (YDL195W); ancestral locus Anc_7.310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680336.1"
                     /db_xref="GeneID:11500460"
                     /db_xref="GOA:G8ZRI3"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR004098"
                     /db_xref="InterPro:IPR009917"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR021614"
                     /db_xref="UniProtKB/TrEMBL:G8ZRI3"
                     /translation="MVKLAEYSRTATFAWSHERIPSLVTGTASGTVDANFSSESALEL
                     WSLLASDPSKPKASLAVDAKFNDLDWSNDDKIIAGALDSGVVELFSSTGDSLKSEARF
                     QQHQGAAKTVKFNSKQNNVLASGGSKGEIYIWDLNTCLKNSEGYTPLTPGVASTPIEE
                     VTSLAWNQSLAHVFASAGSTSYASIWDLKAKKEVIHLSYASPSTGLKSQLSVVEWHPK
                     NSTRVATATGSDTEPLILVWDLRNANTPLQVLSKGHSKGILSLDWCSQDEELLLSSGR
                     DNTIVLWNPESGQELTQFPTRGNWCFKTKFAPEAPDLFASASFDNKIQVQTLQNLVNT
                     LDQEQTESKQKESETDFWNNVTQEDSNEKPNMIHLQAPSWYGNKSPAAQWAFGGKLVH
                     ISADGRSVSITKPSLPGLEENTMLDQALKSSDFKPLINRRLAKTIDDTNDEDWNLLEK
                     LSMDGKDEILKEAFTFDDEEERKEKNKIDEGEDFFANIEEAFQPEGEFSLSRGVEKQI
                     SQDVVGGNLKSAVSASLDDDLLLEAMIIALDSGDKTLKDSVKRYYFTKYGNKSPLSRF
                     LFSISNGNADDLVKNLEISQWKYAAKAIDRFYANDLQSKNEQLEKLAYRLLESGNRQD
                     AILLYLSANSLDKVAEVWLKEAQGLEEKVQKNKGSLYEAHSESLTEFIERFTVLAKLV
                     GEKTKITNEDLISKFMEYVNLASSSGTFDLAYSILETLPAENREVQLEKERVLLASGK
                     SVKNVKSAQKASFAQPSMKPAAGALPYGAVTPGYVPPGGVLPNARVGPQIAQPLAGSV
                     GGSNTNPYAPPAGSPALGTRYAPTTASPNTYPMSMPAATQSSFTPPANPYAASAVNTA
                     GVPIAGQSSYTPLNPKPVPNFISSPPAYGAAEPPTGPPPPTVASGQTPSLNRKANDGW
                     NDLPLPVKEKPSRAKAGSVAPVKIAAAQTAAPANGISRPPLVGKVSSMTPSLSSPLPP
                     PPVKSSRMASVSSNGSMMSNSPMTGSTNPYAPPVVSNISTPRVNATDYSAPQAPAIAN
                     PYAPPAVSSPKLNQPNPYAPPAQTAPMAGLPSNPYANPVGPSQPPAAQKPPIGPPPVG
                     PPPMSLKKKNHSYTTVENASHLLESVQKKPESPYSRPQVAAPPSADTAPVLSAAVVGA
                     TATSAAAPEGIPEDQQPIMDFLKEELVRVTPLIPKEYTKQLKDCDKRLNILYGHLEKQ
                     DLLTQPTIDKLRSLTQFLKEKNYSEAMQVHVDIATNHAQEGGNWLTGVKRLIGIAEAT
                     SS"
     gene            <416622..>418817
                     /gene="TDEL0C02370"
                     /locus_tag="TDEL_0C02370"
                     /db_xref="GeneID:11500461"
     mRNA            <416622..>418817
                     /gene="TDEL0C02370"
                     /locus_tag="TDEL_0C02370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680289.1"
                     /db_xref="GeneID:11500461"
     CDS             416622..418817
                     /gene="TDEL0C02370"
                     /locus_tag="TDEL_0C02370"
                     /inference="similar to DNA sequence:INSDC:YDL194W,YDL138W"
                     /note="similar to Saccharomyces cerevisiae SNF3 (YDL194W)
                     and RGT2 (YDL138W); ancestral locus Anc_7.309"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680337.1"
                     /db_xref="GeneID:11500461"
                     /db_xref="GOA:G8ZRI4"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZRI4"
                     /translation="MQKEESSTEEALDKVRSGFLRKAINKVSKGVSLRRASPGTSSEL
                     EEGNVRPTSMVSEAQSAGDFQMNRLSNMSDEMSEVDDASLLFSQPPQPQSNLMTIVVG
                     VFVAVGGFLFGYDTGLINSIIDMNYVRTNLAPDHEGFSAREMAIIVSFLSLGTFIGAL
                     SAPLLSDSYGRKATIIFSTVVVFLIGNSLQVAAHSVKLLIAGRVISGLGIGLISAVVP
                     LYQGEAANKFLRGAIISTYQWAITWGLLVSSAVSQGTHSRNDASSYRIPIGLQYVWAL
                     VLAVGMLFLPESPRFYVLKDELDKAAKSLSFLRSVPITDAGLLEELVEIKATYDYEAS
                     FGSSSVLDCFRSSRSRPKQTLRMLSGIAIQACQQFSGINFIFYYGVNFFNKTGITNSY
                     LVSFITYAVNVAFNIPGLFLVDRVGRRKILLFGGVFMTASNFIIAIVGCSTNSVVANK
                     VMIAFICVFIASFSATWGGGVWVISAELYPLGVRSKCTAICAASNWLVNFICAFITPY
                     IVDTGSHTSSMGPKIFFIWGSLNALGVVVVYFTIYETRGLTLEEIDELYSKSPNSIQS
                     AKWNKRIRERSMNELLDEAQKMESQPSETTQNAATIHRSLESKGINSLPIPGLPNDIG
                     PEATMNFNERLYNNSSETEYDEIPNNYVDLGNGLGINTYNRGPPSFPSDSSDEEEDAD
                     GGSFSHRPTHDSQNMASVNEYMAQLMESRSESSHSKPAGLFTNYRKHSE"
     gene            <419094..>420152
                     /gene="TDEL0C02380"
                     /locus_tag="TDEL_0C02380"
                     /db_xref="GeneID:11500462"
     mRNA            <419094..>420152
                     /gene="TDEL0C02380"
                     /locus_tag="TDEL_0C02380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680290.1"
                     /db_xref="GeneID:11500462"
     CDS             419094..420152
                     /gene="TDEL0C02380"
                     /locus_tag="TDEL_0C02380"
                     /inference="similar to DNA sequence:INSDC:YDL193W"
                     /note="similar to Saccharomyces cerevisiae NUS1 (YDL193W);
                     ancestral locus Anc_7.308"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680338.1"
                     /db_xref="GeneID:11500462"
                     /db_xref="GOA:G8ZRI5"
                     /db_xref="InterPro:IPR001441"
                     /db_xref="UniProtKB/TrEMBL:G8ZRI5"
                     /translation="MNVIGESVQTRSGRDEIGPVASGRVPPPEASVLRNGLTRSKAHM
                     VQAVTKSVMLDDDQEMIERKLKRLSQEKSLFDRKTSKIQFLMCKVLLMIMYLIYGFYR
                     YFQYEYNRMKLKLLNIMYNPSNTPQLIRQDVNKLKKIPKRLAAILEMKSASYVGGGVK
                     GLMNDGSELVCWTVSAGIKHLILYDYDGVLKNNVQDFRKEIRAKLGKYYGPSNVPKYA
                     IRIPHLNKIYFNDEDDATSNGKNKVAIEVSLLSNRDGRETIVDLTRTMADLCAANELK
                     LSNITMKLVDKELTHLVGPEPDLLLYFGPALDLQGFPPWHIRLTELHWEEDNDDVVYS
                     VFIRGLQKYSACKINVGK"
     gene            <420853..>421398
                     /gene="TDEL0C02390"
                     /locus_tag="TDEL_0C02390"
                     /db_xref="GeneID:11500463"
     mRNA            <420853..>421398
                     /gene="TDEL0C02390"
                     /locus_tag="TDEL_0C02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680291.1"
                     /db_xref="GeneID:11500463"
     CDS             420853..421398
                     /gene="TDEL0C02390"
                     /locus_tag="TDEL_0C02390"
                     /inference="similar to DNA sequence:INSDC:YDL137W,YDL192W"
                     /note="similar to Saccharomyces cerevisiae ARF2 (YDL137W)
                     and ARF1 (YDL192W); ancestral locus Anc_7.307"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680339.1"
                     /db_xref="GeneID:11500463"
                     /db_xref="GOA:G8ZRI6"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZRI6"
                     /translation="MGLFASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVIT
                     TIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRITE
                     AREVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCA
                     TSGEGLYEGLEWLSNNLKNQS"
     gene            <421925..>422374
                     /gene="TDEL0C02400"
                     /locus_tag="TDEL_0C02400"
                     /db_xref="GeneID:11500464"
     mRNA            join(<421925..421927,422015..>422374)
                     /gene="TDEL0C02400"
                     /locus_tag="TDEL_0C02400"
                     /product="60S ribosomal protein L35"
                     /transcript_id="XM_003680292.1"
                     /db_xref="GeneID:11500464"
     CDS             join(421925..421927,422015..422374)
                     /gene="TDEL0C02400"
                     /locus_tag="TDEL_0C02400"
                     /inference="similar to DNA sequence:INSDC:YDL191W,YDL136W"
                     /note="similar to Saccharomyces cerevisiae RPL35A
                     (YDL191W) and RPL35B (YDL136W); ancestral locus Anc_7.306"
                     /codon_start=1
                     /product="60S ribosomal protein L35"
                     /protein_id="XP_003680340.1"
                     /db_xref="GeneID:11500464"
                     /db_xref="GOA:G8ZRI7"
                     /db_xref="InterPro:IPR001854"
                     /db_xref="InterPro:IPR018254"
                     /db_xref="UniProtKB/TrEMBL:G8ZRI7"
                     /translation="MAGVKAYELRTKNKEQLESQLVDLKKELAELKVQKLSRPSLPKI
                     KTVRKDIARVLTVMNHQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASRITE
                     KQRKKQIAFPQRKYAIKA"
     gene            complement(<422483..>425347)
                     /gene="TDEL0C02410"
                     /locus_tag="TDEL_0C02410"
                     /db_xref="GeneID:11500465"
     mRNA            complement(<422483..>425347)
                     /gene="TDEL0C02410"
                     /locus_tag="TDEL_0C02410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680293.1"
                     /db_xref="GeneID:11500465"
     CDS             complement(422483..425347)
                     /gene="TDEL0C02410"
                     /locus_tag="TDEL_0C02410"
                     /inference="similar to DNA sequence:INSDC:YDL190C"
                     /note="similar to Saccharomyces cerevisiae UFD2 (YDL190C);
                     ancestral locus Anc_7.305"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680341.1"
                     /db_xref="GeneID:11500465"
                     /db_xref="GOA:G8ZRI8"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019474"
                     /db_xref="UniProtKB/TrEMBL:G8ZRI8"
                     /translation="MATLHDIFQVTTDPNDSRGLPHVESDELEVALCNGDVDALLLFQ
                     LTENPDLNKPFAYLNGCFLRCQQQKRLLKGQTSAGSLQPLFEEIDRLVIGYGLVAFQI
                     ENFCLNGDFNAYIDQIVKEVDNYTAFLSQLIQRATVEGTLLDLLETFFTSLLQYLTKT
                     LPYFDLNDSATYNAVITLFEMFVSFKPVAAIFSQVSRFFGNFDCKANEFEKTTILGPL
                     LTLSPLNPNVALKNYGENLERTQQQKNIIHESLQAEHKMVIDRLLFLSSTRCCGASPE
                     SRTNLMTYFAQIVNKNHLRRGDHANQSKLASNAFMSNISLLLIKFSQPFLDVSYKKLD
                     KIDVNYFNNLNLFIDLSEETRVNSDFKEADEFYDKNKKDEDCKPNFISDCFFLTLTYL
                     HYGLGGTLLYDEKITPQIKRLRQEIDRIKNLSQSQDMFASFATMQLRQMEKSLKITQG
                     IKDALQGFFSHKALQLEVFDFICGASTFLIRVIDPNHEYPVKPIKLPLIPDQVGVENV
                     DNADYLREHAPIPFKYYPEFVVEGPINYSLFISQYNSSPIFRNPRLHSFVEFATVILR
                     CPELVSNPHLKGKLVQLLSVGAMPLTDDSPGFMMDIFETDELVNQNLLYAFLDFYVIV
                     EKTGSSSQFYDKFNSRYSISIILEQLYERIPLYRKQLVWQSKNNADFFVRFVARMLND
                     LTFLLDEGLSSLAEVHNLQIEVDNRARGLPPAREEDERELRSKLSSAERQAKSSCGLA
                     DKSMTLFEMYSKDIPNAFTTPEIVDRLASMLDHNLESLVGPKCGELKVNDPQQYSFNP
                     KALLKSLTTVYINLADDKEFVSAVARDGRSFNKELFQRAVRILARKIGLVSDEFCHKL
                     LAFAQSAEEQKIAEEEEDLNYGDAPEEFLDPLMYTIMKDPVTLPTSKVNIDRSTIKAH
                     LLSDSTDPFNRMPLKLEQVVPNEELRQRILEFRRQKRPAV"
     gene            <426028..>427086
                     /gene="TDEL0C02420"
                     /locus_tag="TDEL_0C02420"
                     /db_xref="GeneID:11500466"
     mRNA            <426028..>427086
                     /gene="TDEL0C02420"
                     /locus_tag="TDEL_0C02420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680294.1"
                     /db_xref="GeneID:11500466"
     CDS             426028..427086
                     /gene="TDEL0C02420"
                     /locus_tag="TDEL_0C02420"
                     /inference="similar to DNA sequence:INSDC:YDL189W"
                     /note="similar to Saccharomyces cerevisiae RBS1 (YDL189W);
                     ancestral locus Anc_7.304"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680342.1"
                     /db_xref="GeneID:11500466"
                     /db_xref="GOA:G8ZRI9"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="UniProtKB/TrEMBL:G8ZRI9"
                     /translation="MRTALFQKPHDRQFIIDLENSILSFMESNAESYQLRPMNSYYRL
                     LSHQVAEFHDLKHALARAHDNSVVIFKGDQFKKGQNRQLLQELVPVPAEFEESSELIS
                     PNDTNMKSGRRYRILKREDGLEVCTTPPSEEDRDFNTNSQSDANDSEAYLELKKIERE
                     RQYEQRKQEIFDTPKKNEVVSGKDGDGSSPQPSEFETSRYHFNQIDSSPPPQQPHNRR
                     RKNNNIGANKDKRGSYYKENKFNYNDYGNTSSAPYNTGYMMYPTPPMGPCALNSAQFP
                     MMYPAPFPMDGSNGYMSQFMYQPMNGAAVDPKSGLPAGFYHTLFPINTDNNRQVTIIR
                     VETCNITHMASPFQETTK"
     gene            complement(<427363..>427968)
                     /gene="TDEL0C02430"
                     /locus_tag="TDEL_0C02430"
                     /db_xref="GeneID:11500467"
     mRNA            complement(<427363..>427968)
                     /gene="TDEL0C02430"
                     /locus_tag="TDEL_0C02430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680295.1"
                     /db_xref="GeneID:11500467"
     CDS             complement(427363..427968)
                     /gene="TDEL0C02430"
                     /locus_tag="TDEL_0C02430"
                     /inference="similar to DNA sequence:INSDC:YDL135C"
                     /note="similar to Saccharomyces cerevisiae RDI1 (YDL135C);
                     ancestral locus Anc_7.303"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680343.1"
                     /db_xref="GeneID:11500467"
                     /db_xref="GOA:G8ZRJ0"
                     /db_xref="InterPro:IPR000406"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR024792"
                     /db_xref="UniProtKB/TrEMBL:G8ZRJ0"
                     /translation="MSEESEFQRLEAEQDADNYQVKAKKTVDEYKKLDAEDQSLAKWK
                     ESLGLGSDVLPLEFPGDKRKVVIQKIQLLVNTEPQPIMFDLTNEQTIKELASKRYKIK
                     EKSIYKLRITFKVQHEIITGLRYVQYIKKAGIAVDKIDDHLGSYAPSTKTKPFYEVEL
                     PESEAPSGFLARGNYSAVSKFIDDDKTTHLTLNWGVEITKS"
     gene            <428263..>428859
                     /gene="TDEL0C02440"
                     /locus_tag="TDEL_0C02440"
                     /db_xref="GeneID:11500468"
     mRNA            <428263..>428859
                     /gene="TDEL0C02440"
                     /locus_tag="TDEL_0C02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680296.1"
                     /db_xref="GeneID:11500468"
     CDS             428263..428859
                     /gene="TDEL0C02440"
                     /locus_tag="TDEL_0C02440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680344.1"
                     /db_xref="GeneID:11500468"
                     /db_xref="InterPro:IPR018020"
                     /db_xref="UniProtKB/TrEMBL:G8ZRJ1"
                     /translation="MCLPDYSCFVESDNLTEQTKVIDDLFEPSYSILRFTLRDGMFMQ
                     NAKLHAKNYAEFIELIRSRLLNICNNTEQIGPSSRDVDHLADIVGAHPRLGESAKKLS
                     ASSKKEQQKLQNNNDPIEIREMIAKLNNAYEKKYPGLRFVVFVNGRSRPQIIRDMQRR
                     IESGNSWFEEARIAINELCDIAQDRVSKGKLQSLKCKY"
     gene            complement(<429017..>430138)
                     /gene="TDEL0C02450"
                     /locus_tag="TDEL_0C02450"
                     /db_xref="GeneID:11500469"
     mRNA            complement(<429017..>430138)
                     /gene="TDEL0C02450"
                     /locus_tag="TDEL_0C02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680297.1"
                     /db_xref="GeneID:11500469"
     CDS             complement(429017..430138)
                     /gene="TDEL0C02450"
                     /locus_tag="TDEL_0C02450"
                     /inference="similar to DNA sequence:INSDC:YDL188C,YDL134C"
                     /note="similar to Saccharomyces cerevisiae PPH22 (YDL188C)
                     and PPH21 (YDL134C); ancestral locus Anc_7.302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680345.1"
                     /db_xref="GeneID:11500469"
                     /db_xref="GOA:G8ZRJ2"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8ZRJ2"
                     /translation="MDLDLDVPMHDAIEDQPVTQDEDKNSGNENELTATTTSVDEDEE
                     KDDFKPGSSGIADHKSAKPLELNNSNINQLDQWIDYLGKCQILSEDDVARLCKMAVDV
                     LQFEENVKPINVPVTICGDVHGQFHDLMELFRIGGPCPDTNYLFMGDYVDRGYYSVET
                     VSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSASVWKMFTDLFDYFP
                     ITALVDNKVFCLHGGLSPMIETIDQVRELNRIQEVPHEGPMCDLLWSDPDDRGGWGIS
                     PRGAGFTFGQDISEQFNHTNDLSLIARAHQLVMEGYAWSHQQNVVTIFSAPNYCYRCG
                     NQAAIMEVDENHNRQFLQYDPSIRPGEPTVSRKTPDYFL"
     gene            <430625..>431254
                     /gene="TDEL0C02460"
                     /locus_tag="TDEL_0C02460"
                     /db_xref="GeneID:11500470"
     mRNA            <430625..>431254
                     /gene="TDEL0C02460"
                     /locus_tag="TDEL_0C02460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680298.1"
                     /db_xref="GeneID:11500470"
     CDS             430625..431254
                     /gene="TDEL0C02460"
                     /locus_tag="TDEL_0C02460"
                     /inference="similar to DNA sequence:INSDC:YDL186W"
                     /note="similar to Saccharomyces cerevisiae YDL186W;
                     ancestral locus Anc_7.301"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680346.1"
                     /db_xref="GeneID:11500470"
                     /db_xref="UniProtKB/TrEMBL:G8ZRJ3"
                     /translation="MPLDLKSCTTGIPPCQPTFDLTKKQFMPHKNVERVREMVKSRQH
                     DKVFGKKMEINMVRGKPAITYSDNSTTEGEDVLENKTIFQPIGRWWRRSRSQSVRTEN
                     DSFTLTFDNEELSQMDGVSSPWLDGAVPFTYPQQVTTTNDYELIVKNEQEIYQQYYNH
                     PIGPEYLTLSHSPQRDEELSRFRQRQNRQFRPDSWFEGCIGWKIPYTTC"
     gene            <431635..>433305
                     /gene="TDEL0C02470"
                     /locus_tag="TDEL_0C02470"
                     /db_xref="GeneID:11500471"
     mRNA            <431635..>433305
                     /gene="TDEL0C02470"
                     /locus_tag="TDEL_0C02470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680299.1"
                     /db_xref="GeneID:11500471"
     CDS             431635..433305
                     /gene="TDEL0C02470"
                     /locus_tag="TDEL_0C02470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680347.1"
                     /db_xref="GeneID:11500471"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8ZRJ4"
                     /translation="MIEYHLIVLVHGLWGNTSHFDYISKALKEYARDNWGKDHEELLV
                     YTTTLNEGFKTYDGIDVCGFRVAQEIADQIGCFENSSSKGRITKFSIVGYSLGGLISR
                     YAIGLLYQKQFFKKREIQLLNFVTFCTPHVGVLAPGRNMAVRLFNSTVPWLLGNTGKQ
                     MFLKDKVTVGVDQSNNGMPLIHLMSLENTVFYRALESFKYKSLYANIINDRRTAWWTS
                     GISLNDPFFNIDEYNGVEVFQYIRGFDTVVLDRNEMIVVAKAADPPTKNSIQGDSQAE
                     SGDEDSINISDNREVRDFYFFNYWLMKIGKWILVIANLLIIAPLLFTWKIVHSLAEMT
                     ISTIRVTRFVNKYSHQLLHDFFEILPSPDSDEILSANDSIGSESDVEADDLYSVRTSL
                     SRTSSNHSNFGGNGSFPLEYGTYLGLEESLNDQADYLIESIYDAIERKNTHTGFVEEA
                     PSNSTNIDEGSLAVTIRELESQPFEQLVAKHGKEMISLIENLYLDLSPTQVAIINSLN
                     KLQWSKYPIYIRKTPSAHACAIVRQLDADFDEGKIVVDHWIRKVLQRN"
     gene            complement(<433302..>433745)
                     /gene="TDEL0C02480"
                     /locus_tag="TDEL_0C02480"
                     /db_xref="GeneID:11500472"
     mRNA            complement(<433302..>433745)
                     /gene="TDEL0C02480"
                     /locus_tag="TDEL_0C02480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680300.1"
                     /db_xref="GeneID:11500472"
     CDS             complement(433302..433745)
                     /gene="TDEL0C02480"
                     /locus_tag="TDEL_0C02480"
                     /inference="similar to DNA sequence:INSDC:YEL048C"
                     /note="similar to Saccharomyces cerevisiae YEL048C;
                     ancestral locus Anc_1.491"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680348.1"
                     /db_xref="GeneID:11500472"
                     /db_xref="GOA:G8ZRJ5"
                     /db_xref="InterPro:IPR006722"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:G8ZRJ5"
                     /translation="MTISPSFVSLVDEANRPLFVYVTPSESEDVNQVLKYNVLSNLSL
                     DYFENDLFDWSSLETQPDIKALFNLEGVAVYGMIIKQTGLKIIIGFLIKENIQELNDD
                     EISEVFMKVKKIYLRAKLNPFVAPSSFDDSKELSAKLQKKFSEEL"
     gene            complement(<433874..>435373)
                     /gene="TDEL0C02490"
                     /locus_tag="TDEL_0C02490"
                     /db_xref="GeneID:11500473"
     mRNA            complement(<433874..>435373)
                     /gene="TDEL0C02490"
                     /locus_tag="TDEL_0C02490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680301.1"
                     /db_xref="GeneID:11500473"
     CDS             complement(433874..435373)
                     /gene="TDEL0C02490"
                     /locus_tag="TDEL_0C02490"
                     /inference="similar to DNA sequence:INSDC:YEL047C,YJR051W"
                     /note="similar to Saccharomyces cerevisiae YEL047C and
                     OSM1 (YJR051W); ancestral locus Anc_1.490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680349.1"
                     /db_xref="GeneID:11500473"
                     /db_xref="GOA:G8ZRJ6"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR010960"
                     /db_xref="InterPro:IPR027477"
                     /db_xref="UniProtKB/TrEMBL:G8ZRJ6"
                     /translation="MLKVRRLIVYLIIGFLLYAIRQWSQFPTQMTSKLPVVIIGSGLA
                     GLSTGNQLATKYKIPIILLDKAASIGGNSIKASSGINGAFTKTQKNLNVQDSPENFYQ
                     DTVASAKGRGVESLMNKLTEDSSAAIQWLQQEFGLKLDLLAQLGGHSAPRTHRSSGKL
                     PPGFEIVQGLKKNLESIAEKDPTLVKILLNSKVVNIALDSNSKVSSIDYLDSEGNKNT
                     VKTNNVVFCSGGFAFSKEMLKEYAPELVHLPTTNGQQATGDGQKILQKLGADLIDMNQ
                     VQVHPTGFIDPNDRSSQWKFLAAEALRGLGGILLNPINGKRFVDELQRRDFVTEAIQS
                     KCPKDENRAYLVMSEYVYENYKNNMDFYIFKKLIKKVGIEKFVSEYNVPISASELAND
                     LQEYSTAANDQFGRKSVLNSFGESVTPKTEIYVGEITPVVHFTMGGAKINDNSQVIGK
                     DNKPLAAGLYAAGEVSGGVHGSNRLGGSSLLECVVFGRTAAHSIAKNYA"
     gene            complement(<435866..>437029)
                     /gene="TDEL0C02500"
                     /locus_tag="TDEL_0C02500"
                     /db_xref="GeneID:11500474"
     mRNA            complement(<435866..>437029)
                     /gene="TDEL0C02500"
                     /locus_tag="TDEL_0C02500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680302.1"
                     /db_xref="GeneID:11500474"
     CDS             complement(435866..437029)
                     /gene="TDEL0C02500"
                     /locus_tag="TDEL_0C02500"
                     /inference="similar to DNA sequence:INSDC:YEL046C"
                     /note="similar to Saccharomyces cerevisiae GLY1 (YEL046C);
                     ancestral locus Anc_1.489"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680350.1"
                     /db_xref="GeneID:11500474"
                     /db_xref="GOA:G8ZRJ7"
                     /db_xref="InterPro:IPR001597"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR023603"
                     /db_xref="UniProtKB/TrEMBL:G8ZRJ7"
                     /translation="MTSQLPLAYASASNDLRSDTFTTPTPEMIEAALTASIGDAVYQE
                     DMDTCFLENLVANLAGKEQGLFCVSGTLSNQIALRTHLLQPPYSVLCDYRAHVYTHEA
                     AGLAILSQAMVVPVRPANGNYLTLDDITAHYVPDDGDVHGAPTKVISLENTLHGMITP
                     IDELVRIRAWCSQNNIKLHCDGARIWNAAIASGVPLKQFGELFDSISICLSKSMGAPI
                     GSILVGDAKFIKKANHFRKQQGGGIRQSGMMAKMATVAINGDWKAKMSYSHRLASDLA
                     LFCKENDIPLESPTDTNFVFLDLSKAHMNPDVLVKKGLKYRIKLMGGRIAFHYQVTQE
                     TLEKAKCAILESFEHAKEHPFNQQGQTKIYRSESTDKIDIDGNSIHGIKTYKY"
     gene            <437907..>438320
                     /gene="TDEL0C02510"
                     /locus_tag="TDEL_0C02510"
                     /db_xref="GeneID:11500475"
     mRNA            <437907..>438320
                     /gene="TDEL0C02510"
                     /locus_tag="TDEL_0C02510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680303.1"
                     /db_xref="GeneID:11500475"
     CDS             437907..438320
                     /gene="TDEL0C02510"
                     /locus_tag="TDEL_0C02510"
                     /inference="similar to DNA sequence:INSDC:YEL044W"
                     /note="similar to Saccharomyces cerevisiae IES6 (YEL044W);
                     ancestral locus Anc_1.488"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680351.1"
                     /db_xref="GeneID:11500475"
                     /db_xref="GOA:G8ZRJ8"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="InterPro:IPR029525"
                     /db_xref="UniProtKB/TrEMBL:G8ZRJ8"
                     /translation="MNGSNDRLEFLRKVYHDNLIPVPSKFKKHGYRKPSRRHKSSRQL
                     IADESKRISSILQNPNIQVKPVPKVTYFNVNAPPSIRPSKKYCDITGLKGYYKSPVNN
                     IRYHNSEIYQLIVKPMTPGVDQEYLKLRGDNFVLK"
     gene            <438435..>441068
                     /gene="TDEL0C02520"
                     /locus_tag="TDEL_0C02520"
                     /db_xref="GeneID:11500476"
     mRNA            <438435..>441068
                     /gene="TDEL0C02520"
                     /locus_tag="TDEL_0C02520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680304.1"
                     /db_xref="GeneID:11500476"
     CDS             438435..441068
                     /gene="TDEL0C02520"
                     /locus_tag="TDEL_0C02520"
                     /inference="similar to DNA sequence:INSDC:YEL043W"
                     /note="similar to Saccharomyces cerevisiae YEL043W;
                     ancestral locus Anc_1.487"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680352.1"
                     /db_xref="GeneID:11500476"
                     /db_xref="InterPro:IPR003961"
                     /db_xref="UniProtKB/TrEMBL:G8ZRJ9"
                     /translation="MILYTFCTFVALSWLCYRLYKFVTIPVIKIVSTLKVGTPPATKV
                     SIDKISDKSITIHWENEPVTRKRGKRQSENISHFLLYLNNIQVAIFPNSPSFLYTCCL
                     INGLESGKEYQLDFITVNNMGFINKLPSIYCMTKAVASPSANGRKNGKWRKNTLTSTA
                     SLADSTSNFTTPAYANLTSLKDLESYSIEDLKRILVCAQEDLHDVLSQQSSLLQDFQE
                     SKLQLDLEVDNLKNYWSHEIDLRKSLRSNIKSLENSKLLSDLKLEKIDKNIDQANAKI
                     LKMERDMENWSHQDQERLNKEVLRENYNKQLKLINENVESLSDRIKQCQREVTLQEDK
                     NKELNSLKKNASSSQPKQTGVSEDMPLALPTLLKKLNEATMDKSGLLANSGEEYLSKL
                     NPNSPVVKLVRDQLKLDQDLDSKWKSNKNKMSKRIETLQAMFSEISIANRRLRSNLII
                     QPYANADSNANTNTPPNSKSDSNVNLAAIANNINSSSNSSTNLNEKDANINSPPISHR
                     SVIDNIGTVPIANSRSVDNSEANPHLILHNPSTYSSNEPMPSEMNNNAFSTGRPHTAS
                     LLANTNHMHQVFPWSSEQQQQQQVELEQAFEYDNASHLISGLQNIMYDETEYPESISN
                     YSKGFTTDQLDNYWTNQGMGTNNYEAPSYPMNYTSYASNESYGPTVPFSTATGPRSPS
                     TPPNLAPSQSLLAATLVEPSMANFGASLSMNHSESFHAVDSPASNSADGKQINRTLLH
                     NALPLEAPLPSNEDGAHPQDTHVHLQAPSFNFMWHSPPSHSTASKTDTKHVRNASTAS
                     NGSNNSTWSKLNWRNWSPQAPPQSEEVIEETQSPPPIPRSASHKDAVPPVNTNGRRMS
                     RLLSRSGMNSIFKLPSHEERK"
     gene            complement(<441085..>441795)
                     /gene="TDEL0C02530"
                     /locus_tag="TDEL_0C02530"
                     /db_xref="GeneID:11500477"
     mRNA            complement(<441085..>441795)
                     /gene="TDEL0C02530"
                     /locus_tag="TDEL_0C02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680305.1"
                     /db_xref="GeneID:11500477"
     CDS             complement(441085..441795)
                     /gene="TDEL0C02530"
                     /locus_tag="TDEL_0C02530"
                     /inference="similar to DNA sequence:INSDC:YJR050W"
                     /note="similar to Saccharomyces cerevisiae ISY1 (YJR050W);
                     ancestral locus Anc_1.486"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680353.1"
                     /db_xref="GeneID:11500477"
                     /db_xref="InterPro:IPR009360"
                     /db_xref="UniProtKB/TrEMBL:G8ZRK0"
                     /translation="MSRNVDKANSVLVRYQELQAEEGSGYKDYSRYKRPTKLSSVKSL
                     NEAQQWRKQITREINDKTTRIYDPSLNEIQVQELNDELNELLTEQNKWDWYMSKILGG
                     KRPDKRRRDDVIGGKLINGKRYFGRALELPEVKDILKKQQDDEIYGKNGKGIVNTKLI
                     PKDKSAPYYGAEKMVSEELIEFEDQWTSILRKKFIGNDRLSGAKLENIGTKIPTIQDM
                     ESWLVEERKKKLLKDLSL"
     gene            <442005..>443615
                     /gene="TDEL0C02540"
                     /locus_tag="TDEL_0C02540"
                     /db_xref="GeneID:11500478"
     mRNA            <442005..>443615
                     /gene="TDEL0C02540"
                     /locus_tag="TDEL_0C02540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680306.1"
                     /db_xref="GeneID:11500478"
     CDS             442005..443615
                     /gene="TDEL0C02540"
                     /locus_tag="TDEL_0C02540"
                     /inference="similar to DNA sequence:INSDC:YEL042W"
                     /note="similar to Saccharomyces cerevisiae GDA1 (YEL042W);
                     ancestral locus Anc_1.485"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680354.1"
                     /db_xref="GeneID:11500478"
                     /db_xref="GOA:G8ZRK1"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="UniProtKB/TrEMBL:G8ZRK1"
                     /translation="MVRNYRFIIFAFVAIMLLALIKSSTSVKSASDIVRVVSPTASRP
                     DVPQDFSALPIDDEPGYIVDDKTDNGNPSVASAVKEHSSGAISNAKSTSSASAEYSTS
                     KKCDKDHQFVLMIDAGSSGSRIHVYEFDVCTQPPTLIEETFKMLEPGLSSYDTDADGA
                     ARSLDPLLERALETIPKDKRGCAPVAVKATAGLRLLGDAKADKILSAVRSHLENDYPF
                     PVVQGDGVSVMGGDDEGVYAWITTNYLLGNIGAGSKIPTSAVFDLGGGSTQIVFEPTF
                     PPNEKMIDGEHKYELTFGGQKYTLYQFSHLGYGLNQGRNKINALIVETAISEGKIERG
                     DTKTTHKLSSPCLPPKVVASKQVVKLDDGTKYTIDFKGPLQPAGAQCRYLADKILKKD
                     AKCSQPPCSFNGVHQPSLVHTFKERNDLYVFSYFYDRTQPLGLPLSFKLDELVDLTKM
                     VCNGEEVWESVFSGVEGSVEELKKDPKWCIDLSFQVSLLHTGYEIPLYRELKTAKTIA
                     DNEVGWCLGASLPLIEADTWKCKVDKII"
     gene            <443907..>445514
                     /gene="TDEL0C02550"
                     /locus_tag="TDEL_0C02550"
                     /db_xref="GeneID:11500479"
     mRNA            <443907..>445514
                     /gene="TDEL0C02550"
                     /locus_tag="TDEL_0C02550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680307.1"
                     /db_xref="GeneID:11500479"
     CDS             443907..445514
                     /gene="TDEL0C02550"
                     /locus_tag="TDEL_0C02550"
                     /inference="similar to DNA sequence:INSDC:YEL041W,YJR049C"
                     /note="similar to Saccharomyces cerevisiae YEF1 (YEL041W)
                     and UTR1 (YJR049C); ancestral locus Anc_1.484"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680355.1"
                     /db_xref="GeneID:11500479"
                     /db_xref="GOA:G8ZRK2"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="InterPro:IPR017437"
                     /db_xref="InterPro:IPR017438"
                     /db_xref="UniProtKB/TrEMBL:G8ZRK2"
                     /translation="MSLPNSAEECVTRIYKDCDKKSKGNSKTVEQKNTSYTKQRRKSA
                     THRSVPSLGFCKELNYIDDDKKRERINDLNEAKAMIRRLSGDSHPPKVTATKSHFQLS
                     STAYGVRMLSKDLSNTRVELKVENLMIVTKTHDVSLIYLTRELVEWLLINYPKVTVYV
                     GEDMKNSKKFSAEDLCKDSRCENRRIKYWNPKFVDEHDNFFDLIVTLGGDGTVLFVSS
                     VFQRHVPPVLSFSLGSLGFLTNFQFENFKEDLATVLNNRIKTNLRMRLDCKAYRRRPP
                     IIDPNTGKKTCVTELVGQHQVLNELTIDRGPSPFISMLELYGDNSLLTMAQADGLIIA
                     TPTGSTAYSLSAGGSLVYPSVNAIAVTPICPHTLSFRPIILPESMTLKVRVSMKSRAT
                     AWAAFDGKSRLELKKGDYITIQASPYSFPTVESHPTEFIDSISRTLNWNVREQQRSFT
                     HMLSRKNQEKYASDAGNTRADDEEVEEVIIDKNKKPPKFRLHDNADDDNDDENEEALE
                     DDTSLAPVSPKSKPIDQIRSPQANFTI"
     gene            <445830..>447269
                     /gene="TDEL0C02560"
                     /locus_tag="TDEL_0C02560"
                     /db_xref="GeneID:11500480"
     mRNA            <445830..>447269
                     /gene="TDEL0C02560"
                     /locus_tag="TDEL_0C02560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680308.1"
                     /db_xref="GeneID:11500480"
     CDS             445830..447269
                     /gene="TDEL0C02560"
                     /locus_tag="TDEL_0C02560"
                     /inference="similar to DNA sequence:INSDC:YEL040W"
                     /note="similar to Saccharomyces cerevisiae UTR2 (YEL040W);
                     ancestral locus Anc_1.483"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680356.1"
                     /db_xref="GeneID:11500480"
                     /db_xref="GOA:G8ZRK3"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR017168"
                     /db_xref="UniProtKB/TrEMBL:G8ZRK3"
                     /translation="MIWAVLLLGLVKHILLAEAATCNATQACPEELPCCSQFGECGTG
                     SYCLGGCNPMFSYKAEACMPMPVCKDMNTVFDDYSSKVVSHDEYLGNASEADWIYSGY
                     LYDYEDEESMLIAMPKYSAGTVLSSTTYLWYGKVSARVKSSHRGGVVSAFILFSNVQD
                     EIDYEFVGADLETVQTNLYFEGVLNYNQSRNISTTDTFENYHDYEVDWQEDQITWSVD
                     GVVGRTLFRNETYNETSQRYEFPQTPSRVQLSIWPAGNSTNAPGTIAWAGGLIDWDAD
                     DLKDPGYYYAAVKEVNVTCYDPPSYVKKNGTKSYVFANEDSYMSEDIAITDDESILYS
                     NKGSGLDPDNGKSSSSSSSSSSSTSSSSSSSSSSSASSSSSASSSSSASSSSSSSSKS
                     SSKDTTATTTAQSTAQSTAQTAAQTTSSSTQTISPEQSTGFVQNMNSSSKSGSTSQTQ
                     TQSASSATNGANSLPIGMPLAGLLLGYLL"
     gene            complement(<447382..>447714)
                     /gene="TDEL0C02570"
                     /locus_tag="TDEL_0C02570"
                     /db_xref="GeneID:11500481"
     mRNA            complement(<447382..>447714)
                     /gene="TDEL0C02570"
                     /locus_tag="TDEL_0C02570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680309.1"
                     /db_xref="GeneID:11500481"
     CDS             complement(447382..447714)
                     /gene="TDEL0C02570"
                     /locus_tag="TDEL_0C02570"
                     /inference="similar to DNA sequence:INSDC:YEL039C,YJR048W"
                     /note="similar to Saccharomyces cerevisiae CYC7 (YEL039C)
                     and CYC1 (YJR048W); ancestral locus Anc_1.482"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680357.1"
                     /db_xref="GeneID:11500481"
                     /db_xref="GOA:G8ZRK4"
                     /db_xref="InterPro:IPR002327"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="UniProtKB/TrEMBL:G8ZRK4"
                     /translation="MPAPYQPGSAKKGATLFKTRCLQCHTTEKGGPHKVGPNLHGVFG
                     RHSGQAEGYSYTDANIKKNILWDEQHMSDYLENPKKYIPGTKMAFGGLKKEKDRNDLV
                     TYLAKACK"
     gene            <448204..>448863
                     /gene="TDEL0C02580"
                     /locus_tag="TDEL_0C02580"
                     /db_xref="GeneID:11500482"
     mRNA            <448204..>448863
                     /gene="TDEL0C02580"
                     /locus_tag="TDEL_0C02580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680310.1"
                     /db_xref="GeneID:11500482"
     CDS             448204..448863
                     /gene="TDEL0C02580"
                     /locus_tag="TDEL_0C02580"
                     /inference="similar to DNA sequence:INSDC:YEL038W"
                     /note="similar to Saccharomyces cerevisiae UTR4 (YEL038W);
                     ancestral locus Anc_1.481"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680358.1"
                     /db_xref="GeneID:11500482"
                     /db_xref="GOA:G8ZRK5"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023943"
                     /db_xref="InterPro:IPR027511"
                     /db_xref="UniProtKB/TrEMBL:G8ZRK5"
                     /translation="MSFKALLLDIEGTVCPIAFVKDVLFPFFSSKVSVLLQSNDPEVK
                     RLLAQFPAQDNLQEYIQDLVARDVKDPILKQLQGHVWAQGYYNGEIKAPVYKDAIELI
                     KRKPEVYIYSSGSVKAQKLLFGHVEDPSSTKSIDLQPFIKSFFDINTSGKKTEPESYQ
                     KILQNIGKQPDDVLFISDNILELDAASQVGLETILAVRPGNPPVTDIKNYSILEDYST
                     L"
     gene            complement(<448900..>450006)
                     /gene="TDEL0C02590"
                     /locus_tag="TDEL_0C02590"
                     /db_xref="GeneID:11500483"
     mRNA            complement(<448900..>450006)
                     /gene="TDEL0C02590"
                     /locus_tag="TDEL_0C02590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680311.1"
                     /db_xref="GeneID:11500483"
     CDS             complement(448900..450006)
                     /gene="TDEL0C02590"
                     /locus_tag="TDEL_0C02590"
                     /inference="similar to DNA sequence:INSDC:YEL037C"
                     /note="similar to Saccharomyces cerevisiae RAD23
                     (YEL037C); ancestral locus Anc_1.480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680359.1"
                     /db_xref="GeneID:11500483"
                     /db_xref="GOA:G8ZRK6"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR004806"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015360"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8ZRK6"
                     /translation="MVSITFKDFKKEKIPLDLDLSSSVLDAKVQLAQKKECEEGQIKL
                     IYSGKVLQDSKSLQESGLKDGDQVIFMISKKKSTTTTVTEPQSKETSAPVSQSPAPQS
                     ETPAAETQQEASSTTDPGFVVGAQRNEAVERIMEMGYEREQVDRALRAAFNNPDRAVE
                     YLLMGIPENLQQQQQPQQQAEQPQEQEEEQQETESNTEPTGEAAGEDLFAQAAQRGGA
                     PGGETGGEGTTGGPPGSIGLTMEDLLALRQVVSGNPEALAPLLESLSNRFPQLREQIV
                     ANPEVFVSMLLEAVGENLEDAMTGMDEGTEGGAVAAGQQGEEVNVEVSESDEQAIARL
                     CELGFERALVMQVYFACGKNEEIAANMLFNEFGD"
     gene            complement(<450202..>451590)
                     /gene="TDEL0C02600"
                     /locus_tag="TDEL_0C02600"
                     /db_xref="GeneID:11500484"
     mRNA            complement(<450202..>451590)
                     /gene="TDEL0C02600"
                     /locus_tag="TDEL_0C02600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680312.1"
                     /db_xref="GeneID:11500484"
     CDS             complement(450202..451590)
                     /gene="TDEL0C02600"
                     /locus_tag="TDEL_0C02600"
                     /inference="similar to DNA sequence:INSDC:YEL036C"
                     /note="similar to Saccharomyces cerevisiae ANP1 (YEL036C);
                     ancestral locus Anc_1.479"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680360.1"
                     /db_xref="GeneID:11500484"
                     /db_xref="InterPro:IPR005109"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8ZRK7"
                     /translation="MRYKNFVNHSTLVSTCGTLLAVWVLFRLLFSSSSSFSLNTLPFF
                     KPFVPNFKNVPGVEYYDLRNYQGDRDGWQRGNRILFLVPLRDAAQHLPRFFGHMSELS
                     YPHNLIDMSFLVSDSSDDTMGELLHHLQIAQSQKDRNKRFGNIEIFEKDFGQAIGQSF
                     SDRHGFAAQGPRRKLMARARNWLGSVTLKPYHSWVYWRDVDVEIAPISIMEDLMHHDR
                     DVIVPNVWRPLPDWLGNIQPYDLNSWKESEAGIQLANTLTDEDSVIVEGYPEFATWRT
                     HLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRTGSHFPAFSFEKHAETEAFGKLSR
                     RMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAEEEKRILDETRLREFYDRIWEVGFDD
                     VRMDWSDERQSILKNLDHTEAYENQIVVDWSDNDESDITPDEKVQNRLQEEVIDEHPQ
                     DEVPLDFDPDNN"
     gene            <453154..>453627
                     /gene="TDEL0C02610"
                     /locus_tag="TDEL_0C02610"
                     /db_xref="GeneID:11500485"
     mRNA            <453154..>453627
                     /gene="TDEL0C02610"
                     /locus_tag="TDEL_0C02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680313.1"
                     /db_xref="GeneID:11500485"
     CDS             453154..453627
                     /gene="TDEL0C02610"
                     /locus_tag="TDEL_0C02610"
                     /inference="similar to DNA sequence:INSDC:YEL034W,YJR047C"
                     /note="similar to Saccharomyces cerevisiae HYP2 (YEL034W)
                     and ANB1 (YJR047C); ancestral locus Anc_1.478"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680361.1"
                     /db_xref="GeneID:11500485"
                     /db_xref="GOA:G8ZRK8"
                     /db_xref="InterPro:IPR001884"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR019769"
                     /db_xref="InterPro:IPR020189"
                     /db_xref="UniProtKB/TrEMBL:G8ZRK8"
                     /translation="MAEEEHTFETVDAGSSLTYPLQCSALRKNGFVNIKGRPCKIVDM
                     STSKTGKHGHAKVHLVALDIFTGKKLEDLSPSTHNMEVPFVKRTEYQLLDIDDGFLSL
                     MTMDGETKDDVRAPEGELGDSIQAAFDEGKDLNVTIIAAMGEEAAISFKEAPKSD"
     gene            453782..453863
                     /gene="TDEL0Ctrna6S"
                     /locus_tag="TDEL_0Ctrna6S"
                     /db_xref="GeneID:11500486"
     tRNA            453782..453863
                     /gene="TDEL0Ctrna6S"
                     /locus_tag="TDEL_0Ctrna6S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCU"
                     /db_xref="GeneID:11500486"
     gene            <453901..>456858
                     /gene="TDEL0C02620"
                     /locus_tag="TDEL_0C02620"
                     /db_xref="GeneID:11502021"
     mRNA            <453901..>456858
                     /gene="TDEL0C02620"
                     /locus_tag="TDEL_0C02620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680314.1"
                     /db_xref="GeneID:11502021"
     CDS             453901..456858
                     /gene="TDEL0C02620"
                     /locus_tag="TDEL_0C02620"
                     /inference="similar to DNA sequence:INSDC:YEL032W"
                     /note="similar to Saccharomyces cerevisiae MCM3 (YEL032W);
                     ancestral locus Anc_1.477"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680362.1"
                     /db_xref="GeneID:11502021"
                     /db_xref="GOA:G8ZRK9"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008046"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:G8ZRK9"
                     /translation="MSHLSIMKNHFFFSTIQNNSIITKKVLNMDLGTEADGDYNFVPD
                     AVFSDRVRRFQEFLDTFTIYRDAVRSVQLYNSAIENGSEKKTGNPDVLLQRITISLDD
                     LREFDRTFWTGVLNAPAHFIPPAEKALTELATSINDVPQNHSIRASLSAKRPWCLSFK
                     GSFGSHALSPRTLNSHFLNKLVSLEGIVTRTSLVRPKIVRSVHFAEKTGRFHYRDYTD
                     STTTLTTRIPTPAIYPTEDQDGNKLTTEYGYCTYLDHQRITVQEMPEMAPAGQLPRSV
                     DIILDDDLVDKTKPGDRINVVGVFKSLGAGGLNQSDSNALNGFRTLIIGNTVYPLHAR
                     STGVSARQTLTDFDIRNINKLAKRVDIFDVLAQSLAPSIYGHEHIKRAVLLMLMGGVE
                     KNLENGSHLRGDINILMVGDPSTAKSQMLRFVLNTASLAIATTGRGSSGVGLTAAVTT
                     DRETGERRLEAGAMVLADRGIVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTTL
                     NARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEH
                     VLRTHRYLPPGYLEGEPIRESLNLSLSVGADDEEEDSIENPKHKGGQDGDMDEEDSVF
                     EKFNPLLQAGAKLAKNRGNHNGSDIPSIVAIPFLRKYIQYAKERVQPQLTQEAIDVIV
                     KSYAELRNDENTKKSPITARTLETLIRLATAHAKVRLSKTVNRRDALVASNLLRFALL
                     GEDVGSEIYYEDESEEELLQKVSPKKSPKKKQRIRQRNDIASSPTKITTPSRTPNLSS
                     RGGTPSTIRSRRKLTFVDDDDDDVEDESDQSAGKVGKAMLPLPQNEEEDLQRRLQQGL
                     RVSPRRQEQAPAPGGPLTEVAGTPRLPNLSTAGQDEGDQEENDAFLAEYEPGSISTGR
                     LSLISGIIARLMQTDLFEEESYPKVALLERINEELTDEEKFQVPEYLAGLRIMQARNN
                     LMISDEDGKVYKV"
     gene            <457240..>458862
                     /gene="TDEL0C02630"
                     /locus_tag="TDEL_0C02630"
                     /db_xref="GeneID:11500487"
     mRNA            <457240..>458862
                     /gene="TDEL0C02630"
                     /locus_tag="TDEL_0C02630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680315.1"
                     /db_xref="GeneID:11500487"
     CDS             457240..458862
                     /gene="TDEL0C02630"
                     /locus_tag="TDEL_0C02630"
                     /inference="similar to DNA sequence:INSDC:YBL080C"
                     /note="similar to Saccharomyces cerevisiae PET112
                     (YBL080C); ancestral locus Anc_7.403"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680363.1"
                     /db_xref="GeneID:11500487"
                     /db_xref="GOA:G8ZRL0"
                     /db_xref="InterPro:IPR003789"
                     /db_xref="InterPro:IPR004413"
                     /db_xref="InterPro:IPR006075"
                     /db_xref="InterPro:IPR017958"
                     /db_xref="InterPro:IPR017959"
                     /db_xref="InterPro:IPR018027"
                     /db_xref="UniProtKB/TrEMBL:G8ZRL0"
                     /translation="MLRLKRWYNVDKIQTSKFKLLPQYKLKCGLEIHTQLNTNKKLFS
                     QSTNDPFHSLDTPNAHTSYFDIALPGTQPILNYEVVLYALRLSLALDSKVNLRSQFDR
                     KHYFYGDQPMGYQITQHYSPFASGGHLTLHKDGDGINDIEKKINLIQLQIEQDTGKSI
                     YRDNEKQTLIDLNRSNVPLIEMVTQPDFTDLKQIRAFIKKYQNLVRHLDISTGDLETG
                     AMRVDVNLSVNDFARVELKNLPNTSSIMNAIKYEYQRQVKILEAGEGEEYLSHSETRS
                     WNGESTVKLRSKETTIDYRYMPDPELPVISLSADVIEGVGKSLPPSPDEILSQLMTKP
                     YSLSLKDARILTISGNSQDGIYSQVELLKFYLDTFDCYSKIVEREGLGEVKHKLPTNW
                     IIHELLGDLKKLQIPLEKATAILSPEKFADFLTFIHSNKISSASGKLLLFHVLEDFQA
                     HGLTKQINFDELIKEYELQTIDQVNEADLKKLCQKIIEAADSKMINGIVSGKKRNSIK
                     FLVGQGMRSSQGRIQAQQFEDMFKELLCSNNE"
     gene            complement(<459106..>460242)
                     /gene="TDEL0C02640"
                     /locus_tag="TDEL_0C02640"
                     /db_xref="GeneID:11500488"
     mRNA            complement(<459106..>460242)
                     /gene="TDEL0C02640"
                     /locus_tag="TDEL_0C02640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680316.1"
                     /db_xref="GeneID:11500488"
     CDS             complement(459106..460242)
                     /gene="TDEL0C02640"
                     /locus_tag="TDEL_0C02640"
                     /inference="similar to DNA sequence:INSDC:YBL081W"
                     /note="similar to Saccharomyces cerevisiae YBL081W;
                     ancestral locus Anc_7.404"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680364.1"
                     /db_xref="GeneID:11500488"
                     /db_xref="UniProtKB/TrEMBL:G8ZRL1"
                     /translation="MPGKIESVPFLSQLEDVDKYLLEYRSLKLTSPNPSSFNQHHQIH
                     GQMRYSHSNGSGTFDNDGGDKSGINGKQLPMGNVMFNGKSSNSMSVPINGAMGMNRKK
                     AMNTSNQSYRYNNNAAMKYGAQYQLKQHQQPAFAANSMITNHLKQVYPQMSYNTNGSG
                     SNLALDQLSSSFMVPNQNKSSQQQQQQQQGYPSSNSSPSPAPPLADAALSGNSSISSF
                     SSNIGYVLPTASGSSNSQFAAQAPFSNYLDASLISSASIAPGISPTTNISAPTGTDMV
                     GGYPSNPLANEAANTGAPAFNFEQGISTPALMSEAISVDQATPLTRENTLASFDGSSG
                     SMNNSGSNLLMNDYSVGWGSNHANSSSSAGGSFGIWNNDMSVWS"
     gene            complement(<460884..>461978)
                     /gene="TDEL0C02650"
                     /locus_tag="TDEL_0C02650"
                     /db_xref="GeneID:11500489"
     mRNA            complement(<460884..>461978)
                     /gene="TDEL0C02650"
                     /locus_tag="TDEL_0C02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680317.1"
                     /db_xref="GeneID:11500489"
     CDS             complement(460884..461978)
                     /gene="TDEL0C02650"
                     /locus_tag="TDEL_0C02650"
                     /inference="similar to DNA sequence:INSDC:YER107C"
                     /note="similar to Saccharomyces cerevisiae GLE2 (YER107C);
                     ancestral locus Anc_7.405"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680365.1"
                     /db_xref="GeneID:11500489"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8ZRL2"
                     /translation="MAFFGSGSAGNSGVSTTMASERDLANDIIINIPAEDSISDIAFS
                     PQQDFMFSVSSWDNKVRIWDVQNGVPQGRAQYDHTAPVLCTRWTTDGTKVVSGGCDNV
                     VKVYDVASGQSQDLGTHAGPVKCLRYLTFGSSNTEVLVTGSWDKTLKYWDLRQPQPIS
                     TVMMPERVYTLDSKQQLLVVGTAERHIAIIDLGNPATIFKTTQSPLKWQTRAVACYNE
                     GDGYAVGSIEGRCAIRYVDDEQQRKSGFSFKCHRQTSSNRAAGTQAQSLVYAVNSIAF
                     HPIYGTFVTAGGDGSFHFWDKNQRHRLRGYPSLQASIPVCNFNRQGTVLAYALSYDWH
                     QGHMGNRPDYPNVIRLHPTTDDEIKEKKKR"
     gene            complement(<462241..>464229)
                     /gene="TDEL0C02660"
                     /locus_tag="TDEL_0C02660"
                     /db_xref="GeneID:11500490"
     mRNA            complement(<462241..>464229)
                     /gene="TDEL0C02660"
                     /locus_tag="TDEL_0C02660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680318.1"
                     /db_xref="GeneID:11500490"
     CDS             complement(462241..464229)
                     /gene="TDEL0C02660"
                     /locus_tag="TDEL_0C02660"
                     /inference="similar to DNA sequence:INSDC:YER109C"
                     /note="similar to Saccharomyces cerevisiae FLO8 (YER109C);
                     ancestral locus Anc_7.406"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680366.1"
                     /db_xref="GeneID:11500490"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR013720"
                     /db_xref="UniProtKB/TrEMBL:G8ZRL3"
                     /translation="MSQRSPDHIGMDDVYLGGQVPHKKQHEKQHQQHQQKQQQQQQQQ
                     QQQRRQGAGFSSKQMLDAYIYDFFSKSSLKNTAATFCREGGLVDVNGVAKTPSVLDEV
                     KDAPQGFLYEWWQIFWDLFNARTHKEGSAVAKEYTKILSDKQKQEYAYRSHAVQAARL
                     QRMAGQNGESPVESGLSPFVSPMPGMHYPPNYVNVPNPYVTHELNQDVRDFNVTAPTQ
                     FVPPVMGADASGWPVNPNHQFPTNALYHNRTNHYYAVPPTHSPSPQPIGSRSKSSRPP
                     LAKNNSITDIPGSPVQGSPAGSYRGSSSSFAGRISVIEGLHNYQRQMIMSEIEYNNQN
                     KKTTPSPGTSNSTTSKKRMLPPSAGILPQNGTPTSASCSSLNMMNAAKPKAVRRRSAN
                     STLGPVSRSMQPSFSDSPSTPVNAAHPINVNEVNERLVLPNSLATVSEAVSSSGSELT
                     DSSKKSSKKVRKPKKALAITFSNNGFSFVPPNSVPTPPNEAQQKAQFRVLGKYQAKKS
                     QANRSSSKSAKGSSNGSPQVMGDESSMSTPTFVNTMWNSNGKVQTTPHTNFTFVGENG
                     DISGGGPSGPPNADSALGSSSGGSYQYNETDADELLSINSMLSMPDVTAIKGEDAPND
                     LIPGTDTTNGLTETAHQDFNLDLLEPGEPSFNFLSPRQ"
     gene            complement(<464725..>466053)
                     /gene="TDEL0C02670"
                     /locus_tag="TDEL_0C02670"
                     /db_xref="GeneID:11500491"
     mRNA            complement(<464725..>466053)
                     /gene="TDEL0C02670"
                     /locus_tag="TDEL_0C02670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680319.1"
                     /db_xref="GeneID:11500491"
     CDS             complement(464725..466053)
                     /gene="TDEL0C02670"
                     /locus_tag="TDEL_0C02670"
                     /inference="similar to DNA sequence:INSDC:YBL082C"
                     /note="similar to Saccharomyces cerevisiae ALG3 (YBL082C);
                     ancestral locus Anc_7.407"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680367.1"
                     /db_xref="GeneID:11500491"
                     /db_xref="GOA:G8ZRL4"
                     /db_xref="InterPro:IPR007873"
                     /db_xref="UniProtKB/TrEMBL:G8ZRL4"
                     /translation="MAEKTEPQGASDEKEFVRPPLDLWQDFKDGMRFLCFNPRGNAVI
                     MPLLLVVESLALKIITAKVPYTEIDYKAYMEQIEMITMDGELDYSQIRGGTGPLVYPA
                     GHVLLYKLMYKITQGMNLLHEGQNIFRYLYIGTLSLQMIIYYQLQLPPWCVVLACLSK
                     RLHSIYVLRLFNDCFTTFFMVLTVVLLMQATKRRSALISMISSLTYSVAISIKMNALL
                     YLPAFMVSIFLINEGQLTVTALCAMIAVAWQGLVALQFLKTYPMEYLQSAFNFSRSFM
                     FKWSVNWQMIDEDGFDSIIFHKSLLLSQLVGILAVIFFRYPCLLKDLRNSVIRPLSKS
                     IPGVKLGDTVPYLLVTTNYIGVIFSRSLHYQFLTWYHWTIPILMYYSRIPWFLGPIWY
                     ILHEFCWNSYPPNAQASTLLLLLNSTMLLLLAINSLNCSIHKSTNQKKGQ"
     gene            complement(<466196..>469543)
                     /gene="TDEL0C02680"
                     /locus_tag="TDEL_0C02680"
                     /db_xref="GeneID:11500492"
     mRNA            complement(<466196..>469543)
                     /gene="TDEL0C02680"
                     /locus_tag="TDEL_0C02680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680320.1"
                     /db_xref="GeneID:11500492"
     CDS             complement(466196..469543)
                     /gene="TDEL0C02680"
                     /locus_tag="TDEL_0C02680"
                     /inference="similar to DNA sequence:INSDC:YER110C"
                     /note="similar to Saccharomyces cerevisiae KAP123
                     (YER110C); ancestral locus Anc_7.408"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680368.1"
                     /db_xref="GeneID:11500492"
                     /db_xref="GOA:G8ZRL5"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:G8ZRL5"
                     /translation="MDQQYLAQLEQTLGAIVHPNSNGLKEATKTLQTQFYKQPSSLPA
                     LIHILQNASDDALKQLAGVEARKLVPKHWAALDASTKTQIKQSLLQTAFSEPKELIRH
                     SNARVIAAIGTEEMEENQWPDLVPNLIQAASGEDAQTRLTSSFILFSLLEDFTPSLTA
                     YIDDLLDLFSKTINDTASLETRSLAAQGLNHVSGLIQEQEEVNPQQAAKFAALIPSVV
                     SVLEAVIKADDAVNSKLIFNCLNDFLLLESQLTNNAIPDLVKLAIQIAVNNEIDEDVR
                     VFAVQFMISALSYRKSKISQAKLGPEITMAALKVASEEIDVDEELNNEDEAAENEENT
                     PSLTAIRLLAFASSELPPSQVATVIIDHLPAMLQSSNAFERRGILLAISVAVTGSPDY
                     ILSQFDKIIPATITGLKDNEPIVKLAALKCVHHLTSDLQDEVAKFHDEYLPLIIDIID
                     TAKFVVIYNYATVALDGLLEFIAYEAISKYLEPLMNKLFYMLESNKSSKLRCAVVSAI
                     GSAAFAAGAAFIPYFKTSVQYLGQFIENCSQIEGMSEDDIELRALTFENISTMARAVR
                     SETFAEYAEPLVNSAYEAIKTESARLRESGYAFIANLAKVYGENFSPFLKTILPEIFK
                     TLQLDEYQFNFDGDAEDLAAFADGANEEELQNKFTVNTGISYEKEVAAAALSELALGT
                     KEHFVPFVEESLKVLTEQVEESYGLKETALNTIWNIVKAVLLASKFVPETYPKGIPSG
                     SYVDASVLAVIQTAREITLTNLGDEFETSMLITVMEDMANMIKQFGSIIVMDNGNTSA
                     LENLCVQVMSVLKGTHTCQTIDLEEDVPKDEELDASETEATLQDVALEVLVSLSHALE
                     GDFAKIFENFKPVLLSLFESTSKNKRSSAVGAASEIALGMKGQNPFMHEMLEALVIRL
                     TTDKSLEVRGNAAYGVGVLCEFANFDVSAIYEPVLKAMYQLLTTADQKALTAEDDEAT
                     REIVDRAYANASGCAARMTLKHENFVPMEQTIPALLAHLPLKTGFEEYNPIFELIIKL
                     YQNNNSVIASATPKIIELFTVVFTKEDERIKLEQESTLGREENMERLKQFQNEEMREK
                     VIALLKYLNNTYDGLVAQSPVLARVLA"
     gene            complement(<469960..>472938)
                     /gene="TDEL0C02690"
                     /locus_tag="TDEL_0C02690"
                     /db_xref="GeneID:11500493"
     mRNA            complement(<469960..>472938)
                     /gene="TDEL0C02690"
                     /locus_tag="TDEL_0C02690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680321.1"
                     /db_xref="GeneID:11500493"
     CDS             complement(469960..472938)
                     /gene="TDEL0C02690"
                     /locus_tag="TDEL_0C02690"
                     /inference="similar to DNA sequence:INSDC:YER111C"
                     /note="similar to Saccharomyces cerevisiae SWI4 (YER111C);
                     ancestral locus Anc_7.409"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680369.1"
                     /db_xref="GeneID:11500493"
                     /db_xref="GOA:G8ZRL6"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="InterPro:IPR018004"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8ZRL6"
                     /translation="MESGTGMTSSNEAEGTGSAGLVPVIEIATYAETDVYECYIRGFE
                     SRIVMRRTADDWVNITQVFKIAQFSKTQRTKVLEKESTDMRHEKVQGGYGRFQGTWIP
                     LENAKYMVSKYNIRDPVVSTIIGFQLDPMNPPAKRCKNSVLKRSSPNGRITSPSSYNK
                     TPKKKLSASAMARKTKKNGVLQPNPSPLQNLVFQTPQQAHLAGQNSNTTVPQALNDKE
                     TPMTMGYSATQKPLQFYPVPTSLSHHHKIPRNNHHSNANFHNGTESQSFLTFIPEGPN
                     QGVFSTQDQTHQSVPNITINGNSKQPPKKRRKDSQIDPIMNDEAFLNQDKAQQNFKVM
                     KQQMWQDMHPKHLSQTSPKTMYPIAASNTTHSNTSSMEMFSTQDNPTPMSSRSSTPQT
                     FSGIPTAPATAVENDDVAHADLEQMSVEAYKETILQVLSSEDGSDKDYALPSQMYHPP
                     SNLDINFQIDDQGHTPLHWATAMANIPLIKLLIALNGNALQSNSKGFNCITKSIFYNN
                     CYKAGSFPEIISLLRICIVTPDSNGRLPLHYLVELSVNKSKDPLVINYYMDAIIQNLG
                     QDDYTLLRMTLNFQDNLGNTVLHLAALNLNLELCNKLCYLGSSMDITNYENETPASIL
                     AKFNLVPPTSINQALSPQAINKGSPYLEPPTGTLANPAKTASKLSQEKDQQIISPTDN
                     EPIKPPQIKLTPAVPTRKMADRNFLSGADSTTFNSLMDDLSNIDSFVTSSAIRDVKTT
                     PSKLLESSPILHKKRPSMTSMLPPPSLKKFVNLADAMESPLGPIILSPRAGQPKVKQL
                     GEIVSLAGKLRDVSNNLVFSLNTQASSIATETENTEKGITLVKNNLQKIEHGEKELFA
                     QYDESEGIQTISDLGNATEELRNTTESGKVAFIQCIEKSQALSLASLVQEEESKVDED
                     SAASPAPEKSQNEDTWKLATELAFLQFRRRSFLGKIIDGKCNIDTSNKISKYRRLIGM
                     TMENIDTKLDEIETDLRANA"
     gene            <474199..>474726
                     /gene="TDEL0C02700"
                     /locus_tag="TDEL_0C02700"
                     /db_xref="GeneID:11500494"
     mRNA            <474199..>474726
                     /gene="TDEL0C02700"
                     /locus_tag="TDEL_0C02700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680322.1"
                     /db_xref="GeneID:11500494"
     CDS             474199..474726
                     /gene="TDEL0C02700"
                     /locus_tag="TDEL_0C02700"
                     /inference="similar to DNA sequence:INSDC:YER112W"
                     /note="similar to Saccharomyces cerevisiae LSM4 (YER112W);
                     ancestral locus Anc_7.410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680370.1"
                     /db_xref="GeneID:11500494"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:G8ZRL7"
                     /translation="MLPLYLLTNAKGQQVSVELKNGEIVEGELTNVDNWMNLTLSNVS
                     QQDTIGNSGNIAFQKEIVKSQEVYLRGTYIKYIKLQDNVIDQVKQQISNNNGSKDNNS
                     GNFRRGNKFGGRDNFRRGNQNNRGYNNNQSGGGRRPYQNRYENSQRPSSGSGMGGFVQ
                     QHRSQRDTNNANVEF"
     gene            complement(<474759..>476795)
                     /gene="TDEL0C02710"
                     /locus_tag="TDEL_0C02710"
                     /db_xref="GeneID:11500495"
     mRNA            complement(<474759..>476795)
                     /gene="TDEL0C02710"
                     /locus_tag="TDEL_0C02710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680323.1"
                     /db_xref="GeneID:11500495"
     CDS             complement(474759..476795)
                     /gene="TDEL0C02710"
                     /locus_tag="TDEL_0C02710"
                     /inference="similar to DNA sequence:INSDC:YER113C"
                     /note="similar to Saccharomyces cerevisiae YER113C;
                     ancestral locus Anc_7.411"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680371.1"
                     /db_xref="GeneID:11500495"
                     /db_xref="GOA:G8ZRL8"
                     /db_xref="InterPro:IPR004240"
                     /db_xref="UniProtKB/TrEMBL:G8ZRL8"
                     /translation="MMIKRRIWGLLLAVVVIIILLRGSGSSRNSLRNDKLDNGWLQPN
                     VYRWGDHVELLVNKVESDLTQFPYGYYDLPFTCPPTEDKKPLHLSLNEIIRGDRKWES
                     DYKLKFGQDASCEALCARKTKPAGMRRAQELVRQGYVVQWLIDQELPAATTFISTIDH
                     KKYYVSGFPLGFVDPDTEKTYLNTHVMMVIRYNAIDPETFTIVGFEVYPKSVSDYHCP
                     GASKGYEQYELIVPENEDELTYIPFTYSVYWREEFKVDWSHRWNFFLNSGEMSEASSR
                     RFHWMTLGNSVGISFLLMLIVIANLYRIVRVGHEAGSEEFQFTFDENEEADSIYGVAK
                     TWLAQTDSSSISFKILTIFVSIGVQFLFTIIGSLAFSCSLNKLHNIRNSVLSVASFFL
                     CHWSYLWHLFVGTWLHIDHRTTNDGSAGRCRTFSILCGSALPGLVMISTQMLNWIVWA
                     NESSHALPFRTIVLFVSIYFVICIPLSLLGEEVSHRVHRKQAQNFPILSSLGARSIKP
                     CRAPTTLAPRKISERLTFDFATFAICGFLPFAVIYVELQYIYKSVWLEKTDFYYLYGF
                     LLANIILLCIVVCEVSFLGCYVMMRKHKRVATFDSWRWKCFMMGTSCAWYMELYSLYY
                     IFHTLKMTGFPSIFISVSYSLIFNIMCGCGMGSLGYLTSCWLVNRVFCTKYNKA"
     gene            <477529..>479631
                     /gene="TDEL0C02720"
                     /locus_tag="TDEL_0C02720"
                     /db_xref="GeneID:11500496"
     mRNA            <477529..>479631
                     /gene="TDEL0C02720"
                     /locus_tag="TDEL_0C02720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680324.1"
                     /db_xref="GeneID:11500496"
     CDS             477529..479631
                     /gene="TDEL0C02720"
                     /locus_tag="TDEL_0C02720"
                     /inference="similar to DNA sequence:INSDC:YBL084C"
                     /note="similar to Saccharomyces cerevisiae CDC27
                     (YBL084C); ancestral locus Anc_7.412"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680372.1"
                     /db_xref="GeneID:11500496"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G8ZRL9"
                     /translation="MLFGSNSNSNLNNAPMNADDLTTDVNTLNTIVKLQEYIQHAISQ
                     LNYETAVFLSELLYAECSPLEKNHVHRLESVYLYSLSLYLQGEFQTALRVSKDFKEAD
                     HMGISYIFARCCLQLDTDLKEAVDALLNVLDKKPSVTSNGNLTHMPTVATINCLLGRL
                     NFKLERTPESALFYSSALNADPYLWEAYTSLCALRATIDLKRLYSLMTKQNQSTSNRF
                     KSRFSVSKPHSTATPYQSSNRVPSSSSSSSSSLSLNANGSKQQSQVNALAPQHTSIKG
                     QPTNSMLNKANVVVSTSAFSSPPSSKQPTGKLANRSKLLTTPPSKLLHTSNFKTPRNN
                     TLSRSSGPKRGETFSSMIVKPEHHGLLTTALSTTATTPHTLAELILTFARVLKASSQY
                     DSYKAIRLLENRLPSHIKSEMPWCQAQLGKLHYEILNYEESLNHFNQLRRMQPTRTQD
                     IEIFSTLLWHLHDSTRLSHLSNELVETLPNKPQTWCCLGNLYSLQRDHEDAIKYFEKA
                     TKIDYNFAYAYTLQGHEHSSNDSIDTAKNCYRRALACDPQHYNAYYGLGMCYMKLGQY
                     DKALLFFEKARNINPVNVILICCCGVALEKLSYQEKALQYYEQACELQPSSSLAKFKK
                     AHLLYSMARYSAALENFEELAKLAPDEATVHFLLGQLYQIMGRKKDAVKEFTVAMNLD
                     PKGNPLIIDALEKCHSEE"
     gene            complement(<479746..>482796)
                     /gene="TDEL0C02730"
                     /locus_tag="TDEL_0C02730"
                     /db_xref="GeneID:11500497"
     mRNA            complement(<479746..>482796)
                     /gene="TDEL0C02730"
                     /locus_tag="TDEL_0C02730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680325.1"
                     /db_xref="GeneID:11500497"
     CDS             complement(479746..482796)
                     /gene="TDEL0C02730"
                     /locus_tag="TDEL_0C02730"
                     /inference="similar to DNA sequence:INSDC:YBL085W,YER114C"
                     /note="similar to Saccharomyces cerevisiae BOI1 (YBL085W)
                     and BOI2 (YER114C); ancestral locus Anc_7.413"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680373.1"
                     /db_xref="GeneID:11500497"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011510"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="UniProtKB/TrEMBL:G8ZRM0"
                     /translation="MTTKKIPVLSQLDTRITGLSSELASNTTQSTCSSSGMKPCPMYI
                     AINEYTKRMEDELDMKPGDKIQVITTDEEYNDGWFYGRNLRTKEEGLYPMVFTQEISI
                     EQRPSAMRSKSTKRIASSGNGSTSNFSGYSQNGSTSELPTPQPLETAAPMPLSKKKPV
                     DRKISLKTTMSDIDKALEELRSNSMEQLDNGGQNMTHETIFSSTRDLDISYSSGNPEG
                     SSSAKSLSNERSAGANSINGIDTSELNPAMAESWTPPQVTAYFIMSGFDVQSSSRFQQ
                     HKVSGAILLQLELAHLKELEIDSFGTRFEIHKEIEDLRKASKRADKGRIDGKSAEENQ
                     LMPPAFLNQGPTYRGHVRKVSRSLEDFSSNSTPMSAGSNERPKSKANQLQASQNDTQK
                     AALALPSISDKELDDERLFVSPRRAPKPPSYPSPVQPPKSPMIGNDSGNRYSPPTIYE
                     KAMSSSLEPPGAFKFPPNSPQDFKAKSGFSFGGKSSTSSSTPTTDSYPSGSKAQASGN
                     NAGNRNSVIYSGHKKALSGGSFVDLYNRVSMLSPTAPNLTEEGSSQDEDLIPNGRPSS
                     SVYAGHSRNASVARSKLPSQDIKKHRRASSLVSFFSAKNEERPVSPAKNASHLSSHSH
                     SKRDSFIMSPFRQQFTESASHSATPAKVGKSHSNKNTPTPPTLRSPIKPNSAKKDDSK
                     RRSVSAKESSYDSTKTDDDKNKRSVSEAQKGKGLRTINTKNISRKQQTSAFMEGIRNV
                     SVKDAMMDADCSGWMSKKGSGTMGVWRTRFFTLHGTRLSYFASTTDTRERGLIDITAH
                     CVVPAKEDDKLVSLYAASTGKGRYCFKLLPPQPGSKKGLTFTQPRVHYFAVDSKDDMR
                     AWMAALIKTTIDIDTSVPVISSCATPTVSLSRAQEMLSQAREATRLREQQRYLNEEDE
                     DQMLWEKQQNKLQSSDYGTGSHGNTLRQSDDEALGSAINLSSNGNTTVNSNGFASPYL
                     LASGVLSPSLGSSSGKFQDTTPDLTANLKGDYFGRHQHSSGEHF"
     gene            complement(<483090..>483854)
                     /gene="TDEL0C02740"
                     /locus_tag="TDEL_0C02740"
                     /db_xref="GeneID:11500498"
     mRNA            complement(<483090..>483854)
                     /gene="TDEL0C02740"
                     /locus_tag="TDEL_0C02740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680326.1"
                     /db_xref="GeneID:11500498"
     CDS             complement(483090..483854)
                     /gene="TDEL0C02740"
                     /locus_tag="TDEL_0C02740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680374.1"
                     /db_xref="GeneID:11500498"
                     /db_xref="UniProtKB/TrEMBL:G8ZRM1"
                     /translation="MELSPQNKLGNKWFIGKDERDRFLRPVAFSEDDFHHIRACKDGS
                     AGHQCLALLRNISESLQRNNVLVSDRISVDQTIWTLKIYKDDPSSFPITNVPIKCNVM
                     ATMVDSLREYVNEGMSESSLSGLLKTLDYLRKLLEAVIFKAENPALAQSSPDSLQTKT
                     SGSLSSRGSIRRKPATAVSAGVPKSKPLGIDNLVKYHEYKPLIISLHHRLTFLDQSNH
                     QNDVIFDFISQNVCRFILDDCKLLLADYIERRILQI"
     gene            <484066..>485361
                     /gene="TDEL0C02750"
                     /locus_tag="TDEL_0C02750"
                     /db_xref="GeneID:11500499"
     mRNA            <484066..>485361
                     /gene="TDEL0C02750"
                     /locus_tag="TDEL_0C02750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680327.1"
                     /db_xref="GeneID:11500499"
     CDS             484066..485361
                     /gene="TDEL0C02750"
                     /locus_tag="TDEL_0C02750"
                     /inference="similar to DNA sequence:INSDC:YBL086C"
                     /note="similar to Saccharomyces cerevisiae YBL086C;
                     ancestral locus Anc_7.414"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680375.1"
                     /db_xref="GeneID:11500499"
                     /db_xref="InterPro:IPR019448"
                     /db_xref="UniProtKB/TrEMBL:G8ZRM2"
                     /translation="MPLLNGKNKSKKPKFLLSLRINELINIPQSSGYCYVKWHLKEGT
                     GTSSDVFDSNGEVIPAMNQSHGSTPKVMVENHRARWNFEFEKPLQIKLQVDRNRDLVP
                     KNLSLEVFFEFLSDTNGGTVKPRRSNSGSSHSAKSGSTNTYSQKITGKILLGVLSLNV
                     ADYVREDEQPTTNRFLLKKSKVNSILNVTLQMRLVRGGYKDFQPTRNLISGQLPGVLR
                     TGFNDILDDSSDMGSPTSSLYQHSMSSPQSSRFNHGKGKTIDNSMTLDITNNSISASM
                     SPLVDSLYQRTFQLPWDPRPGEFTPRECVEDILQGGNGWAKNEKGICLIDLQALRLNE
                     MENDYYESHKNGPGMRNNDDDTSEAARNVTNYDNMDKREYLEKKQIWSHKSSVQKERK
                     KQYEDNGDSGSKEYGEYVEDIPNDKIRDAKSWSVNNIMT"
     gene            complement(<485396..>485656)
                     /gene="TDEL0C02760"
                     /locus_tag="TDEL_0C02760"
                     /db_xref="GeneID:11500500"
     mRNA            complement(<485396..>485656)
                     /gene="TDEL0C02760"
                     /locus_tag="TDEL_0C02760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680328.1"
                     /db_xref="GeneID:11500500"
     CDS             complement(485396..485656)
                     /gene="TDEL0C02760"
                     /locus_tag="TDEL_0C02760"
                     /inference="similar to DNA sequence:INSDC:YER115C"
                     /note="similar to Saccharomyces cerevisiae SPR6 (YER115C);
                     ancestral locus Anc_7.415"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680376.1"
                     /db_xref="GeneID:11500500"
                     /db_xref="UniProtKB/TrEMBL:G8ZRM3"
                     /translation="MFLSGANLVRFGAFCGIRDSRATRCPLRGISHGIHLKSGRRCAC
                     RSFTLYPSPLISVAKVMLDPDFGSLFNMMDNNRATISPFLNS"
     gene            complement(<486107..>486733)
                     /gene="TDEL0C02770"
                     /locus_tag="TDEL_0C02770"
                     /db_xref="GeneID:11500501"
     mRNA            complement(<486107..>486733)
                     /gene="TDEL0C02770"
                     /locus_tag="TDEL_0C02770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680329.1"
                     /db_xref="GeneID:11500501"
     CDS             complement(486107..486733)
                     /gene="TDEL0C02770"
                     /locus_tag="TDEL_0C02770"
                     /inference="similar to DNA sequence:INSDC:YER116C"
                     /note="similar to Saccharomyces cerevisiae SLX8 (YER116C);
                     ancestral locus Anc_7.416"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680377.1"
                     /db_xref="GeneID:11500501"
                     /db_xref="GOA:G8ZRM4"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:G8ZRM4"
                     /translation="MKVDLDRQDESRKRRRLNEGESDASTDISQEQDCSESDGSIEVV
                     SVNRRVPEPDDEDDDDTDFILRALNESDGESDENGVGRSSRESTDINVVETIPSDEEV
                     IEAIDLEAEILGQKNEDSGNERSVTPAPHKAVRDYQCPICFDPPENSVITPCGHTFCV
                     SCLFQMLNSSRGPKKNGLCALCRKSVAIRDIKMIKLKKKRVRKNPSVT"
     gene            <487146..>487751
                     /gene="TDEL0C02780"
                     /locus_tag="TDEL_0C02780"
                     /db_xref="GeneID:11500502"
     mRNA            join(<487146..487181,487380..>487751)
                     /gene="TDEL0C02780"
                     /locus_tag="TDEL_0C02780"
                     /product="60S ribosomal protein L23"
                     /transcript_id="XM_003680330.1"
                     /db_xref="GeneID:11500502"
     CDS             join(487146..487181,487380..487751)
                     /gene="TDEL0C02780"
                     /locus_tag="TDEL_0C02780"
                     /inference="similar to DNA sequence:INSDC:YBL087C,YER117W"
                     /note="similar to Saccharomyces cerevisiae RPL23A
                     (YBL087C) and RPL23B (YER117W); ancestral locus Anc_7.417"
                     /codon_start=1
                     /product="60S ribosomal protein L23"
                     /protein_id="XP_003680378.1"
                     /db_xref="GeneID:11500502"
                     /db_xref="GOA:G8ZRM5"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR019972"
                     /db_xref="InterPro:IPR023571"
                     /db_xref="UniProtKB/TrEMBL:G8ZRM5"
                     /translation="MSGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRL
                     NRLPAASLGDMVIATVKKGKPELRKKVMPAIVVRQSKPWRRKDGVFLYFEDNAGVIAN
                     PKGEMKGSAITGPVGKECADLWPRVASNSGVVV"
     gene            <487977..>496337
                     /gene="TDEL0C02790"
                     /locus_tag="TDEL_0C02790"
                     /db_xref="GeneID:11500503"
     mRNA            <487977..>496337
                     /gene="TDEL0C02790"
                     /locus_tag="TDEL_0C02790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680331.1"
                     /db_xref="GeneID:11500503"
     CDS             487977..496337
                     /gene="TDEL0C02790"
                     /locus_tag="TDEL_0C02790"
                     /inference="similar to DNA sequence:INSDC:YBL088C"
                     /note="similar to Saccharomyces cerevisiae TEL1 (YBL088C);
                     ancestral locus Anc_7.418"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680379.1"
                     /db_xref="GeneID:11500503"
                     /db_xref="GOA:G8ZRM6"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR021668"
                     /db_xref="UniProtKB/TrEMBL:G8ZRM6"
                     /translation="MENGSILSVLDNLHSTKTKERNAALDELTSTLKQTPDLIPTKTL
                     ASTCETLVELLDDEHRKYCNLLATVNDSSVGKMSLSENRLSSAAYVLRLFVEKTCSRF
                     KLKTLRLLPAVLPELMVKQNSKSLLEPISVHLTFALYALINSRIFQLKLALHQWVSLA
                     ETICHYLEERLDVSLVDRNISNFISILDSLLSMDCVGLSQVSQTIHRTLMKYLQRIKK
                     QDTNTRLVISVISQLTLKTHCFNIMDTLRLIKETWRQLIVIDVAMNEPIQNELSYLDI
                     YANDLIFNNIPSMIGNEEAEFESYEISLISICREYLITRLTGFKSSTLSIAGVKFSSN
                     LSEKVSFFEFDDFKLKESADIYPWLRIMSITKLLISYFKLLQRNSVERQLFKRRKCES
                     NLPSILRNSQTLSSFLCDSLASGNNEVEIVSLQITAFAAAMHDIDGNDLADLLEVIMS
                     KFENVGLTKWVCFALIPIFTQKDLVVTDEGVNRIFKLCLPLIKQPEFCSVSCALLTVA
                     MKHSNCEMSDMTTISQVSSIYELSDVNGPSSPCNEAFVFWESLQIHGAELGSLSLKAI
                     SSKVVDWLKSKWDLLIVPQEDHDRFYEFLAWLCDRKRFGARLTAQVKNFRTYNWKGSW
                     RERYCRWIDQHETRSFILQEEAMYKSIKECSKIERFGSIIVERIVIGDILYRLLELIE
                     GENGLNSVSKFKWVCQVLKLAAYLAGDSNYLNYLLDFKRAASTAVNSIRFTDKNQYKS
                     FFEDVSSLEVPPVIHLVFEGLPMNRIINEFKQLVNQDYEKKHSDQPRILPSIDGEISI
                     TEAYASSNITGQSILALSVKALLHVLQNKEAGSSLENWEFLLTYVDNFGTENFILCLP
                     PITSWVASEYQKWPSDGHYLERFTEILSDHLLQGDFSTSSVAVYHVCSYLAAIRNAWL
                     ETVDSPLNADCNDILDWIILRFEDTAFCGRLAVKGFSKLLLLMLRYHDLSRGYVNGGK
                     QRIFAAFSRSLRTLDILDVVSELRTVAEYMVNLSHKNQCILFSEISALLDTPQQSIKM
                     SAMYALGMFKISSTSHTNLILTVKDVIHYTGFQHTRVYITSAIKKMASHLGLTDVLQV
                     FNICSYDIIAQWLDNSSNKNKNLSDVCDIVVFGFKDLPQFFRLYTAELVAMYFARSPN
                     NSSILSELVKMAGRSKRQLFLDYYHLIVPLSFVTGGIGEAIYDVAQNLTGNSFLKTQS
                     QLLLYRWVLRFLDLGSNYETGTIIESFRPQNLRVKELYISHPNELRYQYPLHIPLATG
                     MGLLRQMSERHSFCKEDLHFLLMWILSDLTNSLDLLDKLRCIRQIKFILAINEEVLAS
                     ITFVPNLLPPLCSYLAESKLHNEISDIIVVLLHISRDNKLDIADELLQLFSHVLMMKR
                     GLCEEVSRSLKEELKQTTNCAGRFKRTLRYCNDAIESMTLSTEVYMNNEILETESCNK
                     NSILLLSLLFDCAQKPYHIVFDEQPSMLSVQNLLKFEVPKDVASENFQLWLAYYLSAF
                     NETNYARLLDTKRDIYLASNYDKLFNNFGSLECLIDNYLAIEERSLLLESCSVKFFCQ
                     TLTALFLNNPKYDDEKALVIKKMIPPEKCGNDCLLITDHVFSSIHNQPEKSMSDMQHF
                     LRNVFLIEKIPYFEWLIQFNTALLHHVTQSVPNCNLFRPLLSKSNSFAQNALPILFNL
                     LICYDHKTAFEWIPDLFTYMLELLKCDDSHEKIKSCLCIVNMLMTGKRLEERRSTSCF
                     SRLPLKIICEAAIKSGQITFAYMVYEMLYMTEASHLDIELLRTIYESLGDVDLLSGLP
                     APHSLIGALHFVSEIEPKTQKNFMFNNAVLDAQFPASDFIQRSSLLKATEYQGYYGIA
                     NCLSKEQPLSKNIAYDYKWALQLSRWDLPTPQRIDSKEKSLYLTLKKISYDAPHPSKT
                     IQDSLVQVVECKNDFETPSEWVETIAEMALLKELSDCMSNPENLVATLRKTIDFDRRA
                     LYVHDFSDYKSNIQSRYMLSKLLLNRSDEFPSISSADLTICTGALLANYVQLAVQEKC
                     PQDALKNAVLLDSLESEGNSSVKLERLRSYVSAIALWECNDVKTPVLIMKDLFNDKSN
                     NAVAERSLNELTEVSNDEVQALLVKWSSKSRIETPSTIYENYVNHFEASIKSHDSRAE
                     VFYIMADFLDGQVKRLRDQGEIEERQKRCEKGSEELQSLATIYMNTNVPDNERRDAKR
                     HHGRVALQLSNDKEILNNLLVQRVQFVWRALHYFINTMVFTNKYDNDVLDKFCGLWFE
                     HDGDDSVNSLLRKEIGMIPSWKFLPWVNQISSKLSVEETEFQKPLQLTMKRLLFKLPY
                     HSLYSVLSMKLYERHSFTTDSIIPQKIKAVDKILNELQGYDSGSYHRTYVVPLQDFCG
                     MSVDLANTQPPKSATSSKKIHLKNVRMGEYWLSQLPNQKIPLPTIKWKIKSSNDGKAP
                     VSYIASVDETVDISTTGLSLPKIVTFTLSDGSRHKVLMKGSNDDLRQDAIMEQVFQQV
                     NDVLQHDKQMRKLDLNISTYTVIPLGPRAGIIEYVTNSLSLHQILSVLHKNDPVSFNQ
                     ARKEMKSVQTRSNNERLQTYIKLTQEIKPQLRNFFFDSFPNSDDWFNAKKTYTKGIAT
                     TSVVGYLLGLGDRHLNNILLDHHTGKPTHIDLGIAFDQGRLLPIPEMVPFRLTRDIVN
                     GFGVTGVEGLFRRSCEHTYAVLRENYEKVMHVLNILKWDPLYSWVMSPIKKHKHLLET
                     ESQDYSNVAFGSEGSKTESKETEQNQQSYRALKGVEEKLIRNGLSVEATIQELIQQAS
                     DPRNLSVIYMGWSPFY"
     gene            complement(<496413..>497447)
                     /gene="TDEL0C02800"
                     /locus_tag="TDEL_0C02800"
                     /db_xref="GeneID:11500504"
     mRNA            complement(<496413..>497447)
                     /gene="TDEL0C02800"
                     /locus_tag="TDEL_0C02800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680332.1"
                     /db_xref="GeneID:11500504"
     CDS             complement(496413..497447)
                     /gene="TDEL0C02800"
                     /locus_tag="TDEL_0C02800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680380.1"
                     /db_xref="GeneID:11500504"
                     /db_xref="GOA:G8ZRM7"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZRM7"
                     /translation="MSILVSGATGFIALHVVSDLLKQDYKVIGTVRSQEKANKLRKQF
                     DNNPNLSFELVSDIAAPEAFDKVFKKHGKDIKVVLHTASPVTVETTNYEKDLLLPAVN
                     GTKSILESIKKYAADSVERVVITSSYASVMNVSKEGDGSIVYTEKDWNPATWENCQID
                     GLNAYCGSKKLAEKAAWDFFEENKNVVKFKMSTINPTYVFGPQLFDEDVNDKLNASCE
                     LINSIVKNNPQVEYLLENIKSHFVDVRDVAKAHLVAFQKDEAVGRRLLTSNGRFAYQD
                     LVDVINEDFPQLKGKVIVGKPGTGKQSYGTFPGINNNRSKEILGFEFISLHKTVHDTA
                     AQVLKKEGKL"
     gene            complement(<498625..>499638)
                     /gene="TDEL0C02810"
                     /locus_tag="TDEL_0C02810"
                     /db_xref="GeneID:11500505"
     mRNA            complement(<498625..>499638)
                     /gene="TDEL0C02810"
                     /locus_tag="TDEL_0C02810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680333.1"
                     /db_xref="GeneID:11500505"
     CDS             complement(498625..499638)
                     /gene="TDEL0C02810"
                     /locus_tag="TDEL_0C02810"
                     /inference="similar to DNA sequence:INSDC:YER118C"
                     /note="similar to Saccharomyces cerevisiae SHO1 (YER118C);
                     ancestral locus Anc_7.419"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680381.1"
                     /db_xref="GeneID:11500505"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:G8ZRM8"
                     /translation="MSMPSRARAKAQRSRSQIEYKFRFNILLSDPFAISSISIYLLSW
                     IIAFVGCITTASSSPSSFPIFTWWGLVYQLMILCIMAVLYCFDVVDYYKTFLTAANAV
                     AFVYSTNSANQLVYGDGSKKAAASAGLILLSIVNLIWTFYFGGDNGAPTNRWVDSFSL
                     RGIRPSPYEDAFLRARRRSGGRALQNGTKSQRYTSNFYPENLPQNYVSSTALAGFENT
                     DPSYASNAQLNDMVNMENNAGNNMGSTYITDSTNDNTDTTMSGTLELYSDAGDESFPY
                     TAKTLYSYQADAGDAYEISFDQGEILKVSDIEGRWWKAKRANGETGIIPSNYVQLIDN
                     DVL"
     gene            complement(<500004..>501368)
                     /gene="TDEL0C02820"
                     /locus_tag="TDEL_0C02820"
                     /db_xref="GeneID:11500506"
     mRNA            complement(<500004..>501368)
                     /gene="TDEL0C02820"
                     /locus_tag="TDEL_0C02820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680334.1"
                     /db_xref="GeneID:11500506"
     CDS             complement(500004..501368)
                     /gene="TDEL0C02820"
                     /locus_tag="TDEL_0C02820"
                     /inference="similar to DNA sequence:INSDC:YBL089W,YER119C"
                     /note="similar to Saccharomyces cerevisiae AVT5 (YBL089W)
                     and AVT6 (YER119C); ancestral locus Anc_7.420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680382.1"
                     /db_xref="GeneID:11500506"
                     /db_xref="GOA:G8ZRM9"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:G8ZRM9"
                     /translation="MASSTRSGVITLLHTACGAGVLAMPYGFKPFGLIPGLLVIIFCA
                     LCSLGGLLLQAKVARYVPEKSASFFTLTQIINPNLSVIFDIAIAIKCFGVGVSYMIVV
                     GDLTPQIASVFTSNHLLLDRNVHITLIMLFIVSPLCFLKRLSSLRYASLIALLSVAYL
                     CVLIFIHFVWPSEEIHDLKGHVSLWIPHDETNPLTTLPIFVFAYTCHHNMFSVINEQK
                     DTSFRHIKKVAIYAMFLALSLYLLIGGMGYLTFGDHIIGNIIKLYPQFASTTVGRIAI
                     VLLVMLAFPLQCHPARASINHILFYLQEHLSQSKQNTRTDNTANAVDEASTLIVNGDQ
                     EYMIDELIEEDSANQPPVVPLHGRKFVIITIFLLLASYLLAISVSSLARVLAVVGSTG
                     STSISFILPGIFGYQLIGSEVDSGSLPFKTKLFKYAGLALAVWGVVVMATCLTATLTM
                     NASH"
     gene            complement(<501518..>502036)
                     /gene="TDEL0C02830"
                     /locus_tag="TDEL_0C02830"
                     /db_xref="GeneID:11500507"
     mRNA            complement(<501518..>502036)
                     /gene="TDEL0C02830"
                     /locus_tag="TDEL_0C02830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680335.1"
                     /db_xref="GeneID:11500507"
     CDS             complement(501518..502036)
                     /gene="TDEL0C02830"
                     /locus_tag="TDEL_0C02830"
                     /inference="similar to DNA sequence:INSDC:YBL090W"
                     /note="similar to Saccharomyces cerevisiae MRP21
                     (YBL090W); ancestral locus Anc_7.421"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680383.1"
                     /db_xref="GeneID:11500507"
                     /db_xref="GOA:G8ZRN0"
                     /db_xref="InterPro:IPR001911"
                     /db_xref="UniProtKB/TrEMBL:G8ZRN0"
                     /translation="MLRSTCHSNLSLNVMRNTRLFSVGRIINQDFPSFDHSLLNPLSS
                     KNPTSKSDQLSQSLNHDHKQKSKPSSNVPRGFAEFAHNPRDDALGSRLTGVVAGRTVN
                     VFNSDTSNAFRQLNGIMFANKIPQDSRNQRFYMKPGKVAELKKSQRHRRDFMKGFKRL
                     IEIVKDAKRKGY"
     gene            <502502..>503776
                     /gene="TDEL0C02840"
                     /locus_tag="TDEL_0C02840"
                     /db_xref="GeneID:11500508"
     mRNA            <502502..>503776
                     /gene="TDEL0C02840"
                     /locus_tag="TDEL_0C02840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680336.1"
                     /db_xref="GeneID:11500508"
     CDS             502502..503776
                     /gene="TDEL0C02840"
                     /locus_tag="TDEL_0C02840"
                     /inference="similar to DNA sequence:INSDC:YBL091C"
                     /note="similar to Saccharomyces cerevisiae MAP2 (YBL091C);
                     ancestral locus Anc_7.422"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680384.1"
                     /db_xref="GeneID:11500508"
                     /db_xref="GOA:G8ZRN1"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001714"
                     /db_xref="InterPro:IPR002468"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018349"
                     /db_xref="UniProtKB/TrEMBL:G8ZRN1"
                     /translation="MHDQLKKVENEVNELTVEPKESVTNTVEEPAAAESDTEGDATKT
                     KKKKKKRSKKKNNNIKDITTFYPDGVYPEGEWLNYGQDFNLARTTDEEQRYLKRSKEN
                     EQHWNDVRKGAEIHRRVRHNVQNKLQPGMSLTDIANIIENATRKFTGAEDLNTMENPT
                     SQGIGFPTGLSLNHCAAHFTPNAGDTTILRREDVMKVDIGVQVNGNIVDSAWTVTFDH
                     QYDNLLTAVREATYTGIRESGIDVRLTDIGEAIQEVMESYEVEINGKTYAVKPCRNLC
                     GHNIGPYRIHGGKSVPIVKNGDNTKMEEGEHFAIETFGTTGRGYVVPGGEVSHYAKNT
                     DSSAIPSLTKAKQLLHTIDRNFGTLPFCRRYLDRLGEDKYLFALNNLVKQGIVQDYPP
                     LNDVHGSYTAQFEHTILLHPHKMEVVSKGDDY"
     gene            <504059..>504866
                     /gene="TDEL0C02850"
                     /locus_tag="TDEL_0C02850"
                     /db_xref="GeneID:11500509"
     mRNA            join(<504059..504101,504196..>504866)
                     /gene="TDEL0C02850"
                     /locus_tag="TDEL_0C02850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680337.1"
                     /db_xref="GeneID:11500509"
     CDS             join(504059..504101,504196..504866)
                     /gene="TDEL0C02850"
                     /locus_tag="TDEL_0C02850"
                     /inference="similar to DNA
                     sequence:INSDC:YBL091C-A,YER120W"
                     /note="similar to Saccharomyces cerevisiae SCS22
                     (YBL091C-A) and SCS2 (YER120W); ancestral locus Anc_7.423"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680385.1"
                     /db_xref="GeneID:11500509"
                     /db_xref="GOA:G8ZRN2"
                     /db_xref="InterPro:IPR000535"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="InterPro:IPR016763"
                     /db_xref="UniProtKB/TrEMBL:G8ZRN2"
                     /translation="MVLVDISPDVLEYKPPFTEQSTEYATITNNSEQPVAFKVKTTAP
                     KFYCVRPNAAVVKPGESVQVQVILLGLTKEPTADFKCRDKFLVITLPAPYDLGEKTVA
                     DAWPELETEFKQQAVSKKIKVKYLLDQEPAVAQAVPQQVPEPVEDHREEIPITAKSEA
                     APVPTLETEQVKKSVDEKKISKPVEEFTSSEPERVTTRESTSSNTKTEPVSAQEGSLN
                     STALILIAIIALVLGWLYY"
     gene            complement(<505042..>505437)
                     /gene="TDEL0C02860"
                     /locus_tag="TDEL_0C02860"
                     /db_xref="GeneID:11500510"
     mRNA            complement(<505042..>505437)
                     /gene="TDEL0C02860"
                     /locus_tag="TDEL_0C02860"
                     /product="60S ribosomal protein L32"
                     /transcript_id="XM_003680338.1"
                     /db_xref="GeneID:11500510"
     CDS             complement(505042..505437)
                     /gene="TDEL0C02860"
                     /locus_tag="TDEL_0C02860"
                     /inference="similar to DNA sequence:INSDC:YBL092W"
                     /note="similar to Saccharomyces cerevisiae RPL32
                     (YBL092W); ancestral locus Anc_7.424"
                     /codon_start=1
                     /product="60S ribosomal protein L32"
                     /protein_id="XP_003680386.1"
                     /db_xref="GeneID:11500510"
                     /db_xref="GOA:G8ZRN3"
                     /db_xref="InterPro:IPR001515"
                     /db_xref="InterPro:IPR018263"
                     /db_xref="UniProtKB/TrEMBL:G8ZRN3"
                     /translation="MASSLPHPKIVKKHTKKFKRHHSDRYKRVSENWRKQKGIDSVVR
                     RRFRGNIDEPNIGYGSNKKTKFLSPSGHKVFLVANIKDLEVLTMHTKSYAAEIAHNVS
                     SKNRVPILARAKALGIKVTNPKGRLALEA"
     gene            <506320..>506934
                     /gene="TDEL0C02870"
                     /locus_tag="TDEL_0C02870"
                     /db_xref="GeneID:11500511"
     mRNA            <506320..>506934
                     /gene="TDEL0C02870"
                     /locus_tag="TDEL_0C02870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680339.1"
                     /db_xref="GeneID:11500511"
     CDS             506320..506934
                     /gene="TDEL0C02870"
                     /locus_tag="TDEL_0C02870"
                     /inference="similar to DNA sequence:INSDC:YBL093C"
                     /note="similar to Saccharomyces cerevisiae ROX3 (YBL093C);
                     ancestral locus Anc_7.425"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680387.1"
                     /db_xref="GeneID:11500511"
                     /db_xref="GOA:G8ZRN4"
                     /db_xref="InterPro:IPR013942"
                     /db_xref="UniProtKB/TrEMBL:G8ZRN4"
                     /translation="MSAAIDEQTLPSYYYYVDPEVTYQASRPNPLEDLISAYGLQDLS
                     HQVARANSDGSKAIKLRKSYKNQISELSGKFGTIPTRENGKGGEVAHILFQNNPDMMN
                     QVRKESGMTPEEYHTAMINRDASLFEPPNLDWNMCRSVLSQFERSYPTEFQNQPGFQV
                     EDLAFDLDGTGKVNAKKRKVKSNGSSMATPNSDMQEDVKRRRLE"
     gene            complement(<507028..>508461)
                     /gene="TDEL0C02880"
                     /locus_tag="TDEL_0C02880"
                     /db_xref="GeneID:11500512"
     mRNA            complement(<507028..>508461)
                     /gene="TDEL0C02880"
                     /locus_tag="TDEL_0C02880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680340.1"
                     /db_xref="GeneID:11500512"
     CDS             complement(507028..508461)
                     /gene="TDEL0C02880"
                     /locus_tag="TDEL_0C02880"
                     /inference="similar to DNA sequence:INSDC:YER122C"
                     /note="similar to Saccharomyces cerevisiae GLO3 (YER122C);
                     ancestral locus Anc_7.426"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680388.1"
                     /db_xref="GeneID:11500512"
                     /db_xref="GOA:G8ZRN5"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:G8ZRN5"
                     /translation="MSSDEGEVFATKELTTQVFQRLASKLENRVCFDCGNKNPTWTSV
                     PFGVMLCIQCSAVHRNLGVHITFVKSSNLDKWTINNLRRFKHGGNHKAREYFLKNNGK
                     QFLNTSNVDARVKYTSGVAKRYKEHLDQKVKKDMELHPAELILAEDELEGSSTESSSL
                     AGSNANSVDDFFSNWEKPASTPTAINNSRQGSSSPKVLTPSSTGGQPKTAARASILSS
                     SRKKAPIAASGAKKHSILSSSRKPTRVAANKVDKSEADDLFEQFAKEAEQEKVDKQSN
                     LGAANQRSKPTYKATTMIEERQETFHDTKKHDDFFDDFDKEDNSKGPVEELKPKFAKL
                     GFGMTMNDADELAKKQKEERTASSGPKYTGKIAARYGEQKAISSDQLFGRGTYDEDAS
                     REAKQKLKTFDTATSISSSSYFGEEEEPQEDEFGRPVRQSFGSQGANNGFVDFNMSNE
                     DDLQVLKDAVEQGAMKLGNYLRDYLRK"
     gene            complement(<508597..>509334)
                     /gene="TDEL0C02890"
                     /locus_tag="TDEL_0C02890"
                     /db_xref="GeneID:11500513"
     mRNA            complement(<508597..>509334)
                     /gene="TDEL0C02890"
                     /locus_tag="TDEL_0C02890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680341.1"
                     /db_xref="GeneID:11500513"
     CDS             complement(508597..509334)
                     /gene="TDEL0C02890"
                     /locus_tag="TDEL_0C02890"
                     /inference="similar to DNA sequence:INSDC:YBL095W"
                     /note="similar to Saccharomyces cerevisiae YBL095W;
                     ancestral locus Anc_7.427"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680389.1"
                     /db_xref="GeneID:11500513"
                     /db_xref="InterPro:IPR006683"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:G8ZRN6"
                     /translation="MNSVVRSLNRGLLLPALGFSLGVGYFIRAWPDEAGSMTLQDNVS
                     SKEGTGLQLQRMDVLEGIRKNGLYRRLLQDPDFDHSVQSEKIPPGHRAYHVGQGILFG
                     PEKLGIDPVILQDTKRREVVIFYHFGADLANEQGQVHKGVLSLVLDEALCYCGFPTLP
                     SKRGVTAKLDIDFQRGIPADSTIVLRAHVSEFKGRKCVIEGTLESVPRFENPWLASLW
                     KPAVYASAKCILVEPRWFKYLNWLNVF"
     gene            <509949..>511922
                     /gene="TDEL0C02900"
                     /locus_tag="TDEL_0C02900"
                     /db_xref="GeneID:11500514"
     mRNA            <509949..>511922
                     /gene="TDEL0C02900"
                     /locus_tag="TDEL_0C02900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680342.1"
                     /db_xref="GeneID:11500514"
     CDS             509949..511922
                     /gene="TDEL0C02900"
                     /locus_tag="TDEL_0C02900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680390.1"
                     /db_xref="GeneID:11500514"
                     /db_xref="GOA:G8ZRN7"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZRN7"
                     /translation="MSDSSSLDEPKATVSHQDDVRAEKANYNKEALFKPKMSDSSSAD
                     MEDNTYGENEANTSGDGNVLGQYSVKQVMQMGRHFAQKHNLPNDDDIFARAAALARDP
                     NKFDHMDFLSEHERIACYDEINKPWSSMTNKLIQIIAASAMSAAVQGMDETVINGALL
                     GYPKAVGLDGGTERENWIQGLVNGAPYLCCAGFSCWTTDWMNNKLGRKNVIFFTCLIS
                     AISCFLQGFGPTGAPGWHYLLAMRLLLGVGLGPKSATTNVYLAECASKQIRGSVTMMW
                     QLNTALGIMFGYVFSLAFFHVPSHGIGGGLNWRLTLASAMIPAIFVMIQIPFCPESPR
                     WLMGKDRYMEAYEATVQIRPHKILACRDMFYQHILMMEEESLQLPFVKRLQEMVTVRR
                     NRNGLLASCVCAFMQQFCGINVIAYYSSTIFKESGFSDLQSLEASFGFGLINFVFAFP
                     AFLMIDRFGRRYLLLRTFPWLALFLLIAGFGFWIPKSNNDARMGVITMGIYVFTAIYS
                     FSCGPVPFIIAAESANLASRSLNASIFTVVLWGFNFILSLTWNSMLAAMKAQGAFGFY
                     AFWNLAGWFMVYFLLPETKQFTLEELDEVFDIPLRTRIAYEFKELWPNFQRSILWRKN
                     VKGQPPLGPHQRLSLKSEEWNDKASAEFVEKAN"
     gene            complement(<512082..>514307)
                     /gene="TDEL0C02910"
                     /locus_tag="TDEL_0C02910"
                     /db_xref="GeneID:11500515"
     mRNA            complement(<512082..>514307)
                     /gene="TDEL0C02910"
                     /locus_tag="TDEL_0C02910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680343.1"
                     /db_xref="GeneID:11500515"
     CDS             complement(512082..514307)
                     /gene="TDEL0C02910"
                     /locus_tag="TDEL_0C02910"
                     /inference="similar to DNA sequence:INSDC:YBL097W"
                     /note="similar to Saccharomyces cerevisiae BRN1 (YBL097W);
                     ancestral locus Anc_7.428"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680391.1"
                     /db_xref="GeneID:11500515"
                     /db_xref="GOA:G8ZRN8"
                     /db_xref="InterPro:IPR022816"
                     /db_xref="UniProtKB/TrEMBL:G8ZRN8"
                     /translation="MSARIRYDHEDVEDQGLFTNRSTMMANFEEWIKMATDNKINSRN
                     SWNFALIDYFHDLNVLRDSENNINFQKASATLDGCVKIYSSRVDSVTTETGKLLSGLA
                     QKKLSEKQEKANAANGEGTEDQGSDDPDASEGDIQIDPSTGLPISNNVVAQTRRLNHN
                     RVLETTLVDFETIKMKELDQELNIDPLFKKALVDFDEGGAKSLLLNTLNIDKDARVVF
                     DAAMKDSKKSEVEETEERDGESESDIEDASESAVGMDSITKAANTSFNNDTTSNSIVI
                     EDEILALGMDFIKFTDISNSVISQSMQQLPKVFDDMNKAKNFIDGINSKFDNFLSEKE
                     LEEAVPDLGYEVDNSNDQMLEEDPIGPIENLSGEEGNHEEADNADEDEDASLADESDA
                     DFGGVFEQELMAYFDENLTKTWRGREHWKVRNFKKKNVLNRNEDTSTAPPDQPSGEAA
                     VPEESKKKKKGPLEIDFFALDDKFEEAIFASKKRANIDLPQKSRTNDSHYLLPDDFHF
                     TTQKITRLFIKPEQTMSLFQPRRSKREQGSAPELVRNASFMDGANGDDGGVAMADEHF
                     WAENYSRKEHEQNEEEKEEPEQIVGGNLENPFEDDAGVDFNQAFDDEDFKDDGPSSMP
                     AEELGKFPFTDNKVSFSRVSKKVDVKRLKDNIWSSIKILKDERRTKSSDEDIREEIKL
                     KFTDIAAEISQRYTNEARKDISTSFCFICLLHLANEHGLEITSAENYEDLNVVVSADC
                     S"
     STS             514134..515237
                     /standard_name="D1S3695"
                     /db_xref="UniSTS:474273"
     gene            complement(<514481..>515887)
                     /gene="TDEL0C02920"
                     /locus_tag="TDEL_0C02920"
                     /db_xref="GeneID:11500516"
     mRNA            complement(<514481..>515887)
                     /gene="TDEL0C02920"
                     /locus_tag="TDEL_0C02920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680344.1"
                     /db_xref="GeneID:11500516"
     CDS             complement(514481..515887)
                     /gene="TDEL0C02920"
                     /locus_tag="TDEL_0C02920"
                     /inference="similar to DNA sequence:INSDC:YBL098W"
                     /note="similar to Saccharomyces cerevisiae BNA4 (YBL098W);
                     ancestral locus Anc_7.429"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680392.1"
                     /db_xref="GeneID:11500516"
                     /db_xref="GOA:G8ZRN9"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR027545"
                     /db_xref="UniProtKB/TrEMBL:G8ZRN9"
                     /translation="MPETVAVIGAGLVGCLTAIALAKRDYKVTLFDYRLDPRDQKTID
                     RNLRSINLAISSRGISSLEFVDKEVAGRVLKGIIPMKGRMIHHLNGAQESQTYGLFGE
                     SINSIDRAVLNHLLLDELERIGSDKVQVKFGHKLSKIKYGKPDEFQSCVFATEEGVDQ
                     VYATNFVVGCDGSYSTTRDQMQREVRMHFSQEYIDCCYIELYIPPSKNYDARYKGNFS
                     LAPDHLHIWPRHQYMLIALANADGSFTSTFFGPWGLVESLLKSEARVREFLIKNFPDA
                     MEIMGINQAVKSFMSHPKGALMCIECDPYNVSGGRGIILGDAAHSMVPFYGQGMNCGF
                     EDVKVLMKLLDAYDGDRAKAFDAYTRERHQDLTAIVKLAKRNYKEMSHDVTSKVFLLR
                     KKLDHWLGKLLKDKWLPLYTMVSFRADIPYHKAIAISKRQKTILDFIQVLIIAAISLL
                     GYEGFKRVSRRLKQASRQ"
     gene            <516526..>518748
                     /gene="TDEL0C02930"
                     /locus_tag="TDEL_0C02930"
                     /db_xref="GeneID:11500517"
     mRNA            <516526..>518748
                     /gene="TDEL0C02930"
                     /locus_tag="TDEL_0C02930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680345.1"
                     /db_xref="GeneID:11500517"
     CDS             516526..518748
                     /gene="TDEL0C02930"
                     /locus_tag="TDEL_0C02930"
                     /inference="similar to DNA sequence:INSDC:YPR024W"
                     /note="similar to Saccharomyces cerevisiae YME1 (YPR024W);
                     ancestral locus Anc_7.430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680393.1"
                     /db_xref="GeneID:11500517"
                     /db_xref="GOA:G8ZRP0"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZRP0"
                     /translation="MSLSLLSSPPVGGGLVKILAPRLPLVGSALIARYGRRQMHRLTL
                     QSSLLSGRRFYAKSVDDKGPEPAKSEENETKRPVGEAANAGTSSQIVSHAILAKKEQE
                     ANKGLANPDAQAAFYRLLLQSNYPQYVVSRFETPGIASSPECSELYMEALQRIGRHSE
                     ADAVRQTLLTASSAGAVNPSLASSGVNSPAYHGTFPSLYSPSYGSRKEPLHVVVTEST
                     FAIVSRWVKWLVIFGLLTYGVSEAFKYIAENTTLLKSSEVADKSVDVAKTNVKFDDVC
                     GCDEARAELEEIVDFLKDPAKYESLGGSLPKGVLLTGPPGTGKTLLARATAGEAGVDF
                     FFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIVFIDELDAIGGKRNPKDQAYAKQT
                     LNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDVRGRSDILK
                     HHMKKITMAADVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMQHFEWAKD
                     KILMGAERKTMVLTDAARRATAFHEAGHAIMAMYTTGATPLYKATILPRGRALGITFQ
                     LPEMDKVDITKRECLARLDVCMGGKIAEELIYGKDNTTSGCGSDLQSATGTARAMITQ
                     YGMGTQVGPVNLADNWETWSDKIRDIADNEVLEILKESEERTRKVIAERSVELHRLAE
                     GLIEYETLDAKEIKKVCQGEKLSKLKTATNTVVEGPDSDERKEIGGDKPKRPAFISAS
                     "
     gene            complement(<519085..>520179)
                     /gene="TDEL0C02940"
                     /locus_tag="TDEL_0C02940"
                     /db_xref="GeneID:11500518"
     mRNA            complement(<519085..>520179)
                     /gene="TDEL0C02940"
                     /locus_tag="TDEL_0C02940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680346.1"
                     /db_xref="GeneID:11500518"
     CDS             complement(519085..520179)
                     /gene="TDEL0C02940"
                     /locus_tag="TDEL_0C02940"
                     /inference="similar to DNA sequence:INSDC:YPR025C"
                     /note="similar to Saccharomyces cerevisiae CCL1 (YPR025C);
                     ancestral locus Anc_7.431"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680394.1"
                     /db_xref="GeneID:11500518"
                     /db_xref="GOA:G8ZRP1"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015429"
                     /db_xref="InterPro:IPR027081"
                     /db_xref="UniProtKB/TrEMBL:G8ZRP1"
                     /translation="MTTVQANAVNIPSSKKGIPGKPPNYKRLSDDDLFRHSSQYRFWS
                     FTPEQLEQRRIEVNAQAVQSIEQDLRNFIDARSTELNEEEIKTIENRAVPVNMEEELK
                     LVNLYAKKVQTIAQRLNLPTEIVATSITFFRRFYLENSVMKIEPKAIVLTTIFLACKS
                     ENYFIGIDSFCEKTRGDKEQVLKYEFPLLESLKFSLLSHHPYRPLHGFFLDIQAVLHG
                     KVDLSYMGHIYDRCKKRITDALLTDAVYFYSPPQITLAVLMLEDEALTTRYLELKFHG
                     NDTNQGNAEDEASRGNGNVTIQLDKLMKIVTNCSKLIEKPTTVPVEEAKSIAARLYFC
                     QNPDDLLKKMKKRKADEQDSSVPVKKPKTE"
     gene            complement(<520368..>522008)
                     /gene="TDEL0C02950"
                     /locus_tag="TDEL_0C02950"
                     /db_xref="GeneID:11500519"
     mRNA            complement(<520368..>522008)
                     /gene="TDEL0C02950"
                     /locus_tag="TDEL_0C02950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680347.1"
                     /db_xref="GeneID:11500519"
     CDS             complement(520368..522008)
                     /gene="TDEL0C02950"
                     /locus_tag="TDEL_0C02950"
                     /inference="similar to DNA sequence:INSDC:YBL099W"
                     /note="similar to Saccharomyces cerevisiae ATP1 (YBL099W);
                     ancestral locus Anc_7.432"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680395.1"
                     /db_xref="GeneID:11500519"
                     /db_xref="GOA:G8ZRP2"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005294"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR023366"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZRP2"
                     /translation="MLARTAAIRSVSRSLVNAARIARVARPATIIAGRRYATAKAQPT
                     EVSSILEERIRGVSEEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMAL
                     NLEPGQVGIVLFGSDRLVKEGELVKRTGKIVDVPVGPELLGRVVDALGNPIDGKGPIK
                     AAGRTRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVAL
                     DTILNQKRWNNGSDESKKLYCVYVAIGQKRSTVAQLVQTLEQHDAMKYSIIVAATASE
                     AAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPG
                     DVFYLHSRLLERAAKMSEREGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEA
                     ELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDA
                     STKQTLTRGERLTQLLKQSQYAPLAAEEQVPLIYAGVNGFIDNIELSRVQEFEASFLA
                     YLKSNHEDILSSIRDKGELPKDLLEKLKSATESFVATF"
     gene            <523912..>527472
                     /gene="TDEL0C02960"
                     /locus_tag="TDEL_0C02960"
                     /db_xref="GeneID:11500520"
     mRNA            <523912..>527472
                     /gene="TDEL0C02960"
                     /locus_tag="TDEL_0C02960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680348.1"
                     /db_xref="GeneID:11500520"
     CDS             523912..527472
                     /gene="TDEL0C02960"
                     /locus_tag="TDEL_0C02960"
                     /inference="similar to DNA sequence:INSDC:YPR026W"
                     /note="similar to Saccharomyces cerevisiae ATH1 (YPR026W);
                     ancestral locus Anc_7.433"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680396.1"
                     /db_xref="GeneID:11500520"
                     /db_xref="GOA:G8ZRP3"
                     /db_xref="InterPro:IPR005194"
                     /db_xref="InterPro:IPR005195"
                     /db_xref="InterPro:IPR005196"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="UniProtKB/TrEMBL:G8ZRP3"
                     /translation="MSGRQRLLESSVATDPSNTRRSKTSALWFWVLIASMVALTTVNF
                     FLANIASFVSGLANLHEPQVGAIKPTVTHHTLDCNENARKSSKKLYELLYDFEASLYD
                     DENMILGSTKFYPNTYSKQPYVSNGYIGSRIPNIGFGYAEDTLNLWTGSGDEIPGALN
                     NGWPLRNRRYAGAFVSDFYCLQESLNSTNFPELDEKGYTTVISSIPQWTNLQFTIDDD
                     SVWFNPQNVSLDEVSNYNQNMSMRNGVVTTQLDWLDGMINVRSEIVTHKKHYALGMMS
                     LEISLNLDRLPPEVPYMDVNVYDVLDFSTSHRTVLQSLGFDKENQGIFMIVEPENVPY
                     SNAAVFSSSTADDSANFTWSEEYSTDEKIVQSTHANLTRENPKIAVKKYVGIMSTEFN
                     TNSAHNVSNIEFAKSVSSRSRGRYDELMSTNTKAWAAIYNDAFIEIPSDALLEMTARS
                     SLYHLLANTRTFNVSADRGLPVPVSGLSSDSYGGMVFWDADIWMQPALLPFFPDIAKN
                     MNNYRNASHQQARLNAQENGYPGAVYPWTSGRYANCTSTGPCIDYEYHINVDVALASF
                     SIYMNGGKGVDDDYLRYTTWPMVRDAAEFFTVYVKFNETLGKYETYNLTDPDEFANHV
                     NNGAFTNAGIKTLLKWATDIGYHLGEYVDPKWIDIAKKIYIPRSCSNITLEYSGMNSS
                     VEIKQADVPLMVYPLGYITDESILNGAIKDLYYYSERQSASGPAMTYPVFVAAAAGLL
                     NHGSSSQSYLYKSVLPYLRAPFAQFSEQSDDNFLTNGLTQPAFPFLTANGGFLQSILF
                     GLTGLRYSYEVDSSTKKISRLLKFNPVELPLLPGGIAIRNFKYMNQVLDVIIDDNNGT
                     IVHKSGDQPIRVKVPDRSYIRDQDISFYLGGNSSGHDDCFNNFIEGGEGDRPVSAFGT
                     YYTINPGEELVLPLFKPGLNVEGNIAESKQVTNCTAGVPGDVPFSALDGNNYTHWQPA
                     YKYDEGKLLIDLGEDNLQEIKSGMILWGQRPARNMSISILPHTYEVEKFVSNLTQVLE
                     HSDLQKIEGEDASEVLEDVGIDTNELRNFECDDDIRTMLNWKTETLESLVDHLKKSKM
                     ISRHFVKILDNYSIEPSEPYFKEVYNKSLIEILPSNKTEFSIDYDALKLNDTACYSND
                     SIQNSTAWRKTRFILVSIQGSYDDDIDIKGGTIKEIVLKV"
     gene            complement(527736..527829)
                     /gene="TDEL0Ctrna3F"
                     /locus_tag="TDEL_0Ctrna3F"
                     /db_xref="GeneID:11500352"
     tRNA            complement(join(527736..527772,527792..527829))
                     /gene="TDEL0Ctrna3F"
                     /locus_tag="TDEL_0Ctrna3F"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /db_xref="GeneID:11500352"
     gene            <528155..>528765
                     /gene="TDEL0C02970"
                     /locus_tag="TDEL_0C02970"
                     /db_xref="GeneID:11502016"
     mRNA            join(<528155..528205,528277..>528765)
                     /gene="TDEL0C02970"
                     /locus_tag="TDEL_0C02970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680349.1"
                     /db_xref="GeneID:11502016"
     CDS             join(528155..528205,528277..528765)
                     /gene="TDEL0C02970"
                     /locus_tag="TDEL_0C02970"
                     /inference="similar to DNA sequence:INSDC:YPR028W"
                     /note="similar to Saccharomyces cerevisiae YOP1 (YPR028W);
                     ancestral locus Anc_7.434"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680397.1"
                     /db_xref="GeneID:11502016"
                     /db_xref="InterPro:IPR004345"
                     /db_xref="UniProtKB/TrEMBL:G8ZRP4"
                     /translation="MSDIGSSIQSQLKSFDTKFAGNNVLQQLEDKTKLPKSYLAVSAS
                     FVYLLLIFINVGGIGEILANIAGFAVPAYFSLFALKTSDKQDDTELLTYWIVFAFLNV
                     IEFWSKAILYLIPFYWFLKTIFLLYLALPQTGGATFIYKTIIAPVSDRYIVVKNKKSD
                     DIRSAVNEAAGKTTGAQIH"
     gene            complement(<528842..>531316)
                     /gene="TDEL0C02980"
                     /locus_tag="TDEL_0C02980"
                     /db_xref="GeneID:11500522"
     mRNA            complement(<528842..>531316)
                     /gene="TDEL0C02980"
                     /locus_tag="TDEL_0C02980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680350.1"
                     /db_xref="GeneID:11500522"
     CDS             complement(528842..531316)
                     /gene="TDEL0C02980"
                     /locus_tag="TDEL_0C02980"
                     /inference="similar to DNA sequence:INSDC:YPR029C"
                     /note="similar to Saccharomyces cerevisiae APL4 (YPR029C);
                     ancestral locus Anc_7.435"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680398.1"
                     /db_xref="GeneID:11500522"
                     /db_xref="GOA:G8ZRP5"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR008152"
                     /db_xref="InterPro:IPR008153"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017107"
                     /db_xref="UniProtKB/TrEMBL:G8ZRP5"
                     /translation="MAGSSLRSFIKDVRSAKTVAEERAIITKASAKIRTKLRDDHLPQ
                     EKRRNNIQKLLYLYVLGEKTHFGQVECINLIASDDFADKRLGYLAATLLLDGTQDLLT
                     LLTNLLNNDLSHPNRYVVSLALTTLGFLSSSELARDLYPDVENILNRSKDPFLVKKAL
                     QCVAKLILKDATLLEVFQPLYLVSLLQNRSICTHGVLLSITKVLQSILSSYPQYQNSI
                     KQEDSTADVSGIVTELVPMMPELLTILQNLNTKNFEPEFDIQGTSDPFLQCELLCTLR
                     MFFQVCTSISVSRIDQYVNKFGDLLTQIATNTDGSKNCGQAILYETVRTIFSLNMEQP
                     LRVLGINILGKFLSGKDNNSKYVGLNTLLHVVPQEPAAVQRHRKFISRCLRDPDTSIR
                     KRALELSFAILDEANIKELVEELIEFLKKASEDDKSLIVYTVENLVTAFNVNQSVDQN
                     WKLETLVTVLKLVGPFITAEPVSDILISINNATDSRHRNEVVRDMLKISLDKSRQDEV
                     TEDNVGWRIATIWCIGEYGGAVLQGGQDKVVSESSLSEYLVQQQKLCDKSENKILHYI
                     LTATLKLSTHINDPGCIEALRQIVVSHTKDADLMIQTKSVQYEVIFRQPSSVKKVICE
                     AMPKFEKKVEPEVPKNLVTLSRTKSAQQEPPDVLDLLGDDAGTSSGPAKSADSQPQSS
                     PADLLADIFGTDGNGIIDATSNKINAPQTLQIPPESVKVHESASVDCFVRLVSCSMGI
                     AQLELYLKSKESIQNFQTFCAVPKTQKLTLSQIHPSNSLEAGQVARQNLKITGSGKLK
                     LRIKLDFMRHGTNDNQQFDHKFDQTL"
     gene            <531888..>535052
                     /gene="TDEL0C02990"
                     /locus_tag="TDEL_0C02990"
                     /db_xref="GeneID:11500523"
     mRNA            <531888..>535052
                     /gene="TDEL0C02990"
                     /locus_tag="TDEL_0C02990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680351.1"
                     /db_xref="GeneID:11500523"
     CDS             531888..535052
                     /gene="TDEL0C02990"
                     /locus_tag="TDEL_0C02990"
                     /inference="similar to DNA sequence:INSDC:YBL101C,YPR030W"
                     /note="similar to Saccharomyces cerevisiae ECM21 (YBL101C)
                     and CSR2 (YPR030W); ancestral locus Anc_7.436"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680399.1"
                     /db_xref="GeneID:11500523"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="UniProtKB/TrEMBL:G8ZRP6"
                     /translation="MPYPMPRPIPTSSSTARERGDHVFTGSPGAGPRSVSPVRNTGMR
                     RRSSTFKNALFSILGSSNSAVQEESSNLPKNHSTGSISGGGSTRRGSLAVPEATACSK
                     SRSQRDYAMPAADGEEMAVSFSFQGSDVGPDEYIPRSATTTSSMTSRSAGSQSLQSFG
                     KEFLTQYLTDRGLLLSRVISETPDLRLTVATSGDHVFLPTMSSNDDEYLARLNGLRGE
                     EEAMEIEPEFSLDRPSSDVPTGAESQLRESLESELANEESAISDDDSDLSEDGNGESG
                     VDYADNQGQRAKNSATASPVTPTFEIDSSMATYTIAVVLSLNKQTTLSNIKGELCLRV
                     RVHWHNGVPPTKSFYEEFYCAGSMEWDLNPENANLFVPQNVSSEERIIENNRNLRPMR
                     LFKNISDENRFYLDKNKTRTELLKKVNLRKTQVFQAGDYVFIIPVVFSNHIPESLYLP
                     SARVNYRFRVATKIAHVEGQESSTGNNQEEPSEPIKIQETDHTTHRRFSNSILKKIKN
                     NLHITNPVQNKVYDETKEIYAEYPLDVVRTPPLVSISTANKPVYINRVWANSLSYEIS
                     FAQKYVSLGSKVPVKIKLAPMSKNVCLKRLKISLVEKITFVSKNYEYEYDQIDPVAKD
                     PYNPYFSDFSSKRKKERTVSLLEVRSSEKGSRALREEIVQNCVDENLLAYSSAEGDNG
                     QPSIGITEPLMIETTLEFPKYEDLNKKTARTVPPYGIDIYTSVPNPEIGSQAGGSHRS
                     GVIGFLANRKNSLASQVKGTSDVSQPVQAQPIVDEKFHETKIRTNAGIPVQFHTNLNV
                     AKRGLYLSSLHFSNIYSKHKLEFMLRISKPDDRDLKRLRHYEVLIDTPIFIVSELCNS
                     GNMDLPTYDMATNSQLAGEIDVETAPPTFEEAISVPNSPVQSPVMSPIGSPNVRANYD
                     PDELSIQQINLSRSNSAAGPPDSQAIIPPQMTLTQSIDPSPRFNNLDKLLSTTPGASG
                     ADLSRSPNTRNSNLGLTSQSNGLEEPSQASIIFKKGYSVSARNAVQGDVSEGSSSEGL
                     DGGVSINSSPPSYDEVRPLMSDEE"
     gene            complement(<535100..>535744)
                     /gene="TDEL0C03000"
                     /locus_tag="TDEL_0C03000"
                     /db_xref="GeneID:11500524"
     mRNA            complement(<535100..>535744)
                     /gene="TDEL0C03000"
                     /locus_tag="TDEL_0C03000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680352.1"
                     /db_xref="GeneID:11500524"
     CDS             complement(535100..535744)
                     /gene="TDEL0C03000"
                     /locus_tag="TDEL_0C03000"
                     /inference="similar to DNA sequence:INSDC:YBL102W"
                     /note="similar to Saccharomyces cerevisiae SFT2 (YBL102W);
                     ancestral locus Anc_7.437"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680400.1"
                     /db_xref="GeneID:11500524"
                     /db_xref="GOA:G8ZRP7"
                     /db_xref="InterPro:IPR007305"
                     /db_xref="InterPro:IPR011691"
                     /db_xref="UniProtKB/TrEMBL:G8ZRP7"
                     /translation="MTNSREEQVHSLRDSLNKWNESRTQHSQGFNESAKTLLSSWADS
                     VNTRAQDVYQRLPLSRQDLVQDQEPSWFNLSRTERLILFVCFILGSIACFTICVFLFP
                     VLAVKPRKFGLLWSMGSLLFVLAFGLFMGPVAYLKHLTSRERLPFSIFFFTTCILTIY
                     FAAFMKSTLLTVPCAILELIALVYYAISYFPFGGTGLKMMSSVGINTARGALHI"
     gene            <536063..>537496
                     /gene="TDEL0C03010"
                     /locus_tag="TDEL_0C03010"
                     /db_xref="GeneID:11500525"
     mRNA            <536063..>537496
                     /gene="TDEL0C03010"
                     /locus_tag="TDEL_0C03010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680353.1"
                     /db_xref="GeneID:11500525"
     CDS             536063..537496
                     /gene="TDEL0C03010"
                     /locus_tag="TDEL_0C03010"
                     /inference="similar to DNA sequence:INSDC:YBL103C"
                     /note="similar to Saccharomyces cerevisiae RTG3 (YBL103C);
                     ancestral locus Anc_7.438"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680401.1"
                     /db_xref="GeneID:11500525"
                     /db_xref="GOA:G8ZRP8"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="InterPro:IPR024099"
                     /db_xref="UniProtKB/TrEMBL:G8ZRP8"
                     /translation="MDGINGDGQQRTLNALLSQSHMSSDNNGGKFTFAGGFEDDLPQE
                     HAYSSNTPATQHEKLLYMNGNGNVKNESPYRSVNNSQLGSSNSFIDDKFATSAAAFNA
                     DGSRNSISNPQYRGSFAYDFQDNGGLEQQLTGIKTEDMLPPELFRRSKDESLLSFTDD
                     ISSSLGSSLQSFDSNYGSSFSYQPQPLNMSATMQPTSAHYSPSVKSPSSSVRAGSYLS
                     TSLRNGSAGTPGPLGTSRTRHASISGNVYAEGLLSASVPKNLTTEERLRRKREFHNAV
                     ERRRRELIKQKIKELGNIVPPSLLNYDGNGKQVKPNKGIILNKTVEYLEYLLQVLDIQ
                     DRKKKQLLTKISELQDKESQLASGRSSEQPVGERDESISGTGQPSQAADYESTSDGTG
                     ADACEEERIIDVRSKPHPSNSAEAPQRWQNSFNELISFMPTNDEQFPVNDDLQQFLSG
                     NLIEAEDNAKLMFNSGERPDYLLDFNS"
     gene            <537820..>539802
                     /gene="TDEL0C03020"
                     /locus_tag="TDEL_0C03020"
                     /db_xref="GeneID:11500526"
     mRNA            <537820..>539802
                     /gene="TDEL0C03020"
                     /locus_tag="TDEL_0C03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680354.1"
                     /db_xref="GeneID:11500526"
     CDS             537820..539802
                     /gene="TDEL0C03020"
                     /locus_tag="TDEL_0C03020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680402.1"
                     /db_xref="GeneID:11500526"
                     /db_xref="GOA:G8ZRP9"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8ZRP9"
                     /translation="MFSVKTQMRRAIHLVRRKNGKVARITIGVLVILLLTIMILHKSS
                     DYYDLTLNPSNLTSSTSYAGDSTPHSEPAYPDHKPFDARTLREALGSVMNQIRELSPQ
                     GELDRSKGDDCSLGDLNVGVPQNDEKVSKSELLKCIQITPDAEDELKNLHKSFLSVLE
                     KKIMPKYPISMYRGDGIVFVGGGRFTMFVMPAIQAIRANAGRDIPIEIMIPPGNNHES
                     GFCENILPLVDPSGLTRCVFMETLFDSKTMKNVKGYQLKALALLASSFRKTLLLDADN
                     YVVNSIDSFFDSEIIEDYGMALWPDYWKRLHHPAVYDIVGSHVDSSRRARFIMDTVSP
                     SQLYQSDDISKVPFHDLDGTIPDGGTESGQLLVDKYKHLDTIILSLYYNYNGPSYYYP
                     LLGQGLAGEGDKDTFALAARALSAHGLQRYFYQLRAPVGALGYWAHPKDNVPILDDEH
                     VPEDQRSFRGVAMLQHDLDLDFKAYKKAYTEIKSKLVQDLKTFRKKATLSDASADLAN
                     VDELFWKERRKDGYDVNEFLSYFSDVPVTFIHSHFPKYNPWEFAQDQEFIFDGKKVMS
                     DHKDDPNFKPTHHGHFRMYDHTFQKLSNYDLELANWLSFKEHICREDGHTNFSYLAEE
                     IEKTEHGLQRYEEMCKYIDERVKMLKSTTWEGSRVN"
     gene            <540079..>542253
                     /gene="TDEL0C03030"
                     /locus_tag="TDEL_0C03030"
                     /db_xref="GeneID:11500527"
     mRNA            <540079..>542253
                     /gene="TDEL0C03030"
                     /locus_tag="TDEL_0C03030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680355.1"
                     /db_xref="GeneID:11500527"
     CDS             540079..542253
                     /gene="TDEL0C03030"
                     /locus_tag="TDEL_0C03030"
                     /inference="similar to DNA sequence:INSDC:YPR031W"
                     /note="similar to Saccharomyces cerevisiae NTO1 (YPR031W);
                     ancestral locus Anc_7.439"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680403.1"
                     /db_xref="GeneID:11500527"
                     /db_xref="GOA:G8ZRQ0"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019542"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:G8ZRQ0"
                     /translation="MQRGLGEDGPKLREEKHFEDFYTDLEKETLLPIISPEQEGSLRL
                     HDAYSRANASGANSRSVKQLICNGKSTFETIKLHRNLNKFQKCQFSISQLDGGKPLHT
                     ERKSKSVDGKRLSGLNKLRIPYFTKFTARLENGSDLHIPGNLEHISKNLSNLSSEYDM
                     DEQDDLYVCFLNSSCCDSKLSHEVFELLITVLEREWSHLEKLIPPKSILVDDPEEDHR
                     AQTTRLHYQLFGADDGTERSTDQTCAVCGGGDSDNTNAIVFCDGCDIAVHQECYGIVF
                     IPEGQWLCRRCLVSKNRKVSCLFCPSHTGAFKQTDTGSWAHVICGLWIPELYFANLHY
                     MEPIEGTENISKSRWKLLCSICKQRMGACIQCTNKSCFTAFHVTCAKRAGLYMDFGGA
                     SINEVASNQLHLSSLLSCFCDRHSPADWPNPKESILKVRRYFIEYNDNDMAGNFNMNQ
                     QPSKATVPKDKWKTNRGTPIAPHLFADILREVIKLFDIPNSQQVSYYICRYWSMKKEL
                     KRGAPLVRKYESNSSSLLDESQLQERVEVTDILLNDLRRLKELSNLTIRRTAVLNRLR
                     ETNDKIKPLTESPENYILRNMVINKFVDSEAFKSLECEISDKIILSQLQSCKEFTISP
                     QNSNVSFEAEVNSALFPLEMASSTPRAVQNNIRKARLLLANLMRQYENSNVSDRLQND
                     FIIENNKVEVKRRRALILMEQEGLSDVEDLGPKERKTLNMVL"
     gene            <542405..>545422
                     /gene="TDEL0C03040"
                     /locus_tag="TDEL_0C03040"
                     /db_xref="GeneID:11500528"
     mRNA            <542405..>545422
                     /gene="TDEL0C03040"
                     /locus_tag="TDEL_0C03040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680356.1"
                     /db_xref="GeneID:11500528"
     CDS             542405..545422
                     /gene="TDEL0C03040"
                     /locus_tag="TDEL_0C03040"
                     /inference="similar to DNA sequence:INSDC:YBL104C"
                     /note="similar to Saccharomyces cerevisiae YBL104C;
                     ancestral locus Anc_7.440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680404.1"
                     /db_xref="GeneID:11500528"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:G8ZRQ1"
                     /translation="MGLIKKVNTWSYDGLIDYLSVNPTRDEVTHFKVDPENDEEESIM
                     KLRTARDFGSITCLDYSDQENGLVAVGEKSGFIRLFNIIMRDNSELESFDMKVRAKQQ
                     RCINTLAINGNGLVSMGLDRNKNDSSLQVWDINYQNRDSTIVNPTFSYCVNESIVSSK
                     FLDDTGLIVASTKFIKEIDLRSANPVCQHPTRLSYDVKLNPFNSWEFSSYGDDGTLAI
                     WDRRKLIRSSNSSELNVAEPLLTFDKLLGVGAASRKYMNSCFRWSSDRNREFSTLHRG
                     DTIKRWWLGSCGTNKEDENDVEDLFVSTVHDINTTFDRVVTFDYIPQSKHKVSLICMR
                     QSGTVYKMPVTQSFTTTSFNNGNSLLLSNCEMSDINEIKVTKTEEKSNFEEKALRDLC
                     FEDLDISDDYSKETDDGSVEESSSENLMVDEDEGSFYQESSWRPEELLQKDISVIMKA
                     RAMLGYGLDPVATVAMIDGSKTLQNNAYIRNTWRWIAIAKASVDDGTMVSGDVDLGYE
                     GVIGIWNGLKGISNQNRFREGIKLNDEQLDKEMEKIIRLRRKRKSASGDMVPNNLILD
                     SPKTVQRKLCSILSGWDLSPSDFEEKYQIIIKTGGYEKAAAWAVFFGDIAKAVEILAS
                     AKKERLRLIATAIAGYMAYKVLPGNNSWRQQCRKMSSELEDPYLRVIFAFIADNDWWD
                     VLYEPAISLRERLGVALRFLNDRDLTKFLERTSATVIENGELEGLILTGITPSGIDLL
                     QSYVDKTSDVQSAALISIFGCPRYFRDKRVDEWVQTYRIMLNSWELFTVRAKFDCLRA
                     KLSRTGSGSIRADIKPRQMYMQCINCKKNISTPTTSCGGTQNTTPTGMVSDMPPGSGI
                     SEGLHRGGAIFSKTKKYGMANTPSPLTQQRRKNACPHCGTPFPRCVICLLPLGTTGLP
                     FVISGVESKYDRDAIDEGPSPKDGTNKSQNGAIEQEKADVAKTYQRKKERLNEWFSFC
                     LSCNHGMHAGHAEEWFERHDVCPAPGCVCKCNK"
     gene            <545862..>549299
                     /gene="TDEL0C03050"
                     /locus_tag="TDEL_0C03050"
                     /db_xref="GeneID:11500529"
     mRNA            <545862..>549299
                     /gene="TDEL0C03050"
                     /locus_tag="TDEL_0C03050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680357.1"
                     /db_xref="GeneID:11500529"
     CDS             545862..549299
                     /gene="TDEL0C03050"
                     /locus_tag="TDEL_0C03050"
                     /inference="similar to DNA sequence:INSDC:YBL105C"
                     /note="similar to Saccharomyces cerevisiae PKC1 (YBL105C);
                     ancestral locus Anc_7.441"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680405.1"
                     /db_xref="GeneID:11500529"
                     /db_xref="GOA:G8ZRQ2"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002219"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011072"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:G8ZRQ2"
                     /translation="MYSQVEQDIQKKIEREHNIIQGASNLKKRTDNAMVIQKCNTNIR
                     EARQNIEYLEETLRKLYLSNDRQTHTQETADSRGNGPKGYRHLSTISPDEHIFSRLDL
                     IKYDCPSLSQRIQYMLQQLEFKLQVERQYQEANAKLTKLYQIDGDQRSSSAAEGGAME
                     SKNRIQMLTKALKKYQAINVDLDPAKPHDADSLNHQPKFRRKQLTGELTIGVTAIRDV
                     DHIESPMFSRKPDTYVSIKIDDTVKARTRASRNDRWHEDFQIQVGKGNEVEITVYDKI
                     NDTLTPVAVMWLLLSDIAEEIRKKKAGQTSGQSGWVNARVLSTYNTQGDTSVDSNIPV
                     DDRRTLQHPGSDVGAVSDPNSAELSSKVTTNTWFTMEPAGQILLTLGFNKSSQPQRKN
                     LMGGLHRHGAIISRQEDIYEQHGHHFVQKSFYNIMCCAYCSEFLRYTGFQCQDCKFLC
                     HKKCYTNVVTKCIAKTTTDSDPDEAKLNHRIPHRFEPISNRGTKWCCHCGYILPWGRQ
                     KVRKCTECGIMCHTQCAHLVPDFCGMSMEMANKILRTIQDTKRSQEKRKRLPSSLQTE
                     GSASTKVSRDTSPVKHIEKQLPLEPVELSNGGGTPVYAPHLRKPQPHPERQLDLDKKL
                     NSFIDQNESYLNFTENAQKAYDDSETRTLDPFASDIPEVFNPFDSNKTKIDNTRDHWK
                     QKEQLMHEEAQKLQQDVDVDMNAVIPRTEITKTEVEPVRVEPEHQIVDEDAFSRAEKT
                     SISTEVEHSNPFREMNDEAFQREQHQVSTELSAESSSLIQTETHTSKGSVQSSPKKAH
                     ATIRHRRKAPKRRKVSLDDFVLLKVLGKGNFGKVLLSKSKNTDRLCAIKVLKKDHIIQ
                     NHDIESARAEKKVFLLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQR
                     LSVRRAKFYAAEVLLALKYFHANGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWFG
                     NKTSTFCGTPEFMAPEILKEQAYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAI
                     LTDEPLYPIDMAGDIVQIFQGLLTKDPEKRLGAGPRDALDVMEEPFFRNINFDDILEL
                     RVQPPYLPEIKSPEDTSYFEQEFTSAAPTLTPMPSVLDTRQQEEFRGFSFMPDDLEL"
     gene            <549551..>552631
                     /gene="TDEL0C03060"
                     /locus_tag="TDEL_0C03060"
                     /db_xref="GeneID:11500530"
     mRNA            <549551..>552631
                     /gene="TDEL0C03060"
                     /locus_tag="TDEL_0C03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680358.1"
                     /db_xref="GeneID:11500530"
     CDS             549551..552631
                     /gene="TDEL0C03060"
                     /locus_tag="TDEL_0C03060"
                     /inference="similar to DNA sequence:INSDC:YBL106C,YPR032W"
                     /note="similar to Saccharomyces cerevisiae SRO77 (YBL106C)
                     and SRO7 (YPR032W); ancestral locus Anc_7.442"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680406.1"
                     /db_xref="GeneID:11500530"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013905"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8ZRQ3"
                     /translation="MFKGRRLNVFKSDRSKSTDSSPGSSDIPSAKSSKKFSIKEIANG
                     GPYSKLFATREINKYGLNGKIVTTSFDITQSLLAVATDAGEIHVYGQQQVEVVFTLDS
                     KVLIKHMRFVKGIYLVAIDSKDVIMVFSLYSKKMLTSVFSPGKIACIETDPSLDWLLI
                     GLQSGITLIYDIDRNQMTNFKVENLQRTRFFPKSRVSPVVSIQWNPRDIGTVLISYEL
                     VTVAYSLVEGDIKQHFIYELQPGALGGEFSIDTNKARRPTVRQSLYHPNSLHILTVHD
                     DNSLVFWDANSGQLIQARTLFETDVHVPQPNFQKSPTLDAPRITKVAWVCQSNPEYTS
                     LLMSTDSRQGGGSMAMINFGGTPMYSITSYENMSKYYANTREQKIFPLNNKSPIVSFN
                     PLPRKSPYFAGCHDPGVVLIILADGEVETQIYPSGAFTYKASMFPQSIAWARPIATRA
                     VATTVSKKLWLGVMSASQNGDNVLKGGFPIKKSVRANDVRSALATGHANGSVRIWDAS
                     HGELDSSAVFEMNLSHILNRSSGLEVDNISFAADTLEIAVSIKAGDVVLFKFEVNQFY
                     NPDQKTSDREIQMDFRRFSLNDSKEVLVDVRDRSPDNIRQGFMPITAVHAQKGEVTAL
                     RNSNVGFVGVGYQEGTLMVIDRRGPAVIYAGNINDLCKNYGSYVTTMEFMIMEYGTDG
                     YSSILLLCGTNMGELLTFKVLPEAGGRFGVQFMEGQRTNNEGPIINIDSLSKVVSRSC
                     QAAVPQMEDLRNGVAIPGFVIVSGATDIRTVKIGRSSESRKSFKFPLAASALSFIPHV
                     ANSGEVKVASVLVNLLTSGEIVVLSVPDLKEISVMRIPVATQSRFLKDSSVLRNGDIV
                     VRTGQFQASLISVVNEQATGLNKQYDERSESASDSLYNPRLKIAYRPQVNSLQWARGT
                     IHCTTEQLDTLLGGEHRPQSKYEESIIAKGTISLKPDEKSDDPGDHAGCKRPVRSGTR
                     SSRYGMFKSVSRAVESRFDAIEDSLNDYATAMSEGVNDVVEQTTKDMAKGAFGL"
     gene            <552782..>553384
                     /gene="TDEL0C03070"
                     /locus_tag="TDEL_0C03070"
                     /db_xref="GeneID:11500531"
     mRNA            <552782..>553384
                     /gene="TDEL0C03070"
                     /locus_tag="TDEL_0C03070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680359.1"
                     /db_xref="GeneID:11500531"
     CDS             552782..553384
                     /gene="TDEL0C03070"
                     /locus_tag="TDEL_0C03070"
                     /inference="similar to DNA sequence:INSDC:YBL107C"
                     /note="similar to Saccharomyces cerevisiae YBL107C;
                     ancestral locus Anc_7.443"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680407.1"
                     /db_xref="GeneID:11500531"
                     /db_xref="InterPro:IPR016805"
                     /db_xref="InterPro:IPR019171"
                     /db_xref="UniProtKB/TrEMBL:G8ZRQ4"
                     /translation="MSDDIIEITAPEALLDSNLKFPKEVPFVKHLTVTRERCVNPTLV
                     DSFLRLLRYGSDDSMRQRLSAYHNYEKEGRYNEKKCDKFLTEELYPNWHSRDRVIGFC
                     NGQLGQMKTELDQRYGQDPATFVRAEVDLRLDPYAARDRAQEQEDHYKQWKRLNNWVE
                     NQKRIESILRTNSNRVLRQNCDQNADYLEDFWNFQHNHRT"
     gene            <553652..>555124
                     /gene="TDEL0C03080"
                     /locus_tag="TDEL_0C03080"
                     /db_xref="GeneID:11500532"
     mRNA            <553652..>555124
                     /gene="TDEL0C03080"
                     /locus_tag="TDEL_0C03080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680360.1"
                     /db_xref="GeneID:11500532"
     CDS             553652..555124
                     /gene="TDEL0C03080"
                     /locus_tag="TDEL_0C03080"
                     /inference="similar to DNA sequence:INSDC:YJR078W"
                     /note="similar to Saccharomyces cerevisiae BNA2 (YJR078W);
                     ancestral locus Anc_7.444"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680408.1"
                     /db_xref="GeneID:11500532"
                     /db_xref="GOA:G8ZRQ5"
                     /db_xref="InterPro:IPR000898"
                     /db_xref="UniProtKB/TrEMBL:G8ZRQ5"
                     /translation="MSNNIDLPTLEEYGLCQNGFLPKEMPVTKLLDEYYRQWEAVANN
                     LPSLLLSKKIRSVVDRLPVLKVKQELLEDEGQLRRAYSVLCFITNAYIWGFDEPCDTL
                     PDCIAKPLLIISEKLGLPPLATYASLVLWNYKPIVEDPELVDNIMDLSNLTTINTFTG
                     GMDETWFYIVSVMTEKIGSSCVTSGLQAIKAARNNDIDAVVSELKSIAEAIDNLGSVL
                     MKMEAMCDPHIFYFRIRPYLAGWKNMAEVGLPKGVRYGSEGEYKIFAGGSNAQSSLIQ
                     ALDILLSVEHFPMGKKGSEDRKTISANSNQNSFINDMRQYMPREHREFLKHLSLVSNI
                     RDFVLKSNNKKLTLAYDACLAMLKSFRDKHIQIVTRYVVLQAHKKTPGKSSGVLRSGL
                     SKTHGKKEQKGTGGTSLIPFLKQCRDETGSNAASDWGKKILSTAVLDVHENSSITGVR
                     KRQPVEDDGSNAKRTKQGLSGDWDVTHRDNEGATYPAGHW"
     gene            complement(<555243..>556940)
                     /gene="TDEL0C03090"
                     /locus_tag="TDEL_0C03090"
                     /db_xref="GeneID:11500533"
     mRNA            complement(<555243..>556940)
                     /gene="TDEL0C03090"
                     /locus_tag="TDEL_0C03090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680361.1"
                     /db_xref="GeneID:11500533"
     CDS             complement(555243..556940)
                     /gene="TDEL0C03090"
                     /locus_tag="TDEL_0C03090"
                     /inference="similar to DNA sequence:INSDC:YPR033C"
                     /note="similar to Saccharomyces cerevisiae HTS1 (YPR033C);
                     ancestral locus Anc_7.445"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680409.1"
                     /db_xref="GeneID:11500533"
                     /db_xref="GOA:G8ZRQ6"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004516"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR015807"
                     /db_xref="UniProtKB/TrEMBL:G8ZRQ6"
                     /translation="MKFFYCRCFEQSALNKRYDEPLRSFEDGSLMFIRAIRRPVNIKR
                     YFSKMSQIPDAPAAATAGSNKAKKSKLQVSLKTPKGTKDWADTDMVIREAVFSTLSSL
                     FKRHGGVTIDTPVFELREILAGKYGEDSKLIYDLKDQGGELCSLRYDLTVPFARFCAM
                     NNIQNIKRYHIAKVYRRDQPAMTKGRMREFYQCDFDIAGTYEPMVPDAECLSVAVEGL
                     TSLGIKDFKIKLNHRKILDGIFKVAGVKDEDVRKISSAVDKLDKSPWEAVKHEITVEK
                     GQSEETANKIGEYVKFNGSLKDIHAKLSEDSDITSNELAKQGLDDIALLINYVEALGI
                     DSYISFDLSLARGLDYYTGLIYEVVTEASAPPENAGELKKKAKTDEDASSYVGVGSIA
                     AGGRYDKLVSMFVEASGKKATQIPCVGISFGVERIFSLIKQRTESASLKPTATQVFVM
                     AFGGGKDWTGYLPERMKIAKQLWGAGIESEYVYKAKANPRKQFDAADKSGASLAVILG
                     KEEYLDGKLRVKRLGPEFADDDGEVVEAENIVKVVKDKLSQINEDGVDQVTRLIRGL"
     gene            complement(<557008..>558114)
                     /gene="TDEL0C03100"
                     /locus_tag="TDEL_0C03100"
                     /db_xref="GeneID:11500534"
     mRNA            complement(<557008..>558114)
                     /gene="TDEL0C03100"
                     /locus_tag="TDEL_0C03100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680362.1"
                     /db_xref="GeneID:11500534"
     CDS             complement(557008..558114)
                     /gene="TDEL0C03100"
                     /locus_tag="TDEL_0C03100"
                     /inference="similar to DNA sequence:INSDC:YJR080C"
                     /note="similar to Saccharomyces cerevisiae YJR080C;
                     ancestral locus Anc_7.446"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680410.1"
                     /db_xref="GeneID:11500534"
                     /db_xref="InterPro:IPR002838"
                     /db_xref="InterPro:IPR016031"
                     /db_xref="UniProtKB/TrEMBL:G8ZRQ7"
                     /translation="MLRTTRSISLLRPTVTSVVPTQAELTSSNVDSLFSDEVTDTTRV
                     RVLGQPPTLASLVVPPSIALYVRKGCLTSLHGSPSINMSYEWIGFWSNLLRYGTLKPA
                     IYHKLISTTKFDALVAPNFLSNRLGPRLGLSSSPFRTLCLLNLDGTSDWNVWGKNSIV
                     AFEGNTSLELRPPRLNLFRNPLFSSKYLVLKGRGNVLLSGSGSVYTIQLKDASDEIIL
                     RSEHLLALNGSTQLDINESITEQSLIPQEEVKKVVEPFREFDIKMFFQISRDLIATLW
                     NRSKSIYSYLKNGPTKFLKIKGPRTLLVQSSFNVYLPASNVNPGVTTAAKLTTQPSKD
                     YLNYVSVSNNGQVDFQSTADFQQSVDRIKSLVKK"
     gene            complement(<558173..>558496)
                     /gene="TDEL0C03110"
                     /locus_tag="TDEL_0C03110"
                     /db_xref="GeneID:11500535"
     mRNA            complement(<558173..>558496)
                     /gene="TDEL0C03110"
                     /locus_tag="TDEL_0C03110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680363.1"
                     /db_xref="GeneID:11500535"
     CDS             complement(558173..558496)
                     /gene="TDEL0C03110"
                     /locus_tag="TDEL_0C03110"
                     /inference="similar to DNA sequence:INSDC:YJR082C"
                     /note="similar to Saccharomyces cerevisiae EAF6 (YJR082C);
                     ancestral locus Anc_7.447"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680411.1"
                     /db_xref="GeneID:11500535"
                     /db_xref="InterPro:IPR015418"
                     /db_xref="UniProtKB/TrEMBL:G8ZRQ8"
                     /translation="MDAYEELKKGLKESLQQQRELEDEFDRLQQEIYDKETEYLSNKN
                     NNVTVAGSRTTYGGNIIKGFDGFHKTHHGDAQNHFHNDDRLFSLSSAIFVKQQHQDAL
                     QDHIE"
     gene            <558606..>559922
                     /gene="TDEL0C03120"
                     /locus_tag="TDEL_0C03120"
                     /db_xref="GeneID:11500536"
     mRNA            <558606..>559922
                     /gene="TDEL0C03120"
                     /locus_tag="TDEL_0C03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680364.1"
                     /db_xref="GeneID:11500536"
     CDS             558606..559922
                     /gene="TDEL0C03120"
                     /locus_tag="TDEL_0C03120"
                     /inference="similar to DNA sequence:INSDC:YPR034W"
                     /note="similar to Saccharomyces cerevisiae ARP7 (YPR034W);
                     ancestral locus Anc_7.448"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680412.1"
                     /db_xref="GeneID:11500536"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="UniProtKB/TrEMBL:G8ZRQ9"
                     /translation="MTMKKCVVIHNGSSSTVAGFSNMELPQSIISSSYVQKGNERVFG
                     TFAMLDECESKEECEVYTIMDKNGMPYNWEALEAQWRYLYEYELKVDPQELPLVISVP
                     ATHSEIDPQVVENYFDLALNKLQVPALQIVVEPLAVALAMGKSSALVIDVGARGTTVT
                     PIVDGTVVRSGVMKSRFGGDFLDYQVAKLLEEPLGSSSHEAWYNSATWIREFKSTMLQ
                     VCDKNLSELERYHRDQLLLQQQQQQQLGGAYHNYMTNPLTQKRNFLLKKNNKTVTLEL
                     RDCYRVCEYLFQPQLASPDYASRDGLGELLSRSIKKAAASVSAQGTPGGGQGASLVYN
                     RHQPQLQPEQPSTTTTTASSATTEQVYAQLLTNVVITGSTSLVAGFEPRIVSELAVRF
                     PQNKLATYANQIHLDRAVQGWIAMGAMAALPGWQLGQWHTRRELAG"
     gene            <560301..>561407
                     /gene="TDEL0C03130"
                     /locus_tag="TDEL_0C03130"
                     /db_xref="GeneID:11500537"
     mRNA            <560301..>561407
                     /gene="TDEL0C03130"
                     /locus_tag="TDEL_0C03130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680365.1"
                     /db_xref="GeneID:11500537"
     CDS             560301..561407
                     /gene="TDEL0C03130"
                     /locus_tag="TDEL_0C03130"
                     /inference="similar to DNA sequence:INSDC:YPR035W"
                     /note="similar to Saccharomyces cerevisiae GLN1 (YPR035W);
                     ancestral locus Anc_7.449"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680413.1"
                     /db_xref="GeneID:11500537"
                     /db_xref="GOA:G8ZRR0"
                     /db_xref="InterPro:IPR008146"
                     /db_xref="InterPro:IPR008147"
                     /db_xref="InterPro:IPR014746"
                     /db_xref="InterPro:IPR027302"
                     /db_xref="InterPro:IPR027303"
                     /db_xref="UniProtKB/TrEMBL:G8ZRR0"
                     /translation="MSGTEKTYILQKYLDLDQRGKIIAEYVWIDGTGNMRSKGRTLKK
                     AITALDQLPEWNFDGSSTNQAPGHDSDVYLKPVAFYPDPFRRGDNIIVLSECYNNDGT
                     PNKFNHRHEAAKLFAAHKGEEIWFGLEQEYTLFDEYDQVYAWPKGGYPAPQGPYYCGV
                     GTGKVHARDVIEAHYRACLYAGLEISGINAEVMPSQWEFQVGPCEGIEMGDQLWMARY
                     LLIRVAEEFAVKISLHPKPLKGDWNGAGCHTNVSTKDMRLPGGMKYIETAIERLSKRH
                     LEHIKLYGADNDLRLTGRHETASMTGFSSGVANRGASVRIPRSVAKEGYGYFEDRRPA
                     SNIDPYLVTGIMCETVCGSIDNADMTKEYEREFS"
     gene            <561569..>562978
                     /gene="TDEL0C03140"
                     /locus_tag="TDEL_0C03140"
                     /db_xref="GeneID:11500538"
     mRNA            <561569..>562978
                     /gene="TDEL0C03140"
                     /locus_tag="TDEL_0C03140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680366.1"
                     /db_xref="GeneID:11500538"
     CDS             561569..562978
                     /gene="TDEL0C03140"
                     /locus_tag="TDEL_0C03140"
                     /inference="similar to DNA sequence:INSDC:YPR036W"
                     /note="similar to Saccharomyces cerevisiae VMA13
                     (YPR036W); ancestral locus Anc_7.450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680414.1"
                     /db_xref="GeneID:11500538"
                     /db_xref="GOA:G8ZRR1"
                     /db_xref="InterPro:IPR004908"
                     /db_xref="InterPro:IPR011987"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZRR1"
                     /translation="MILLDSTHFNDIRSAIRSRPVAWDALARSAEISEMDASNAKTLE
                     STLIRHANEPSSSTEPGFKINDTTMMPLIHLLSTSNNADSKKSVQNLLAELLSSEQFA
                     HDTIQFFINHPEKVDQLFEVSLVGDRQTVMISSFNLVNLLIQPQLINKDLVASLVSSE
                     PFLNILNNLDLMDTSYVCVRLLQELAAVESYRSVIWQSHKSFLPTLFKVIAQALEPNS
                     VTRVVATNSNNLVIQLQYYSLLLIWLLTFDPKIASDLTQNYLQDFLNLLKLVKVTIKE
                     KISRLCISIILQCTSSNVKNNRAVIKNLLLLGNALPVLQSLSDRKYSDEELRQDMATL
                     KDVLEQEYKELTSFDEYLAELDSKLLCWSPSHVDNGFWSDNIDKFKSDNWKLFKTLVN
                     LLIETKDSGLNDRQHKIILEVALSDITHVVELLPESIDILGKMKGKIVIMELLNHPDS
                     RVKYEALKTTQAVIGYTSK"
     gene            complement(<562981..>563730)
                     /gene="TDEL0C03150"
                     /locus_tag="TDEL_0C03150"
                     /db_xref="GeneID:11500539"
     mRNA            complement(<562981..>563730)
                     /gene="TDEL0C03150"
                     /locus_tag="TDEL_0C03150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680367.1"
                     /db_xref="GeneID:11500539"
     CDS             complement(562981..563730)
                     /gene="TDEL0C03150"
                     /locus_tag="TDEL_0C03150"
                     /inference="similar to DNA sequence:INSDC:YJR083C"
                     /note="similar to Saccharomyces cerevisiae ACF4 (YJR083C);
                     ancestral locus Anc_7.451"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680415.1"
                     /db_xref="GeneID:11500539"
                     /db_xref="UniProtKB/TrEMBL:G8ZRR2"
                     /translation="MSRIVSNPVELHKLSIVDKQTGSRDVSPTRLAPAEQGNAPQSPR
                     RLGLQISLPIESSPVKDTESLELSPVSSHTTSRRQSAASEHDILFKLAAKEREIVELE
                     QKLHTARKELHLLESQYRSTVPTNSPSKNEVIQNWSKRVQRTLDDVNNSPNVIKSKKS
                     ISSFFNAEPQQPQSRGKGGFFQNLVDKFNEFSVAEDEEEEFDRTQNKQKDDFYLKEKL
                     DYDDDEEVVNEATGSTLLNVKDSKLKDIYRR"
     gene            <563858..>565081
                     /gene="TDEL0C03160"
                     /locus_tag="TDEL_0C03160"
                     /db_xref="GeneID:11500540"
     mRNA            <563858..>565081
                     /gene="TDEL0C03160"
                     /locus_tag="TDEL_0C03160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680368.1"
                     /db_xref="GeneID:11500540"
     CDS             563858..565081
                     /gene="TDEL0C03160"
                     /locus_tag="TDEL_0C03160"
                     /inference="similar to DNA sequence:INSDC:YJR084W"
                     /note="similar to Saccharomyces cerevisiae CSN12
                     (YJR084W); ancestral locus Anc_7.452"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680416.1"
                     /db_xref="GeneID:11500540"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="UniProtKB/TrEMBL:G8ZRR3"
                     /translation="MVTINLDAYFIHKRYDDGLLQFLKNDNYEEAHTYRLTMKNDGKL
                     DQLYNVTMDLKFASWVNDDKQKIFDLADEQLRLFNRIAEVETDWIVYPLYYVAHQYLQ
                     IARKIRVKDDKMDKNAYLERCGRAIHRSFNLCLNDRNPELHEDRKTGCYLLANLEFKL
                     YHLLGNRDMMKNLVKVLQSRGDEIPPLAQSLAALHSKHLVMFNYYMGEYYGCYESDFT
                     KGHSFLSEALLECATNICDKQIDKILILLIPFALLTTRQYPNVNVWQEKLTDNFVALK
                     VHEPIVSCLLNGDLKTYDTNFAKNEIFFLQNGLYVAMSLLRELVFLRLVKNCWKFTGM
                     PSVLQLQAVATAYSKSAQGYKKRKPAKADDLLLDELECQLANLIAKNLVKGYLSHANR
                     CLVLSKKLPFPSQST"
     gene            <565491..>565649
                     /gene="TDEL0C03170"
                     /locus_tag="TDEL_0C03170"
                     /db_xref="GeneID:11500541"
     mRNA            <565491..>565649
                     /gene="TDEL0C03170"
                     /locus_tag="TDEL_0C03170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680369.1"
                     /db_xref="GeneID:11500541"
     CDS             565491..565649
                     /gene="TDEL0C03170"
                     /locus_tag="TDEL_0C03170"
                     /inference="similar to DNA sequence:INSDC:YPR036W-A"
                     /note="similar to Saccharomyces cerevisiae YPR036W-A;
                     ancestral locus Anc_7.453"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680417.1"
                     /db_xref="GeneID:11500541"
                     /db_xref="UniProtKB/TrEMBL:G8ZRR4"
                     /translation="MAFLTLTSDIQQPFVIPNFSPVSPAASRKNSAASVETETQLPVG
                     RKGSISLL"
     gene            complement(<565807..>566124)
                     /gene="TDEL0C03180"
                     /locus_tag="TDEL_0C03180"
                     /db_xref="GeneID:11500542"
     mRNA            complement(<565807..>566124)
                     /gene="TDEL0C03180"
                     /locus_tag="TDEL_0C03180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680370.1"
                     /db_xref="GeneID:11500542"
     CDS             complement(565807..566124)
                     /gene="TDEL0C03180"
                     /locus_tag="TDEL_0C03180"
                     /inference="similar to DNA sequence:INSDC:YJR085C"
                     /note="similar to Saccharomyces cerevisiae YJR085C;
                     ancestral locus Anc_7.454"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680418.1"
                     /db_xref="GeneID:11500542"
                     /db_xref="GOA:G8ZRR5"
                     /db_xref="InterPro:IPR005349"
                     /db_xref="UniProtKB/TrEMBL:G8ZRR5"
                     /translation="MEHPAFTLGLLTAAGGFMGYARKGSVPSLVAGLVFGSVYGYAGY
                     LLHHNRDNGLEIALGASLVMLTTGVARGIPSRFRKPVPLTLTVLGSLGSFYYYNKYKE
                     FYP"
     gene            <566341..>566628
                     /gene="TDEL0C03190"
                     /locus_tag="TDEL_0C03190"
                     /db_xref="GeneID:11500543"
     mRNA            <566341..>566628
                     /gene="TDEL0C03190"
                     /locus_tag="TDEL_0C03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680371.1"
                     /db_xref="GeneID:11500543"
     CDS             566341..566628
                     /gene="TDEL0C03190"
                     /locus_tag="TDEL_0C03190"
                     /inference="similar to DNA sequence:INSDC:YJR086W"
                     /note="similar to Saccharomyces cerevisiae STE18
                     (YJR086W); ancestral locus Anc_7.455"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680419.1"
                     /db_xref="GeneID:11500543"
                     /db_xref="GOA:G8ZRR6"
                     /db_xref="InterPro:IPR015898"
                     /db_xref="UniProtKB/TrEMBL:G8ZRR6"
                     /translation="MSQELLSYKIKGLKLRRINELNDKLRDELGRERITASNACLAIS
                     NYVSTHRDYTLPEIWGYPPPGSNHFADATNKKRRSLQETGQSTSNACCTIM"
     gene            complement(<566646..>567236)
                     /gene="TDEL0C03200"
                     /locus_tag="TDEL_0C03200"
                     /db_xref="GeneID:11500544"
     mRNA            complement(<566646..>567236)
                     /gene="TDEL0C03200"
                     /locus_tag="TDEL_0C03200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680372.1"
                     /db_xref="GeneID:11500544"
     CDS             complement(566646..567236)
                     /gene="TDEL0C03200"
                     /locus_tag="TDEL_0C03200"
                     /inference="similar to DNA sequence:INSDC:YPR037C"
                     /note="similar to Saccharomyces cerevisiae ERV2 (YPR037C);
                     ancestral locus Anc_7.456"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680420.1"
                     /db_xref="GeneID:11500544"
                     /db_xref="GOA:G8ZRR7"
                     /db_xref="InterPro:IPR017905"
                     /db_xref="UniProtKB/TrEMBL:G8ZRR7"
                     /translation="MKRVNLKSGHITRIIAALTIVGLWWFFSSSDLSYNKPSIDLLPV
                     AQDEPKKATSNEKGTIMPSMPDKEAKEKLGRASWTYFHTLLARFPDEPTAEQSEKLKQ
                     FIELYAELYPCGECSYHFVKTLKRYPPQVSSRTAAALWGCSIHNIVNDYLGKEHYDCS
                     TILEDYDCGCGDDEGKIKDDLKLDKVSLFKEGKQGG"
     gene            <567362..>568450
                     /gene="TDEL0C03210"
                     /locus_tag="TDEL_0C03210"
                     /db_xref="GeneID:11500545"
     mRNA            <567362..>568450
                     /gene="TDEL0C03210"
                     /locus_tag="TDEL_0C03210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680373.1"
                     /db_xref="GeneID:11500545"
     CDS             567362..568450
                     /gene="TDEL0C03210"
                     /locus_tag="TDEL_0C03210"
                     /inference="similar to DNA sequence:INSDC:YPR040W"
                     /note="similar to Saccharomyces cerevisiae TIP41
                     (YPR040W); ancestral locus Anc_7.457"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680421.1"
                     /db_xref="GeneID:11500545"
                     /db_xref="InterPro:IPR007303"
                     /db_xref="UniProtKB/TrEMBL:G8ZRR8"
                     /translation="MADRRPLRGPGINTFQIDAARKVHARTVQARIPQAAASAASERF
                     ISPSPPTTSAVRRLVPRHVCNSPNNPPCASCGTMIVPSPAATLPLQDCPSMTINNWTI
                     STRKKPILNSQELEDWENNKLKGLTLPEMIFGNSYVRIENTLHGWTLEFNALDALKQV
                     KLADCGIRVSYSKKWMDSKQQKQAQRSSSPTEFEVDDSSLKIAHHYDWTYTTRYRGTE
                     ESKDQRYKFTRDDTQQLPLDKLSRPDHILFYDDMILFEDELADNGISILNVKIRVMDE
                     RLLLLNRFFLRVDDVLLRVIDTRVCVEFDENKVMREYKEMEGDYKSLLANHRISHSHD
                     PKAALRDSNWVAQHAPVVSREYETLNFD"
     gene            complement(<568507..>569373)
                     /gene="TDEL0C03220"
                     /locus_tag="TDEL_0C03220"
                     /db_xref="GeneID:11500546"
     mRNA            complement(<568507..>569373)
                     /gene="TDEL0C03220"
                     /locus_tag="TDEL_0C03220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680374.1"
                     /db_xref="GeneID:11500546"
     CDS             complement(568507..569373)
                     /gene="TDEL0C03220"
                     /locus_tag="TDEL_0C03220"
                     /inference="similar to DNA sequence:INSDC:YJR088C"
                     /note="similar to Saccharomyces cerevisiae YJR088C;
                     ancestral locus Anc_7.458"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680422.1"
                     /db_xref="GeneID:11500546"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G8ZRR9"
                     /translation="MGSIREKLLTIATTKLYTQLEPAELQSLYDELRSYTSSGDPNLS
                     QSTYLNLMEMLFYVNVYLSKDVEAEVIYNSFRDRFGEDSPNLYVMKATLLQINENDQA
                     AVDYIEKLIKDSLEYDTDSLSYLVLQKKLISVKARAHDNEWLVSQVCSLIEKFPLDPE
                     LYFYAGKLYDELGQFSRAAYCYEEVLLIMPFNYVAFGNLAESIYYKAIKTERSAKLNY
                     DTLQKSLNNALRSVELSENYLKGWSFVAMVSEKMGDKKELNTLARKRIEYIATTSNSK
                     NRATAELVLKNL"
     gene            <569645..>570874
                     /gene="TDEL0C03230"
                     /locus_tag="TDEL_0C03230"
                     /db_xref="GeneID:11500547"
     mRNA            <569645..>570874
                     /gene="TDEL0C03230"
                     /locus_tag="TDEL_0C03230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680375.1"
                     /db_xref="GeneID:11500547"
     CDS             569645..570874
                     /gene="TDEL0C03230"
                     /locus_tag="TDEL_0C03230"
                     /inference="similar to DNA sequence:INSDC:YPR041W"
                     /note="similar to Saccharomyces cerevisiae TIF5 (YPR041W);
                     ancestral locus Anc_7.459"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680423.1"
                     /db_xref="GeneID:11500547"
                     /db_xref="GOA:G8ZRS0"
                     /db_xref="InterPro:IPR002735"
                     /db_xref="InterPro:IPR003307"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016189"
                     /db_xref="InterPro:IPR016190"
                     /db_xref="UniProtKB/TrEMBL:G8ZRS0"
                     /translation="MSINICRDNHDPFYRYKMPPIQAKVEGRGNGIKTAVLNVADIAH
                     ALNRPAPYIVKYFGFELGAQTSISVDKDRYLVNGVHEPAKLQDVLDGFINKFVLCGSC
                     KNPETEIIITKDSDLVRDCKACGKRTPMDLRHKLSSFILKNPPDSVNGSKKKKKAATA
                     SANVRGGGLSISDIAQGKSQASNNSPNGTTEALVEDEDDDELARQINAAASSLEKIEM
                     KDDEWAVDMSEEAIRQRAKELQAAADNETGEMGKLEEFGEWILKEGGEDKENLPSDVE
                     IFKQAADLDVLQDPKIACVLAQCLFDENIVSQVTEHAAFFTKVFVSPEYERDFLGGIE
                     RFLGLERKDLIPLLPKILVQVYNNDIVSEEEIIKFGTKCSKKYVPKDVSKKVRRAAKP
                     FITWLQTAESDDDEDDE"
     gene            <571045..>573282
                     /gene="TDEL0C03240"
                     /locus_tag="TDEL_0C03240"
                     /db_xref="GeneID:11500548"
     mRNA            <571045..>573282
                     /gene="TDEL0C03240"
                     /locus_tag="TDEL_0C03240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680376.1"
                     /db_xref="GeneID:11500548"
     CDS             571045..573282
                     /gene="TDEL0C03240"
                     /locus_tag="TDEL_0C03240"
                     /inference="similar to DNA sequence:INSDC:YJR089W"
                     /note="similar to Saccharomyces cerevisiae BIR1 (YJR089W);
                     ancestral locus Anc_7.460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680424.1"
                     /db_xref="GeneID:11500548"
                     /db_xref="InterPro:IPR001370"
                     /db_xref="UniProtKB/TrEMBL:G8ZRS1"
                     /translation="MDIGRSNGNGDVSVMYNLGARIRSFQTTSIVDGKKFRWRYTVIP
                     YQGMARLGFFFHPFQSSKNDKEIYKDAVQCICCKNITYNFGDCRSKKKDIVETMISVL
                     RQHLKNNECILSELKLKVLEDHLNEFSNENWSDHLTFGDPMSQKMLDFRESTFLMNWD
                     PPSDSLLPACMSQAGLLRYDSSYTGFEELMENDAQDACYCVYCKRIVGSWQPNDDPLL
                     EHYRSSNGGMCYFFDKMRSDSTYNEVISELETTFACLTNDHDSNESNIEPHEQVDSPL
                     ISQEADAISRDEELAKDHDLAHADERPSSIAQMKEESISRKQTNKDEIQDNGPPSPER
                     SPARKKRILRRLSTRKYFDDRDGDTTYDSEHSFREEKDLVIEFKERTKKARDIGRTNK
                     ILDDSNDEFSFSAQGHSAFEIPTFNSILPSNNISERNEITDERVEKSLSDQSSVQGSP
                     KEKTVHPDERNLKLDDIPIDAVLSSDSSLDSNAASSPSRELLTNLKEEKSDHSATELR
                     HLRPLQDARSTNFVIDDLDDELSASRSVLRDTHENITSLDTGTPLPSRSVLNGSGSPN
                     YDQKQESIRKQITQDEKSSVNHSPLDQSPINQSPIHQSSLEGLKNTETPRLVPPEKKK
                     DDQRLLHTTEEKSENSELDRRLVKEYFHDLLVYINKNDATLRNDRDGELAFFIKQMPR
                     SELDMTFTDWLNEKLKKVKDDFLEESRVKLDVLKRDFERACDTVNSLNNEEALLKIAA
                     NLGIS"
     gene            complement(<573410..>576646)
                     /gene="TDEL0C03250"
                     /locus_tag="TDEL_0C03250"
                     /db_xref="GeneID:11500549"
     mRNA            complement(<573410..>576646)
                     /gene="TDEL0C03250"
                     /locus_tag="TDEL_0C03250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680377.1"
                     /db_xref="GeneID:11500549"
     CDS             complement(573410..576646)
                     /gene="TDEL0C03250"
                     /locus_tag="TDEL_0C03250"
                     /inference="similar to DNA sequence:INSDC:YJR090C"
                     /note="similar to Saccharomyces cerevisiae GRR1 (YJR090C);
                     ancestral locus Anc_7.461"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680425.1"
                     /db_xref="GeneID:11500549"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR026940"
                     /db_xref="UniProtKB/TrEMBL:G8ZRS2"
                     /translation="MVDNQDSEVPEEMPGGLPASWFTNPVPSRESLNHQGRDILAREH
                     RQRVSRIAQNEVALRDIFRFNIHRSNAQSNGQEGHSGSLAEAQTNPNNNESLLVDTRV
                     NMLSGVPGSSSLQSNDLAKLYAFQSTLQQKVQAYLDVIERRRNGILDEIGMDNSKLDK
                     MQQSDSPQVASFLNKLQRVRLRAIETETMELQTLRMKFLTVVEEYRKAMNEYCKAKME
                     GKQVQNPTDYFQNWVDSLDPVETSMSKGLQELLPGSRSITNSILALTSKAGGPSTFNV
                     FPLNHLPSEILHLILEKLSHNSEIVNLLTVCKLWAQIIVKILYYRPHINKRSQMELFM
                     RTMTLDSHETIFIYRSMIKRLNFSFVGDHMHDQELYNFVGCQNLERLTLVFCKNVTSK
                     SISAVLQGCKYLQSVDITGIREISDNIFDTLAESCPRVQGFYVPQAKNVTSRALHNFI
                     THAPMLKRVKITANNNMDDNLINLFAEKCPMLVEVDVTLSPNVHDFSLLKLFTKLTQL
                     REFRITHNTNITDKLFLELSQKVKQLPALRLLDLSGCENITDKTIERVVELAPKLRNV
                     FLGKCSRITDYSLHHLARLGKNLQTVHFGHCFNISDQGVRVLVQSCPRIQYVDFACCT
                     NLTNRTLYELSDLTKLKRIGLVKCSQMTDEGLLNMISLRGRNDGLERVHLSYCSNLTI
                     YPIYELLMACPRLSHLSLTAVPSFLRPDITAFCRTAPSDFSDNQRQIFCVFSGKGVHK
                     LRHYLMSLTTPTSGPQTDLHEVLTKYIVSKNMLQQGENLEDGINRITSDLNQDSAAIL
                     AATGLSQMNGVNNDFLFQNIDFDRLEDVFNWYETPPRGLSSEELATLWSQVDQKFCED
                     PFDEEYDGLDNVVAPGANSNLNNELCYIVRKLHELDDRANDFEVNVASLARVQFQFTG
                     FLLHEMAQIYMQMVELNRQISQIQSRVYESNVEADIKGLSVWRLLFIEKFVELLQKYK
                     LSTVVLRLYLKDSITLLTRQRELLLAHQRTSWNANNDNENSDDPAIWRQFENNMQMTP
                     DQMRIIQFGLRGPPIVGEAGLRPLVDANNNAIDERSETPDDETILEDA"
     gene            complement(<577094..>580288)
                     /gene="TDEL0C03260"
                     /locus_tag="TDEL_0C03260"
                     /db_xref="GeneID:11500550"
     mRNA            complement(<577094..>580288)
                     /gene="TDEL0C03260"
                     /locus_tag="TDEL_0C03260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680378.1"
                     /db_xref="GeneID:11500550"
     CDS             complement(577094..580288)
                     /gene="TDEL0C03260"
                     /locus_tag="TDEL_0C03260"
                     /inference="similar to DNA sequence:INSDC:YJR091C,YPR042C"
                     /note="similar to Saccharomyces cerevisiae JSN1 (YJR091C)
                     and PUF2 (YPR042C); ancestral locus Anc_7.462"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680426.1"
                     /db_xref="GeneID:11500550"
                     /db_xref="GOA:G8ZRS3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZRS3"
                     /translation="MSDRKIPKHELLGGNGDTLSKIPEVIDPGITIPIYEEDVGTGTG
                     TGSNIDDQPQKLGSYRARAGKFSNTLSNLLPSISAKLHHSRKGTHGKAPDDDVTTSNN
                     SSESTVGSKNTHSTPAKGKDFIQSFGGISLNGAESLTPPHELEKLVHFPDSNFLINQP
                     RTSSDSFTFGTSNLPHPISRTRNNTMNSQFTSISSIPANAGSSSAIWSSNQSPNDQMQ
                     QHLFHQFNGNTNNNTNNINNNISINGSSPLQEYSTNTAYFDATIPTSNSKNLGVPNSM
                     WSQGTAGGRPRSQSNTSSIYTDASLYEPAGRSRAPSIYTLSQPQAPQQQESPLIEDDV
                     DPRSINWVTTDHLVPIINQISNLLPTNTISISNVFSLQQQQPQLINAVNLTSASLATL
                     CSKYGNVISARTLKGLNMALVEFDTVESAIRAFEMLQGKEVSVIGAPSSVSFAKVLPM
                     HQQPPQVVVSPGAPNNAIGSDVPQPLLQEQLFNGQVNFQQKGNVSVPMFNHQQQESQP
                     QQVHVASNFNHSYGHVSQNEKEQCPFSLPPPSLNEQVGTLKEILQSFETPFDETQTDH
                     LINNALKHNGTSETSDFGPLPDPLTNRDFDAPKLRELRKSIDANQMSDLEIEQLAMAM
                     LDELPELSSDYLGNTIVQKLFTHSSDIIKDIMLRKTSKYLTSMGVHKNGTWACQKMIT
                     MARTPRQIMLVTKGVEKYCTPLFNDQFGNYVIQCVLKFGFPWNSFIFESIMANFWTIT
                     QNRYGARAVRACLEAHDIITQEETLVIGAMIVLYAEYLATNSNGTLLVSWFLDTSQLR
                     HRHAILAPKLFSQIVELCRHRLASLTVLKVLNYRGDDTVRKEMLDRIFGDTSSDEPAP
                     ALRQILCDTNHGPTFVYKVLTMSLLEGELRNHVIKQVRQVLLDTTPSQLHRRLMEEVG
                     LSPASAQQNSNLKHRSSISQVFSQDSTHLRGLSVSSVRSNGSRHSGLVPTTSAGQASI
                     PTSSTATNNNMQWNVGYMNYPGMFPGFGSNGYSVNADELPSQFDMLSLNNGTHVSLPQ
                     LSLTNQNNTTNVMYPAKNNASQDAHLNGQGMYGQ"
     gene            <581846..>585901
                     /gene="TDEL0C03270"
                     /locus_tag="TDEL_0C03270"
                     /db_xref="GeneID:11500551"
     mRNA            <581846..>585901
                     /gene="TDEL0C03270"
                     /locus_tag="TDEL_0C03270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680379.1"
                     /db_xref="GeneID:11500551"
     CDS             581846..585901
                     /gene="TDEL0C03270"
                     /locus_tag="TDEL_0C03270"
                     /inference="similar to DNA sequence:INSDC:YJR092W"
                     /note="similar to Saccharomyces cerevisiae BUD4 (YJR092W);
                     ancestral locus Anc_7.463"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680427.1"
                     /db_xref="GeneID:11500551"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR012966"
                     /db_xref="UniProtKB/TrEMBL:G8ZRS4"
                     /translation="MTSNAVADETMDSLLKEIDDEMENTISTENKSSTDRSGESQKTR
                     SWSIPLQDIGDETMDMIVSHNTISNIMVRNEDQGDEHGEAGTVEPLAPSRKSVVFSEG
                     VNFHEYQDVSDQGEDEQDSNELTTSWKKSSFVAAKPVEVNQSLIVEAHTDSEDEKDHE
                     QPVITTHDLLQHTVTDLDEKLSHMLDKKRNVQRLKLMTEELEEKELESEEKEKASPIK
                     FTLQPTKPLIPSIGNSIEETSLIHFQSMENLAGADDEIEDDDSCSEYMNEVQHSPSKI
                     PLVNTVNINKFSITNQGREPQTRISSGSSCCDSISDLKTTIQHDSYRLLDDKVSGNGD
                     DSDCKFYDDGKPLENEVMVTSHPNTSRIFSVATSAEGYKSAKETVRSPDSVYSNQEME
                     SPPTVKLLEAPVNDLHIKAELMGDEDTTQDEEQGSHKDDDIISDSGSVIERSMHKGQY
                     PPEIPQLPVLTSSHSASKEKSLEADSEEDNQSEIGFTDLHDVASSVKDVDQEKPEKVE
                     ISSVDKSEKSIEIPRSHDSAQTVTSKSLQTNVEGLNPLSSQDDFVTTTSRSSSIAEHA
                     NETAGANISSGGKESKNERKFSILPPFAPVGSIFLDDPFVDDFETSGESIDLTKSVKP
                     SNYLSIWHMQEEDIRATSPAISSNSQFSRCTDSTNTSASVNSNLEHNFKFKPRVISRS
                     KYYYPESRQASCDVEDSYVISNFETALDPLRRNTIISRRIQENIKSRRKLYPSMKEID
                     ENDAESLDDKEIVTGPAEEHTVVDDVAEERNQEIEKQPDHDFSAFQLDLLPCLPDAKL
                     KDEFMSYLEAVSHDNRSILNHSEIETGKYNVWDHQSEFEVPTGDVKKTISMDVINKLL
                     EEENHTPEPVAEESVSLQPPVNLAILKTPVKEVSVGRGLSLKGYDALVSTDVGSERHS
                     ALFVSPSRGEDGQSPVKKTHVDSPFKVKHKKPAQHDSEKPDTDFKGLAIQSFEPEEKQ
                     KVVLPESVHAIESDEQKSLSNEEQVDQSLPDRGNLYLRLNNVANILIHGITHHKAQFA
                     IEFDNGKDVVQTAWDTLANDKKWEINQEFEVILDNDLDKIPKLIITLKCRYESPKNEL
                     KEIVERVPVGRKFPFGKSKYQYQKRFVQTAPKKDEWDYLFARDGSFGRCEIPINKDFL
                     KEIKFQSKPLSFTLINEWARKSDSNSTKKIHELPRRPPYAIGTLNIEACHLERTSPFE
                     KLPKTLAIAHNIISKYRAQQAITKEGFLLQEGGDVEGSIQRRFFKLQGNNMLGYHEMS
                     RQAKVDINLLKVVNVFGPGDVPKEGERNLTDLVLFSGCFHLVFDNGERIAFSTESAEE
                     EAEWFNKIKDVVDLNRCHQPWVKYFNQNYLI"
     gene            complement(<585965..>586798)
                     /gene="TDEL0C03280"
                     /locus_tag="TDEL_0C03280"
                     /db_xref="GeneID:11500552"
     mRNA            complement(<585965..>586798)
                     /gene="TDEL0C03280"
                     /locus_tag="TDEL_0C03280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680380.1"
                     /db_xref="GeneID:11500552"
     CDS             complement(585965..586798)
                     /gene="TDEL0C03280"
                     /locus_tag="TDEL_0C03280"
                     /inference="similar to DNA sequence:INSDC:YJR093C"
                     /note="similar to Saccharomyces cerevisiae FIP1 (YJR093C);
                     ancestral locus Anc_7.464"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680428.1"
                     /db_xref="GeneID:11500552"
                     /db_xref="InterPro:IPR007854"
                     /db_xref="UniProtKB/TrEMBL:G8ZRS5"
                     /translation="MSSSDEDDKFLYGSDTEQAEVGSKRVSQDNDGALSKRQKVSNEN
                     TEKDSSSDSSQGEDNDSESSESESDSDVEFIISTGTDSTRLDSATASGATATAAQPSG
                     ITLATAPVETPAQVTEDGTPLTKTDASLVPPSGTIDLEAEGMYEGQPVTSLDPEVLKE
                     KPWRQPGANLSDYFNYGFNEFTWMEYLHKQEKLQQEYNPHKILMGILTLQQQGNLNGP
                     KTMANSGDINNSGGIKSNTPINQHVPSHPMMAPGFPPLPMFGGFPFPGMMPPMNQQQK
                     K"
     gene            complement(<587270..>588031)
                     /gene="TDEL0C03290"
                     /locus_tag="TDEL_0C03290"
                     /db_xref="GeneID:11500553"
     mRNA            complement(<587270..>588031)
                     /gene="TDEL0C03290"
                     /locus_tag="TDEL_0C03290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680381.1"
                     /db_xref="GeneID:11500553"
     CDS             complement(587270..588031)
                     /gene="TDEL0C03290"
                     /locus_tag="TDEL_0C03290"
                     /inference="similar to DNA sequence:INSDC:YJR094C"
                     /note="similar to Saccharomyces cerevisiae IME1 (YJR094C);
                     ancestral locus Anc_7.465"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680429.1"
                     /db_xref="GeneID:11500553"
                     /db_xref="UniProtKB/TrEMBL:G8ZRS6"
                     /translation="MISDSITLNSLFISAQGRDDDDVSINSTDIYDCYLQPDNYDDTY
                     EDLEDLEDDTFFESSQLHQLVQTQPVQLINEQDLIDRLPQPQELVVEEASNGISPMMT
                     SRSSSMSSTFSKRNSLYGNVPESIDEEMGLECDGSMVERKVQPLFSAFNSIYNNTAQY
                     EDYSAPRSFAIHESALDLGAEVNHYAISDSYHYSIHKSSNTRYATDEEIEFVKNLNSK
                     LSRYSGYFTAGSKDQEYSDKVRFQEISYKFSKTYV"
     gene            <588850..>589281
                     /gene="TDEL0C03300"
                     /locus_tag="TDEL_0C03300"
                     /db_xref="GeneID:11500554"
     mRNA            join(<588850..588851,589026..>589281)
                     /gene="TDEL0C03300"
                     /locus_tag="TDEL_0C03300"
                     /product="60S ribosomal protein L43"
                     /transcript_id="XM_003680382.1"
                     /db_xref="GeneID:11500554"
     CDS             join(588850..588851,589026..589281)
                     /gene="TDEL0C03300"
                     /locus_tag="TDEL_0C03300"
                     /inference="similar to DNA
                     sequence:INSDC:YJR094W-A,YPR043W"
                     /note="similar to Saccharomyces cerevisiae RPL43B
                     (YJR094W-A) and RPL43A (YPR043W); ancestral locus
                     Anc_7.466"
                     /codon_start=1
                     /product="60S ribosomal protein L43"
                     /protein_id="XP_003680430.1"
                     /db_xref="GeneID:11500554"
                     /db_xref="GOA:G8ZRS7"
                     /db_xref="InterPro:IPR002674"
                     /db_xref="InterPro:IPR011331"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:G8ZRS7"
                     /translation="MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGK
                     KAVKRGAAGIWTCASCRRPLLVVLTLSPPLLPLLSDLPSED"
     gene            <589960..>590919
                     /gene="TDEL0C03310"
                     /locus_tag="TDEL_0C03310"
                     /db_xref="GeneID:11500555"
     mRNA            <589960..>590919
                     /gene="TDEL0C03310"
                     /locus_tag="TDEL_0C03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680383.1"
                     /db_xref="GeneID:11500555"
     CDS             589960..590919
                     /gene="TDEL0C03310"
                     /locus_tag="TDEL_0C03310"
                     /inference="similar to DNA sequence:INSDC:YJR095W"
                     /note="similar to Saccharomyces cerevisiae SFC1 (YJR095W);
                     ancestral locus Anc_7.467"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680431.1"
                     /db_xref="GeneID:11500555"
                     /db_xref="GOA:G8ZRS8"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8ZRS8"
                     /translation="MSQKKKSSNPAVNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRA
                     ASGEIKPPGFITTGKTIYTQEGFIALYKGLGAVVIGIIPKMAIRFSSYEFYRTLVADK
                     QTGIVSTGNTFLAGVGAGITEAVLVVNPMEVVKIRLQAQHLNPTAPGVAPKYKNAVHA
                     CYTIVKEEGISALYRGVSLTAARQATNQGANFTIYSKLKEYLQDYHGTEVLPSWETSC
                     IGLISGAIGPFSNAPLDTIKTRLQKDSCTSKDSGWTRIAKIGAQLVKEEGFRALYKGI
                     TPRVMRVAPGQAVTFTVYEFARRHLDNLGIFNRKKADPPKPLK"
     gene            <591171..>592022
                     /gene="TDEL0C03320"
                     /locus_tag="TDEL_0C03320"
                     /db_xref="GeneID:11500556"
     mRNA            <591171..>592022
                     /gene="TDEL0C03320"
                     /locus_tag="TDEL_0C03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680384.1"
                     /db_xref="GeneID:11500556"
     CDS             591171..592022
                     /gene="TDEL0C03320"
                     /locus_tag="TDEL_0C03320"
                     /inference="similar to DNA sequence:INSDC:YJR096W"
                     /note="similar to Saccharomyces cerevisiae YJR096W;
                     ancestral locus Anc_7.468"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680432.1"
                     /db_xref="GeneID:11500556"
                     /db_xref="GOA:G8ZRS9"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:G8ZRS9"
                     /translation="MSVPKFYTLSNGVKIPSLALGTYDLPKSTTANIVYEALKCGYRH
                     FDTAVLYNNERKVGEGIYQWLQEDPKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQ
                     KVEKLGYIDLLLIHSPLSGSRKRLETYKAMQEAVDEGIVKSIGVSNYGQHHLEELLSW
                     EGLKYKPVVNQIEISPWCMRQELAQWCQSQGIVVEDYAPLTHGYKLKDPQLVKVAEEV
                     GKNTGQVLIRWSLQHGYLPLPKTSNVDRLPGNLDVYDFKLTESQIKAFEHPEAHEPTD
                     WECTDAP"
     gene            <592158..>592871
                     /gene="TDEL0C03330"
                     /locus_tag="TDEL_0C03330"
                     /db_xref="GeneID:11500557"
     mRNA            <592158..>592871
                     /gene="TDEL0C03330"
                     /locus_tag="TDEL_0C03330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680385.1"
                     /db_xref="GeneID:11500557"
     CDS             592158..592871
                     /gene="TDEL0C03330"
                     /locus_tag="TDEL_0C03330"
                     /inference="similar to DNA sequence:INSDC:YJR099W"
                     /note="similar to Saccharomyces cerevisiae YUH1 (YJR099W);
                     ancestral locus Anc_7.470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680433.1"
                     /db_xref="GeneID:11500557"
                     /db_xref="GOA:G8ZRT0"
                     /db_xref="InterPro:IPR001578"
                     /db_xref="UniProtKB/TrEMBL:G8ZRT0"
                     /translation="MSTQRSVIPLESNPEVFTQFAHNLGLDESHEFVDIYSLTDPDLL
                     GFVPRPVKALILLFPLNEVFESEKNLRTDDNTELKTNDGNQPVWFKQTIRNACGLYGI
                     LHSLANNDELLKTDSPLLNFLKSNQRDNGQYADEITDDFVVSLSEDNAERFRQGQTQA
                     PENGEVDLHFITFVEHNGKIYELDGRRPTGAKLLGVTQDKDLLGQSLVSDRVQWYMDN
                     ADEESKLNFSLLGLAQPWN"
     gene            complement(<592923..>594503)
                     /gene="TDEL0C03340"
                     /locus_tag="TDEL_0C03340"
                     /db_xref="GeneID:11500558"
     mRNA            complement(<592923..>594503)
                     /gene="TDEL0C03340"
                     /locus_tag="TDEL_0C03340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680386.1"
                     /db_xref="GeneID:11500558"
     CDS             complement(592923..594503)
                     /gene="TDEL0C03340"
                     /locus_tag="TDEL_0C03340"
                     /inference="similar to DNA sequence:INSDC:YPR045C"
                     /note="similar to Saccharomyces cerevisiae YPR045C;
                     ancestral locus Anc_7.471"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680434.1"
                     /db_xref="GeneID:11500558"
                     /db_xref="InterPro:IPR005062"
                     /db_xref="UniProtKB/TrEMBL:G8ZRT1"
                     /translation="MDATYNKVNPVSLGQNRKNRDAKKRKKESTVSKGGKIPMPPAFP
                     PPSAPPVPPPSQFLPSQLPGVLAPSGAGISSFQEPLQPWKSNMEGSLPNNGLPGVPTM
                     SPFFFNNGMNFHPNDSGLPVVPKPEKSGTISPNPSFFPYLNNTSSMPQTGLHGVWNGL
                     NQATRSTPKSSLGNDGRKRKSSKTKNHRMINVETNSMSSVEEIERRRKRAERFNSSQN
                     SRSSTALDDEENFANLNAISTKSHKYDKNKRIVGRCQSLEKSYLRLTSEPNPDLVRPL
                     NVLKKTYSMLMKKHQKRQASYQYLCDQFKSMRQDLRVQMIENQFAVKVYESHARIALE
                     NGDIGEFNQCQSRLITLFELPSIKPSCLEEFTSYRVLYYMLTEDNGSINTLRLKLMTE
                     NQAVFNNALVQTAFTLAHARLMGNYHQFMRMYSAMKSLGKKLVDAFIEKEKLKSLVVI
                     CKSYNQINLDFLIKELQFKDGGEMTEFFRRTNIQKYVIIKNPGETNEFQYLDTRACRL
                     PILQQYFHSKKIDIKGQQ"
     gene            complement(<594741..>595748)
                     /gene="TDEL0C03350"
                     /locus_tag="TDEL_0C03350"
                     /db_xref="GeneID:11500559"
     mRNA            complement(<594741..>595748)
                     /gene="TDEL0C03350"
                     /locus_tag="TDEL_0C03350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680387.1"
                     /db_xref="GeneID:11500559"
     CDS             complement(594741..595748)
                     /gene="TDEL0C03350"
                     /locus_tag="TDEL_0C03350"
                     /inference="similar to DNA sequence:INSDC:YJR100C"
                     /note="similar to Saccharomyces cerevisiae YJR100C;
                     ancestral locus Anc_7.472"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680435.1"
                     /db_xref="GeneID:11500559"
                     /db_xref="InterPro:IPR005552"
                     /db_xref="UniProtKB/TrEMBL:G8ZRT2"
                     /translation="MQIMLRRLYSSTAKVARNGPFRRLRQRGDGIQGARTALASDILG
                     SQVETTFIQPHHPVATTILNEPTIVIERQLEMMNVFLGFEQANKYAIMDVLGNRIGYM
                     QERDFSIGKAILRQIYKLHRPFTVDVFDNWGNVIMTIRRPFSWINSHIKAFLPPITTV
                     EQDYVKQSSTLEKEVHSSSPFGNVPQPQYIDDSQGEGILVGESIQNWHLWRRRYELFQ
                     RDLGSEGSFSEYGQIDAPFLSFEFPVMDANGKIMAGVDRNWVGLGREFFTDTGVYVIR
                     FDSKQSFENVYPPDLLSDSVLDLDQRAVLLANAVSIDYDYFSRHSRHSGGLLSFGSYD
                     E"
     gene            596346..596443
                     /gene="TDEL0Ctrna9L"
                     /locus_tag="TDEL_0Ctrna9L"
                     /db_xref="GeneID:11500521"
     tRNA            join(596346..596384,596399..596443)
                     /gene="TDEL0Ctrna9L"
                     /locus_tag="TDEL_0Ctrna9L"
                     /product="tRNA-Leu"
                     /note="codon recognized: CUA"
                     /db_xref="GeneID:11500521"
     gene            <596591..>597364
                     /gene="TDEL0C03360"
                     /locus_tag="TDEL_0C03360"
                     /db_xref="GeneID:11502027"
     mRNA            <596591..>597364
                     /gene="TDEL0C03360"
                     /locus_tag="TDEL_0C03360"
                     /product="mitochondrial 37S ribosomal protein RSM26"
                     /transcript_id="XM_003680388.1"
                     /db_xref="GeneID:11502027"
     CDS             596591..597364
                     /gene="TDEL0C03360"
                     /locus_tag="TDEL_0C03360"
                     /inference="similar to DNA sequence:INSDC:YJR101W"
                     /note="similar to Saccharomyces cerevisiae RSM26
                     (YJR101W); ancestral locus Anc_7.473"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM26"
                     /protein_id="XP_003680436.1"
                     /db_xref="GeneID:11502027"
                     /db_xref="GOA:G8ZRT3"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019831"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="UniProtKB/TrEMBL:G8ZRT3"
                     /translation="MFRSIVTKRGVHTVPRLPQASHLSRQGVPNVLSVGGFKVLWDQH
                     QKYLCDKLTLATTGTSMESYLPFHLLLNTAKKASQSHIFNLASAAHNNHLFVENIVPT
                     FTSTSTQPSRLFLTCVEESFGLDWEALKKEMVRRAEQDVLGQGWLFLVENSDKELHIL
                     TIQNNGTPYYFPRNQLFDLNCALTLEEFAQLEEIKKLVVEQGDKKVKDWTVPLVCVSL
                     WDQAYLHDYGVQGRSKYVENVLNNLNWGVVNNRLYSDSL"
     gene            complement(<597430..>597999)
                     /gene="TDEL0C03370"
                     /locus_tag="TDEL_0C03370"
                     /db_xref="GeneID:11500561"
     mRNA            complement(<597430..>597999)
                     /gene="TDEL0C03370"
                     /locus_tag="TDEL_0C03370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680389.1"
                     /db_xref="GeneID:11500561"
     CDS             complement(597430..597999)
                     /gene="TDEL0C03370"
                     /locus_tag="TDEL_0C03370"
                     /inference="similar to DNA sequence:INSDC:YJR102C"
                     /note="similar to Saccharomyces cerevisiae VPS25
                     (YJR102C); ancestral locus Anc_7.474"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680437.1"
                     /db_xref="GeneID:11500561"
                     /db_xref="InterPro:IPR008570"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014041"
                     /db_xref="UniProtKB/TrEMBL:G8ZRT4"
                     /translation="MTDPSTVLPAIYSFPPLYTRQPNAIIRRQQIASWIDLVLAYCKS
                     QNFWCMTLEGVPVDEYNKSRISIFINSEIQRSVPQVFVEEIWSKMCEEGKAMGTETGR
                     KDSSQYYVLWRTLDSWASLVLQWFENSGKLNQVVTIYELAQGDETADWEFHGMPEPLL
                     AHCIKPLCQRNRATLIKDERGKPVATKVV"
     gene            <598092..>598652
                     /gene="TDEL0C03380"
                     /locus_tag="TDEL_0C03380"
                     /db_xref="GeneID:11500562"
     mRNA            <598092..>598652
                     /gene="TDEL0C03380"
                     /locus_tag="TDEL_0C03380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680390.1"
                     /db_xref="GeneID:11500562"
     CDS             598092..598652
                     /gene="TDEL0C03380"
                     /locus_tag="TDEL_0C03380"
                     /inference="similar to DNA sequence:INSDC:YPR046W"
                     /note="similar to Saccharomyces cerevisiae MCM16
                     (YPR046W); ancestral locus Anc_7.475"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680438.1"
                     /db_xref="GeneID:11500562"
                     /db_xref="UniProtKB/TrEMBL:G8ZRT5"
                     /translation="MERVQELEREHVQLYGELLKALDKLYQLQRGHGRIRDKDAESTL
                     ATRRQLQMSIEKSAAMIRTLERLLKYEGNPDMGLTTTEDLLALRLGKLMQENYEMDYD
                     VAEFMKREDKVRQELREERLQYSRLTTRLRELSDKINSQKDTPDESDKIKSIPTLGRS
                     EIIDQNERIEELLIALKIHGGYDPML"
     gene            <599123..>600853
                     /gene="TDEL0C03390"
                     /locus_tag="TDEL_0C03390"
                     /db_xref="GeneID:11500563"
     mRNA            <599123..>600853
                     /gene="TDEL0C03390"
                     /locus_tag="TDEL_0C03390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680391.1"
                     /db_xref="GeneID:11500563"
     CDS             599123..600853
                     /gene="TDEL0C03390"
                     /locus_tag="TDEL_0C03390"
                     /inference="similar to DNA sequence:INSDC:YBL039C,YJR103W"
                     /note="similar to Saccharomyces cerevisiae URA7 (YBL039C)
                     and URA8 (YJR103W); ancestral locus Anc_7.476"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680439.1"
                     /db_xref="GeneID:11500563"
                     /db_xref="GOA:G8ZRT6"
                     /db_xref="InterPro:IPR004468"
                     /db_xref="InterPro:IPR017456"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:G8ZRT6"
                     /translation="MKYVVVSGGVISGIGKGVLASSTGMLFKTLGLKVTSIKIDPYMN
                     IDAGTMSPLEHGECFVLDDGGETDLDLGNYERYLKVTLTKDHNITTGKIYSHVISRER
                     KGDYLGKTVQIVPHLTNAIQDWIERVARIPVDDTGLEPDICIIELGGTVGDIESAPFV
                     EALRQFQFRVGKENFALIHVSLVPVIHGEQKTKPTQAAIKDLRSLGLTPDMIACRCTE
                     ALDEPTINKIAMFCHVGPDQVVNVYDVKSTYHIPLLLLEQKMMDYLHKRLQLGDIQLA
                     AEDRQRGEQLLEKWTSMTKNFEASDKLVKIALVGKYTNLKDSYLSVIKALEHSSMKCR
                     THLEILWVEASDLEPESQEVDKAKFHEAWNKVSTADGILVPGGFGSRGTEGMILAAKW
                     ARESNVPYLGICLGLQIATIEFARNVMGLKNGNSAEFFPDLAEEDQVVVYMPEIDKEK
                     MGGTMRLGLRPTFFQDSTEWSKIKKLYGDKASILERHRHRYEINPKLVSELEDKGLVF
                     VGKDETNERCEIFELKNHDYFVATQYHPEYTSKVLDPSRPFVGLIAAAAGIMDPVLAG
                     EYEFHGKADF"
     gene            complement(<600910..>601374)
                     /gene="TDEL0C03400"
                     /locus_tag="TDEL_0C03400"
                     /db_xref="GeneID:11500564"
     mRNA            complement(<600910..>601374)
                     /gene="TDEL0C03400"
                     /locus_tag="TDEL_0C03400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680392.1"
                     /db_xref="GeneID:11500564"
     CDS             complement(600910..601374)
                     /gene="TDEL0C03400"
                     /locus_tag="TDEL_0C03400"
                     /inference="similar to DNA sequence:INSDC:YJR104C"
                     /note="similar to Saccharomyces cerevisiae SOD1 (YJR104C);
                     ancestral locus Anc_7.477"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680440.1"
                     /db_xref="GeneID:11500564"
                     /db_xref="GOA:G8ZRT7"
                     /db_xref="InterPro:IPR001424"
                     /db_xref="InterPro:IPR018152"
                     /db_xref="UniProtKB/TrEMBL:G8ZRT7"
                     /translation="MVKAVALLKGDAGVSGTVYFEQKSESEPTTVSWEISGNDANAER
                     GFHIHEFGDNTNGCTSAGPHFNPTGKTHGAREAEVRHVGDLGNLKTDGKGVAKGSLQD
                     SLIKLTGPTSILGRTVVIHAGQDDLGKGGVEESLKTGNAGGRNACGVIGITK"
     gene            complement(<601598..>601783)
                     /gene="TDEL0C03410"
                     /locus_tag="TDEL_0C03410"
                     /db_xref="GeneID:11500565"
     mRNA            complement(<601598..>601783)
                     /gene="TDEL0C03410"
                     /locus_tag="TDEL_0C03410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680393.1"
                     /db_xref="GeneID:11500565"
     CDS             complement(601598..601783)
                     /gene="TDEL0C03410"
                     /locus_tag="TDEL_0C03410"
                     /inference="similar to DNA sequence:INSDC:YBL039W-B"
                     /note="similar to Saccharomyces cerevisiae YBL039W-B;
                     ancestral locus Anc_7.478"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680441.1"
                     /db_xref="GeneID:11500565"
                     /db_xref="UniProtKB/TrEMBL:G8ZRT8"
                     /translation="MAFFYDNPVIEFFHKVVRKPSTILMWLFTSVIVGSTAYLIVFLP
                     GPSSTDHDTDKDPDEPR"
     gene            <601902..>602945
                     /gene="TDEL0C03420"
                     /locus_tag="TDEL_0C03420"
                     /db_xref="GeneID:11500566"
     mRNA            <601902..>602945
                     /gene="TDEL0C03420"
                     /locus_tag="TDEL_0C03420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680394.1"
                     /db_xref="GeneID:11500566"
     CDS             601902..602945
                     /gene="TDEL0C03420"
                     /locus_tag="TDEL_0C03420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680442.1"
                     /db_xref="GeneID:11500566"
                     /db_xref="GOA:G8ZRT9"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:G8ZRT9"
                     /translation="MIWRWFWWFAVIGMVIGEEFGSTRELYESLMVSELYTFVYVYSH
                     GCHSQEVGPEFEQLAQLMLGEDGQPLVGFASIDGHKSRNFARQFNVESFPQLLLFKPQ
                     KEPAQTLLDLLGDVYHGGKSSVDMAKYLWQQTGHLPRWPKSEDSVLELDSLNTLQKHA
                     STFNSYWSRSFTVNSSGELMQQVILIAFLTPWTRTKYQDMFLGGMPNSLVDKLSAKYG
                     SQLKLLRLDSSQENMASVVNEFRVSTEPSIFLLFQEDSRDSRMALLELLPYDSQTWDH
                     EAQLVSQLVDTAVGRNFSQLQQLSRDYHSIYLYDSLQQRQQKIQDDWDQSLVDQIGNF
                     TDADTILSSIWGM"
     gene            <603057..>603710
                     /gene="TDEL0C03430"
                     /locus_tag="TDEL_0C03430"
                     /db_xref="GeneID:11500567"
     mRNA            <603057..>603710
                     /gene="TDEL0C03430"
                     /locus_tag="TDEL_0C03430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680395.1"
                     /db_xref="GeneID:11500567"
     CDS             603057..603710
                     /gene="TDEL0C03430"
                     /locus_tag="TDEL_0C03430"
                     /inference="similar to DNA sequence:INSDC:YBL040C"
                     /note="similar to Saccharomyces cerevisiae ERD2 (YBL040C);
                     ancestral locus Anc_7.479"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680443.1"
                     /db_xref="GeneID:11500567"
                     /db_xref="GOA:G8ZRU0"
                     /db_xref="InterPro:IPR000133"
                     /db_xref="UniProtKB/TrEMBL:G8ZRU0"
                     /translation="MNLFRIVADLSHLASILILIHTIKTTNSIDGISFKSQVLYVLVF
                     ASRYLDLFFRWISLYNTLMKLFFIGSSIYIIMLLQNAKNTVAYKEMILKDTFKVRYIL
                     AASGVLALLFNERFTVIDILWSFSLWLESIAILPQLFMLSKTRKAPSLTIHYIFALGL
                     YRALYIPNWLWRWLMEDNKGFQKLPFVTGFIQTLVYSDFFYIYYQRVIKGDRTRLPH"
     gene            complement(<603757..>604482)
                     /gene="TDEL0C03440"
                     /locus_tag="TDEL_0C03440"
                     /db_xref="GeneID:11500568"
     mRNA            complement(<603757..>604482)
                     /gene="TDEL0C03440"
                     /locus_tag="TDEL_0C03440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680396.1"
                     /db_xref="GeneID:11500568"
     CDS             complement(603757..604482)
                     /gene="TDEL0C03440"
                     /locus_tag="TDEL_0C03440"
                     /inference="similar to DNA sequence:INSDC:YBL041W"
                     /note="similar to Saccharomyces cerevisiae PRE7 (YBL041W);
                     ancestral locus Anc_7.480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680444.1"
                     /db_xref="GeneID:11500568"
                     /db_xref="GOA:G8ZRU1"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8ZRU1"
                     /translation="MTTIASEYSNEVAHTPIQHQFNPYTDNGGTILGIAGEDFAVLAG
                     DTRHTTDYSINSRHESKVFDCGDNIVMSANGFAADGEALVKRFKNSVKWYHFDHNDKK
                     LSLSSAARNIQHLLYGKRFFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGA
                     AASLIMPFLDNQVNFKNQFEPGTNGKVRRPQTYLSIEEVIKLVRDAFTSATERHIQVG
                     DGLEILIVTKDGVRKEFYELKRD"
     gene            <605100..>606917
                     /gene="TDEL0C03450"
                     /locus_tag="TDEL_0C03450"
                     /db_xref="GeneID:11500569"
     mRNA            <605100..>606917
                     /gene="TDEL0C03450"
                     /locus_tag="TDEL_0C03450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680397.1"
                     /db_xref="GeneID:11500569"
     CDS             605100..606917
                     /gene="TDEL0C03450"
                     /locus_tag="TDEL_0C03450"
                     /inference="similar to DNA sequence:INSDC:YBL042C"
                     /note="similar to Saccharomyces cerevisiae FUI1 (YBL042C);
                     ancestral locus Anc_7.481"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680445.1"
                     /db_xref="GeneID:11500569"
                     /db_xref="GOA:G8ZRU2"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="UniProtKB/TrEMBL:G8ZRU2"
                     /translation="MEAHYNDEDEFVKIQDNESKTKAFSLTTETNSLDGGDSGVAKKT
                     ITEEDRSFWQKFIDLIEVKHPDGFGESKSKSVVEAYVYNGELTPVEAARRKWTWKQYV
                     FFWMSGTFNVNTWQISATGLQLGLNWWQTWICIWVGYFFVAVFVVLASRVGNMYHLSF
                     PSSCRIAFGTYFSIWVVLNRVVMACVWYSTQAYLGGICVQLILRSIFGNNLNSRWHDT
                     IPSVNLTPYELVCFIIFWIISLPFLWYPPHKLRHIFAIKSAVTPIAAFALLVWSVRKC
                     GGNLSLGSLNGNSTMGSAATAWAVIRSIMSAMDNFSTLILNAPDFSRFGKTPVSSMWS
                     QFIALPLCFAVISLLGIICVSAAYTLYGVNYWSPLDILSRYLDGYSAGDRAGVCIISF
                     SFLFDQLGANLSSNAIPAGTDMTALLPKFITIRRGSYICAAISLAICPWNLLASSSKF
                     TSALSAYAVFLSAIAGVIFADYYILRKGYVDIFHCYTNKPGSYYMYNRYGTNWRAVVA
                     YVVGIVPNFPGFIGSVGPKVPEGAMKVYYLNYFVGYLVSAITYLILAYFFPMSGTPEG
                     VKMSDRVWLERWVEVEDFPYEREQFERNWNTQQEHSKSA"
     gene            complement(<607022..>607507)
                     /gene="TDEL0C03460"
                     /locus_tag="TDEL_0C03460"
                     /db_xref="GeneID:11500570"
     mRNA            complement(<607022..>607507)
                     /gene="TDEL0C03460"
                     /locus_tag="TDEL_0C03460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680398.1"
                     /db_xref="GeneID:11500570"
     CDS             complement(607022..607507)
                     /gene="TDEL0C03460"
                     /locus_tag="TDEL_0C03460"
                     /inference="similar to DNA sequence:INSDC:YBL043W,YJR115W"
                     /note="similar to Saccharomyces cerevisiae ECM13 (YBL043W)
                     and YJR115W; ancestral locus Anc_7.483"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680446.1"
                     /db_xref="GeneID:11500570"
                     /db_xref="UniProtKB/TrEMBL:G8ZRU3"
                     /translation="MNATLGQQYLLASKARGKLERCAQCGKNKDYNLRVLVGHANLLD
                     RLLSGIDKYRGKAAQRAEECSVEYISSEDDFDEQCREFPSSSSASDSSSSDYESDEED
                     EYDEALRYTPLSLCGNQGQPPVVAIASEQLCDDYESDSESDVEHQTMAPLEFHCEPIH
                     A"
     gene            <608195..>609544
                     /gene="TDEL0C03470"
                     /locus_tag="TDEL_0C03470"
                     /db_xref="GeneID:11500571"
     mRNA            <608195..>609544
                     /gene="TDEL0C03470"
                     /locus_tag="TDEL_0C03470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680399.1"
                     /db_xref="GeneID:11500571"
     CDS             608195..609544
                     /gene="TDEL0C03470"
                     /locus_tag="TDEL_0C03470"
                     /inference="similar to DNA sequence:INSDC:YBL045C"
                     /note="similar to Saccharomyces cerevisiae COR1 (YBL045C);
                     ancestral locus Anc_7.484"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680447.1"
                     /db_xref="GeneID:11500571"
                     /db_xref="GOA:G8ZRU4"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:G8ZRU4"
                     /translation="MLRTTSIRSSSHLLRRSIATQAAPKAEVTALSNGIVVATKHNPH
                     SLTSSVGVVFGSGSTAENPYNNGVSNVWSNVFTGKQTAAEAAKKGFSLSSTVGRDFQS
                     YIVDSKPGSASSALEFLQSKFSAPLNDSIFEETKNSVLSQVSNFEHNDHAGRVMEHLH
                     STAFQNTPLSLPTRGTVESIETLVPSDLQSFASNHFLASNAVVVGSGNISHQELVKAA
                     ESQISLKSGAKPVQKKQSSFLGSEVRLRDDTLPKAWISIAAEGEKITSPHYMTSLLAA
                     QVFGSYNASEPASRLQGVKLLDILQEYQITDSFDHFSLGYKDSGLWGFTTTTSAVGSI
                     DDLIHFTLKQWNRLTISVTDTEIARAKALLKLKLASAATDNASVATHLGAATLAQVEK
                     TDLAEAYAAIDALTAKDVKQWAGDKLWDQDIAIAGVGQIEGLLDYMRIRADMSMMRW"
     gene            complement(<609711..>610733)
                     /gene="TDEL0C03480"
                     /locus_tag="TDEL_0C03480"
                     /db_xref="GeneID:11500572"
     mRNA            complement(<609711..>610733)
                     /gene="TDEL0C03480"
                     /locus_tag="TDEL_0C03480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680400.1"
                     /db_xref="GeneID:11500572"
     CDS             complement(609711..610733)
                     /gene="TDEL0C03480"
                     /locus_tag="TDEL_0C03480"
                     /inference="similar to DNA sequence:INSDC:YBL046W"
                     /note="similar to Saccharomyces cerevisiae PSY4 (YBL046W);
                     ancestral locus Anc_7.485"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680448.1"
                     /db_xref="GeneID:11500572"
                     /db_xref="InterPro:IPR015267"
                     /db_xref="UniProtKB/TrEMBL:G8ZRU5"
                     /translation="MTTITVSGQQAVSDVDTNMMGIRSKSLFEILKRIVVHGEFDVLN
                     ESEPDEVLGEIIEHITVSIPEGIFRTKENDGNKEFGRLKGELIALGDYLRDQFQIKEV
                     YPFTIVRICELCYDPFKYFKVYELGKFVSAMTSCCLVKTSWSSTGASIKATKNQTNFS
                     NGESDQEDVSLTKIPWIDEETEKELVPFIKEIDSIMGANLGFEDGDEDENMDVEINDL
                     EGRNESEDFIIEGYYEDAPGGDGDSDDDDDDYVEGAQSEEDDDDSEDEEDRATSNGKR
                     KPTEVDDYEYIEKTRRNTRVTTPKKLKAQSTEEQRPDVQMSSLEQQVSILISPEGQKQ
                     DAQGNI"
     STS             610840..610925
                     /standard_name="Gli3"
                     /db_xref="UniSTS:525612"
     gene            <610982..>611764
                     /gene="TDEL0C03490"
                     /locus_tag="TDEL_0C03490"
                     /db_xref="GeneID:11500573"
     mRNA            <610982..>611764
                     /gene="TDEL0C03490"
                     /locus_tag="TDEL_0C03490"
                     /product="mitochondrial 37S ribosomal protein RSM7"
                     /transcript_id="XM_003680401.1"
                     /db_xref="GeneID:11500573"
     CDS             610982..611764
                     /gene="TDEL0C03490"
                     /locus_tag="TDEL_0C03490"
                     /inference="similar to DNA sequence:INSDC:YJR113C"
                     /note="similar to Saccharomyces cerevisiae RSM7 (YJR113C);
                     ancestral locus Anc_7.486"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM7"
                     /protein_id="XP_003680449.1"
                     /db_xref="GeneID:11500573"
                     /db_xref="GOA:G8ZRU6"
                     /db_xref="InterPro:IPR000235"
                     /db_xref="InterPro:IPR020606"
                     /db_xref="InterPro:IPR023798"
                     /db_xref="UniProtKB/TrEMBL:G8ZRU6"
                     /translation="MFKLGRSSLQRPVATVARMSRSSGAVVPRMMTISMRLQSTESKP
                     QESNEFSDEKIDEWLEAIKSLRAEFSEQEFLPETSLAPPGQTRIDIIGDVMAASKKFE
                     PTKQQMEEWERLKDVPIPQRKDPILQHVTNMVMRHGKKQRAEKILSRALYLVFCQTRQ
                     DPVEVLKKALDELAPLMMVRTFNTGVAKAAVIPVPLNQRQRNRIAWKWIVEGADKRAS
                     SDFAVRLGEELISVYKGNSSGYDKRDQIHKTAIAHRSYIRLK"
     gene            complement(<611815..>612105)
                     /gene="TDEL0C03500"
                     /locus_tag="TDEL_0C03500"
                     /db_xref="GeneID:11500574"
     mRNA            complement(<611815..>612105)
                     /gene="TDEL0C03500"
                     /locus_tag="TDEL_0C03500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680402.1"
                     /db_xref="GeneID:11500574"
     CDS             complement(611815..612105)
                     /gene="TDEL0C03500"
                     /locus_tag="TDEL_0C03500"
                     /inference="similar to DNA sequence:INSDC:YJR112W-A"
                     /note="similar to Saccharomyces cerevisiae YJR112W-A;
                     ancestral locus Anc_7.487"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680450.1"
                     /db_xref="GeneID:11500574"
                     /db_xref="InterPro:IPR006976"
                     /db_xref="UniProtKB/TrEMBL:G8ZRU7"
                     /translation="MAFLVESWLFVRMLACRRIEICLRRRIYDMDNGRTWEFTSIDKY
                     VVAVVVCLFSAVGSEFLQSFLSHGRRTFDLMDMAYNVVGSIVGILIAFWQER"
     gene            <612431..>616339
                     /gene="TDEL0C03510"
                     /locus_tag="TDEL_0C03510"
                     /db_xref="GeneID:11500575"
     mRNA            <612431..>616339
                     /gene="TDEL0C03510"
                     /locus_tag="TDEL_0C03510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680403.1"
                     /db_xref="GeneID:11500575"
     CDS             612431..616339
                     /gene="TDEL0C03510"
                     /locus_tag="TDEL_0C03510"
                     /inference="similar to DNA sequence:INSDC:YBL047C"
                     /note="similar to Saccharomyces cerevisiae EDE1 (YBL047C);
                     ancestral locus Anc_7.488"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680451.1"
                     /db_xref="GeneID:11500575"
                     /db_xref="GOA:G8ZRU8"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:G8ZRU8"
                     /translation="MSSITFQTPLTPEENNLFREQFRRLDDEELGIVTGEAVKPLFAA
                     SGLQAQTLSQVWALVDVNNNGFLSFDEFGAALRVIGHLQQYPSLAITSDLYAHPSAKL
                     PVLNGSQVGIQRASSQTSAPIPVLAPQSLSKYSQLYDRAANGALTLPGDKAKDIFLKA
                     RLPTSTLGEVWALCDRNASGSLDKTEFVMAMHLIQLCMTNSPSVNPLPSTLPSQLWNS
                     IGASVAATVAPLSANSTGRSSLGRRSTISRLSSGVFTSASTDWSLSMEKKQQFDAIFD
                     SLDKARTGSLSSQVLVPFFLSSKLNQDTLASIWDLADIHNNAEFTKLEFAIAMFLIQK
                     KNAGVELPDVVPDQLLHSPALGLYQQQQQPQLAVPSRETKPSFQDQVQPQIPQNSNNG
                     SLNDLMALNSSFASPSPQPPIRHSSSNFGRDTGYTAAPASHSARNVPGQVDWSSPNVI
                     REDEEERTMQGQYQVQSQQPQQQQMQPQAQPVQYQQVQQTHAPSVPQTVSKSVSPNAA
                     HQTSNLSQVPNFASIGLSGASAAAGMVGAVGGSGHRNNDLYADAEASSQLSSATTEMA
                     NLSNQVNSLSKQATITNEKKARATQELKRVNEMKAAIEGKLATLRSTHEQNVKETETL
                     EAQLAEANKESEGLNQQLAVIEGNYHATESKVRDLTDELQQAQQKNAQLKEQISSLNS
                     NSAALQSRLAERQQHVKQERSLVDVNSRQLEVSQITVANFESEIQGLGEKLSVYLSKR
                     KELDDYQKTVEEQHSQLQTKYQALETGNADLKAREEELENRNKQVEEQEKLYEQHVNR
                     LQNMFVDLSKRKESLDKAEEDLEKQHIEYANKVQDLSERQMKLAMGELPSDSKEIISK
                     NTASNANREEDVSKFVDDSVANSKLGNATNEDEERTESEVFDKDVPTNGSQTEADDES
                     EAARHINEAERAENLADRFEGDLNEYGIPRSQSLTSSVANNPPQSVMDDTGLPQKLDE
                     SAGARTNDRDLTTAATQIPGHWEEPATSTAGTAQPTSSPEASSKTEAEPLSNDKAHFA
                     NKNVSQHTSSLVASGTAPSFEQVVPKSNNDTNEVFPPIKNLHIDDSTSSSSSSEDEFQ
                     DTREEAVAGVEKKKGFATTVGEDHPSKSNQQQTIATPSAPTAKDEFDDAFTGLEQAAD
                     EEGQDLADDHQNSGSMEAFEKIDHGDLDEELQHNAFTGTLTSDTGAPAGGPHDVSDNV
                     SNDEWDEIFAGFGNAKVPVTNTNTGASTDIPVQQPVPLTQNFNSTSSPVNRKIATTPR
                     SLAIEELSGMGFTEQEALGALEKTIGIWKQLPISCWTVLK"
     gene            complement(<616468..>617076)
                     /gene="TDEL0C03520"
                     /locus_tag="TDEL_0C03520"
                     /db_xref="GeneID:11500576"
     mRNA            complement(<616468..>617076)
                     /gene="TDEL0C03520"
                     /locus_tag="TDEL_0C03520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680404.1"
                     /db_xref="GeneID:11500576"
     CDS             complement(616468..617076)
                     /gene="TDEL0C03520"
                     /locus_tag="TDEL_0C03520"
                     /inference="similar to DNA sequence:INSDC:YJR112W"
                     /note="similar to Saccharomyces cerevisiae NNF1 (YJR112W);
                     ancestral locus Anc_7.489"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680452.1"
                     /db_xref="GeneID:11500576"
                     /db_xref="InterPro:IPR007128"
                     /db_xref="InterPro:IPR016851"
                     /db_xref="UniProtKB/TrEMBL:G8ZRU9"
                     /translation="MTNDQKIRYLRLKQVFNKALNQSISKLESWEKVSSCFPRYSNTR
                     DGSSNLVTCQRQVIEFWTELCKREFDEILVERNVKEKLDELDDLVSEAKERLRLSNQR
                     GDIMKDSTPIDELSSEKLIQGNLYKERIIATQQLDDRLANIKEINVNMQQELNELVAE
                     LDNEQVELTKLYDKYLGTAIEQPLDETLVQGLNDMLLELRNL"
     gene            <617230..>618063
                     /gene="TDEL0C03530"
                     /locus_tag="TDEL_0C03530"
                     /db_xref="GeneID:11500577"
     mRNA            <617230..>618063
                     /gene="TDEL0C03530"
                     /locus_tag="TDEL_0C03530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680405.1"
                     /db_xref="GeneID:11500577"
     CDS             617230..618063
                     /gene="TDEL0C03530"
                     /locus_tag="TDEL_0C03530"
                     /inference="similar to DNA sequence:INSDC:YJR111C"
                     /note="similar to Saccharomyces cerevisiae YJR111C;
                     ancestral locus Anc_7.490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680453.1"
                     /db_xref="GeneID:11500577"
                     /db_xref="GOA:G8ZRV0"
                     /db_xref="InterPro:IPR003779"
                     /db_xref="InterPro:IPR029032"
                     /db_xref="UniProtKB/TrEMBL:G8ZRV0"
                     /translation="MNSLLSAQRLVHLAQFHPKLRNIWYLLAAVTFSVCNQPQEIPKV
                     YHYAMMLNSDVEKKDLNRLAEKTIDLLRKEATQLRSSIDETYPRPTPFQRQLTERFRE
                     AFVKSGPLGGLPKAINVLTTLKEVTPTVLIPSTKELDPFQAAAGNQPCYLNVGRACES
                     AEQTTKRGIEHWNHVYSKVSKRVVNNLNSTYPDLWYYTLAHVYGPLLSYDEILSAQET
                     SLIIIASLVPQDVNPQLRGHLKGAVNMGCDQETVEAARNLAVIVSQWCGVSWKSGVVK
                     L"
     gene            complement(<618215..>620227)
                     /gene="TDEL0C03540"
                     /locus_tag="TDEL_0C03540"
                     /db_xref="GeneID:11500578"
     mRNA            complement(<618215..>620227)
                     /gene="TDEL0C03540"
                     /locus_tag="TDEL_0C03540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680406.1"
                     /db_xref="GeneID:11500578"
     CDS             complement(618215..620227)
                     /gene="TDEL0C03540"
                     /locus_tag="TDEL_0C03540"
                     /inference="similar to DNA sequence:INSDC:YJR110W"
                     /note="similar to Saccharomyces cerevisiae YMR1 (YJR110W);
                     ancestral locus Anc_7.491"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680454.1"
                     /db_xref="GeneID:11500578"
                     /db_xref="GOA:G8ZRV1"
                     /db_xref="InterPro:IPR010569"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G8ZRV1"
                     /translation="MEYIKIAKVDDVLLHRRGAVTRGTLHLTTHHLIFTSDALSREFW
                     VSYSTIASVFKNHGSALISRIDQHKEFMSQDANYKDLYKGKDLWSFINIKIIGKDYTV
                     FSIDLSNEIEARDVFDSLLKLTVLKDISLSYAFIYSPSSAESQFNSWQIYDTMVEFKR
                     QGLDLTSSECGWRLSNLNNDYKFCPTYPSKLVVPSEISDTLLMHASKYRSQGRIPVLT
                     YYYKKTKCSITRAAQPLPGIIKQRSIQDERLVAEIFKTSGKGNNGLLQQKNIVVDARP
                     TANAMAQAALGGGSENMDNYNFNKTCSRVFLGIDNIHVMSDTLSYMVDHFLVDGDLNL
                     PIDKASLNAGKSFSWIKHVRLLLSSTDTLVKSIIFNRSNLLVHCSDGWDRTAQICSLV
                     QICLDPYFRTMEGFMVLVEKDWLSFGHKFQERSGLLSSESVFHDNTMGFSGLSNSSAD
                     VNSSTTLFGKDGNELSEMDSIVNMTSSTVLNSDIVNKVSEHFKKRKKNKNSLKFSSPI
                     FQQFLDCIYQLLTQNPTLFEFNERFLRRLVYHVYSCQYGTFLYNNEKDRLEFEVDKKT
                     RSVWDYFRSRKSEFIERDYVPCQATGEEDENEVTWILPDLHKVEWWWQLYGRRPEEMN
                     GPSAVPSCDSMGAELNALKTDVPERNTSKSAGIKFPKFGLELFGKR"
     gene            complement(<620849..>621325)
                     /gene="TDEL0C03550"
                     /locus_tag="TDEL_0C03550"
                     /db_xref="GeneID:11500579"
     mRNA            complement(<620849..>621325)
                     /gene="TDEL0C03550"
                     /locus_tag="TDEL_0C03550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680407.1"
                     /db_xref="GeneID:11500579"
     CDS             complement(620849..621325)
                     /gene="TDEL0C03550"
                     /locus_tag="TDEL_0C03550"
                     /inference="similar to DNA sequence:INSDC:YBL049W"
                     /note="similar to Saccharomyces cerevisiae MOH1 (YBL049W);
                     ancestral locus Anc_7.492"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680455.1"
                     /db_xref="GeneID:11500579"
                     /db_xref="InterPro:IPR004910"
                     /db_xref="UniProtKB/TrEMBL:G8ZRV2"
                     /translation="MGLRYSSYIECPAAKLEGDNWNSSDTSCLSLYHQASEPRHSQYH
                     IGYHSRHGSDSSTPKFVTYGCRRCRTHLSSSTQIMSKDYRGKTGDAFLMTRVVNVIEG
                     SVETRPMITGDYLVCDILCHWCKSLLGWKYLESERKDQRYKEGKYILEVKTICRCD"
     gene            complement(<622010..>622950)
                     /gene="TDEL0C03560"
                     /locus_tag="TDEL_0C03560"
                     /db_xref="GeneID:11500580"
     mRNA            complement(join(<622010..622858,622921..>622950))
                     /gene="TDEL0C03560"
                     /locus_tag="TDEL_0C03560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680408.1"
                     /db_xref="GeneID:11500580"
     CDS             complement(join(622010..622858,622921..622950))
                     /gene="TDEL0C03560"
                     /locus_tag="TDEL_0C03560"
                     /inference="similar to DNA sequence:INSDC:YBL050W"
                     /note="similar to Saccharomyces cerevisiae SEC17
                     (YBL050W); ancestral locus Anc_7.493"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680456.1"
                     /db_xref="GeneID:11500580"
                     /db_xref="GOA:G8ZRV3"
                     /db_xref="InterPro:IPR000744"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G8ZRV3"
                     /translation="MSDPVELIQRAEKKGVPSSGIKKFFGGSDSMKFEEAADLCVQAA
                     NVYRLRKELKNAGDAFVKAADYQIQAGSEDEAGNTFVEAYKSYKSSGQASEAVESLNK
                     AIEIFTTKGQFRRGANFKFEMGELLENDLNDYGKAIDAYETAGEWYSQDQALALANKC
                     LVRCADLKALNGQYLEACDVYAKLIKNSIGNRLSQWSLKDYFFKMGLCQLAATDSVAA
                     SRTLQEGKREDSNFAESREAQLLQDLIACIAEGDGEQLSEKVLNFDRFNKLDKWKTTI
                     LLKVKETIAQADDDLL"
     gene            <623664..>627005
                     /gene="TDEL0C03570"
                     /locus_tag="TDEL_0C03570"
                     /db_xref="GeneID:11500581"
     mRNA            <623664..>627005
                     /gene="TDEL0C03570"
                     /locus_tag="TDEL_0C03570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680409.1"
                     /db_xref="GeneID:11500581"
     CDS             623664..627005
                     /gene="TDEL0C03570"
                     /locus_tag="TDEL_0C03570"
                     /inference="similar to DNA sequence:INSDC:YJR109C"
                     /note="similar to Saccharomyces cerevisiae CPA2 (YJR109C);
                     ancestral locus Anc_7.494"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680457.1"
                     /db_xref="GeneID:11500581"
                     /db_xref="GOA:G8ZRV4"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005480"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005483"
                     /db_xref="InterPro:IPR006275"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:G8ZRV4"
                     /translation="MSTIYSSTEPTISTFNSPHYNPQLVEGVESVLIVGSGGLAIGQA
                     GEFDYSGSQAIKALKEANKQTILINPNIATNQTSHSLADKIYYIPVTPEYITYVIERE
                     RPDAILLTFGGQTALNCGVALDRMGVLQKYNIKVLGTPIRTLELTEDRELFAQALQEI
                     NIPIANSIACETLDEALSAADEVGYPIIVRSAYALGGLGSGFANNAKELKELASQSLS
                     LAPQILVEKSLKGWKEVEYEVVRDRVGNCITVCNMENLDPLGVHTGDSIVFAPSQTLS
                     DEEYHMLRSAAIKIIRHLGVIGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATG
                     YPLAYTAAKIGLGYTLPELPNPITKTTVANFEPSLDYIVAKVPKWDLSKFQYVNREIG
                     SAMKSVGEVMAIGRNFEEAYQKALRQVDPSLLGFQGSDEFGDKLDEALSVATDRRALA
                     VGQALLHENYTVERVHELTHIDSWFLHKCMNIVNMYKKLEAVNSLEALDKQLLQDAKK
                     KGFSDKQIALSINKNSDANVHELDVRKVRKSFGIIPFVKRIDTLAAEFPANTNYLYTT
                     YNATKNDVEFTDKGMLVLGSGVYRIGSSVEFDWCAVNTAKTLRGEGKKTVMINYNPET
                     VSTDFDEVDRLYFEELSFERVMDIYELENSEGCVISVGGQLPQNIALKLHENGCNTLG
                     TSPVDIDSAENRHKFSSILDSINVGQPEWSELTSVSEAKKFANKVSYPVLIRPSYVLS
                     GAAMNVIHNEDELEDKLTLASAVSPDHPVVMSKFIEGAEEIDVDAVAYKGEVLVHAIS
                     EHVENAGVHSGDATLILPPQHLSEKIKKELKEIADKVAHAWKITGPFNMQIIKDGEDL
                     KVIECNIRASRSFPFVSKVLGVNFIEIAVRAFLGGEKVPKPVDLMSKKYDYVATKCPQ
                     FSFTRLAGADPFLGVEMASTGEVASFGKDEIESYWTAMQSTMNFHVPLPPNGILFGGD
                     LNKPFLGEVISTISSLGFNFYVANEAAKQYLEKYTKDPVSVIEFPKNDKRGLREVFQK
                     YDIKLVFNLASKRADHTLDEDYVMRRNAIDFAIPLFNEPQTSKLFARALKANIAEKIR
                     VLDSKDVVVPSEVRSWEEFVGFKPV"
     gene            <627672..>629264
                     /gene="TDEL0C03580"
                     /locus_tag="TDEL_0C03580"
                     /db_xref="GeneID:11500582"
     mRNA            <627672..>629264
                     /gene="TDEL0C03580"
                     /locus_tag="TDEL_0C03580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680410.1"
                     /db_xref="GeneID:11500582"
     CDS             627672..629264
                     /gene="TDEL0C03580"
                     /locus_tag="TDEL_0C03580"
                     /inference="similar to DNA sequence:INSDC:YJL153C"
                     /note="similar to Saccharomyces cerevisiae INO1 (YJL153C);
                     ancestral locus Anc_1.195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680458.1"
                     /db_xref="GeneID:11500582"
                     /db_xref="GOA:G8ZRV5"
                     /db_xref="InterPro:IPR002587"
                     /db_xref="InterPro:IPR013021"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZRV5"
                     /translation="MTVQRYFSPTINVANDKTHYSETKLTTQYRYVNSVVAKSEVDGT
                     LEVRPTAQDYEFQVDLKIPKIGVMLVGLGGNNGTTLVASVLANRDKIRFHTKDGAKEA
                     NYYGSVTQSSTIKLGIDEQGNDVYVPFNSVLPFVSPNDFVVGGWDINGANLGDAMARS
                     QVLEYDLQQQLRGEMAKTVPLPSIYYPDFIAANQDERADNCINRDGKSGNVSTKGKWS
                     HVEQIRKDIKNFKSGNDLDKVIVLWTANTERYADVLSNVNDNADNLLAAIKNDHEEIA
                     PSTIFAVASILEGVPYINGSPQNTFVPGVIDLAEKHNALIAGDDFKSGQTKIKSVLAQ
                     FLVDAGIKPVSIASYNHLGNNDGFNLTSERQFKSKEISKRSVVDDVIASNKILYNEKA
                     GNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGGHNRISIHNVCEDSLLATPLIIDLI
                     VMAEFCSRVSYKKLGSDQQSYESFYSILSFLSYWLKAPLTRKGFKTINGLNKQRQGIE
                     NFLRLLIGLPALDELRFEEKLK"
     gene            complement(<629320..>630372)
                     /gene="TDEL0C03590"
                     /locus_tag="TDEL_0C03590"
                     /db_xref="GeneID:11500583"
     mRNA            complement(<629320..>630372)
                     /gene="TDEL0C03590"
                     /locus_tag="TDEL_0C03590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680411.1"
                     /db_xref="GeneID:11500583"
     CDS             complement(629320..630372)
                     /gene="TDEL0C03590"
                     /locus_tag="TDEL_0C03590"
                     /inference="similar to DNA sequence:INSDC:YKR066C"
                     /note="similar to Saccharomyces cerevisiae CCP1 (YKR066C);
                     ancestral locus Anc_1.194"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680459.1"
                     /db_xref="GeneID:11500583"
                     /db_xref="GOA:G8ZRV6"
                     /db_xref="InterPro:IPR002016"
                     /db_xref="InterPro:IPR002207"
                     /db_xref="InterPro:IPR010255"
                     /db_xref="InterPro:IPR019793"
                     /db_xref="UniProtKB/TrEMBL:G8ZRV6"
                     /translation="MATIFTSTVSKRSLYLLGGAVAAASLASTVALNNHGNNYKNFRN
                     NNKTNFGKGALLGAAPALHAAQCEKGRTIEDFQKVYNAIAAKLREEDEYDNYIGYGPI
                     LLRLSWHVSGTYDKNDNSGGSFGGTYRFKKEADDPSNMGLQNAAKFLEPIAKEFPWIS
                     HGDLYTLGGVTAIQEMQGPKIPWRPGRVDADEKETPENGRLPDATQGSDYVRKYFGRF
                     GFTDQEIVALIGAHSLGKTHLKNSGFEGPWGASTNVFTNDFFKNLLNENWKKEKNEAG
                     NEQYNSDKGYMMLPTDFSLIQDSKFKELVEKYANNQDVFFEDFKNAYVKLLENGINFD
                     KLGKPMVFKTLDEQEE"
     gene            <630815..>633559
                     /gene="TDEL0C03600"
                     /locus_tag="TDEL_0C03600"
                     /db_xref="GeneID:11500584"
     mRNA            <630815..>633559
                     /gene="TDEL0C03600"
                     /locus_tag="TDEL_0C03600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680412.1"
                     /db_xref="GeneID:11500584"
     CDS             630815..633559
                     /gene="TDEL0C03600"
                     /locus_tag="TDEL_0C03600"
                     /inference="similar to DNA sequence:INSDC:YJL154C"
                     /note="similar to Saccharomyces cerevisiae VPS35
                     (YJL154C); ancestral locus Anc_1.193"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680460.1"
                     /db_xref="GeneID:11500584"
                     /db_xref="GOA:G8ZRV7"
                     /db_xref="InterPro:IPR005378"
                     /db_xref="UniProtKB/TrEMBL:G8ZRV7"
                     /translation="MSYAETLEQALLTVKQQAMQMQRCLQQRKLMDALKHTSIMLTEL
                     RNPELSPKQYYELYIMIFDSLSVLSTYLAENHPKHHHLADLYELVQYAGNVVPRLYLM
                     ITVGTSYLKCPDSPRDEILKDMIEMCRGVQNPIRGLFLRYYLSQRTKQLLPEDATEFN
                     ANFIITNFIEMNKLWVRLQHQGPLREREQRTKERKELQILIGSQLVRLSQIVDDNLSM
                     YKDQILPVVLEQAIQCRDIVSQEYLLDAICQVFPDEFHLATLDILLDATTHLNPDVSI
                     NKIVLTLIDRLNGYKDRQEQEQGQEQEENTTSKEVKAADINLFQIFWNYLSTLNEERP
                     DLSLQQFIPLIESVLNLSLRWYPENLQNLNALYKITTQKCQDFGSDIPPNCEYLFQNL
                     LTLQNSESSTLRPSSNFFYKLISQCESFGGLLALQSLPLQKSALNSILDVLLHNEVDF
                     DDENEASSNEGFLIDSKENLCSLLSIFEPLTKLGPPMPSLDRKGSKNVKGTGDHFPAD
                     EDDNDDEGSWILDPIQEKLAKLNHVVFQSVVKSSDPIKDIEFEMEVLLTLRNWCYKGG
                     KNIKYTYPAIITNFWKVIRRCHLLATRCDSENTKRHTELIKQNFKYVSRSTNDLFNMC
                     GNSFSDALYKLNIQSASLADQLSLGEIAYDFFSQAFTLFEESLSDSRTQFQALVYMAQ
                     SLQKTRSLREENYYDSLIVRCTLHGSKLLKKQDQCRAVYLCSHLWWTTEIALIGEEEG
                     VTTDFYREGKRVLECLQRSLRVADSTMDNIQSSELMIEILNRCLYYFIHGDEHDTHVS
                     VRYINGLIELIKTNLKSLKMEETTTAKTQLAEQRLSELHIDDAQNTAKVSNRFVIGSD
                     GSYIDVPTVNGGRALVSTKLNSMYINEMIQIPIQHFNRTCDYILNQRDVDDRFKVIVI
                     "
     gene            <633813..>635174
                     /gene="TDEL0C03610"
                     /locus_tag="TDEL_0C03610"
                     /db_xref="GeneID:11500585"
     mRNA            <633813..>635174
                     /gene="TDEL0C03610"
                     /locus_tag="TDEL_0C03610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680413.1"
                     /db_xref="GeneID:11500585"
     CDS             633813..635174
                     /gene="TDEL0C03610"
                     /locus_tag="TDEL_0C03610"
                     /inference="similar to DNA sequence:INSDC:YJL155C"
                     /note="similar to Saccharomyces cerevisiae FBP26
                     (YJL155C); ancestral locus Anc_1.192"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680461.1"
                     /db_xref="GeneID:11500585"
                     /db_xref="GOA:G8ZRV8"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR016260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G8ZRV8"
                     /translation="METKMGFYTVSNVENMRICVVMVGLPARGKSFISQKIVRYLSWL
                     SIRAKCFNVGSYRRKAGAAHPSADFFDSSNKEALKVRQKAVTHAIEDMMKWYEEENGV
                     VAILDATNSTRERREWVLRLCRENAIEPMFLESWCDDQDMILRNISDVKTSSPDYEGM
                     DPEAATQDFLRRISNYEKVYEPLDRDNDKDLTFVKLINVAQEVIVNRIQSYLESRVVF
                     YVMNLHIRPRCIWLSRHGESVYNVEKKIGGDSSLSARGFQYASKLPEIVRESAGDVNL
                     TVWTSTLCRTQQTAESLPYKQLQWKALDELDAGVCDGMTYEEIEVKYPDDFKARDDDK
                     YEYRYPGGESYRDVVIRLEPIIMELERQENILIVTHQAVLRCIYAYFMNVPQEESPWM
                     SIPLHTLIKLEPRAYGTEVTRIKADIPAVSTYKEKGTSKLGESSAYATKYRNLLNEPS
                     KSA"
     gene            <635381..>637450
                     /gene="TDEL0C03620"
                     /locus_tag="TDEL_0C03620"
                     /db_xref="GeneID:11500586"
     mRNA            <635381..>637450
                     /gene="TDEL0C03620"
                     /locus_tag="TDEL_0C03620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680414.1"
                     /db_xref="GeneID:11500586"
     CDS             635381..637450
                     /gene="TDEL0C03620"
                     /locus_tag="TDEL_0C03620"
                     /inference="similar to DNA sequence:INSDC:YJL156C"
                     /note="similar to Saccharomyces cerevisiae SSY5 (YJL156C);
                     ancestral locus Anc_1.191"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680462.1"
                     /db_xref="GeneID:11500586"
                     /db_xref="GOA:G8ZRV9"
                     /db_xref="InterPro:IPR009003"
                     /db_xref="InterPro:IPR012985"
                     /db_xref="UniProtKB/TrEMBL:G8ZRV9"
                     /translation="MVRRIFGLNKKLLKKTGEDKSESNVDQKTGSPKSVTEPDASPNE
                     NDPQRPASAYDASSSRATSSFGTSSIFSRSRYTSGTGSSSAASDFTYGKKKHSNLSGA
                     PFEDVGKPLRIVDHEKFSLLNPVLEEDAPNESTIPKDGESAQAPTATNTLSRTRISRS
                     LDQVENELNILEDRLVGLMDDINQNVTSISKAVMQAIEFFKQFLPSSSVKGSSRVTFE
                     RYASLRNISKIFLHFMDNLLISEAFGNSRSILMRRYLHFLKRLNINVLEDSESESQTL
                     PCLSNFCLDADCNLPNRTSINRIIDEIVSSDSSLISDCDGAFIAPVLRGLSRKSSLLT
                     VMFGVPSPQQEHYDIVKALYSMFPDVHFFCIKDSIKPCAEVLGPRPMAANTLPTPSAG
                     SFQFTPPYRLAPDALSPPMSMSLSSDLSSKMTGTLGGYLFPQIEKGSKLSHFSGASFA
                     ITCSHVVLSESQDYPFVSIPSKVLQTTYKNTLVEESHRYAKDSPEEKAFMDESLRIEE
                     NMKWQDENKFGQVVWGERSIVNQKLSDFAIIKVGSQYKCENCLGVGLTGVPDPTLRFQ
                     NMYVKEKVLNLKHGMRVFKIGAATNYTSGTVSTARLVYWADGKLQSSEFVVSSPLPLF
                     ASAGDSGSWILTKLENKVGLGVVGMLHSYDGEHRQFGLFTPIGDILERLQSVTGVMWD
                     IDCPLDD"
     gene            <637838..>640300
                     /gene="TDEL0C03630"
                     /locus_tag="TDEL_0C03630"
                     /db_xref="GeneID:11500587"
     mRNA            <637838..>640300
                     /gene="TDEL0C03630"
                     /locus_tag="TDEL_0C03630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680415.1"
                     /db_xref="GeneID:11500587"
     CDS             637838..640300
                     /gene="TDEL0C03630"
                     /locus_tag="TDEL_0C03630"
                     /inference="similar to DNA sequence:INSDC:YJL157C"
                     /note="similar to Saccharomyces cerevisiae FAR1 (YJL157C);
                     ancestral locus Anc_1.190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680463.1"
                     /db_xref="GeneID:11500587"
                     /db_xref="GOA:G8ZRW0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G8ZRW0"
                     /translation="MSLKTPHRQHFEKKVHTPPSVERDPGKPKFLKTVPGRAFRRSSN
                     SDNEPFETTGLFVPAPGLSNRGAAPQPLNIPQLLSPPPSVKKKSLGSPALRAVFQHHF
                     TCPPGGQLESPIHLTPSVKIQSLERPLESFDIVSAFKSGTKSEPRTEVSPCDDTIIWT
                     DSVDDPYLEEDSPTYLRSISQNISKVNAKAGHRRFIGTQCAMCDEKICNVLSGEKIVE
                     LTCSHASHYQCYLATLEYLYLQKKYPQCSVCGKTVKPSDEGTLEKMMSRLLSRKSYEE
                     DPDLTIGPQWLDLKLPHTADRSSLFTPGEQVIQTADISSNGFRTPYQSLGSATFRDYN
                     DVKGPLVQKNTWLGETLLEIGRREQKASGNENQIALEPEVHVRPSGDSTSFDISVRIP
                     LDEDEAGHQQNEEDAFEEERQFLRQQVEDLVKEEVDTDDELGTLVMFDSVAYSTDGEE
                     WNENIMIYLFDQYLLLFDRDEMSTRGKIPMKQVCQVLKLNDSTLLIDLKSRALPEVYI
                     CFPSDDARNSLLQKWKFYLGQSKEFPRLEGITSTSWDILPEELTLELKHLWIKANKNA
                     DNPEDIVLKPWQTLQEDIPLQLIICLNLSHDANLQKNDYEWSITKGLKALLGCLNEKD
                     LLGLVAVGKDGRGNVGNYGTFIGTINKLWPHWVETFDSLEAIEHKIFGTPANELDKML
                     ETCLRLVSTADSMLEEGSSSHFLKQVILLREGEPPKIEHKYGRLISDVHNFDLMQMAP
                     FNQNGEVEQLKNAISLLHRKSIKDLTVRLAGQELFFGNMAPGEEKTISCKFTDPLRFC
                     DVEWFNMRNQRTERINRPIEID"
     gene            <641069..>641794
                     /gene="TDEL0C03640"
                     /locus_tag="TDEL_0C03640"
                     /db_xref="GeneID:11500588"
     mRNA            <641069..>641794
                     /gene="TDEL0C03640"
                     /locus_tag="TDEL_0C03640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680416.1"
                     /db_xref="GeneID:11500588"
     CDS             641069..641794
                     /gene="TDEL0C03640"
                     /locus_tag="TDEL_0C03640"
                     /inference="similar to DNA sequence:INSDC:YJL158C"
                     /note="similar to Saccharomyces cerevisiae CIS3 (YJL158C);
                     ancestral locus Anc_1.189"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680464.1"
                     /db_xref="GeneID:11500588"
                     /db_xref="GOA:G8ZRW1"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:G8ZRW1"
                     /translation="MQFQKIALLSAAALASTVSADGYTPGEEWTTLTPTATYSCGATE
                     YPSSFGIAIQTVGSSSSIAKRDAVSQIGDGQVQATSTSAPSTTATESATETAVSQIND
                     GQLQQTTASGETGSTTVLSPSSTTVSNSVCPTESITLGATSCKNTGTLTIQLKDGVLT
                     DGKGRIGAIVSNRQFQFDGPPPQAGSIYAAGWSITSDGNLALGDSDIFYQCLSGNFYN
                     LYDQSIGEQCHPIHLELVNLVDC"
     gene            complement(<642165..>643295)
                     /gene="TDEL0C03650"
                     /locus_tag="TDEL_0C03650"
                     /db_xref="GeneID:11500589"
     mRNA            complement(<642165..>643295)
                     /gene="TDEL0C03650"
                     /locus_tag="TDEL_0C03650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680417.1"
                     /db_xref="GeneID:11500589"
     CDS             complement(642165..643295)
                     /gene="TDEL0C03650"
                     /locus_tag="TDEL_0C03650"
                     /inference="similar to DNA sequence:INSDC:YJL159W,YKL163W"
                     /note="similar to Saccharomyces cerevisiae HSP150
                     (YJL159W) and PIR3 (YKL163W); ancestral locus Anc_1.188"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680465.1"
                     /db_xref="GeneID:11500589"
                     /db_xref="GOA:G8ZRW2"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:G8ZRW2"
                     /translation="MQYKKTLATAALATTALAAYVPSEPWSTLTPDATYKNGATDYAS
                     AFGIAVKPVATSSSIAKRDAVSQIGDGQIQATTATTADAVSQIGDGQIQATTATTAQA
                     ISQIDDGQIQATTATTAEAVSQIDDGQIQATTATTAEAVSQIDDGQIQATTATTAQAV
                     SQIGDGQIQATTATTAEAVSQIGDGQIQATTATTAEAVSQIGDGQIQATTATTATTDA
                     VSQIDDGQIQATTATTDAASQIGDGQVQATSTTSGASQVSDGQVQATDSAGSDGRVKA
                     VSCKNDGTLQMTLNEGILTDGKGRIGSIVANRQFQFDGPPPQAGAIYAAGWSITPEGN
                     LAIGDEDVFYQCLSGNFYNLYDQSLGEQCHQVNLEVIDLVSC"
     gene            <644282..>645241
                     /gene="TDEL0C03660"
                     /locus_tag="TDEL_0C03660"
                     /db_xref="GeneID:11500590"
     mRNA            <644282..>645241
                     /gene="TDEL0C03660"
                     /locus_tag="TDEL_0C03660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680418.1"
                     /db_xref="GeneID:11500590"
     CDS             644282..645241
                     /gene="TDEL0C03660"
                     /locus_tag="TDEL_0C03660"
                     /inference="similar to DNA sequence:INSDC:YJL160C,YKL164C"
                     /note="similar to Saccharomyces cerevisiae YJL160C and
                     PIR1 (YKL164C); ancestral locus Anc_1.187"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680466.1"
                     /db_xref="GeneID:11500590"
                     /db_xref="GOA:G8ZRW3"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:G8ZRW3"
                     /translation="MLYRFAITAALASSALAAYAPSEPWATLTPTVTYSDGATDYDGT
                     FGIAIKTLAAQSSSNSTVQKRDAVSQIGDGQIQATTATTAEAISQIDDGQIQATTATT
                     AEAVSQIDDGQIQATTATTAEAVSQIGDGQIQATTATTADAVSQIGDGQIQATTATTA
                     TTDAVSQIGDGQIQATSATTTLAPASQIDDGQIQATSSTTTSDGASQSTDSASDGRVK
                     AVSCKNDGTLEMSLNEGVLTDNKGRIGSIVANRQFQFDGPPPQAGAIYAAGWSITPEG
                     NLAIGDEDVFYQCLSGNFYNLYDQSLGEQCKEVHLEVIDLVKC"
     gene            complement(<645419..>645961)
                     /gene="TDEL0C03670"
                     /locus_tag="TDEL_0C03670"
                     /db_xref="GeneID:11500591"
     mRNA            complement(<645419..>645961)
                     /gene="TDEL0C03670"
                     /locus_tag="TDEL_0C03670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680419.1"
                     /db_xref="GeneID:11500591"
     CDS             complement(645419..645961)
                     /gene="TDEL0C03670"
                     /locus_tag="TDEL_0C03670"
                     /inference="similar to DNA sequence:INSDC:YJL161W"
                     /note="similar to Saccharomyces cerevisiae YJL161W;
                     ancestral locus Anc_1.186"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680467.1"
                     /db_xref="GeneID:11500591"
                     /db_xref="UniProtKB/TrEMBL:G8ZRW4"
                     /translation="MRPTFFRLQSLGANSAKSSTNMPKDIPFYASKRNLAINALVTSL
                     YGYGLYAFYKDYVITRNTASHKAKTTNAEVPTTYYGRVEEVHDAPNRLFHSEHEDRNL
                     DRSTMRRVFHSLTYGDMSQFTVAWGFLIQLCNTMHSVYGTKSMIFRTSLLGVAAFPPV
                     LYYLYRLRLFNLEAKGVVIN"
     gene            646344..646415
                     /gene="TDEL0Ctrna7E"
                     /locus_tag="TDEL_0Ctrna7E"
                     /db_xref="GeneID:11500592"
     tRNA            646344..646415
                     /gene="TDEL0Ctrna7E"
                     /locus_tag="TDEL_0Ctrna7E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:11500592"
     gene            <646797..>648467
                     /gene="TDEL0C03680"
                     /locus_tag="TDEL_0C03680"
                     /db_xref="GeneID:11502022"
     mRNA            <646797..>648467
                     /gene="TDEL0C03680"
                     /locus_tag="TDEL_0C03680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680420.1"
                     /db_xref="GeneID:11502022"
     CDS             646797..648467
                     /gene="TDEL0C03680"
                     /locus_tag="TDEL_0C03680"
                     /inference="similar to DNA sequence:INSDC:YJL162C"
                     /note="similar to Saccharomyces cerevisiae JJJ2 (YJL162C);
                     ancestral locus Anc_1.185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680468.1"
                     /db_xref="GeneID:11502022"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:G8ZRW5"
                     /translation="MPALSDVILDETTYYSTLGLSSNANEAEIHKSYMMLARQLHPDK
                     SKSEASAEQFKLISHAHSVLMDEAKRLKYDESLFSKGLHNYSPRENCHRCIPTDRKSA
                     TSSGKHKSKTAQESAGKYHRPYEQQPYGFGTEGTKTSHTHPKVPIFQSFNLKNYQRSQ
                     RSPQPKEHEVPKRFDTPNIFSQEARDMKDRKSKDYNKSTEDESNATRRNGEQDDKNGH
                     PTETEVHEGEEPFRAKIHKGNISDPFDASPKSPFENNRDRHYARKKHEARLQGKRSVS
                     PVKVTPTSNSPDLSDTWDGLKDLLNKFENKKSKAAESMNNQTKKEVETDSHKHNGTSG
                     KVRKANGQSLHLDDLGNSLPLNDKSFDMQGVSDILDDVPLIKRAKKDNGREISPEIEM
                     ISPAKQYHQQPHTRHPVYLPQPTETLHMPVNQPLPKLYRSDVIALDQYKVNSQVMDWE
                     VPPMPNFQCNFLNKSEVAHCKQLVMEFNTRCNSLKHRLLMIMYDRLDADCKLDERLVK
                     VENSANWISCKDFDFEVVNKLSELQNRQRIVAQSFASILKSMYAAEHS"
     gene            <648638..>651400
                     /gene="TDEL0C03690"
                     /locus_tag="TDEL_0C03690"
                     /db_xref="GeneID:11500593"
     mRNA            <648638..>651400
                     /gene="TDEL0C03690"
                     /locus_tag="TDEL_0C03690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680421.1"
                     /db_xref="GeneID:11500593"
     CDS             648638..651400
                     /gene="TDEL0C03690"
                     /locus_tag="TDEL_0C03690"
                     /inference="similar to DNA sequence:INSDC:YKL165C"
                     /note="similar to Saccharomyces cerevisiae MCD4 (YKL165C);
                     ancestral locus Anc_1.184"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680469.1"
                     /db_xref="GeneID:11500593"
                     /db_xref="GOA:G8ZRW6"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR007070"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="InterPro:IPR017852"
                     /db_xref="UniProtKB/TrEMBL:G8ZRW6"
                     /translation="MWNRHRLILITVGVLFHLFYLWSIFDIYFVSPLVHGMNQYQSTD
                     NPPAKRLFLIVGDGLRADTTFDLITHPTSGKTEYLAPYIRSLVLNNATYGISHTRMPT
                     ESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSAHTYSFGSPDILPMFKEGAS
                     DPSRVDTWTYGHEFEDFTQSSIELDAYVFRHLDDLFHNSTRDSTLNDEIRGDGNVVFL
                     HLLGCDTAGHSYRPYSAEYYDNVKYIDDQVSMLSDKVRSFFGDDDTAFIFTADHGMSA
                     FGSHGDGHPNNTRTPLVAWGAGLNKPLKNDYPVFDNYTFTWGLEDVQRHDVKQADIAS
                     LMSYLIGVNYPANSVGELPLAYIDGKESDKLHALYKNARSILEQYLVKEKEIIESQFT
                     YKEYHKFAHRPYQKYLSDIEGLIDRIAQGENDLAPEAIYLTEELMTTTLEGLQYLTTY
                     NWRFIRTIVTFGFVGWITYAFIIFLKLYILENNFADYSTSAGNLFLFGALGVLLNWVL
                     YYQRSPFNFYMYLMFPLYLWSKIFTNNTILREGLKEFLKGTSFMQRVAVAMAIFAVYE
                     GIVYGFFHRWIFTIIFNVLAFYPIYCGVSQVSTNLGWILTSVFLSTFTLYDAVKIESL
                     DQITVAGILIILTSIYALKNVFKSIGYYTFFLLLMQISMVIAMLLVTQKSVTSLQNRQ
                     GLPRDAQIGGWSICFISLFILPIFHYLNPNNDYKVRLLTIYLTFAPAFIILTISFESL
                     FYVVFTAYLVQWIEIEYHIKQLKSHDNHLQLLRVALIGFFLLQIAFFGTGNVASISSF
                     SLDSVYRLLPIFDPFPMGALLMLKLIVPYVLLSTALGILNLKLNIKDYTISSLIISTS
                     DILSLNFFYLLKTEGSWLDIGVTISNYCLAILSSLFMLLLEIIGHVLLKNVTIQRKVD
                     KIKKQS"
     gene            <651756..>653480
                     /gene="TDEL0C03700"
                     /locus_tag="TDEL_0C03700"
                     /db_xref="GeneID:11500594"
     mRNA            <651756..>653480
                     /gene="TDEL0C03700"
                     /locus_tag="TDEL_0C03700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680422.1"
                     /db_xref="GeneID:11500594"
     CDS             651756..653480
                     /gene="TDEL0C03700"
                     /locus_tag="TDEL_0C03700"
                     /inference="similar to DNA sequence:INSDC:YJL163C"
                     /note="similar to Saccharomyces cerevisiae YJL163C;
                     ancestral locus Anc_1.183"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680470.1"
                     /db_xref="GeneID:11500594"
                     /db_xref="GOA:G8ZRW7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G8ZRW7"
                     /translation="MEQQHDEARIFIDEGPDYVAEQAGIAVLESVMDHEQPAHESEEM
                     RWLREARIKHQHLSSFQRPSLAILCCLLMLISLAETLCITPMISLTMKKVCEGIMTAN
                     GDVLDSAQEMHCDPKKVQTIMSGISSTILILTGLSFTFTSGTWGEFSDRVGRVRIFGY
                     MALLKVIGNGVHLWALLPSTPYNKWVIILAGSVSSLSGGMLALLANANSYIADIAEPD
                     QRAMSMSIMMSTVYGTMGLGPIVGSLLVKFFSEGDRLPIYLSLIVGTIATLSCFTVIK
                     EPRHDDALKLSQATFMERRESISSTRSSGSHFSAKMKSFSRLQLLRLIDVFSSLKKLW
                     LKPTARGSLAPRYTVLLLIVIDILFLSITVGSLPTLVLFATYQYGWRSVELGYFISIS
                     GLGRAAVLLVLSPCLIHLLKKRYKPLSFSVDRIDIICIMISLAFLIMSFLTALIGLGH
                     EGSLFACATLQALSAFCSPALQSAIIKYCSKKFTGQCFGAIALIRSVVMLIVPPTLLR
                     IYGATVSFKPELFLYIPLMSGISALILSSFLRIVDDKEELRRDSEVNVTYPSKPLQSR
                     KDSPNSKP"
     gene            <653934..>655169
                     /gene="TDEL0C03710"
                     /locus_tag="TDEL_0C03710"
                     /db_xref="GeneID:11500595"
     mRNA            <653934..>655169
                     /gene="TDEL0C03710"
                     /locus_tag="TDEL_0C03710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680423.1"
                     /db_xref="GeneID:11500595"
     CDS             653934..655169
                     /gene="TDEL0C03710"
                     /locus_tag="TDEL_0C03710"
                     /inference="similar to DNA sequence:INSDC:YJL164C,YKL166C"
                     /note="similar to Saccharomyces cerevisiae TPK1 (YJL164C)
                     and TPK3 (YKL166C); ancestral locus Anc_1.182"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680471.1"
                     /db_xref="GeneID:11500595"
                     /db_xref="GOA:G8ZRW8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZRW8"
                     /translation="MYIDPQKNNQVRKLDIPGIHKKENMSEEHVRDDDGLTAEQREQH
                     LTLKKLSEQVRASEREKEARNEQQQREAQSSDGSQAKNATPVMRGKNTSGKYCLTDFQ
                     ILRTLGTGSFGRVHLVRSNHNGRFYALKVLKKQTIVKLKQVEHTNDERRMLSVVSHPF
                     LIRMWGTFQDAEQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHAN
                     EIIYRDLKPENILLDRNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVISTKPYNKS
                     VDWWSFGIYIYEMLAGYTPFYDANAMKTYENILNAELKFPPFFNADAQDLLSKLIERD
                     LSKRLGNLQNGSEDVKNHPWFSEVVWEKLLSRNIETPYEPPIQQGQGDTSQFDRYPEE
                     EINYGVEGDDPYADLFKDF"
     gene            <655369..>655764
                     /gene="TDEL0C03720"
                     /locus_tag="TDEL_0C03720"
                     /db_xref="GeneID:11500596"
     mRNA            <655369..>655764
                     /gene="TDEL0C03720"
                     /locus_tag="TDEL_0C03720"
                     /product="mitochondrial 54S ribosomal protein MRP49"
                     /transcript_id="XM_003680424.1"
                     /db_xref="GeneID:11500596"
     CDS             655369..655764
                     /gene="TDEL0C03720"
                     /locus_tag="TDEL_0C03720"
                     /inference="similar to DNA sequence:INSDC:YKL167C"
                     /note="similar to Saccharomyces cerevisiae MRP49
                     (YKL167C); ancestral locus Anc_1.181"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein MRP49"
                     /protein_id="XP_003680472.1"
                     /db_xref="GeneID:11500596"
                     /db_xref="InterPro:IPR007741"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:G8ZRW9"
                     /translation="MSSVAKQLKYLNRISFTTKEAQILINPSKYAGIKLTFQAQNHNG
                     HMGARKFWRQYLPTLQFYNPGLKIDVVRIDNKDTKRAGVPCILEIVSKEDKVLDQIDM
                     KNKKDDTIMNDLLQRLDFEPIPEESLIKV"
     gene            <656214..>658154
                     /gene="TDEL0C03730"
                     /locus_tag="TDEL_0C03730"
                     /db_xref="GeneID:11500597"
     mRNA            <656214..>658154
                     /gene="TDEL0C03730"
                     /locus_tag="TDEL_0C03730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680425.1"
                     /db_xref="GeneID:11500597"
     CDS             656214..658154
                     /gene="TDEL0C03730"
                     /locus_tag="TDEL_0C03730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680473.1"
                     /db_xref="GeneID:11500597"
                     /db_xref="InterPro:IPR007300"
                     /db_xref="UniProtKB/TrEMBL:G8ZRX0"
                     /translation="MRRTETIRPKDRKYEALVRHWLIFKQFVVLRRRLLFRTYVLTPL
                     GVILVMALLYGVDRLIKNCIKITFPASVAVMLINFAFMCILASFRRPYIDFYLNVIDV
                     PLSWALRWMNVFFTPAFVTLPLSPWISYKEALLIVAVFVIGYLISFALLSYITMLGQK
                     VTRSFKLKSIFVRQDELHNGMQEGSSFAPPSTHKRSSSTSSDIGEEEPVNGNESTNSS
                     IRIFYAESDEMEPHDPLLDLANNSGISLSQLNSRATSGLHSIVSPKHLPSDTIEPGEE
                     AIEIGPSRRTVTNGPSQNHHISNGTFLRKLKPVIHKNPEVHSAMTVSSSESPNICQRA
                     ITRQYSKQIDLYFSISMWDAHLHHILYGLGFFATIFTYYFQWYTTPFHLFTAVCMFMI
                     VTDSEYIVNRPKLKKFAHPVICSMALTWIVMLISVMIKHRKVVYFLRELRSYKTGRNY
                     LRLFDNDNYGYHQWPGAGDIFSSCMDVSIVGLSLPMYTYRKDLKRHFFSMVPPILIFT
                     AATLFLNPLICYKIGISSKRAIGFAGRSVTLALGTPLIANLDGDQTVMAVTTVMSGVI
                     GALTGGRMFDFIRVPEDDYVTRGLALGCNCGAIATAYLLGVDRRAAAISSLSFVCYGA
                     LMVILSAIGPIKHFVHQLVGLN"
     gene            <658468..>660702
                     /gene="TDEL0C03740"
                     /locus_tag="TDEL_0C03740"
                     /db_xref="GeneID:11500598"
     mRNA            <658468..>660702
                     /gene="TDEL0C03740"
                     /locus_tag="TDEL_0C03740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680426.1"
                     /db_xref="GeneID:11500598"
     CDS             658468..660702
                     /gene="TDEL0C03740"
                     /locus_tag="TDEL_0C03740"
                     /inference="similar to DNA sequence:INSDC:YJL165C,YKL168C"
                     /note="similar to Saccharomyces cerevisiae HAL5 (YJL165C)
                     and KKQ8 (YKL168C); ancestral locus Anc_1.180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680474.1"
                     /db_xref="GeneID:11500598"
                     /db_xref="GOA:G8ZRX1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8ZRX1"
                     /translation="MGSSEERNPRSASVKRTRSLSESIKGIFKGGSSSGHAQHPGSPS
                     ETPPAILKKNSSRLGNITINKEAELSSSRGAPIQAPTSPLQTPIAPRQSNLGVPKLSK
                     LSLSQPSQPSSSDNDHASPPPNLSEEEEFARARHSSGRRSDEEQRGRDVSREGRQRPK
                     QPESKSYNAQQSSEQEDSGLIDSVLENDDNDNSIREERSSSTEAHANRARASSSAVRS
                     GSLKRMGSTSSATSSNQGYPRGRHRADTFSASSLPRFNERESKCILQVDNFKVYENGF
                     HEHNLKITSLISDTNDGNDGLSKQKSGFSLSGIFKPHKEDKKLDNALSLIPTGTLSLS
                     QRIDKARSQAMERNGDSIDEADEESSGDVAKGQTEDTRTPKIVNPNAAVGTEELKLIN
                     TLSEKIHLALNGKSSKIEGDEKTREDPPTKFHDQYGKPIGVIGHGAYGVVKICSRPLT
                     ANDAEPYPTYSNGKRLFFAVKELRPKPNYQVEKFSTRITSEFIIGHSLSRCHKKGDAP
                     APNILKVLDLLEAQDAFVEVMEFCPSGDLYNLLTRKSKNGTALQPLEADCFMKQLLHG
                     VQFMHSHGVAHCDLKPENILFHPDGLLKICDFGTSCVFQTAWEKQVHFQSGTMGSEPY
                     VAPEEFIHGKEYDARQADCWSCGVVYCTMVLGHYLWKVAARGKDPLYDSFIDEMSEHN
                     EFYVFEEMRHVNNEINRLRRIALYQIFQIDPNKRITVSDLLQTAWMRRTKCCVFYKPV
                     DKER"
     gene            complement(<660814..>661230)
                     /gene="TDEL0C03750"
                     /locus_tag="TDEL_0C03750"
                     /db_xref="GeneID:11500599"
     mRNA            complement(<660814..>661230)
                     /gene="TDEL0C03750"
                     /locus_tag="TDEL_0C03750"
                     /product="mitochondrial 54S ribosomal protein YmL38/YmL34"
                     /transcript_id="XM_003680427.1"
                     /db_xref="GeneID:11500599"
     CDS             complement(660814..661230)
                     /gene="TDEL0C03750"
                     /locus_tag="TDEL_0C03750"
                     /inference="similar to DNA sequence:INSDC:YKL170W"
                     /note="similar to Saccharomyces cerevisiae MRPL38
                     (YKL170W); ancestral locus Anc_1.179"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL38/YmL34"
                     /protein_id="XP_003680475.1"
                     /db_xref="GeneID:11500599"
                     /db_xref="GOA:G8ZRX2"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR005745"
                     /db_xref="InterPro:IPR019972"
                     /db_xref="InterPro:IPR023571"
                     /db_xref="UniProtKB/TrEMBL:G8ZRX2"
                     /translation="MIYLKSMLKVIDNSGAQMAECIKVLKKGSPKSPARIGDRIVCVV
                     QKAKPLAQNITGTSNTNRVKKGDIVHGIVVRAKQRNMYREDGSTVSFGDNACVLINKN
                     TGEPLGTRIMANDGCVGRELREKGYNKICSLASRVV"
     gene            complement(<661391..>663895)
                     /gene="TDEL0C03760"
                     /locus_tag="TDEL_0C03760"
                     /db_xref="GeneID:11500600"
     mRNA            complement(<661391..>663895)
                     /gene="TDEL0C03760"
                     /locus_tag="TDEL_0C03760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680428.1"
                     /db_xref="GeneID:11500600"
     CDS             complement(661391..663895)
                     /gene="TDEL0C03760"
                     /locus_tag="TDEL_0C03760"
                     /inference="similar to DNA sequence:INSDC:YKL171W"
                     /note="similar to Saccharomyces cerevisiae YKL171W;
                     ancestral locus Anc_1.178"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680476.1"
                     /db_xref="GeneID:11500600"
                     /db_xref="GOA:G8ZRX3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8ZRX3"
                     /translation="MSRSERSLVSGVDSKERSLRPSVTPLEDSGSQPGDDELYFEPKR
                     LYRATQGASSKSSLVRVYSENESANFDQITGSRIYDDLKHRPIPITGKTLASTNGSER
                     TLQAEPQRARKRRFSWNQQDSDMQDEYIPEFDFAEAVLKWQNEDGDSPAGMYHTLANN
                     SANATPPKYIESITRFNTWGTDHESNSISPNSSYVFDSSHAQVDPIPLPNAANKVPMM
                     DSMSATEVEKNITDGTAHSSELDRFKNMGFNSSFQARKLSRRKTSVGDSFNSASSSLT
                     HLPDNAVSIISELKMTPEEVLELIGKLPHDFLFLPYSQRKKIIVDLIPNKDYKLLMSL
                     IKSLMLKSSKSNTSLNKNSIPDIAPASVKSRHGSVASQFLSSFSPAGITSMANKNNFR
                     PDDKGMQIMGYNLGKVIGFGAWGMIRECHDDITGADKAMKIVRFRNNLKVKKQVLKEV
                     SIWQELKSDNILPLIQWKLDEDYAMYCLTERIHGGTLYDLVISWGEYGVSKIDFQSRC
                     RLTILLSLQLISALRYMHGKDIAHGDVKLENCLLEKASRETEWRVLLCDFGMSCRFNL
                     CKRSPMDDYVTDDSLVSPTDTDYMEILSSFKDKKTIRSRKAMDFHRSRSSTNMHYGNR
                     LSKLQRIVKNKRLTHDDTPLGISSLPKTYGPSLTSARIANSSTPSLRNFASHATKLTP
                     TMDMTSPHIDSNTSPANVGPDPHSHIGSLPYASPELLEPSPPPLGPSADIWALGVTLY
                     TMLTGKLPFKHEYEPRMRAMITSGKFDRKSLEAICHVETNEHTGAGQELKSQPSFVGL
                     YNAIVGCLKNKMNERWGLDKIEPALKNDLMKLSSFV"
     gene            complement(<664253..>664540)
                     /gene="TDEL0C03770"
                     /locus_tag="TDEL_0C03770"
                     /db_xref="GeneID:11500601"
     mRNA            complement(<664253..>664540)
                     /gene="TDEL0C03770"
                     /locus_tag="TDEL_0C03770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680429.1"
                     /db_xref="GeneID:11500601"
     CDS             complement(664253..664540)
                     /gene="TDEL0C03770"
                     /locus_tag="TDEL_0C03770"
                     /inference="similar to DNA sequence:INSDC:YJL166W"
                     /note="similar to Saccharomyces cerevisiae QCR8 (YJL166W);
                     ancestral locus Anc_1.177"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680477.1"
                     /db_xref="GeneID:11500601"
                     /db_xref="GOA:G8ZRX4"
                     /db_xref="InterPro:IPR004205"
                     /db_xref="UniProtKB/TrEMBL:G8ZRX4"
                     /translation="MGGPPSAKTYMGWWGHMGSPAQKGITSYAVSPYAQKPLAGAAHN
                     AVFNLFRRFKSQVLYLAIPAGIYWAWWVNSRDYNEYLYTKAGREELERVNV"
     gene            complement(<664822..>665877)
                     /gene="TDEL0C03780"
                     /locus_tag="TDEL_0C03780"
                     /db_xref="GeneID:11500602"
     mRNA            complement(<664822..>665877)
                     /gene="TDEL0C03780"
                     /locus_tag="TDEL_0C03780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680430.1"
                     /db_xref="GeneID:11500602"
     CDS             complement(664822..665877)
                     /gene="TDEL0C03780"
                     /locus_tag="TDEL_0C03780"
                     /inference="similar to DNA sequence:INSDC:YJL167W"
                     /note="similar to Saccharomyces cerevisiae ERG20
                     (YJL167W); ancestral locus Anc_1.176"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680478.1"
                     /db_xref="GeneID:11500602"
                     /db_xref="GOA:G8ZRX5"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="UniProtKB/TrEMBL:G8ZRX5"
                     /translation="MSKESNRAKFVAEFPELVKELKSVLTGYGMPAEAVKWYEDSLNY
                     NTPGGKLNRGLSVVDTYAILKGYASVDDLPVEVYKKVALLGWCIELLQAYFLVADDMM
                     DQSITRRGQPCWYRVKEVGDIAINDAFMLEGAIYVLLKKHFRQEPYYVDLIELFHDVT
                     FQTELGQLLDLITAPEDKVDLSKFSLEKHSFIVTFKTAYYSFYLPVALAMYVAGISDP
                     KDLQQAHDVLIPLGEYFQIQDDYLDCFGTAEQIGKIGTDIQDNKCSWVVNKALQLASP
                     EQRKLLDENYGKKDAECEARCKKLFHDLDIQKHYQAYEEKVAQDLRAKIAQTDESRGF
                     RAQVLTAFLNKVYKRSK"
     gene            complement(<666056..>667207)
                     /gene="TDEL0C03790"
                     /locus_tag="TDEL_0C03790"
                     /db_xref="GeneID:11500603"
     mRNA            complement(<666056..>667207)
                     /gene="TDEL0C03790"
                     /locus_tag="TDEL_0C03790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680431.1"
                     /db_xref="GeneID:11500603"
     CDS             complement(666056..667207)
                     /gene="TDEL0C03790"
                     /locus_tag="TDEL_0C03790"
                     /inference="similar to DNA sequence:INSDC:YKL172W"
                     /note="similar to Saccharomyces cerevisiae EBP2 (YKL172W);
                     ancestral locus Anc_1.175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680479.1"
                     /db_xref="GeneID:11500603"
                     /db_xref="InterPro:IPR008610"
                     /db_xref="UniProtKB/TrEMBL:G8ZRX6"
                     /translation="MAKVIKVAVKKGEPTVVTSVEKTVDVDDNGSVATTEEYQSQALS
                     KKDKRRLKKELAKIQAEKKEEKQEEEEEQEEDDEEEEEEEEQGLDLDRLARSDSEDDD
                     EEDDDDEEDGDEEDDDGKDEEEKDEEEEDVPLSDVEFDSDADVVPHHKLTINNVKAMK
                     HALARVQLPWKKHSFQEHQSVTSATNTDEGMRDIYDDTERELAFYKQSLSSVLEAREQ
                     LARLRVPFKRPLDYFAEMVKNDEHMDKIKNKLVVEASEKKARGDARKQRQLKKFGKQV
                     QVATLQKRQLEKRETLDKIKSLKKKRKQSEINDGDFNVGIEEATEDNNRHKMNHKRAA
                     KDAKYGSGGMKRFKRKNDADSSADVTGFSQRKMKGKSSRPGKSRRSKRF"
     gene            <667719..>669419
                     /gene="TDEL0C03800"
                     /locus_tag="TDEL_0C03800"
                     /db_xref="GeneID:11500604"
     mRNA            <667719..>669419
                     /gene="TDEL0C03800"
                     /locus_tag="TDEL_0C03800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680432.1"
                     /db_xref="GeneID:11500604"
     CDS             667719..669419
                     /gene="TDEL0C03800"
                     /locus_tag="TDEL_0C03800"
                     /inference="similar to DNA sequence:INSDC:YNL039W"
                     /note="similar to Saccharomyces cerevisiae BDP1 (YNL039W);
                     ancestral locus Anc_2.282"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680480.1"
                     /db_xref="GeneID:11500604"
                     /db_xref="GOA:G8ZRX7"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017174"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:G8ZRX7"
                     /translation="MSSVVNKSGTRFFPKLRQRRLLSAAPKKTLTTVTDEGTKSTEDV
                     SPTDEDTKVDEKDSQKEFQESENPEEDTGATAVQDEEDEEDGALSQIKPNPSQTSTQI
                     PESQSVREGRRSSRLDSLGTNQTSAPIFRPAFNESGTGTTGKRLSTIAKPNLKKVRLR
                     SVSEKDATLETLKKRRMSIRTSISKKSGSAHRISVVSRRTSPDADVHTATAIPNPNGK
                     SDSVTELFQKTDSLYEKYTIKNLKEIPKHIQDTDSERYMVDEEAFTMADLCKPKLPIG
                     EISENFTIAKQAGLLRFEKRRQRRELRRRAREEFKSVSSLNEEDQERELEERKKAAEK
                     LLNTDVPESSGPQTAIQLRLNPDGTMVVDEESTVVDRHKNASYQNAHKLKVNENPFEN
                     LYNSGTYGKNIYTDPWNTEELVKFYKALSMWGTDFNLIAQLFPYRSRKQIKAKFINEE
                     RKHPVTVELALRSRLPPNFEQYCLDIRKDIGTVSAFHEKIQELQVEHEEHMRAIDNAK
                     ATAKEEDLQNVKTIKDSGKKTSGGFRTDQVRAYRKSEVVLGTIDDLKKHPAQEVEENS
                     "
     gene            <669543..>670226
                     /gene="TDEL0C03810"
                     /locus_tag="TDEL_0C03810"
                     /db_xref="GeneID:11500605"
     mRNA            <669543..>670226
                     /gene="TDEL0C03810"
                     /locus_tag="TDEL_0C03810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680433.1"
                     /db_xref="GeneID:11500605"
     CDS             669543..670226
                     /gene="TDEL0C03810"
                     /locus_tag="TDEL_0C03810"
                     /inference="similar to DNA sequence:INSDC:YNL038W"
                     /note="similar to Saccharomyces cerevisiae GPI15
                     (YNL038W); ancestral locus Anc_2.281"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680481.1"
                     /db_xref="GeneID:11500605"
                     /db_xref="GOA:G8ZRX8"
                     /db_xref="InterPro:IPR019328"
                     /db_xref="UniProtKB/TrEMBL:G8ZRX8"
                     /translation="MKLAKEILQYMSKPTIASKRCKKYCLVIDQSDNGTWLKFATKPS
                     NYASRVMMNLALLVLLNSLSAIIVQAKVPLELRAKIVIGAIAFCLNSLLLRRPPIESL
                     VVYRNYGVQVTTVRGFLLLPDQLNIKWLGQSQFIPRDEIVDIVINEGFCRGFQVIFYL
                     AVIIRDAKKLKLLFPVCIKRIKHRFPRLLLTLDRPQDPAWMTKRSFIICLESVFSSTR
                     SAFIARAVC"
     gene            <670321..>671289
                     /gene="TDEL0C03820"
                     /locus_tag="TDEL_0C03820"
                     /db_xref="GeneID:11500606"
     mRNA            <670321..>671289
                     /gene="TDEL0C03820"
                     /locus_tag="TDEL_0C03820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680434.1"
                     /db_xref="GeneID:11500606"
     CDS             670321..671289
                     /gene="TDEL0C03820"
                     /locus_tag="TDEL_0C03820"
                     /inference="similar to DNA sequence:INSDC:YIL096C"
                     /note="similar to Saccharomyces cerevisiae YIL096C;
                     ancestral locus Anc_2.280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680482.1"
                     /db_xref="GeneID:11500606"
                     /db_xref="InterPro:IPR019446"
                     /db_xref="UniProtKB/TrEMBL:G8ZRX9"
                     /translation="MGRKLKGKPSHKSLKTTLQRHQVREKIRQLHKNKEQNKQQKKSQ
                     PNAKVRKNQELQKLNEASFSAFQKDETLLLVGEGDFSFTRSLIEEEFLKAENIIATSY
                     DSSPSELELKYPHSFKENYDFLIQNKVKMMFKVDAMDLIKTLTLSKRNAWSKLLGSSW
                     KYKSLQNIMFNFPHTGKGVKDQDRNIADHQQLIFGYFRSCKKLFELVNAPILEAKNSY
                     DQGYTASEGKQDLTPEGYGNILLSVFTGEPYDSWMIKSLAKDNGLCVQRSHKFEWKNY
                     PQYHHKRTNSEQETTKPAEERDARIYIFEKFERAKKAKSKDLSDEE"
     gene            complement(<671332..>672843)
                     /gene="TDEL0C03830"
                     /locus_tag="TDEL_0C03830"
                     /db_xref="GeneID:11500607"
     mRNA            complement(<671332..>672843)
                     /gene="TDEL0C03830"
                     /locus_tag="TDEL_0C03830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680435.1"
                     /db_xref="GeneID:11500607"
     CDS             complement(671332..672843)
                     /gene="TDEL0C03830"
                     /locus_tag="TDEL_0C03830"
                     /inference="similar to DNA sequence:INSDC:YIL097W"
                     /note="similar to Saccharomyces cerevisiae FYV10
                     (YIL097W); ancestral locus Anc_2.279"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680483.1"
                     /db_xref="GeneID:11500607"
                     /db_xref="InterPro:IPR006595"
                     /db_xref="InterPro:IPR024964"
                     /db_xref="UniProtKB/TrEMBL:G8ZRY0"
                     /translation="MGSLIHEPSTDFHLKLNEQLFHIPHELLRKNVRQVHKLIERESS
                     TLQSLFSELNVSLQANSLDQDKLALNKLNEIIRKVDLFERKLTKRVDEELRLLERIDS
                     RLKFFHGLQNAKESQDVSKLTDWYQKYTNVLIADYLIRNDQVHLNSLQDDEDSVTLQD
                     GKMWNPGVTYLKQQQLESLLDYDILLAANRISKSLTVDHNLEPLLHWIGENKVFLKKN
                     RSFLEFEARLQDYVELLKAGDYKSAIGRFQKFLLPFVESNYSDLKLASGLLVFINSCR
                     QEESKLQVNDSIDPQIITNDENNTEPNLRSKDDIYEHFFRKKVAKRTSTPPTVNKVIF
                     KQYNKNADLARYTDLLDQKRWSTLNELFSKEYYSMYGISHKEPLLMYLSLGISTLKTK
                     ECLHRKEFVSSDNPKLDEYLQKDVLGTTCPVCSEEFAPIAKDLPYAHHIQSKLFENPV
                     MLPNGNIYDAKKLKALALNLNRSNLADLQEFEVVDPIDKKKYPETDFIKMYPT"
     gene            complement(<673007..>674092)
                     /gene="TDEL0C03840"
                     /locus_tag="TDEL_0C03840"
                     /db_xref="GeneID:11500608"
     mRNA            complement(<673007..>674092)
                     /gene="TDEL0C03840"
                     /locus_tag="TDEL_0C03840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680436.1"
                     /db_xref="GeneID:11500608"
     CDS             complement(673007..674092)
                     /gene="TDEL0C03840"
                     /locus_tag="TDEL_0C03840"
                     /inference="similar to DNA sequence:INSDC:YNL037C"
                     /note="similar to Saccharomyces cerevisiae IDH1 (YNL037C);
                     ancestral locus Anc_2.278"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680484.1"
                     /db_xref="GeneID:11500608"
                     /db_xref="GOA:G8ZRY1"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004434"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:G8ZRY1"
                     /translation="MLRSAVGKRMFASVAAAEKVLPKKYGGRFVVTLIPGDGVGKEVT
                     DSVVSIFEAENLPIDWDRVDISGLDHEEGVQAAVDSLKRNKIGLKGIWHTSAADQAGK
                     GSLNVALRKELDIYANVALFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPGVV
                     ESLKIMTEDKTERIARFAFDFAKKYNRHAVTAVHKANIMKLGDGLFRNVVTRVGEQEY
                     PDVKVGSIIVDNASMQTVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANYGR
                     EYAVFEPGSRHVGLDIKDKNIANPTAMILSASLMLDHLGLSTSATKISNAVHQVIAEG
                     KSTTPDIGGSASTTEFTQAVIEKLASL"
     gene            <674368..>674844
                     /gene="TDEL0C03850"
                     /locus_tag="TDEL_0C03850"
                     /db_xref="GeneID:11500609"
     mRNA            <674368..>674844
                     /gene="TDEL0C03850"
                     /locus_tag="TDEL_0C03850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680437.1"
                     /db_xref="GeneID:11500609"
     CDS             674368..674844
                     /gene="TDEL0C03850"
                     /locus_tag="TDEL_0C03850"
                     /inference="similar to DNA sequence:INSDC:YIL098C"
                     /note="similar to Saccharomyces cerevisiae FMC1 (YIL098C);
                     ancestral locus Anc_2.277"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680485.1"
                     /db_xref="GeneID:11500609"
                     /db_xref="UniProtKB/TrEMBL:G8ZRY2"
                     /translation="MKQAARAYRDVIRAMVRGDRRSRIAQRAEETRKQIAMLTYKRMN
                     IVRQQNETKDAMLNASLFKDLQLLNRQVETLKRDRAENDKSLLFVRDTALIRDSLLQE
                     RGDNERLVQHLHDIGSFLTNQREYDELIERYNGSSKLSQEETVRRTAGKVGLHVPF"
     gene            complement(<674841..>676649)
                     /gene="TDEL0C03860"
                     /locus_tag="TDEL_0C03860"
                     /db_xref="GeneID:11500610"
     mRNA            complement(<674841..>676649)
                     /gene="TDEL0C03860"
                     /locus_tag="TDEL_0C03860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680438.1"
                     /db_xref="GeneID:11500610"
     CDS             complement(674841..676649)
                     /gene="TDEL0C03860"
                     /locus_tag="TDEL_0C03860"
                     /inference="similar to DNA sequence:INSDC:YIL099W"
                     /note="similar to Saccharomyces cerevisiae SGA1 (YIL099W);
                     ancestral locus Anc_2.276"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680486.1"
                     /db_xref="GeneID:11500610"
                     /db_xref="GOA:G8ZRY3"
                     /db_xref="InterPro:IPR000165"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR011613"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="UniProtKB/TrEMBL:G8ZRY3"
                     /translation="MKGSINGSHRGSKHALSVLTLIIIISLIAYRFFLPLESELQVAR
                     APWSFEDEDRNVTIVDFFKPFDSAHPTSLPLKDYYRKINLKPVAPYSINRANFSEWVD
                     VQCESSFERLLQNVADSELNGDHLVSEGVVEGVVIASPSKSAPDYFYQWVRDAAITMH
                     TVVNNLFPVTVAPYDAGAGAVNVTLARTVLKYVNNSYVLQRSDNPSGQGVDGQDGNPL
                     RGLGEPKWLVDNKPFTQNWGRPQNDGPPLRSLTIFTLLHELALNGVALEDIIEKCGFG
                     ADLIFRNDTELFEQIIYWDLRFIMFNWKEDSFDLWEEVNGKHFFTSLVQFTSIKMAIS
                     FLEKSENEWTRFDKQVLLQDLRKCLNDMAQFLTFDSGFINPNKNYIVETPSVLNQRCG
                     LDIAVIIGSLLTHAENFDVGVPFGVTDTGVLNTLYSLVKSMGVIYPINHQRAPLNIGV
                     ALGRYPEDIYDGVGTSEGNPWFLATSAAPELLYRLILENYKLQRDLVIPLNRWESEFW
                     TLVFDGFQHYTDQEYQLVIPWGSPAFGQTMTAVFDLGESFLDKMREHVSDAGEMSEQF
                     NKYTGYLQGAHDLTWSYGALWSTCHARKQVLPLVSA"
     gene            <677210..>677857
                     /gene="TDEL0C03870"
                     /locus_tag="TDEL_0C03870"
                     /db_xref="GeneID:11500611"
     mRNA            <677210..>677857
                     /gene="TDEL0C03870"
                     /locus_tag="TDEL_0C03870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680439.1"
                     /db_xref="GeneID:11500611"
     CDS             677210..677857
                     /gene="TDEL0C03870"
                     /locus_tag="TDEL_0C03870"
                     /inference="similar to DNA sequence:INSDC:YNL036W"
                     /note="similar to Saccharomyces cerevisiae NCE103
                     (YNL036W); ancestral locus Anc_2.275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680487.1"
                     /db_xref="GeneID:11500611"
                     /db_xref="GOA:G8ZRY4"
                     /db_xref="InterPro:IPR001765"
                     /db_xref="InterPro:IPR015892"
                     /db_xref="UniProtKB/TrEMBL:G8ZRY4"
                     /translation="MISDTPFTLTHDSKLDDLLAANKQWSKSMNNLHPSLFPEFNGKG
                     QQPHTLFIGCSDSRYNETCLGVLPGEVFTWKTVANICNPEDLTLMATLEFAIRCLKVN
                     KVVVCGHTDCGGIKTCLTGQLEPLKDKEGLNCGHLYQYLHDIDELHRSEKEQLASFPT
                     LEEKSKYLSHCNVKRQFAQIMKNDTVKNAIVAQELEVYGLVYNVDSGLLDPVIAN"
     gene            <678183..>680255
                     /gene="TDEL0C03880"
                     /locus_tag="TDEL_0C03880"
                     /db_xref="GeneID:11500612"
     mRNA            <678183..>680255
                     /gene="TDEL0C03880"
                     /locus_tag="TDEL_0C03880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680440.1"
                     /db_xref="GeneID:11500612"
     CDS             678183..680255
                     /gene="TDEL0C03880"
                     /locus_tag="TDEL_0C03880"
                     /inference="similar to DNA sequence:INSDC:YIL101C"
                     /note="similar to Saccharomyces cerevisiae XBP1 (YIL101C);
                     ancestral locus Anc_2.274"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680488.1"
                     /db_xref="GeneID:11500612"
                     /db_xref="GOA:G8ZRY5"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="UniProtKB/TrEMBL:G8ZRY5"
                     /translation="MVKRKDGGNPQEVTGGGLKYAIHNLDLSTVELSTSPLDDYQRLF
                     FARLLSRPNVDQRRNLDVKRVTYKSSIAEAFANPACVVPDAGLTHDGASPRMQFSQRR
                     PSGSAKYVLDCFEYQLPDVLLGGQSGLEQFTSLSEGSKARLGLDEHPGRVLSGTISMP
                     GDPAQSEGFVAPTQGEGDELVANPLTKNQQFKLRKIDHSLQQNSKLINPNNCVLWTHE
                     SGYVFLTGIWRLYQDVMRGLISLPRVDDSNRAEVQEVCKKELDYISTTAFYESGACPP
                     AGYSDRRKRRQSAGSDMPSSTGQGSLSSPTIPTSANPSSSVTHYTDLHWNGLSPDLKQ
                     MMCDTYRNHLIHEKGFSPQDLVKCDFAEVIKRVRGGYIKIQGTWLPLETARLLCVRFC
                     YPIRYLLVPIFGPTFPTDCENWFKYIQNQLKIREANLNKLSPSPVDVGTQPRRRKRRD
                     STRSKVSKPVGNELLNAFQNLLDISKNPPVANPTPKQISRRSSSCAPECALMQRRSSL
                     EKLPPISAIMQSISPRSSVGHHSDSGYTPLRNIHRDSGMESQPPIHPNPTVQTLSHLA
                     SFYNTNGHRYSYPGNVYMSHQRPVSNKMQLTPNDGLFEMYMNKTSSAPMQEVSVKSEM
                     TNATNYKPVNFTDGSDKWFPRSRAQISGSGNISNPASPGQKNNVATLSTSYPEMNAPM
                     TYWFSATR"
     gene            complement(680359..680431)
                     /gene="TDEL0Ctrna11T"
                     /locus_tag="TDEL_0Ctrna11T"
                     /db_xref="GeneID:11500613"
     tRNA            complement(680359..680431)
                     /gene="TDEL0Ctrna11T"
                     /locus_tag="TDEL_0Ctrna11T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:11500613"
     gene            <680607..>683096
                     /gene="TDEL0C03890"
                     /locus_tag="TDEL_0C03890"
                     /db_xref="GeneID:11502013"
     mRNA            <680607..>683096
                     /gene="TDEL0C03890"
                     /locus_tag="TDEL_0C03890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680441.1"
                     /db_xref="GeneID:11502013"
     CDS             680607..683096
                     /gene="TDEL0C03890"
                     /locus_tag="TDEL_0C03890"
                     /inference="similar to DNA sequence:INSDC:YNL041C"
                     /note="similar to Saccharomyces cerevisiae COG6 (YNL041C);
                     ancestral locus Anc_2.273"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680489.1"
                     /db_xref="GeneID:11502013"
                     /db_xref="GOA:G8ZRY6"
                     /db_xref="InterPro:IPR010490"
                     /db_xref="UniProtKB/TrEMBL:G8ZRY6"
                     /translation="MDFIDLETFSAVNSTTERGSNDTLPEPSSTLNLSAFPVSSNQDQ
                     GSFKIPDFHKRNLSEVDPKENIYDRMAQHATLFMKKLDLDVTESIVTDDSRKITSQFT
                     EPTKASLPGLEIDDLVSNKKVSASKITDQVLLQKLSRVLNEYTVTNYHTRSQIRKSLQ
                     SLEENKERLMLDDEKLIDPGYVGNLARKSMRSDLESELLKDHLTILEELTPIIRRIKR
                     LSTSVEKIKNVGHTIIDDTGKTPTDKKEQTLEKNIESLQSDIKHLKLKRQILFAIKDQ
                     FTLNQVEDDIVTNGPVGAQFFDVVAKAMNIKEKATVLLTLPNSNAGSSLIVKVNQILE
                     NVNRKVFNYLVDFLYSYESGLNAFSERSFSPNSADLDIFRTSLIYLSSDLEYFNEFLK
                     RVTTMRTKNVLDDFLSQFDYKTKDSRPLLLSSGDPLRYIGDVLANVYASIANEADFVK
                     SLFKFQGELIESSSFTISQQSKEFLHGLDGKLLNEIIKSLANACRIRVEQVVKFEQDP
                     VTNLQIFRLLNLYQLMFKKQGINEENILVIELKTLQELSKDQIEKYFVKCMNEIPSVD
                     NTATDLMPPEWLQEYINKLVELFEVYDRGRSPDAEEAPTIDFEKFLNNALEKMIENIL
                     LKGLQQAFPLAKKNDEARSCLLTVQINSLDLIKSRLQPFTSTIFAFNERTAGIWSGIE
                     RKIDDAVSRLLDLQVKLIFEKTGLSLYYNLFNMIFPITSVQDELDYDMYLSLCENPLM
                     KLETIREKVKGSLNEYAPQALTDVQANLLFRLTSPAIADYVCDSCLAKLSLFYVTFRR
                     VLMHLYPDRIEDIASILNFSEEEFKTLIGIH"
     gene            complement(<683125..>684402)
                     /gene="TDEL0C03900"
                     /locus_tag="TDEL_0C03900"
                     /db_xref="GeneID:11500614"
     mRNA            complement(<683125..>684402)
                     /gene="TDEL0C03900"
                     /locus_tag="TDEL_0C03900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680442.1"
                     /db_xref="GeneID:11500614"
     CDS             complement(683125..684402)
                     /gene="TDEL0C03900"
                     /locus_tag="TDEL_0C03900"
                     /inference="similar to DNA sequence:INSDC:YIL103W"
                     /note="similar to Saccharomyces cerevisiae DPH1 (YIL103W);
                     ancestral locus Anc_2.272"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680490.1"
                     /db_xref="GeneID:11500614"
                     /db_xref="GOA:G8ZRY7"
                     /db_xref="InterPro:IPR002728"
                     /db_xref="InterPro:IPR016435"
                     /db_xref="UniProtKB/TrEMBL:G8ZRY7"
                     /translation="MTSEVQNQPQPRRRFVGARKKVENNEACACKDSAVVHKPKARIS
                     AARAINHIPDEILNDEDLLNAIKLLPQNYNFEIHKTVWNIKKQNAKRVALQMPEGLLI
                     YSLIISDILEQFCDCETVIMGDVSYGACCIDDYTARALDCDFIVHYAHSCLVPIDVTE
                     IKVLYIFVTISIDEEHIIKTLKKNFPKGSRLAAFGTIQFNPTIHSIKDRLLNDVDHML
                     YVVPPQIKPLSRGEVLGCTSERLNKEQYDAMVYVGDGRFHLESAMIHNPEIPAYRYDP
                     YSRKFTREGYDQRRLVELRTDAIETARHGKTFGLILGALGRQGNLPTVENLEKKLTAA
                     GKTVVKIILSEIFPQKLAMFSDIDVFVQVACPRLSIDWGYAFNKPLLTPYETNVLLTQ
                     DVMFTEKYYPMDYYEASGYGRGKIPTHATQSSE"
     gene            <684580..>686058
                     /gene="TDEL0C03910"
                     /locus_tag="TDEL_0C03910"
                     /db_xref="GeneID:11500615"
     mRNA            <684580..>686058
                     /gene="TDEL0C03910"
                     /locus_tag="TDEL_0C03910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680443.1"
                     /db_xref="GeneID:11500615"
     CDS             684580..686058
                     /gene="TDEL0C03910"
                     /locus_tag="TDEL_0C03910"
                     /inference="similar to DNA sequence:INSDC:YIL104C"
                     /note="similar to Saccharomyces cerevisiae SHQ1 (YIL104C);
                     ancestral locus Anc_2.271"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680491.1"
                     /db_xref="GeneID:11500615"
                     /db_xref="InterPro:IPR007009"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:G8ZRY8"
                     /translation="MITPKFSVTQDDDFIYINVQISTIRFDAAGLEMVAEGNVFVFHL
                     SPYYLRLRFPYEVVDDERATAKYQAQDESIHIQLPKLEKGKFFEDLDVPTKLLARHGD
                     LVGADEISQQNVDKQRPLIQEIGNEQDNSKKKDLEKISAAGEAFNWEIEQTSEEASDG
                     LLSIKYGFEDSYDSVIGVSVSNGNDINEVDDPEHTSPNDRVKERLRKEDLKFDPEYYV
                     SEYMIRRYAEPDDLEINGIKELLSYTPSLVKEYLKWYKKADDKNAAMPIEFSDQEQSQ
                     MQNNIPRKEYLVSDSKRLYITILNLLFAYMFEAIETEGSHTTESAWSIGKLTPQICCL
                     DQQLLLQDTSDSFSIIKAAIITGIRRSLSYPLHRNYELSIKAWNYVYYILRGGKRLAI
                     RCLLDIHEIFRYHDVYYVYNRILMDDLCSWFISAGSENVIRSLAIEAKKEIDQLTKDD
                     IEFNCISGVDEEAVNAVAWEKLTIREMEILAEGQYQESEETN"
     gene            complement(<686066..>687049)
                     /gene="TDEL0C03920"
                     /locus_tag="TDEL_0C03920"
                     /db_xref="GeneID:11500616"
     mRNA            complement(<686066..>687049)
                     /gene="TDEL0C03920"
                     /locus_tag="TDEL_0C03920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680444.1"
                     /db_xref="GeneID:11500616"
     CDS             complement(686066..687049)
                     /gene="TDEL0C03920"
                     /locus_tag="TDEL_0C03920"
                     /inference="similar to DNA sequence:INSDC:YNL042W"
                     /note="similar to Saccharomyces cerevisiae BOP3 (YNL042W);
                     ancestral locus Anc_2.270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680492.1"
                     /db_xref="GeneID:11500616"
                     /db_xref="InterPro:IPR021216"
                     /db_xref="UniProtKB/TrEMBL:G8ZRY9"
                     /translation="MNTPKNSYSPISHEPPRSLIEVLLGAKIEDTNLGQSALEKGLEL
                     RVEQERTKQLYYKLENTTRSIELLRMAREIGVSPQDIPKLFNGEDFNVAMPVPSKDKP
                     TVNVADNTGRQPLSYRFPPAGSTLPPKPVSNSAPIIPAKRTHSPARIGANAVAALNES
                     ISLKEEDSSTHLSPFANRPSGNISNHSRNISLPMTKSISPNIPSGMTSILSFGRDSSE
                     QLPGSIANANDSDNYDLRRATMAHKKHRRARSASSFGVIDLKMKEESRQQELPKLKTQ
                     INSLPMQPSSTDPEKPHHDYDEKTCSESSSRNGSPTQARSINSVAKLLNSC"
     gene            complement(<687417..>688013)
                     /gene="TDEL0C03930"
                     /locus_tag="TDEL_0C03930"
                     /db_xref="GeneID:11500617"
     mRNA            complement(join(<687417..687923,687990..>688013))
                     /gene="TDEL0C03930"
                     /locus_tag="TDEL_0C03930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680445.1"
                     /db_xref="GeneID:11500617"
     CDS             complement(join(687417..687923,687990..688013))
                     /gene="TDEL0C03930"
                     /locus_tag="TDEL_0C03930"
                     /inference="similar to DNA sequence:INSDC:YNL044W"
                     /note="similar to Saccharomyces cerevisiae YIP3 (YNL044W);
                     ancestral locus Anc_2.269"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680493.1"
                     /db_xref="GeneID:11500617"
                     /db_xref="InterPro:IPR004895"
                     /db_xref="UniProtKB/TrEMBL:G8ZRZ0"
                     /translation="MNQLGTLSQVSRFTEDLSMDRIKTELRSLQSRLASVRPPQEFFN
                     VKNVSKPQNFSDLQSRVSYNLKYYSTNYGLIIGALSVYTLLTNILLLFVIVLVFISIA
                     GINKLDGQDLVTPFGSFKTNQLYTALLFVAVPLGFLASPISTLLWLIGASAVTVFGHA
                     SLLEKPIETVFEEESV"
     gene            <689070..>691289
                     /gene="TDEL0C03940"
                     /locus_tag="TDEL_0C03940"
                     /db_xref="GeneID:11500618"
     mRNA            <689070..>691289
                     /gene="TDEL0C03940"
                     /locus_tag="TDEL_0C03940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680446.1"
                     /db_xref="GeneID:11500618"
     CDS             689070..691289
                     /gene="TDEL0C03940"
                     /locus_tag="TDEL_0C03940"
                     /inference="similar to DNA sequence:INSDC:YIL105C,YNL047C"
                     /note="similar to Saccharomyces cerevisiae SLM1 (YIL105C)
                     and SLM2 (YNL047C); ancestral locus Anc_2.267"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680494.1"
                     /db_xref="GeneID:11500618"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G8ZRZ1"
                     /translation="MTSNISEVLAQQQHNLQHLQNLQQHTRSLTSNEYPSNLSYLPQN
                     SGIRQQYIQEQQPQQPQLPIQSQPQPYPMDGMTSVSPAQNTLTTQAARTNSMSTYQNP
                     NAVPVGCLAPSPVPMQNPQQVQGLLQSQPQSQPQSQPYAQVPLRQQPVQQQAYQMQQN
                     ATQQTFNGVGNSSRAALQGRNSLTSNSNVSRARTSIHRSANNANTQQDPRSPLVILMP
                     TSAQPTEVLANRFAAWRSVIRAIITYLTETASIQDEIVRQQLRLTHAVQFPFFAVENQ
                     HQPANPEDKSIQKFFLPLGNGSIQDLPTILNQYHGSLASHASRASKELTNEVIPRLED
                     LRRDLLVKMKEIKSLQSDFKNSCSKELQQTKQDMRNFLESIEESRYGSAKQDPYLTKT
                     ILDRQIKKQLTEENFVHEAFDNLENSGAELEKVVVMEIQNALNIYARLLGEEAQLAFD
                     ILLSKMETGFFNKNPQFEWENFIMRDPNFIVPNLPMRKMREIVYKNQQDPLTYEIRSG
                     VLERRSKFLKSYSRGYYVLTPSFLHEFKTGDRKKDIVPVMSLSLNECSVAEHSKKGSS
                     DDRFILHAKQNGLIHRGHNWVFRADNYETMMAWFEDLKVFTSANNAQEKAKAVVERLN
                     LDSDGRPKTNGMEAAQQEPARTSMSQPPQENRRISQENHRISQDNRRLSHDNRRDSTD
                     LQSNTNVPASTPRLDNQTNTITTSSIPDTNDFEIDHSIPNIYIDIPANEAKNRGQQM"
     gene            complement(<691377..>693089)
                     /gene="TDEL0C03950"
                     /locus_tag="TDEL_0C03950"
                     /db_xref="GeneID:11500619"
     mRNA            complement(<691377..>693089)
                     /gene="TDEL0C03950"
                     /locus_tag="TDEL_0C03950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680447.1"
                     /db_xref="GeneID:11500619"
     CDS             complement(691377..693089)
                     /gene="TDEL0C03950"
                     /locus_tag="TDEL_0C03950"
                     /inference="similar to DNA sequence:INSDC:YNL048W"
                     /note="similar to Saccharomyces cerevisiae ALG11
                     (YNL048W); ancestral locus Anc_2.266"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680495.1"
                     /db_xref="GeneID:11500619"
                     /db_xref="GOA:G8ZRZ2"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="UniProtKB/TrEMBL:G8ZRZ2"
                     /translation="MSREWLHTSAVIAVICIVIFLRGLVRALPDFTMNPPVRYRLRIN
                     NAMKRLESDPTKNVKLDFSWKHGSVRRQMILASAKPSEYTNGVTSSNRISIGQTDKGN
                     RESFVNRLIPQVRKNRKVLFGFFHPYCNAGGGGEKVLWKAVESTLSKDSRNVAIIYTG
                     DTDASKQEILNNVLKRFDYELDKDRVVFIYLKNRKYVDSKMWPRFTLIGQALGSILLT
                     IEAIYRCPPDVWCDTMGYPFGYPAVHYLARIPIVTYTHYPVISSDMLQKLQNMNKSLK
                     TTIKYWYWKLFMLWYKYVGTFVDIATTNSTWTNNHMKQIWKSCEPVIIYPPCSTEKLI
                     VQDEQWDRKNQAIVLAQFRPEKRHELILQSYSQFLEIAGDISHAPKLILIGSTRSQAD
                     RDYVNHLREWSSTDLKIPSNLVEFQTDCSYEKIKVYLRESSYGINAMWNEHFGIAVVE
                     YAASGLIPLVHASAGPLLDIVVPWDTQQRKQVEKSTTESRTGFFFKDKSDPDYDKAHD
                     GEKYPTLSELFVTAVNLTDNEKLSISKRGRECVLFKFSDLKFHQDWDQVLVQLDGILH
                     SLEN"
     gene            complement(<693206..>694191)
                     /gene="TDEL0C03960"
                     /locus_tag="TDEL_0C03960"
                     /db_xref="GeneID:11500620"
     mRNA            complement(join(<693206..694115,694172..>694191))
                     /gene="TDEL0C03960"
                     /locus_tag="TDEL_0C03960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680448.1"
                     /db_xref="GeneID:11500620"
     CDS             complement(join(693206..694115,694172..694191))
                     /gene="TDEL0C03960"
                     /locus_tag="TDEL_0C03960"
                     /inference="similar to DNA sequence:INSDC:YIL106W"
                     /note="similar to Saccharomyces cerevisiae MOB1 (YIL106W);
                     ancestral locus Anc_2.265"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680496.1"
                     /db_xref="GeneID:11500620"
                     /db_xref="InterPro:IPR005301"
                     /db_xref="UniProtKB/TrEMBL:G8ZRZ3"
                     /translation="MSFLQNFHLSPGQTIRSTRGFRWNTNANKDDDSIKGSPKRSRDD
                     RAGLFPAQPNPHGLDTQLWTTPTRDAQPFSENELPLPLQQQQTLRENGVVTDFNYTPS
                     HQKPFLQPTAGTTVSSHQDLKQIVEMTLGSEGVLNQAVKLPRGEDENEWMAVHCVDFY
                     NQINMLYGTITEFCSPQSCPRMIATNEYEYLWSFQKGQAPVAVSAPKYVECLMRWCQD
                     QFDDESVFPAKMSGQFPPKFIERYVVQMLRRLFRVYAHIYCHHFNEVLELNLQTVLNT
                     SFRHFCLFSQEFELLRPADFGPLVELVMELRDR"
     gene            <694911..>697328
                     /gene="TDEL0C03970"
                     /locus_tag="TDEL_0C03970"
                     /db_xref="GeneID:11500621"
     mRNA            <694911..>697328
                     /gene="TDEL0C03970"
                     /locus_tag="TDEL_0C03970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680449.1"
                     /db_xref="GeneID:11500621"
     CDS             694911..697328
                     /gene="TDEL0C03970"
                     /locus_tag="TDEL_0C03970"
                     /inference="similar to DNA sequence:INSDC:YIL107C"
                     /note="similar to Saccharomyces cerevisiae PFK26
                     (YIL107C); ancestral locus Anc_2.264"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680497.1"
                     /db_xref="GeneID:11500621"
                     /db_xref="GOA:G8ZRZ4"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR016260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G8ZRZ4"
                     /translation="MFKSVQYFDSSVQSPSDSEVEPTESRGDDSGSEVGPKAPVQQGS
                     RDKHVRIMVDEDDDDADEKQEGGERTGDCLPSFQKRPLSDTPVTSTWNSPASSTDNTP
                     LTSPESSSTNLTHLLPHREVSSEGAAIPAGVRESMSPPAASGALSPSRFPHPTRRPTT
                     IDVPGLTKSKSSPDGTISKEDPGSKLVIVMVGLPATGKSFITNKLSRYLNFSMYYCKV
                     FNVGNTRRQFAKEHNISDQDSKFFDPGNNEFSKLRDKWAMDTLEQLLDYLLEGPGSVG
                     IFDATNTTKERRKHVYNKIHERNPHLKVLFLESVCSNKAVVERNIQLKLFGPDYKGKD
                     PDASLKDFKERLSNYMKAYEPIEDSENFQFIKMIDVGKKVIAYNIQGFLASQTVYYLL
                     NFNLTERQIWITRNGESEDNVDGRLGGDSNLTPRGERYARALASFIDSQRTLFYANEC
                     EKKGKSPGDDDTQCNEFFVWTSMRNRSIETAKFFNEEDYPIKQMRMLDELSAGDFEGM
                     TYPEIQEEYPVEFEKRRKDKLRYRYPGIGGESYMDVTNRLRPVIAEIERIDDNVLIIT
                     HRVVARILLGYFMNLNKDIIANVDVPLHCVYCLELKPYGITWALWEFDESTGDFFKVP
                     QSEMNTTKVKENELVYKERRYSLVPTAPASANNSLSDVRVRKNDSSRSSSLTRDESST
                     SLSTSSDTKDVMHPNSAPAIPFAHGLPTITNLMDGGGTSISTNRPRQTTALQNHVKSS
                     LLNNSMGNLRPATSPRQTFEIDKLNQKLANLKTRSPRKSGDEKDTELAKIDTNTLSRK
                     SSDVQQK"
     gene            complement(<697431..>699503)
                     /gene="TDEL0C03980"
                     /locus_tag="TDEL_0C03980"
                     /db_xref="GeneID:11500622"
     mRNA            complement(<697431..>699503)
                     /gene="TDEL0C03980"
                     /locus_tag="TDEL_0C03980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680450.1"
                     /db_xref="GeneID:11500622"
     CDS             complement(697431..699503)
                     /gene="TDEL0C03980"
                     /locus_tag="TDEL_0C03980"
                     /inference="similar to DNA sequence:INSDC:YIL108W"
                     /note="similar to Saccharomyces cerevisiae YIL108W;
                     ancestral locus Anc_2.263"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680498.1"
                     /db_xref="GeneID:11500622"
                     /db_xref="InterPro:IPR001229"
                     /db_xref="InterPro:IPR021917"
                     /db_xref="UniProtKB/TrEMBL:G8ZRZ5"
                     /translation="MGGSDAIELFNLQDQTQLVSPCLTVHGTCKNATGARMIQVLHPQ
                     LPRLSYPLNESGFKATIILTPGENRLTFATDTNKSKTVTCYYTPLLQDPPIHLCLLVA
                     KDSPLEFDSPKVQRDKEGGNGLDLAVKKLRVGARLMQAYTNEQMMRAGFGNRTFRFLE
                     EFTWDTTFQQRSEMRNTVKIHILRSDKSTKEIRDANLAQQNPNASDAGGLFGVAMDAL
                     QKYGGPFADRVKPVQAAVMFLDTHWDGNLITAHAALGGGTDEVKLAIFGSHALFAWPP
                     HLEQLVEYFTDETRTSKKEVANDCDECGTHWEAFTLTLGAFLHEIGHSLGCPHEESGV
                     MLRDYTTLNRSFVTREAFSIRTNSYGAKSPIYPKEECTWHRLDLVRFLYHPSFTLPQD
                     YLDPSFLRPGEIDKFTEPKPSIYALGDDLCRITSRTGVYLIEIVCGDLTKAYIEYLPV
                     SLGGPGPQHDLTLSLSELRSLIPPNEMPEHGNSFGLKLLSVNAPGLEIGKFPDFLKVT
                     FIPMDQYGFPRGVQGVKSQLLGNPSGGQDVGIVPIDIRRVTAVRIYHGGALDGMRFYF
                     SSQTESANPPVPPRNYLGKLVKSFKATSIDNTSGKNVLFGYETGSYTDAVLEEGEYIT
                     GFNVRCGGWIDALQIVTNEGRVTKMLGNEGGGGLIELRPPEGQYILGLYGNVGQWVDA
                     MGIIYGRL"
     gene            <700038..>702758
                     /gene="TDEL0C03990"
                     /locus_tag="TDEL_0C03990"
                     /db_xref="GeneID:11500623"
     mRNA            <700038..>702758
                     /gene="TDEL0C03990"
                     /locus_tag="TDEL_0C03990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680451.1"
                     /db_xref="GeneID:11500623"
     CDS             700038..702758
                     /gene="TDEL0C03990"
                     /locus_tag="TDEL_0C03990"
                     /inference="similar to DNA sequence:INSDC:YIL109C,YNL049C"
                     /note="similar to Saccharomyces cerevisiae SEC24 (YIL109C)
                     and SFB2 (YNL049C); ancestral locus Anc_2.262"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680499.1"
                     /db_xref="GeneID:11500623"
                     /db_xref="GOA:G8ZRZ6"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:G8ZRZ6"
                     /translation="MSHHRKRVYPQAQVQYAQDGFGQQPMMAADAGYPPTGSPAMYPQ
                     QPQGAPQAPLQQQFFTPVQQQLHQQIDQATSAMDNMQLHNVPAVDPNTFYQQQQTTAA
                     PQGYPQMQYQQQAAGIPSRGSKPMNQLYPIDLLTELPPPVNDLTLPPPPMMVPPEKVL
                     VPSEEANAPTDYIRCTLNAVPKSNSLLKKSKLPLALVIRPYQHLQDDINPPPLNEDGL
                     VVRCRRCRSYMNPFVNFTDQGRRWRCNFCRLANDVPMQFDQTMSGVPANRYDRNEVKY
                     GVMEYLAPKEYTMRQPPPSTYAFILDVSQNAIKSGLLATATRSLLEVLDSLPNHDSRT
                     RVSIICVDNAIHYFSIPLDEDSDQVKMMDVCDLDEPFLPLPTSMVVNLNSSRKNIEKL
                     LNQIPEIFQFNIMSKFALGPALKSAYNLIGGIGGKIIVVSSTLPNIGIGKLQKRNENG
                     VVNTSKESSQLLTCQDSFYKSFTIDCSKSQITVDMFLASEDYMDIATLSNLGRYTGGQ
                     THFYPGFSAAKLTDVTKFTKEFSKHLCMDISMETVMRARGTSGLRMNSFYGHFFNRSS
                     DLCAFSTMPRDQSYVFEVAMDETIVGDYCCFQIAVLLSLNTGQRRIRVITVCLPTTES
                     LAEVYASADQLAMTSYFTQKAVEKAVSSSLEDARELLNRAVQDILAVYKKEIVVSNTA
                     GGAPLRLCANLRMFPLLMHSLTKHMAFRPGIVPSDHRAAALNNLESIPLPYLIKTIYP
                     KVYSLHDMPDEVGFPDENGHIVLPEPINASASLFERYGLYLIDNTTELFLWIGGDAVS
                     ELVTDVFGAPDIFEVPIGKQELPVIEGSEFNNRIKSIISKIREHDDVITYQSLYIVRG
                     ASLSEPVNHASAREVATLRLWATSSLVEDKVLNSESYREFLQNTKMKITK"
     gene            <703015..>703777
                     /gene="TDEL0C04000"
                     /locus_tag="TDEL_0C04000"
                     /db_xref="GeneID:11500624"
     mRNA            join(<703015..703031,703120..>703777)
                     /gene="TDEL0C04000"
                     /locus_tag="TDEL_0C04000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680452.1"
                     /db_xref="GeneID:11500624"
     CDS             join(703015..703031,703120..703777)
                     /gene="TDEL0C04000"
                     /locus_tag="TDEL_0C04000"
                     /inference="similar to DNA sequence:INSDC:YNL050C"
                     /note="similar to Saccharomyces cerevisiae YNL050C;
                     ancestral locus Anc_2.261"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680500.1"
                     /db_xref="GeneID:11500624"
                     /db_xref="InterPro:IPR018555"
                     /db_xref="UniProtKB/TrEMBL:G8ZRZ7"
                     /translation="MAEYQMYIFAQSSTDEVNHTTTTYESPVDLELVEVDVQTDGPKE
                     DAEADENDEFDFPLFSFGVAGNNTEQGEEKSTGTGRLMKVSLREPEYTIATQERPKEY
                     YFATYTEDDHQKFSRSAIDYETAMKDASLGPYQGWSRWRGTMVDLNEYSTKIESSLRR
                     QKKLQTRRPGQKQRLAKKMGMQREKERQEKAQEIKKMMKKRFHKRGGKKNKKKAEPVT
                     PRFRTE"
     gene            complement(<703859..>705025)
                     /gene="TDEL0C04010"
                     /locus_tag="TDEL_0C04010"
                     /db_xref="GeneID:11500625"
     mRNA            complement(<703859..>705025)
                     /gene="TDEL0C04010"
                     /locus_tag="TDEL_0C04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680453.1"
                     /db_xref="GeneID:11500625"
     CDS             complement(703859..705025)
                     /gene="TDEL0C04010"
                     /locus_tag="TDEL_0C04010"
                     /inference="similar to DNA sequence:INSDC:YNL051W"
                     /note="similar to Saccharomyces cerevisiae COG5 (YNL051W);
                     ancestral locus Anc_2.260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680501.1"
                     /db_xref="GeneID:11500625"
                     /db_xref="GOA:G8ZRZ8"
                     /db_xref="InterPro:IPR019465"
                     /db_xref="UniProtKB/TrEMBL:G8ZRZ8"
                     /translation="MSDDLEDFEVLLSQDFSATQFCNDLLKTTNRQPTTTELELGTPM
                     KKIRYDLEEVESRITETIKNNPAHVLDQIYKSKSLEDVARSNIKPSLEYLDISYKRLQ
                     QEVLEPYERAQVLQNVLSKVHQTSLLLRDGAIYIHLANRIQFITSKQTHYSINTALEL
                     VTYYTQINLSMSENVNLKSLRLIKQLETEVVIPVRKELINFLSLTLTKTLATPEQVQK
                     DQEIISKLAKALHNMSQRDFVTTIQKAVLSHVAVTVQALAKTINSIKDFPVALEDAMK
                     RSMAIESLELILHEVKVEKTSLLADYMLQVKPKNVRPHHLFWKKVSDAFKKEFDTSYS
                     RGGPVGKSLARNGGMIIDTIKQRMADTITNDADSQDMDVMLHAVSIINPQAETN"
     gene            complement(<705161..>706261)
                     /gene="TDEL0C04020"
                     /locus_tag="TDEL_0C04020"
                     /db_xref="GeneID:11500626"
     mRNA            complement(<705161..>706261)
                     /gene="TDEL0C04020"
                     /locus_tag="TDEL_0C04020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680454.1"
                     /db_xref="GeneID:11500626"
     CDS             complement(705161..706261)
                     /gene="TDEL0C04020"
                     /locus_tag="TDEL_0C04020"
                     /inference="similar to DNA sequence:INSDC:YIL110W"
                     /note="similar to Saccharomyces cerevisiae YIL110W;
                     ancestral locus Anc_2.259"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680502.1"
                     /db_xref="GeneID:11500626"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZRZ9"
                     /translation="MSFSFGFTSTDFSDDELDGEIQQGQSQVGSTIQSSHPLDAAHLS
                     CKDVVQPLWENLEAMIKSLENVRISFEEFRTPQNNTVLYRRELFDVKHQLMSEADEGN
                     DEKVELDILIGETSEDLRKNVYEGGLKSWECSIDVVDSLSVSDAQLKNVDCVLELGCG
                     TALPTEYIFSRYLKEQSKSGCKFILSDYNNSVLRLVTIPNLIITWAKTILSDEQWIQL
                     QQSGNEDIPIRTDELLLTAGFLEAFYQDIKERNISIDVISGTWGRCFSNLIPARLDTG
                     KEILIISSETIYQPENLPVVAETILEVILSKQPGNVKAIVAAKDIYFGVGGSIMEFEK
                     YLKKRIANAALPITYSTYKVDSGLKRSIISIQ"
     gene            complement(<706662..>707150)
                     /gene="TDEL0C04030"
                     /locus_tag="TDEL_0C04030"
                     /db_xref="GeneID:11500627"
     mRNA            complement(<706662..>707150)
                     /gene="TDEL0C04030"
                     /locus_tag="TDEL_0C04030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680455.1"
                     /db_xref="GeneID:11500627"
     CDS             complement(706662..707150)
                     /gene="TDEL0C04030"
                     /locus_tag="TDEL_0C04030"
                     /inference="similar to DNA sequence:INSDC:YNL052W,YIL111W"
                     /note="similar to Saccharomyces cerevisiae COX5A (YNL052W)
                     and COX5B (YIL111W); ancestral locus Anc_2.258"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680503.1"
                     /db_xref="GeneID:11500627"
                     /db_xref="GOA:G8ZS00"
                     /db_xref="InterPro:IPR004203"
                     /db_xref="UniProtKB/TrEMBL:G8ZS00"
                     /translation="MTIILTGIESFIVLRTSFTRVARVTPVRFAQTQALSKAAIADLQ
                     NRWEAMPAAEQQDIVSKLSERQKLSWGDLTETEKQAAWYISYSEWGPRRPVHGKGDSG
                     YIAKGVAIGLLFSVGLFAFARQFGGEPPKTMTKEWQLKSDEYLKSKNANPWNGYSQVQ
                     SK"
     gene            complement(<707532..>710555)
                     /gene="TDEL0C04040"
                     /locus_tag="TDEL_0C04040"
                     /db_xref="GeneID:11500628"
     mRNA            complement(<707532..>710555)
                     /gene="TDEL0C04040"
                     /locus_tag="TDEL_0C04040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680456.1"
                     /db_xref="GeneID:11500628"
     CDS             complement(707532..710555)
                     /gene="TDEL0C04040"
                     /locus_tag="TDEL_0C04040"
                     /inference="similar to DNA sequence:INSDC:YIL112W"
                     /note="similar to Saccharomyces cerevisiae HOS4 (YIL112W);
                     ancestral locus Anc_2.257"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680504.1"
                     /db_xref="GeneID:11500628"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8ZS01"
                     /translation="MNEHVDPSVKKRSLSNYLSNVNLRREELEKLKKRQDEEKQQLAV
                     QQEQLKQEEQEREKERLVKEQREQEALRRKEDQQKKTVPTEQAEIKENDIPQQAAVKD
                     NESNLRSLDLNVEERRRSIPGDKVGDAVNTFKDHNSPQPGTSYNAQEIEKPKSETISR
                     DDLHAMLKEPKIRRSGVVAGDNCEDEGAIDKEPKKEELSEEEIASDAPTEPASPPKPR
                     RRRLIRGDRLSSLSPRHSTFDNESDSELSDIDELKSLKISSSFIHGDSSPVRDSHDSR
                     HRYHQPSSPRLVRRSTSPGRAKHHIAVPKASKQKKGIYRDAGGRTRLQISCDKGNYEQ
                     AKKLIEEEGYDVNDQDNAGNTALHEAALNGHLDIVKLLIENGADVNMQSFEMFKDTPL
                     IDASANGHLDVVKYLLSHGADPTICNAKGLTAFESIEDSDLDEQERDIVHEIKRNLRS
                     AARNWKDEKAVPGVLNKKDKHLKNQSQLSQRSEELLGDFEFFWTDITSRAGKEKLFKA
                     SKEGKLSYVGAYLENGGKIDLKSFFEAVKFGHEDIVSLFLAFGAPVNAVSKNGTTALI
                     CAVGRGHVGTVKLLLEAGADPSKKDKNGHTASHYAENSPMGVVNTEEIELLEQAIKKS
                     SSHVTSKEKCIKKSLEQAHVEEKTIINRQEDITDNHKDQEDDENVISIARKRRTVSPD
                     RLENKRQTLLSEILSPEAIEPREAVSPQNIRDSKTSETSTPELESVKIPEQTPEEKEQ
                     RLKAEEEYIQRRLLNKRRKEQELLRKLALDEEKREKERAQQKIEEAKKLQERERLKQI
                     ELENKNKEAELVRRREIRSLYPIGLRLVDFNNADDYHDYLPLYFAQVGEDGSKYVLDL
                     QVCVILKDTNFLYNEHNIQNNIPVQLKHKRQLWNIMKFIFLNGGKNAFDWNSCSLQDR
                     IQFELQEYKKFSNLPLQWIKLQDICISDVSKRQQIEQGIVQIVLTDNIDEAWDIPTAK
                     ELAIETVQPHFLPNKFQKRHTVTHILQNHKTQPLW"
     gene            complement(<710821..>712128)
                     /gene="TDEL0C04050"
                     /locus_tag="TDEL_0C04050"
                     /db_xref="GeneID:11500629"
     mRNA            complement(<710821..>712128)
                     /gene="TDEL0C04050"
                     /locus_tag="TDEL_0C04050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680457.1"
                     /db_xref="GeneID:11500629"
     CDS             complement(710821..712128)
                     /gene="TDEL0C04050"
                     /locus_tag="TDEL_0C04050"
                     /inference="similar to DNA sequence:INSDC:YIL113W,YNL053W"
                     /note="similar to Saccharomyces cerevisiae SDP1 (YIL113W)
                     and MSG5 (YNL053W); ancestral locus Anc_2.256"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680505.1"
                     /db_xref="GeneID:11500629"
                     /db_xref="GOA:G8ZS02"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G8ZS02"
                     /translation="MAQQEEKTATTPSIVEIRSRSPRSLQTRNTKNLSLNIRDKKVSG
                     AELEDLDKIPSVITKPVVIGTTKHPMVSQPIRSDASIYSLPSGKKSGSASPIYATNIY
                     GSSANSNKIGRVHSMSLSLKTGELLPSLGARGRSQTISSALETSTPEVGRFNMDMDKK
                     EWILPNKGEVDSEELLHPDVFKKNAYPNGPLLVVPPNVYLYSEPTLKEILQFDVVINV
                     AKEVTNLGPMLPQKKAISYHHVNWSHNSKISVDLDRLTDIIHEATTQNKKVLVHCQCG
                     VSRSASLIVAYIMRFFQMGLNDAYSHLKRIAKDTSPNMGLIFQLMEWNEQRTRITNDP
                     QGSEHDLSNTNLSFGMVIPNASSSINDLTIGSPELTPRTPGDYFNKFSASSSSTSTSS
                     STFVGNQSNSKPVTISTNLCDYLPTTSAGPIATSTDDFWTQSL"
     gene            complement(<712688..>715552)
                     /gene="TDEL0C04060"
                     /locus_tag="TDEL_0C04060"
                     /db_xref="GeneID:11500630"
     mRNA            complement(<712688..>715552)
                     /gene="TDEL0C04060"
                     /locus_tag="TDEL_0C04060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680458.1"
                     /db_xref="GeneID:11500630"
     CDS             complement(712688..715552)
                     /gene="TDEL0C04060"
                     /locus_tag="TDEL_0C04060"
                     /inference="similar to DNA sequence:INSDC:YNL054W"
                     /note="similar to Saccharomyces cerevisiae VAC7 (YNL054W);
                     ancestral locus Anc_2.255"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680506.1"
                     /db_xref="GeneID:11500630"
                     /db_xref="InterPro:IPR024260"
                     /db_xref="UniProtKB/TrEMBL:G8ZS03"
                     /translation="MVEGDHKLIVETETVEAPVSSLLMASTGTGNNGAGGNVNCAKVQ
                     LKDALEHGVPPAAIKTVTANSLGSKNDAGLLKKNYSVLPAGASSVAHDGLTDSGSNIN
                     LIDNNPLSPHISQASVRNKKSSLLIDSANDKTAEGDDVPKGRGMEGDKTLRKHMEEIA
                     NANRDDVESKTNGETEHNVSRSAQSSKTSTTVPTPLMLPVATHAIAGAIVPPTSTVSA
                     TTGTQANRPTETKPSKIIERPPITATNSRDVLLDDEVRKKAVNGTTTGGVNANADLAL
                     KKSSTVHSEDIHHDLDSLQKPTKADFFAARLASAVGENEISDSEETFIYESAANSTKN
                     AIAPPAFDQHNDHSQQLQHGIASKMSVPVLNNNAKLLSRLKNTRHTSMSALPISASTK
                     HLANDIANRNESLVTSTPVPNPTSSAPNDDAASTKSSDHLNGAKVNDLQSVKSVHSEM
                     RSPDKRLSLTSMGKMNPTGNLLNNATKNGHTSRKPSVSNSTLRHVSSTQAGTARGKFV
                     TKPDGDNNKRNLRTTASKIFDANGAPLRRYSGVPDDVNLEDFIEQSNGHYMTNPSNQR
                     DDRTRNFLENNHNNDKRFSRDMTEPYNRSAIQEEEGENDRDEDDLRSMFYYNHRGDLE
                     ARPQISDYEEDGEGIDDDNHDDKYYNGSFRNGYNGNGSANYDNGRPTRLLESQFSPSD
                     MHFAPHNFNQPNPNGAQNAQYNSNANEQTPLRIRKPLSRNQLSYSPHNFYTRKSSWAK
                     IRHCVYFTFIVISLLTVGFILGFLLATNKELQGFNIVIMDNILSSSDELLFDITVTAF
                     NPGFFAIGVQDVNLDIFAKSSHIPKTMMLESGSNTSPSRETILLGTVCSLETPLKFEG
                     GFLKRSYDVSVSTVKLLDPGSKADNPDDDEGKKGDSQKKDDVAKWKSLIQHEYELIVR
                     GSMQYKIPFFRSNKSIAVQSSADVHPGKDGDEEYNKFLLL"
     gene            <716187..>717032
                     /gene="TDEL0C04070"
                     /locus_tag="TDEL_0C04070"
                     /db_xref="GeneID:11500631"
     mRNA            <716187..>717032
                     /gene="TDEL0C04070"
                     /locus_tag="TDEL_0C04070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680459.1"
                     /db_xref="GeneID:11500631"
     CDS             716187..717032
                     /gene="TDEL0C04070"
                     /locus_tag="TDEL_0C04070"
                     /inference="similar to DNA sequence:INSDC:YIL114C,YNL055C"
                     /note="similar to Saccharomyces cerevisiae POR2 (YIL114C)
                     and POR1 (YNL055C); ancestral locus Anc_2.254"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680507.1"
                     /db_xref="GeneID:11500631"
                     /db_xref="GOA:G8ZS04"
                     /db_xref="InterPro:IPR001925"
                     /db_xref="InterPro:IPR023614"
                     /db_xref="InterPro:IPR027246"
                     /db_xref="UniProtKB/TrEMBL:G8ZS04"
                     /translation="MAPPFFSDINKGVNDLLNRDFYHTSVAAVDVSTVAKNGVKFDLK
                     AKQTVKDGPLAANIETKVSDKATGLTLTQGWSNSNNLNTKIELADVTPGLKSELVTSL
                     VPGVSKAAKLNVNFVQPFFTARGAFDLLKGPSFVGDLTLAHEGIVGGAEIGYDITGGS
                     LSRYAVGLGYSAGDYSLGLSINNAQLTTVSFFQKVSPILQVGAKAISTPKQLANVNIE
                     FATLYLPDPTSQVKAKVADSGIVALAYKQQLRPGVTLGVGASFNALNLSEPVHKIGSS
                     LSFSA"
     gene            <717789..>722240
                     /gene="TDEL0C04080"
                     /locus_tag="TDEL_0C04080"
                     /db_xref="GeneID:11500632"
     mRNA            <717789..>722240
                     /gene="TDEL0C04080"
                     /locus_tag="TDEL_0C04080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680460.1"
                     /db_xref="GeneID:11500632"
     CDS             717789..722240
                     /gene="TDEL0C04080"
                     /locus_tag="TDEL_0C04080"
                     /inference="similar to DNA sequence:INSDC:YIL115C"
                     /note="similar to Saccharomyces cerevisiae NUP159
                     (YIL115C); ancestral locus Anc_2.253"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680508.1"
                     /db_xref="GeneID:11500632"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:G8ZS05"
                     /translation="MSVVGEEVSTETSEDFGFKKLGQATILPSYNEKLPYTSLQNLDI
                     SNEKCRYVATSGGKVVIGDLQSLREFIQNDENTEISFLWERELKDVMMVKFSVSEDVV
                     IVCKDGSVYTVDQNSLNDPKNIYKFDKALSQAQLFQSSLLAITIDDQLFSYNLAQSSL
                     SSSIADNLASFDIMDNELYLLLDDYSVQVKNLQNNHETIKKLSAPQELMDEFHDQYHP
                     NIIKVLNKNQLLLVFGEKVSETDEDVMYDHKFFIVDHSADQPTFSESFDMTPAFGSVL
                     RYPTSYNIRIQEPVPEYEVINVLASACSSEVTIWDSKEVIQPSQDSERAVLPISKTTD
                     NDTNPIGVSLDVSTHGVITDPCPGVDKIDRLPLIYILNDEGNLQIVGLYHSSAIKSGN
                     FSVPNVEEASSRTIEQKTSTTSISDKDSGSVSLSDLSLGSKKETTDVDEAKSTDNDNS
                     SSGFEMQSSNKAESKPLFGSSVSDAPTSEVPNKKDDSAAQPFSIYGNKAAFGAPAFGT
                     PAFGTPAFGASDAKPAFGQTSFGSSDTKSAFGAPAFGTLDSKSPFGAPSFGSSDSKPA
                     FGTPSFGGSGFGALSFGSSDSKPTFGNPSFGGSDSKPGFGAPSFGSSDSKPTFGNPSF
                     GGSDSKPTFGNPSFGGSDSKPAFGAPSFGSSDTKSAFGGPAFGSSDTKASFGAPSFES
                     ADSKPAFGTPSFGGSDSKPAFGAPSFGNLNSKPTFGKPAFGSSALSTIDKKVQNEQSP
                     FANSTFSKFAGENPFTSKKNERSPFASLSGDEGEKQTSSPFKLDTTQSPFAKLEASKA
                     DTELFNLKSKLATASEQEFKSNDVTADEISATENEVESESEPDSHSGSEESDFQKNVQ
                     GESSAETATFEPKGKEIEHAMPSRKSTEAADDTQDNTNSDLSDSTIEQTPSVQVQPAK
                     AGYSDSSISAITARIKAGAKVSSDDLKLNQFEEPKFTDQTRGNSPFSAFANNLDKASP
                     SGFSFAKISAGNEGSEDSKPKEALTENRKGESLSESLTESAAEMEEESASDASGVSEE
                     KSSAVDATPYADDKDSQRKEDREEEANESEQQRTGMTDEPEEFTSKEIQEAIASDVDG
                     SQGGDVAPREDLIKTPNSESLEKADSAREESYDALDDVTQGELEAAMGGAQLVEDDDE
                     QNTADKAVPTSDYKPQEKVVVTQGVQAPEVSDNACQTVSPASCDFEVQTFQNEESYVA
                     TQHKPKPVPSYFTGANITQLQYSSSDPIMKSIEKTYQVVSAEMSVLRENASKMNEFMV
                     DQSTRYLENRSKKTISNIYTWRIPESEQLQAIITEETKPFVDKLQKIEKLQQDLAKLE
                     LNDTKPLKEELRKAKTEYYQCETLDCNPELGELKYHQLKMQHELRQKMSKLTEKFEHV
                     EELVQILKLCTVENQRIQDNPYVSKLVKDSARRQNLLDEIVSLREEIHALNSTSRAVH
                     APEKSSTGYSVGKEEIQSAPVVELGLQLSTKQQLGEYLKKQRKIPGA"
     gene            complement(<722310..>723461)
                     /gene="TDEL0C04090"
                     /locus_tag="TDEL_0C04090"
                     /db_xref="GeneID:11500633"
     mRNA            complement(<722310..>723461)
                     /gene="TDEL0C04090"
                     /locus_tag="TDEL_0C04090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680461.1"
                     /db_xref="GeneID:11500633"
     CDS             complement(722310..723461)
                     /gene="TDEL0C04090"
                     /locus_tag="TDEL_0C04090"
                     /inference="similar to DNA sequence:INSDC:YIL116W"
                     /note="similar to Saccharomyces cerevisiae HIS5 (YIL116W);
                     ancestral locus Anc_2.252"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680509.1"
                     /db_xref="GeneID:11500633"
                     /db_xref="GOA:G8ZS06"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR005861"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8ZS06"
                     /translation="MTFDLSKIVRPKIYNLEPYRCARDDYKEGVLLDANENANGPVPR
                     DLAGLNLHRYPDPHQIEFKTAMANYRNRTSSFKDITPLTAENLCLGVGSDESIDAIIR
                     ATCVPGKEKIMAMPPTYGMYSVCASVNDVEIVKCPLVTSDNSFQVDTEAVLDTLKKDP
                     LIKLVFITSPGNPTGAKIETSRIEKILQNWDQGILVVDEAYIDFCGGSTAPLVNKYPN
                     ICTLQTLSKSFGLAGIRVGMTFTSKEFAKVLNSMKAPYNISSITSEYALKAVEDDAFT
                     AMEENAKAVNKEKQRLLKSLTSLDFVDDQYVGGIDSNFLLLRINKGDNKLAKALYRKL
                     ATESAVVVRFRGTELGCEGCLRITVGTPEENDILIREFAKQLKALASTC"
     gene            complement(<723562..>724125)
                     /gene="TDEL0C04100"
                     /locus_tag="TDEL_0C04100"
                     /db_xref="GeneID:11500634"
     mRNA            complement(<723562..>724125)
                     /gene="TDEL0C04100"
                     /locus_tag="TDEL_0C04100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680462.1"
                     /db_xref="GeneID:11500634"
     CDS             complement(723562..724125)
                     /gene="TDEL0C04100"
                     /locus_tag="TDEL_0C04100"
                     /inference="similar to DNA sequence:INSDC:YNL056W"
                     /note="similar to Saccharomyces cerevisiae OCA2 (YNL056W);
                     ancestral locus Anc_2.251"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680510.1"
                     /db_xref="GeneID:11500634"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G8ZS07"
                     /translation="MGQRANYIPPLSFSPVVSTDVSLYRSGYPMPLNYAFIRDQLHLK
                     TIIYVGEKDELSPEYAEFLEQEKIQFHRIYMDSCRDPDIQERMDQVLQLVLDVDNYPI
                     LIHSNKGKHRAGVVVGIIRKLLQGWSVAGIYQEYGIFSGGLKGEVDLEFITMFNTNLV
                     VPRRKMPDFATFRPAASVERGKVDRLH"
     gene            <724615..>725517
                     /gene="TDEL0C04110"
                     /locus_tag="TDEL_0C04110"
                     /db_xref="GeneID:11500635"
     mRNA            <724615..>725517
                     /gene="TDEL0C04110"
                     /locus_tag="TDEL_0C04110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680463.1"
                     /db_xref="GeneID:11500635"
     CDS             724615..725517
                     /gene="TDEL0C04110"
                     /locus_tag="TDEL_0C04110"
                     /inference="similar to DNA sequence:INSDC:YIL117C,YNL058C"
                     /note="similar to Saccharomyces cerevisiae PRM5 (YIL117C)
                     and YNL058C; ancestral locus Anc_2.250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680511.1"
                     /db_xref="GeneID:11500635"
                     /db_xref="UniProtKB/TrEMBL:G8ZS08"
                     /translation="MSTMDAVVKALPKFTTSATSETATATDESSASSSTISYTPTVTP
                     PSPAGNPNIWDSDHRPNGTVFIAVGSIVAAIFLGMLLWSVITSHLSRRIAKKTMMGDR
                     YEGHSRESSGFYDNGDDKEFLAAFKGSDDQKTKRNEISLLKTESNLNGSTSWDSLPEY
                     VPEFPQERLNPIQDSFPRYNRNSLFISPTIQVAQQQGHRSRMDKPSHHSSLSNTSLLS
                     SDKTTPALSHELHKPERAASPERKEKKTPGGYHKRNKSSLGLNSADSSGSLAVNERKP
                     RDRPKRKAPSMYLDDILKGEEDMV"
     gene            complement(<725595..>726290)
                     /gene="TDEL0C04120"
                     /locus_tag="TDEL_0C04120"
                     /db_xref="GeneID:11500636"
     mRNA            complement(<725595..>726290)
                     /gene="TDEL0C04120"
                     /locus_tag="TDEL_0C04120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680464.1"
                     /db_xref="GeneID:11500636"
     CDS             complement(725595..726290)
                     /gene="TDEL0C04120"
                     /locus_tag="TDEL_0C04120"
                     /inference="similar to DNA sequence:INSDC:YIL118W"
                     /note="similar to Saccharomyces cerevisiae RHO3 (YIL118W);
                     ancestral locus Anc_2.249"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680512.1"
                     /db_xref="GeneID:11500636"
                     /db_xref="GOA:G8ZS09"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZS09"
                     /translation="MGLLCGSSSASKKPIEKKIVILGDGACGKTSLLNVFTRGYFPKV
                     YEPTVFENYIHDIFVDGKHITLSLWDTAGQEEFDRLRSLSYSDTDTIMLCFSVDSRDS
                     LANVQHKWVGEIADHCEGVKLVLVALKCDLRNTENETNAITPGLINQQRSDLDNGNRN
                     LEESVQDNHNNYITYEEGLAMAKKIGALRYLECSAKLNKGVNEAFTEAARVVLTDEPK
                     GKKNTESDGCIIM"
     gene            <727196..>732382
                     /gene="TDEL0C04130"
                     /locus_tag="TDEL_0C04130"
                     /db_xref="GeneID:11500637"
     mRNA            <727196..>732382
                     /gene="TDEL0C04130"
                     /locus_tag="TDEL_0C04130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680465.1"
                     /db_xref="GeneID:11500637"
     CDS             727196..732382
                     /gene="TDEL0C04130"
                     /locus_tag="TDEL_0C04130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680513.1"
                     /db_xref="GeneID:11500637"
                     /db_xref="GOA:G8ZS10"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR018201"
                     /db_xref="UniProtKB/TrEMBL:G8ZS10"
                     /translation="MIKDEYKEELAVTLLTELLAYQFAFPVRWIETQDVFINDFKAER
                     IIEVGPSPILTNMAARTVRANESHEMARHMRREIYCTSNHLDKIYYGTEPAASTSSKP
                     ESVKIEKELEPVAPVETAINNVVPVSQPLSTHTFDSSVTLQPRHIVTALVSNKLPGCK
                     YADLNINKSLKEVSHGKSTLQNEIKSDLIKEFVNLKDDSFEDIPLSELCQSLEQHTLG
                     AVTLAQVIKFMSQSLSGKFKSLSGVRNYLGNEWSIADSNPILLYMAYQDSSFKTRISC
                     ETEAAHFIDSCCQAFAVTENIKVITAQATSGAVDPEGGEVKPVISAAEYDAFNEGLHG
                     LYTQQRDVLNKRLIVSDDKSELLRKDSELQTIKDKMTALEAEFGEFYLNESIKRLFSP
                     AKIRVYDSAWNWSRQDILLLIHSNTHNAKNGVEANIRSILNRVDANSLKILQYYIDKQ
                     CRDDQWKAYLLDVCQKCKDSMELKPSYADDVQSTMAFRNSTHKNMTESIELNSGSYVK
                     EIALATSVEDVKRDTSLVSTKLDMDSSSYYKIETELFRVYSKIIQYALAASNSNPDDL
                     WGQFESLYEQLLIFIKNSDQIASYFRNIVSDALSSINKSMYEKGGDVVVHDYGVESSS
                     DEESDIDINFDDNKTEHSQPIAVRRQHEAANQPNIDQCSIPVGVIPFLHIKRHSNINE
                     EWIYDKHYTQIFLSNLLKIGSSGFSLDRKTALLLISNLESKLISEIIKVLLQTGATVI
                     VAVGEFSRKITQSLQEIYHKFGSKDSKLVVIPLNQASKVDIKKFCDHIYSEYDDIDFL
                     LPLNVHESENKITSLSSQDEVTLRSVSINLLRLLGHLVEAKEAKQMQTRPTFVLLPLS
                     PLLGSKGASGTLSESYAFLNKTLNRWQIEGWKDHLSICGCMYGWTDEDKTDPVLNKGL
                     DKLGIRTFSPAETAFNVLGLLTYEIVTEAHSTPLVADLNGGLHTLPNILPVLQALKSD
                     LVDQLSLENVLNEEKVSDDQLCGNSTARSGSEINPRGNINLQYPELHAYQTLRDEFNG
                     SKIGGLVDPSGLVVITGFSEIGPWGNARTRWEMESTGVFSLEGCIEMAWIMGLIKYKQ
                     KADFNGWIDAQTLEPVDGLQIKEKYEMRILEHTGIRIIEPKLFDGYNPSKKQMLQEVI
                     IDQDLQPIQTSAEVAEQYKLEQGDMVDVFPIEDDQCMVKFVRGASLYIPKALDIERMV
                     AGQVPTGWNAEAYGIPSDITSQVDPTTLFALVSTAEALIASGITDPYEMYEYVHVSEV
                     GNCIGSGIGGMKSHELMQVHRTREEMVQNDILPETFINVIAAWINMLLLSSSGPIKTP
                     VGACATAVESLESGYETIISGKAKICFVGGVDDFHGNISHEFANMGATSNSTDEAKRG
                     REPKEMCRPATSTRNGFMESQGAGVQVLMRGDLAVKMGVPIYGVVGMTATASDKIGRS
                     LPAPGKGVLTAARESEHKPKYGASKLNVAYRKRQLQYRLKEIERWVEDELCMGADPDI
                     TRELAEDQLQRAKMHWGTDFYKNDPTIAPLRGALNVFGLSIDDLRVASCHGTSTKANE
                     KNESQILNKMMAHLGRAEGNPLVAVFQKALTGHPKGAAGAWMLNGCLQIMNSGIIPGN
                     KNADNIDNQFEEYKYLVYPSRAIAVDTVKACCLTSFGFGQKGAMALVINANFLLACLT
                     EDEYQTYRRKRSERERSAHKYYNDGLVRNKLVQVKSEAPFSKEDEEQFYLNPLARVKL
                     TV"
     gene            <732580..>734829
                     /gene="TDEL0C04140"
                     /locus_tag="TDEL_0C04140"
                     /db_xref="GeneID:11500638"
     mRNA            <732580..>734829
                     /gene="TDEL0C04140"
                     /locus_tag="TDEL_0C04140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680466.1"
                     /db_xref="GeneID:11500638"
     CDS             732580..734829
                     /gene="TDEL0C04140"
                     /locus_tag="TDEL_0C04140"
                     /inference="similar to DNA sequence:INSDC:YNL059C"
                     /note="similar to Saccharomyces cerevisiae ARP5 (YNL059C);
                     ancestral locus Anc_2.248"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680514.1"
                     /db_xref="GeneID:11500638"
                     /db_xref="GOA:G8ZS11"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR027664"
                     /db_xref="UniProtKB/TrEMBL:G8ZS11"
                     /translation="MSRDSSLPPLKVRVIDEPPLLEVPEFFDDPNSYSPDVPIAVDFG
                     SNQLRAGLINRATPSHVFTNRITRFRDRKLMKTMTFIGNDVNLDQAVRAQSKSPFDGP
                     MVTNWDYVEDILEYTFNHLGSTPNNGISNPILVTERLATLQTQRSSWYQVLFECFNVP
                     GVTFGIDSLFAYYQNTTANSTGLVIGCGNEDTNIIPVVDGQGMLTEAKRINWGGSQAA
                     DYLTNLMTLKYPYFPTKLSNFHYRTMYEDYCYVSQDYDEELKSFLKLDTLESKNVVVE
                     APFVEILQPQKTEEELRIQAEKRKESGKRLQEQAKQKRIERLIQKEEELEYYNQVKEQ
                     LKDQPKKKVLHILQNSGFDDERDFKKYLYNLERSLKKSQAANEESGDVEEEDVNEHKF
                     DLVEVPDESLTEDQIKEKRKQRFLKASLDARKKAKEEKERAAQEEEERKVKEQQWREI
                     DLEGWIKDKRRKLSNLIAKRKDKLKMRDEMKDRKSQMSQNRMKNLATLAEDSGRGGTK
                     RTRQQATIDNDPNDTFGANDDDWTVYNDVTQYPEALEELIEEGYKEIVELEGQLLEHD
                     PNFTEEDTMDAQYDWRNSTLHLFLRGPRPHDSENSHEQHQMHLNVERIRVPEVFFQPT
                     MCGEDQAGVSELCERVLLSKFGASPRQMSSITSEMAKNVWVTGGNAKIPGLRERIVKE
                     FTGFLPVNTSFNVNISSDPSLDAWRGMAKYAQNETDYKKSFISKKEYEEYGPDYIKEH
                     KLGNMNYFE"
     gene            complement(<734914..>736758)
                     /gene="TDEL0C04150"
                     /locus_tag="TDEL_0C04150"
                     /db_xref="GeneID:11500639"
     mRNA            complement(<734914..>736758)
                     /gene="TDEL0C04150"
                     /locus_tag="TDEL_0C04150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680467.1"
                     /db_xref="GeneID:11500639"
     CDS             complement(734914..736758)
                     /gene="TDEL0C04150"
                     /locus_tag="TDEL_0C04150"
                     /inference="similar to DNA sequence:INSDC:YNL061W"
                     /note="similar to Saccharomyces cerevisiae NOP2 (YNL061W);
                     ancestral locus Anc_2.247"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680515.1"
                     /db_xref="GeneID:11500639"
                     /db_xref="GOA:G8ZS12"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR011023"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023273"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZS12"
                     /translation="MGSRRVKNKQGAPPSLDEFQAKKEKKHSKKKEKRSHSEDHASKS
                     KKPKRSKKQDEEADEKRELEALKEKEQALPEVDLKELSQAKKSLFDDEEEEAEDEDEE
                     LKDEFDLEQEYDYDDEEAEAHPAFSDDDDEVDLEELNAANMEEMSKKLDEENALEAEE
                     AEKELVEAEYTQPRADVLPTEEEEEMMAQNPPDLTSIRTRMIEIVKVLEDFKNLGAEN
                     RSRADYTDRLLKDISEYFGYVPFLAEKLFNLFSPAEAMEFFEANEIARPITIRTNTLK
                     TRRRDLAQALVNRGVNLQPIGSWTKVGLQIFDSQVPIGATPEYLAGNYILQAASSFLP
                     VIALDPHENERILDMAAAPGGKTTYISALMKNTGCVFANDANKARTKSLIANIHRLGC
                     TNTIVCNYDAREFPKVIGGFDRILLDAPCTGTGVIGKDQSVKVSRTEKDFIQVPHLQK
                     QLLLSAIDSVDSNSKTGGIIVYSTCSVAVEEDEMVVDYALRKRPNVKLVEAGLAIGKE
                     GFTSYRGKKFHPSLKLTRRYYPHTYNVDGFFVAKFQKIGPSPHDDNQATPREKELAAR
                     QEAAEEGIIHSDFANFDNEEDEKYIKRSQKNSLLKKGIDPRAQKKQSS"
     gene            <736944..>738233
                     /gene="TDEL0C04160"
                     /locus_tag="TDEL_0C04160"
                     /db_xref="GeneID:11500640"
     mRNA            <736944..>738233
                     /gene="TDEL0C04160"
                     /locus_tag="TDEL_0C04160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680468.1"
                     /db_xref="GeneID:11500640"
     CDS             736944..738233
                     /gene="TDEL0C04160"
                     /locus_tag="TDEL_0C04160"
                     /inference="similar to DNA sequence:INSDC:YNL062C"
                     /note="similar to Saccharomyces cerevisiae GCD10
                     (YNL062C); ancestral locus Anc_2.246"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680516.1"
                     /db_xref="GeneID:11500640"
                     /db_xref="GOA:G8ZS13"
                     /db_xref="InterPro:IPR007316"
                     /db_xref="InterPro:IPR017423"
                     /db_xref="UniProtKB/TrEMBL:G8ZS13"
                     /translation="MDPLTQLAFNQHVILKLPSGNWKIVELKPNASISLGKFGAFNVD
                     DIIGYPLGTTFEIYYEEEAETDNRDKNKIPVGKVRVMTESESVHNVTSSANNMNLVNI
                     GNQVQGLTMEQIEELKKQSVSGEQIIAKMIEAHGSFDKKTVHSQQKYLNRKKQKFAKH
                     FTAEYLSGSRMLQFLLEKGDTQRVLDLSQETMGMLLNLANIRSNGTYLCVDETGGLLV
                     YFLLERMFGGDNGSTEKGRIVVVHENEHANLDLLKFSNYSDKFVREYVKTVSLLDFFE
                     PPSLSEVESAFTPLPKEEAYALKAGKKNAYYRRLKWYNNQLEAISLATQVQYDALVCA
                     STLYLPQLVPRLAEHVHGSRPVVCYAQFKEPLLELAHSLYDDLRFLAPSILETRYRPY
                     QTVRGKLHPVMTMRSGGGYLLWSHRVLPAEEPEATVS"
     gene            <740380..>744582
                     /gene="TDEL0C04170"
                     /locus_tag="TDEL_0C04170"
                     /db_xref="GeneID:11500641"
     mRNA            <740380..>744582
                     /gene="TDEL0C04170"
                     /locus_tag="TDEL_0C04170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680469.1"
                     /db_xref="GeneID:11500641"
     CDS             740380..744582
                     /gene="TDEL0C04170"
                     /locus_tag="TDEL_0C04170"
                     /inference="similar to DNA sequence:INSDC:YNL088W"
                     /note="similar to Saccharomyces cerevisiae TOP2 (YNL088W);
                     ancestral locus Anc_2.201"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680517.1"
                     /db_xref="GeneID:11500641"
                     /db_xref="GOA:G8ZS14"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002205"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR013506"
                     /db_xref="InterPro:IPR013757"
                     /db_xref="InterPro:IPR013758"
                     /db_xref="InterPro:IPR013759"
                     /db_xref="InterPro:IPR013760"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018522"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR024946"
                     /db_xref="UniProtKB/TrEMBL:G8ZS14"
                     /translation="MTVDSKSASERYQKISQLEHILKRPDTYIGSVESQEQQQWIHDE
                     ETDCMIEKTVNIVPGLYKIFDEILVNAADNKVRDPSMKKIEVNIQREKNLIEVKNDGK
                     GIPIEIHEKEKIYIPELIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFTLET
                     ADSNTGQKYVQKWENNMGVCHPPKITSYKKGPSFTKVSFKPDLKRFSMETLDDDIIGV
                     LRRRVYDINGSVRDISVYLNGKSLKIRNFKNYVELYVKSLEKKRLAHGNTVDDSQVKM
                     PTILYERVNSCWEIAFSVSDISFQQISFVNSIATTAGGTHINYITDQIIKKVSEVLKK
                     QKKSIKPFQIKNHIFLFVNCLIENPAFTSQTKEQLTTRVRDFGSRCEISDDYVKKIMK
                     TDLQARILEIATENENNALKKSDGSRKNRITDYPKLEDANKAGTKEGHKCTLVLTEGD
                     SALSLAVAGLSVVGRDYYGCYPLRGKILNVREATAEQILKNAEIQAIKKIMGLQHRKR
                     YENTSSLRYGHLMIMTDQDHDGSHIKGLIINFLDSSFPGLLDIPGFLLEFITPIVKVT
                     ITRPRREVISFYNMPDYEKWRAEESSRYTWKQKYYKGLGTSSSQEVRAYFSDLDRHLK
                     KFHALEGGDQELIELAFAKKKADDRKEWLRQYEPGTVLDPNLTEIPISDFINKEFILF
                     SLADNIRSIPNILDGFKPGQRKVLYGCFMRKMSTDIKVAQLAPFVAEKTSYHHGEQAL
                     AQTIIGLAQNFVGSNNINLLKPNGAFGTRATGGKDAAAARYLYTELSKITRKIFHPSD
                     DPLYKYLQEDEATIEPEWYLPILPMILVNGAEGIGTGWSTNIPPFNPLDIVKNLKHLM
                     KNEPMEEMHPWFKGWGGTLEKIDSQRYRMYGKIEQTGPTTLEITELPARTWTSTIKEY
                     LLLGLSGTEKMKPWIKDMEEQHSDTIRFIIKLTQEEMDKTRKIGFFERFKLTSTINLN
                     NMVAFTPSSKIRKYENVGEILEEFYYTRLEYYQKRKDYMTSRLQWEVEKLSYQVRFIK
                     MIIEKELTVTNKPHKQIVAELETNGFPRINKEGKPFYGKTNEQIKELVDEEIVAEEEE
                     DEEAANEGEIVNGPEELYGSFEYLLGMRIWSLTKERYERLLKQKQEKQVELELLLELS
                     AQQLWETDIEEFATAYEHFLKLDEESRNGDVPTASSKAKGKRKRNTAKTDEEYDPSKK
                     IKKSKKAAVKKVKDDPDFEKILIEPMLLQKPKRSAKIKSESESATPPPEIVKRENETD
                     VSDTPSTIFDTVAKKNPKSQQTEFGTFSSKFKQLSDSFDNAKKATNEVEEPKAETPKP
                     VKHTKPRSRNAKVALSSDEDDFDLSDSEDIIPVRKRAPRSTRAKTVPKKIATDVINLS
                     DDSFLEADEQSVSDESFHGSDD"
     gene            <744899..>748426
                     /gene="TDEL0C04180"
                     /locus_tag="TDEL_0C04180"
                     /db_xref="GeneID:11500642"
     mRNA            <744899..>748426
                     /gene="TDEL0C04180"
                     /locus_tag="TDEL_0C04180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680470.1"
                     /db_xref="GeneID:11500642"
     CDS             744899..748426
                     /gene="TDEL0C04180"
                     /locus_tag="TDEL_0C04180"
                     /inference="similar to DNA sequence:INSDC:YNL087W,YOR086C"
                     /note="similar to Saccharomyces cerevisiae TCB2 (YNL087W)
                     and TCB1 (YOR086C); ancestral locus Anc_2.202"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680518.1"
                     /db_xref="GeneID:11500642"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR017147"
                     /db_xref="UniProtKB/TrEMBL:G8ZS15"
                     /translation="MSYELTVGKLLRSPERSTAVQSGLDKLAPATLKANKEHEPSQEI
                     SPEKTAHFGLGESSRKAVNPSYVGWKQIGGWQEGDALTEADDIIDLSKDTYLNNVIPD
                     QFYGDWYHLLGLIVIAGVLSFAIGYFRFSFAPVFFVGLVTSLLYRTSSIKYRSAIRDQ
                     LQKELTVQKIEDDYESLEWLNSFLDKYWPLLEPTVSQMVVQQVNDVLATNPSIPAFIK
                     ALWIDQFTLGVKPPRVDVVKTFQNTDSDVVVMDWGVSFTPHVLCDMNAKQLRNYVNQK
                     VVVKATLFGFTVPVYLSDFSLRAKVRVRFRLMTPFPHVETINIQLLEVPDVDFVARLF
                     GDFVFNWEIMSIPGLYQMIKKLAQVYAGPILLPPFSLQLNIPQLLSGSAVSVGVLEIT
                     IKNAKGLNRSTGLLAKSIDPYLLFEIGGTVVAKTRTVRDTLDPVWDESLYILLNAFTD
                     PLTITVLDKREKLKDKVMGRIEYNLTSLHDKNDQKNLKSFFLRNSKPVGALNFDLKFF
                     PTIEAKKLPDGTVEEQPEFNTGITKITIEEAFGLGDVGEKVTAYVELYLNAKLVLTTA
                     KATSKENLQWNQEYEAVITDRRKARCRLVLKDAKGKVISTTVESLNDLLDRTQTDKKA
                     IPLKEKKGEIKVSAVWKPVALDMGTIAIAYTPPIGVVRILLNKAEDLRNLEKVGKIDP
                     YARVLVNGIPRGRTNARSQTLNPVWNEAIYVAVTSANQKLAIEVMDVETVKEDRSVGT
                     FDVKLDSMFHKGTDDKYLEKVDNEPRSGRLVTKKGAKGSVTFYVSFYPALPVLSLEEV
                     QEVDKLKEKKANLEKKKGEKLSAEEQKHLKEEELDVQDIESMYSNKMKLDFNELLQYN
                     TGVFSVSILDGEVSQTGLYVQAFFDGNGEPTFVSPKIATRSITTGWTGDVMIKELEYS
                     NATFRVTKDKSANKAEDCICEVVIPTVELIKNCYFKPSILTLSGGGSAKLMIQTSWFP
                     IAVSKLPQADLITNSGDLTVTARSAENLISADTNGYSDPYLKFYLNDSKNTVFKTSHQ
                     KKTLNPVWEQSGSVVIHNRVNDYLRIKVMDWDAANADDVIGRAVVPLSKIDPENVTDL
                     DIPVVSEEGGDGGVLHLSFQFSPRYTLSVSKTEKKVGDIAQKGLGTGLKVGSTVVGAG
                     FGTIGKLGRTMFGGKKNHYVAQGVYNNAV"
     gene            <748567..>748881
                     /gene="TDEL0C04190"
                     /locus_tag="TDEL_0C04190"
                     /db_xref="GeneID:11500643"
     mRNA            <748567..>748881
                     /gene="TDEL0C04190"
                     /locus_tag="TDEL_0C04190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680471.1"
                     /db_xref="GeneID:11500643"
     CDS             748567..748881
                     /gene="TDEL0C04190"
                     /locus_tag="TDEL_0C04190"
                     /inference="similar to DNA sequence:INSDC:YNL086W"
                     /note="similar to Saccharomyces cerevisiae YNL086W;
                     ancestral locus Anc_2.203"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680519.1"
                     /db_xref="GeneID:11500643"
                     /db_xref="InterPro:IPR020515"
                     /db_xref="InterPro:IPR028119"
                     /db_xref="UniProtKB/TrEMBL:G8ZS16"
                     /translation="MSSDVENAEGNGIHTVELCVYSLLSTDLDGIYQSINQLRESQAL
                     LLLLMRKCRGSLKLENEVLYDKSSFDDSSHKLNELEKRMNKLIKRMNEIKLRSEKLAK
                     QH"
     gene            complement(<748944..>749981)
                     /gene="TDEL0C04200"
                     /locus_tag="TDEL_0C04200"
                     /db_xref="GeneID:11500644"
     mRNA            complement(<748944..>749981)
                     /gene="TDEL0C04200"
                     /locus_tag="TDEL_0C04200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680472.1"
                     /db_xref="GeneID:11500644"
     CDS             complement(748944..749981)
                     /gene="TDEL0C04200"
                     /locus_tag="TDEL_0C04200"
                     /inference="similar to DNA sequence:INSDC:YOR085W"
                     /note="similar to Saccharomyces cerevisiae OST3 (YOR085W);
                     ancestral locus Anc_2.204"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680520.1"
                     /db_xref="GeneID:11500644"
                     /db_xref="InterPro:IPR006844"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR021149"
                     /db_xref="UniProtKB/TrEMBL:G8ZS17"
                     /translation="MRLQILFTICAFLQSLCVALSHDKLLKLSEKGPNNVIELTDSNF
                     KRVLGSPRDSYILVFLTASAPQVGCSICLEAADEFKMVANSWFTDHPDGASTRGKEAR
                     RLFFAKSDLKDAQHIPQIFGFYSLQHVPRLLLFSPGEDINKYKIIDLAGDPGQERALQ
                     IINSLRSATNIDDFNLHLPVDWTLSIVIAVLTFVAVYIFKRHRSLVAKLVNMRPLWAI
                     VWTLFIILMLGGYMYNNIRNAQLAGVGPKGEVLYFLPNQTQNQFKIETQVIGVIYASL
                     TVSLLFLIFGIPKLKDFYKGSKSGQLLEAASTILFAAIIYAFFAGLTAVFNIKQPGYP
                     YQLMKLSALFK"
     gene            <750484..>752952
                     /gene="TDEL0C04210"
                     /locus_tag="TDEL_0C04210"
                     /db_xref="GeneID:11500645"
     mRNA            <750484..>752952
                     /gene="TDEL0C04210"
                     /locus_tag="TDEL_0C04210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680473.1"
                     /db_xref="GeneID:11500645"
     CDS             750484..752952
                     /gene="TDEL0C04210"
                     /locus_tag="TDEL_0C04210"
                     /inference="similar to DNA sequence:INSDC:YNL085W"
                     /note="similar to Saccharomyces cerevisiae MKT1 (YNL085W);
                     ancestral locus Anc_2.205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680521.1"
                     /db_xref="GeneID:11500645"
                     /db_xref="GOA:G8ZS18"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR022039"
                     /db_xref="InterPro:IPR022040"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:G8ZS18"
                     /translation="MAIKSLESYLFERGLVGSYPIEALKNAMLGIDVNHYISRLLTSK
                     REQYLDAIGGFPTSLKMYLESDLKIFREYKITPVFVFNGTLISNQLEDSGYLNGFATE
                     ASAVALSSPGSNSSSGSNAPMYSANSSVSANKEAIFVQRHRGWTQXXNNLMNSNQSSY
                     IDQPVQPQEPFRYNATIESKRFQADLIAYFIDNDIIYQVAPYTSWSQLSYLLNSGYID
                     AIYGPTDCLMLSDVSKFILGMEFPNKEFRFIDKARVLKELDCSHDEFVDIAMAVGNDL
                     QPTALPPLQIYPGSQLFEIALEMVITTGTNFYAYQFSNPIKNESADCVERYQKGMSAL
                     RYMPVLKDSGKVELRVEPESASEFMGGIEDTYGGKQGAFGDNVIPTETSQAASPSPRP
                     IPSDVHDFIAQQLPSEYYFYKSLGLVSGKLFDAITTGVYPEEPPLDGGSTNSYRNLIK
                     KSVDFFKNKEINLLTQPINRYYQIKPIKQIKWYAPEDAILLTNRTTPSIFDKLNRLVV
                     KTDDGDRTFSIAEFITLINNSKNLAKDFISDKVIFPNSVSPKQKLSGSFDLLSTSFLR
                     TLYQLEFFEFDLDKGILQPTKWGSVLLNLDDLQVDAKYYEPILVLLVFLKLDVLSLSQ
                     DTVPSALSSLSQATLRSYPQESLFILLLTRVLTLYQVDQKPSNYHGPVDKKTLIFRDH
                     LDFVKANLNEMYEAVTVSSLTSGEFDRTLLEGREWQTTIVRNMPFKLTTPNTIMAMMW
                     EFFLQKYLHNGNAKADALTLISTEFSSYKSTPNLEEQMSKSQEFLQQCSRVLNALGSV
                     NLIKSDDASLFEKAVEFSGKAIAD"
     gene            <753544..>755127
                     /gene="TDEL0C04220"
                     /locus_tag="TDEL_0C04220"
                     /db_xref="GeneID:11500646"
     mRNA            <753544..>755127
                     /gene="TDEL0C04220"
                     /locus_tag="TDEL_0C04220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680474.1"
                     /db_xref="GeneID:11500646"
     CDS             753544..755127
                     /gene="TDEL0C04220"
                     /locus_tag="TDEL_0C04220"
                     /inference="similar to DNA sequence:INSDC:YIL142W"
                     /note="similar to Saccharomyces cerevisiae CCT2 (YIL142W);
                     ancestral locus Anc_2.206"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680522.1"
                     /db_xref="GeneID:11500646"
                     /db_xref="GOA:G8ZS19"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012716"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:G8ZS19"
                     /translation="MSVNIFGDQVTEERAENARMAAFVGAIAVGDLVKSTLGPKGMDK
                     LLQSASSDSSLVTNDGATILKSIPLDNPAAKVLVNISKVQDDEVGDGTTSVTVLSAEL
                     LREAEKLIDQSKIHPQTIIEGYRIASQAALAGLEKAAIDNSEDVAKFHDDLVHIAKTT
                     LSSKILSQDKDYFAKLATDAILRLKGSTDLEHIQIIKIIGGKLSDSFLDEGFILAKKF
                     GNSQPRRVENAKILIANTSLDTDKVKVFGTKFKVDSTSKLAQLEKAEREKMKNKIAKI
                     SKFGINTFINRQLIYDYPEQLFTDLGINSIEHADFEGVERLALVTGGEVVSTFDQPEK
                     CKLGECDLIEEIMIGEDSFLKFSGCKAGEACTIVLRGATDQVLDEAERSLHDALSVLS
                     QTTKETRTVLGGGCAEMIMSKSVDTIAQNVDGKKSLAVEAFARALRQLPTILADNAGF
                     DSSELVAKLRSSIYNGMSTSGLDLNAGVIADMRDLGVVESYKLKKAVVSSASEAAEVL
                     LRVDNIIRARPRTANRQHM"
     gene            complement(<755192..>756322)
                     /gene="TDEL0C04230"
                     /locus_tag="TDEL_0C04230"
                     /db_xref="GeneID:11500647"
     mRNA            complement(<755192..>756322)
                     /gene="TDEL0C04230"
                     /locus_tag="TDEL_0C04230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680475.1"
                     /db_xref="GeneID:11500647"
     CDS             complement(755192..756322)
                     /gene="TDEL0C04230"
                     /locus_tag="TDEL_0C04230"
                     /inference="similar to DNA sequence:INSDC:YNL084C"
                     /note="similar to Saccharomyces cerevisiae END3 (YNL084C);
                     ancestral locus Anc_2.207"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680523.1"
                     /db_xref="GeneID:11500647"
                     /db_xref="GOA:G8ZS20"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR025604"
                     /db_xref="UniProtKB/TrEMBL:G8ZS20"
                     /translation="MPKLEQFEIKKYWQIFSGLKPVDNKVNHDQVLPILYNSKLDSSV
                     LNKIWFLADIDDDDSLDFEEFVICMRLIFDMVNKNIDKVPDELPDWLIPGSKTNLIKE
                     RKQRKQQENADIPKTEAPEVDWYMSPEDVTQYQKILDTCERSRDGTVTFPSLSYAIKS
                     KFFNVGPSDLDKVWNLVNPKSLSSIDKDPAFYFIHCLRQFNDVGARIPSELPKAMADI
                     CNKERVSYDLNSPQADVKKVISEPSQTSKSNTQETGKSGGHRQAASYSSVDSVTDIET
                     LERDLAQLDTELSQVEAKNASASSQNSVRTLREQFEGLLRYKQQQTLEHTENSRISVP
                     INSRAVKEDLDNIEEQITILESYLSNRQSELQSLRNEIKSIH"
     gene            <757193..>759616
                     /gene="TDEL0C04240"
                     /locus_tag="TDEL_0C04240"
                     /db_xref="GeneID:11500648"
     mRNA            <757193..>759616
                     /gene="TDEL0C04240"
                     /locus_tag="TDEL_0C04240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680476.1"
                     /db_xref="GeneID:11500648"
     CDS             757193..759616
                     /gene="TDEL0C04240"
                     /locus_tag="TDEL_0C04240"
                     /inference="similar to DNA sequence:INSDC:YIL140W"
                     /note="similar to Saccharomyces cerevisiae AXL2 (YIL140W);
                     ancestral locus Anc_2.208"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680524.1"
                     /db_xref="GeneID:11500648"
                     /db_xref="GOA:G8ZS21"
                     /db_xref="InterPro:IPR006644"
                     /db_xref="InterPro:IPR008009"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR015919"
                     /db_xref="UniProtKB/TrEMBL:G8ZS21"
                     /translation="MRRLSMPMIQLLVSLLALWTTVYSQPYEAYPIDKQYPPVARVGE
                     QFEFQISNDTFRSSAGDSSQIAYDAYELPSWLSFDSASRVFSGKADSSALDEDDLYFD
                     FILEGTDASDNESLNKTYQLVLTKRSSIEVADNFNLLALLKNYGSTNGKDGLILTPDE
                     IFNVTFERSTFTSDHSVVAYYGRSQVYNAPLPNWLSFDPNNLKFSGTAPVVNSNIAPQ
                     VSYGFVLTATDFEGYSGVSVPFNLVIGAHELTTSIQNRLLINVTSSGDFTYQLPLNYV
                     YFDNDPIQSDKLGSIEMVNAPSWVKLDNDTLSGTMPMDSSSENSANFSVAVYDTYDDV
                     IYLNLMIEATSDLFAVTTLPNINATRGEWFQYSFLPSQFTDYSQTNVSVNYSNASQSH
                     DWIHFVSSNMTLHGLVPDDFQSLAMQLVASRDSKSQDLDFQIIGMDSKVNSSNHTNST
                     TTSSSSLTSTSSATSSTSSSATKITESPSATAAGISPIKKKSNKTTAIACGVAIPLGL
                     IALLGLLLLLFLRRRKNRNANHDNEKSPSISGPDVNNPANKPNQAIVPPVNPFDDDQS
                     SITSSARRLGALNAMRLDEASDSEASTINEKRSSVATDELYQDARSTENLLKKPDTEF
                     FDPQNRSSSVYINSEPANRKSWRYQLSSPTKESVMRDSCISTNTVSTAELLNTEIKDG
                     QNIKKDPRKSTLGIRDSVFLNNNSKSQSSPSMNVRPGTRDSSEGDQLPILDEHSNVSP
                     ELKSNTCASSSSSDDFVPVKNGENYDWIHRQKPDRQPSNKRLVQTQNQSKVDIGQAHE
                     VEGHFPEKI"
     gene            complement(<759868..>761469)
                     /gene="TDEL0C04250"
                     /locus_tag="TDEL_0C04250"
                     /db_xref="GeneID:11500649"
     mRNA            complement(<759868..>761469)
                     /gene="TDEL0C04250"
                     /locus_tag="TDEL_0C04250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680477.1"
                     /db_xref="GeneID:11500649"
     CDS             complement(759868..761469)
                     /gene="TDEL0C04250"
                     /locus_tag="TDEL_0C04250"
                     /note="ancestral locus Anc_2.209"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680525.1"
                     /db_xref="GeneID:11500649"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:G8ZS22"
                     /translation="MYRVKAEFTGKSIGLPISKFILSKGKRGLNIASVLLKDVKGSNN
                     PTSAEDLASRPDANATTRADYYEYERLLKDSVKDFKATWLNALAERKTQLAQGKVIDS
                     YVYSHIKSTDVIDKTRKDSFAYVVLPFREDPLISDFYVNAAGRLRMGQLFQDLDSLAG
                     KIAYKHTAPVEPMIVTASVDRIYLLKALDTIADYNIIISGAVTYTGRSSMEISISARA
                     MQRDIPKEITEESLSEEDTFMTASFTFVARNPETHKSLAINRLLPLNEKEWMDFKRAE
                     SRMSAKKMKAANMDLEKYPPTKAESLLLHQLWAASKELASLKEKPSNIVFMKDTNVKS
                     TMFMQPQYRNRHSYMIFGGYLMRQTFELAYCCAASFSHSLPRFVSLDSLTFNTPVPVG
                     SVLHMDATVVYTEHLHESTSKPKVASVTDQSIDGNTVFHFQPTPVNELSMHENDFLSK
                     PGTLVQIKVDTMVQQLASDKLKKSGSFIYSFFAPRDKDDQHTADPGYCTVVPESYSEM
                     IEYIEGRRRANDTAMYAKTLKQTPN"
     gene            <762512..>764107
                     /gene="TDEL0C04260"
                     /locus_tag="TDEL_0C04260"
                     /db_xref="GeneID:11500650"
     mRNA            <762512..>764107
                     /gene="TDEL0C04260"
                     /locus_tag="TDEL_0C04260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680478.1"
                     /db_xref="GeneID:11500650"
     CDS             762512..764107
                     /gene="TDEL0C04260"
                     /locus_tag="TDEL_0C04260"
                     /inference="similar to DNA sequence:INSDC:YNL083W"
                     /note="similar to Saccharomyces cerevisiae SAL1 (YNL083W);
                     ancestral locus Anc_2.210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680526.1"
                     /db_xref="GeneID:11500650"
                     /db_xref="GOA:G8ZS23"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8ZS23"
                     /translation="MDAPRRTEPETDEVRCRRYEKLFRTLDVDGTGQVDLQGLRRAFD
                     KSGHPLRDSDEAIIVLFNAMDCDKDSIVDLQDFSKYASMAESQIEKGFEKLDSDHDGK
                     VKLSEVSQYLSRLDNNCKKSEQIAQLERNMENRKNESRFNIFLNWAFLTKPKEKDLTP
                     YITYDQWRDFLLFMPRKEGSRLHTAYSYFCYFNADVDLSSEGDMTLINDFINGFGFFI
                     AGGISGVISRTCTAPLDRLKVFLIARTDLSSTLLNSRKALLAKNPHADLAKIRSPIVK
                     AITTLYRQGGLRAFYVGNGLNAVKVFPESSMKFGSFELAKKMMTKLEGCRDTSELSKF
                     STYISGGLAGVVAQFSVYPIDTLKFRVQCAPLDNEIRGNKLLFKTAKDMYRTGGIKLF
                     YRGITVGVMGIFPYAALDLGTFSALKKWYISNKAKKLAIPESEVSLSNLIVLPMGAFS
                     GTVGATVVYPINLLRTRLQAQGTFAHPATYTGFRDVLVKTIQQEGYPGLFKGLVPNLA
                     KVCPAVSISYLCYENLKSLMKLE"
     gene            complement(<764260..>764985)
                     /gene="TDEL0C04270"
                     /locus_tag="TDEL_0C04270"
                     /db_xref="GeneID:11500651"
     mRNA            complement(<764260..>764985)
                     /gene="TDEL0C04270"
                     /locus_tag="TDEL_0C04270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680479.1"
                     /db_xref="GeneID:11500651"
     CDS             complement(764260..764985)
                     /gene="TDEL0C04270"
                     /locus_tag="TDEL_0C04270"
                     /inference="similar to DNA sequence:INSDC:YIL139C"
                     /note="similar to Saccharomyces cerevisiae REV7 (YIL139C);
                     ancestral locus Anc_2.211"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680527.1"
                     /db_xref="GeneID:11500651"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="UniProtKB/TrEMBL:G8ZS24"
                     /translation="MNYWIEKWLKVYLKCFINSILFHRNVYPAESFDITTYQAFDLPQ
                     FTPVNRHPGLQEYIEELILDLLSKLIHIYGLCLCVVTKEDNVCVERYVLSFDEFRHVD
                     EVGTLSESEVFEEFRSSLNSLTAHLEKLDPIKDDTVAFEIIINTMEMQLGHRPQGNER
                     LKNQEAKKAFERETNWTKCEEDEGLPENLGVYKPKIKMTSLAGCDVGPLIIHNHCEKL
                     LVSDGSLNGVYVTSQDSSILGSL"
     gene            <765121..>767778
                     /gene="TDEL0C04280"
                     /locus_tag="TDEL_0C04280"
                     /db_xref="GeneID:11500652"
     mRNA            <765121..>767778
                     /gene="TDEL0C04280"
                     /locus_tag="TDEL_0C04280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680480.1"
                     /db_xref="GeneID:11500652"
     CDS             765121..767778
                     /gene="TDEL0C04280"
                     /locus_tag="TDEL_0C04280"
                     /inference="similar to DNA sequence:INSDC:YNL082W"
                     /note="similar to Saccharomyces cerevisiae PMS1 (YNL082W);
                     ancestral locus Anc_2.212"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680528.1"
                     /db_xref="GeneID:11500652"
                     /db_xref="GOA:G8ZS25"
                     /db_xref="InterPro:IPR002099"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR014790"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR028831"
                     /db_xref="UniProtKB/TrEMBL:G8ZS25"
                     /translation="MAKIAAITGHDIHKITSSQVIIDLVTCVKELIDNSIDAHAHHIE
                     VTFKDYGMESIECSDDGDGISSENFECLALKHFTSKISSFTDISSVETLGFRGEALAS
                     LCAVAHVSVTTTAKPPRADRLEYDTTGALSSKSTTSRNKGTTVLVSDLFYNLPVRRKE
                     FDKNCKRQFSQCIALLQNYALIQEDIKMSVWNITSNKRKRLILGTSRCLEMSKKILSI
                     FGSSSMRGLAPIDVELDLNPYKALINKRHADIPDYQALDYKITVQGYISKSSFGCGRS
                     AKDRQSVFINKRPIEYPALLRCCNEVYRTFNNVQYPTVFLNFMLSPALIDVNVTPDKR
                     TVMLHNERYIIEVFRENLINYYDRQEQVLPKSTLSQSLEPEQKRRRLASQILEGGFCE
                     DDESDRDINDESNLEKQEGSNMEITETEPEKSPSLFTDIQENAQRSSSIATIDHPKDD
                     TNFNPFMNEKSPKGSEMIKEACLNQERNDGALRSSSEELLGESESRTFKATLECFKNS
                     SREDTLEDQPKKYPLNESQSVVVEIDGDKLDYQAVITKDEQLAFLSDGMSSPLKPRIM
                     YKTAEENEDEDDAYYARMDPPQEVNVRLQRPPSVSQELYQNTHRSITDPNLSQKLESD
                     KFVLRLKVELSKEFTSRLTNLASKRQNANLENSIEKNKDLQDLEEGEKYMTLTVKKDD
                     FRKMQIVGQFNLGFIIVTRRVQDKYDLFIVDQHASDEKYNFETLQRSTVFKSQSLIAP
                     LPVELSIIDELLVMDHLEVFEKNGFKLKIEEDEEQGSKIKLISLPVSKKTLFTVDDFY
                     ELVYLIKENGGLHTDNIRCSKVRSMFAMRACRSSIMIGKPLAMKTMVKVVRHLSELEK
                     PWNCPHGRPTMRHLMELKEWDSLLEDYKL"
     gene            complement(<767823..>768254)
                     /gene="TDEL0C04290"
                     /locus_tag="TDEL_0C04290"
                     /db_xref="GeneID:11500653"
     mRNA            complement(<767823..>768254)
                     /gene="TDEL0C04290"
                     /locus_tag="TDEL_0C04290"
                     /product="putative mitochondrial 37S ribosomal protein
                     SWS2"
                     /transcript_id="XM_003680481.1"
                     /db_xref="GeneID:11500653"
     CDS             complement(767823..768254)
                     /gene="TDEL0C04290"
                     /locus_tag="TDEL_0C04290"
                     /inference="similar to DNA sequence:INSDC:YNL081C"
                     /note="similar to Saccharomyces cerevisiae SWS2 (YNL081C);
                     ancestral locus Anc_2.213"
                     /codon_start=1
                     /product="putative mitochondrial 37S ribosomal protein
                     SWS2"
                     /protein_id="XP_003680529.1"
                     /db_xref="GeneID:11500653"
                     /db_xref="GOA:G8ZS26"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="InterPro:IPR010979"
                     /db_xref="InterPro:IPR018269"
                     /db_xref="InterPro:IPR027437"
                     /db_xref="UniProtKB/TrEMBL:G8ZS26"
                     /translation="MVVHILGKGFKGKEVIKIALASKFYGIGEKTAERVCSKLGFYPW
                     MRMHQLTEPQVMSITSELSNMTIEGDARAIVKESIALKRRIGSYEGMRHAMNLPVRGQ
                     RTRNNAKTARKMNRVDRKGFHTFACSPLNALLNTINPSLRK"
     gene            complement(<768530..>769675)
                     /gene="TDEL0C04300"
                     /locus_tag="TDEL_0C04300"
                     /db_xref="GeneID:11500654"
     mRNA            complement(<768530..>769675)
                     /gene="TDEL0C04300"
                     /locus_tag="TDEL_0C04300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680482.1"
                     /db_xref="GeneID:11500654"
     CDS             complement(768530..769675)
                     /gene="TDEL0C04300"
                     /locus_tag="TDEL_0C04300"
                     /inference="similar to DNA sequence:INSDC:YNL080C"
                     /note="similar to Saccharomyces cerevisiae EOS1 (YNL080C);
                     ancestral locus Anc_2.214"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680530.1"
                     /db_xref="GeneID:11500654"
                     /db_xref="GOA:G8ZS27"
                     /db_xref="InterPro:IPR021100"
                     /db_xref="UniProtKB/TrEMBL:G8ZS27"
                     /translation="MEFRARRTSAVPEVAAAANAVHHHHHHHYVLCEGNNAPSQRRSL
                     TSSNSSNAINTTNGIHQPKRLPTPPSSQGYASIKTLSLSNLTAKQHLLLAICRDVSLL
                     PPLIYIFTSLQQAWRISFRTKLKLYELQSLKDTMKIFVQSCIANNSISHAEEMSTNGN
                     GLLLSTLTTARASEYLLCALWCVVSLYLTYSILDSLMVRWIVKYSTLAAILRMFAMSL
                     LIITTELLLLASLSPNGDYYLHTWILVSCIMTAAYIWQSYLTSNLNYVSQDDYDASEE
                     EADCNTRKELNSTDIEELTSSNVSLNSLPSSCSLQKRKNKRRPQKRFKFTKKRTIDLY
                     NIIVFCVVPVGLASFITMVGLLRNLVIQRLDVEQLGRMLQSTPYVLD"
     gene            complement(<770014..>770499)
                     /gene="TDEL0C04310"
                     /locus_tag="TDEL_0C04310"
                     /db_xref="GeneID:11500655"
     mRNA            complement(<770014..>770499)
                     /gene="TDEL0C04310"
                     /locus_tag="TDEL_0C04310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680483.1"
                     /db_xref="GeneID:11500655"
     CDS             complement(770014..770499)
                     /gene="TDEL0C04310"
                     /locus_tag="TDEL_0C04310"
                     /inference="similar to DNA sequence:INSDC:YIL138C,YNL079C"
                     /note="similar to Saccharomyces cerevisiae TPM2 (YIL138C)
                     and TPM1 (YNL079C); ancestral locus Anc_2.215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680531.1"
                     /db_xref="GeneID:11500655"
                     /db_xref="InterPro:IPR000533"
                     /db_xref="UniProtKB/TrEMBL:G8ZS28"
                     /translation="MEKIREKLNNLKLEAESWQEKYEELKEQYKQLEQDSVEKENQIK
                     SLTTKNQHLEDEVEKLETNLTDSKQLADDSHNLRSHNENYVKENQQLEEELEESDAKL
                     KETTEKLRETDLKAEQLERKVVALEDERDDWEKKHEEISTKYEEAKKELDEIAASLEN
                     L"
     gene            <772554..>773438
                     /gene="TDEL0C04320"
                     /locus_tag="TDEL_0C04320"
                     /db_xref="GeneID:11500656"
     mRNA            <772554..>773438
                     /gene="TDEL0C04320"
                     /locus_tag="TDEL_0C04320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680484.1"
                     /db_xref="GeneID:11500656"
     CDS             772554..773438
                     /gene="TDEL0C04320"
                     /locus_tag="TDEL_0C04320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680532.1"
                     /db_xref="GeneID:11500656"
                     /db_xref="InterPro:IPR001959"
                     /db_xref="InterPro:IPR010095"
                     /db_xref="UniProtKB/TrEMBL:G8ZS29"
                     /translation="MAKYKSTGVPFKLKFKTRKARTQNLSVLKRFWNNKRSFYCDVFS
                     SSKMRSAERLPEQLIMDSRLQRTRHNKNYPIVPIVGEEITRKEGREKFIFIDPGVRTF
                     LTGYDSGQNVVEIGKNAVVRIEKLKHRRRKLQSKLAKLKRQKKRQNHRKALHRLDEKI
                     SRIVKDMHKKSALFLCNSYDNVFIPKLNFHHCTKLNRKSRSSMATLAHCSFNERVAMK
                     AEQFRSTSAVVVEEDYTSKTCSKCGNVKQDLGSSKIYSCVQCFSVFDRDFNAAKNIML
                     TYCSEHLMASGASSILLL"
     gene            <773682..>774692
                     /gene="TDEL0C04330"
                     /locus_tag="TDEL_0C04330"
                     /db_xref="GeneID:11500657"
     mRNA            <773682..>774692
                     /gene="TDEL0C04330"
                     /locus_tag="TDEL_0C04330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680485.1"
                     /db_xref="GeneID:11500657"
     CDS             773682..774692
                     /gene="TDEL0C04330"
                     /locus_tag="TDEL_0C04330"
                     /inference="similar to DNA sequence:INSDC:YNL078W"
                     /note="similar to Saccharomyces cerevisiae NIS1 (YNL078W);
                     ancestral locus Anc_2.216"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680533.1"
                     /db_xref="GeneID:11500657"
                     /db_xref="UniProtKB/TrEMBL:G8ZS30"
                     /translation="MILVDDRLRVCDLSSGAPHRPTVSDSSPLHSSSPSRSLPISGLA
                     VDSDGYTLPQEPSEILTPVINRLMSPQASPKVPSNFEWHTTTANRRTRVDSHENFDLG
                     HFIQWDRYRQSSDTLPSIDRSNSIRSHASLKRTDFTSKTELNQQRKKRGFIFHRGFFK
                     RRSSYKRLRTSAKNTRNRAGLNAVLSYADLQSFDPVDIISSKKVVLYRPNNITRRYPG
                     ISAAFEVPVQHYVRSKLPKRQTTIPRNSQIGRSNTCPSSLRSRRRRQNAPESGAIHDL
                     WREYLSLVIAQRIQLRLSLAQTDLAAGNNDISIGNLRHKTSTKSSLRSVDTRLSSLRK
                     CS"
     gene            complement(<774763..>776859)
                     /gene="TDEL0C04340"
                     /locus_tag="TDEL_0C04340"
                     /db_xref="GeneID:11500658"
     mRNA            complement(<774763..>776859)
                     /gene="TDEL0C04340"
                     /locus_tag="TDEL_0C04340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680486.1"
                     /db_xref="GeneID:11500658"
     CDS             complement(774763..776859)
                     /gene="TDEL0C04340"
                     /locus_tag="TDEL_0C04340"
                     /inference="similar to DNA sequence:INSDC:YIL137C"
                     /note="similar to Saccharomyces cerevisiae TMA108
                     (YIL137C); ancestral locus Anc_2.217"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680534.1"
                     /db_xref="GeneID:11500658"
                     /db_xref="GOA:G8ZS31"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR024571"
                     /db_xref="UniProtKB/TrEMBL:G8ZS31"
                     /translation="MTSVKPLHLVNSILPLHYDLQLELCPSKVNFKATEIIDFKPGTQ
                     GEGLLQRFELHSRDLVILSATLNDDIAVKVSYDKENQLALFNLDQPVDVLTMERIQLT
                     LKYIGKIKTIKTREDETSGVFKTNFMNQETGLSDNFVVATHCQPSYARSIFPCVDEPS
                     WKTTFQLSIKTLQKYEVVSNVGQLSSVADDNQDYKTVRFGVTPLMSTSVFGFVLGDLE
                     HSTSQATMTHSSRRIPISVYSPMNIGDSIFCLDIVQKYLPLLEEYFKADYPLDKLDFV
                     LLPFLTDMAMENFGMIFVQMNHLLLPPSMLADAKTREQVQQLVVHELVHQWMGNFISF
                     ESWEYLWFNEAFATWCACVLLEHTGDIPNYWTSSEYLQNQVENTMRTDAKIETLSISA
                     ISKKNTTSLTSQTHDFFDPHSYMKGIAILRSMQVCIGDELFRSALQEIFQEARFHAKP
                     IKPIDIFVRMGVLLKSENIAHFFTSLCQTPGLPVVSVEIVKSESAITTRLTQHRLLTA
                     KQKNLEDVPYHVPLLIQLPDGKIDQKNVLLTDRSTTLNYPIVVCNHDAQGFYRVSYES
                     MECYDQINKEVALGKLSAIDLVKVFSDLSFFVEHSAKNIHMVGLYSLLKNLASNEMDL
                     EKNKEYWAGLCEGLKILDLPKLKSLKYNCASSEILDFKAGILKPLANKINRMNFKNPD
                     QYQLEVMSQLKTLKKN"
     gene            <777185..>778573
                     /gene="TDEL0C04350"
                     /locus_tag="TDEL_0C04350"
                     /db_xref="GeneID:11500659"
     mRNA            <777185..>778573
                     /gene="TDEL0C04350"
                     /locus_tag="TDEL_0C04350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680487.1"
                     /db_xref="GeneID:11500659"
     CDS             777185..778573
                     /gene="TDEL0C04350"
                     /locus_tag="TDEL_0C04350"
                     /inference="similar to DNA sequence:INSDC:YNL077W"
                     /note="similar to Saccharomyces cerevisiae APJ1 (YNL077W);
                     ancestral locus Anc_2.218"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680535.1"
                     /db_xref="GeneID:11500659"
                     /db_xref="GOA:G8ZS32"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="UniProtKB/TrEMBL:G8ZS32"
                     /translation="MVKDTRLYDVLNVSPEASAVEIRKAYRLLALKHHPDKNNHSEES
                     KSKFLEVNEAYEILIDEKKRSLYDQYGTIDENAIQQSMPQEDPVMSSFFNTGSPMGMG
                     MGMSAGDLFASFFDKMSSPSFGGKKTKKSMDHGPDIKHDLKCTLSSLYEGKNTKLGLN
                     RRRVCKACKGRGSMKVRTCKACRGRGQQSRSRQMGPMMQTWTQTCSDCNGMGTFTKDS
                     DVCRDCEGEGCIRERKIFDVEVKPGMCQGQQIILPGEADEVIKTRFGNETVIPGDVII
                     TIIQIKDPKFQRVNRNGCDLMVRNCKIPLVTSLCGGKLSIDGHPNGKLINVTILPGEL
                     IKPNHFKSIENLGMPRYEEKRAPEGYGNLYIQFQVEFPETLASETVTKLKQVLDEDPN
                     VKKQVTAEDKDVCERVDDCIEMEEHVLSNLLPDFDDLMRNEETGNRSKKRRYYEDPGT
                     PDSEESSNCTTH"
     gene            <780287..>781810
                     /gene="TDEL0C04360"
                     /locus_tag="TDEL_0C04360"
                     /db_xref="GeneID:11500660"
     mRNA            <780287..>781810
                     /gene="TDEL0C04360"
                     /locus_tag="TDEL_0C04360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680488.1"
                     /db_xref="GeneID:11500660"
     CDS             780287..781810
                     /gene="TDEL0C04360"
                     /locus_tag="TDEL_0C04360"
                     /inference="similar to DNA sequence:INSDC:YIL136W"
                     /note="similar to Saccharomyces cerevisiae OM45 (YIL136W);
                     ancestral locus Anc_2.219"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680536.1"
                     /db_xref="GeneID:11500660"
                     /db_xref="UniProtKB/TrEMBL:G8ZS33"
                     /translation="MSSRLLIGGAAAAAAGYMLYEYQQQNERQRQALIPPTQARQPVT
                     GVKEQASALGRDIQQSKDDTAKWLKDQKEYGQTKATEMTNELQRNLHEEASRQRRGVN
                     EVVDDATYDVSKGWDRIKEGVAEDTQSIKDALRGVAHKADQTVPNAKQKGREMAEGAK
                     ETSKSIFNYGFGEAERAKAIAIGEYDKANKQFNNLLEQYNESKKGLFDSGDSKLKQQV
                     DDYKKIIQQKKQELQKASDEYAKYAKDNFNDISNKLDEQDEKIRKEGGFFKWLKGTSV
                     PGDETDDVDRTANSRSLAGFGENAQFFSEQQIEDQLRSKQIGPSEAQRRLDELKKFKE
                     EGWFNTHKSPESEERVAKRAAQGLAGWGESAAQFAQDELEESKKAYNRTIPRSREEAS
                     KAVDDAWNKLQETKKTAEDKGSKWWNASKEKTNEVSEEAQKAYDDATKNYESAKKTLA
                     DWSDKTSAKFWSSADDVVRVSQNVAGKAQSAANKARSKTQEKTGDSDLVEQEQLIEE"
     gene            <782183..>783676
                     /gene="TDEL0C04370"
                     /locus_tag="TDEL_0C04370"
                     /db_xref="GeneID:11500661"
     mRNA            <782183..>783676
                     /gene="TDEL0C04370"
                     /locus_tag="TDEL_0C04370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680489.1"
                     /db_xref="GeneID:11500661"
     CDS             782183..783676
                     /gene="TDEL0C04370"
                     /locus_tag="TDEL_0C04370"
                     /inference="similar to DNA sequence:INSDC:YNL076W"
                     /note="similar to Saccharomyces cerevisiae MKS1 (YNL076W);
                     ancestral locus Anc_2.220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680537.1"
                     /db_xref="GeneID:11500661"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="UniProtKB/TrEMBL:G8ZS34"
                     /translation="MSEGNRRETSSQGPMSGAVDDKYLKVAPNLFTPERLHLFDSLDL
                     YVSLTKCAKAVEQGERLHNLSWRIMNKALLRDKDINKSKKREGVKNLYYVLNPITNRQ
                     PMNQQLSKTPSQNSTSSLRSTTVPKKHAVPRMEPLSKANTAGSNQKVPHSNNGSLFTG
                     TKQHKSTSALSHINRQRSKKEDPQTIVKGFEPNTVITPKNPAIARKVKSRLEEGEKNT
                     FYIESTPSPEPDKHNGSTTTLRKPLPSRQESLFGKPKTNDHAAISSSHNSMFFSSEED
                     DDDDDSDWDDDSPIYEDDDDVNDDDEEDQYYRKQWDKLLLGKNPNHSSGNVTPNSASS
                     QDPIKRSLLSGLFLNEQSNVNSKNKTTPFVAISNNVAQNNNTRPILGTSNVTAVGSVT
                     PPDKNDVVQPHGQSNAPPAAQTILPTALSTHMFLPNNIHQQRLAMAAAASSQDSRGSP
                     VHELQRRATRRESMDIPSKNRNNTFIKTRMEISEEEKMSRAYSQRNL"
     gene            <783826..>784692
                     /gene="TDEL0C04380"
                     /locus_tag="TDEL_0C04380"
                     /db_xref="GeneID:11500662"
     mRNA            <783826..>784692
                     /gene="TDEL0C04380"
                     /locus_tag="TDEL_0C04380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680490.1"
                     /db_xref="GeneID:11500662"
     CDS             783826..784692
                     /gene="TDEL0C04380"
                     /locus_tag="TDEL_0C04380"
                     /inference="similar to DNA sequence:INSDC:YNL075W"
                     /note="similar to Saccharomyces cerevisiae IMP4 (YNL075W);
                     ancestral locus Anc_2.221"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680538.1"
                     /db_xref="GeneID:11500662"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:G8ZS35"
                     /translation="MLRRQARERKEYLYRKAQELQETQLQQKREIIKNALAQGKPLPK
                     ELAEDEQLQKDFRYDQTAGAGETEDLVDDEYAATSGISDPRIIVTTSRDPSTRLSQFA
                     KEIKLLFPTAVRLNRGNYIMPNLVSACVKSGTSDLVILHEHRGVPTSLTVSHFPHGPT
                     AYFTLHNVVLRHDILNSGNQSEVNPHMIFENFTTPLGKRVESILKHLFPPGPKKDSPR
                     VITFANRGDFISVRQHVYVRTREGVEIAEVGPRFEMRLFELRLGTLDNKDADVEWQLR
                     RFVRTAARKDYL"
     gene            complement(<784739..>785992)
                     /gene="TDEL0C04390"
                     /locus_tag="TDEL_0C04390"
                     /db_xref="GeneID:11500663"
     mRNA            complement(<784739..>785992)
                     /gene="TDEL0C04390"
                     /locus_tag="TDEL_0C04390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680491.1"
                     /db_xref="GeneID:11500663"
     CDS             complement(784739..785992)
                     /gene="TDEL0C04390"
                     /locus_tag="TDEL_0C04390"
                     /inference="similar to DNA sequence:INSDC:YIL135C,YNL074C"
                     /note="similar to Saccharomyces cerevisiae VHS2 (YIL135C)
                     and MLF3 (YNL074C); ancestral locus Anc_2.222"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680539.1"
                     /db_xref="GeneID:11500663"
                     /db_xref="UniProtKB/TrEMBL:G8ZS36"
                     /translation="MNEPAEASLSRSSTRSTAYTTCPPSPTLSDSNSSLIFERNVEDP
                     CLMTQAHSPQEGFSKHGSTTSLLSRHNSNQFPGLRSRGSTATIPHSPLMEGQSPEYVM
                     PSLDHRRTLENFVAPALDAGCCVVTDDNADLDDMDIVYMKRPSTMGLDMALGRTKSNS
                     SSTITSANQDTQQTVPQLSLSRSYSNSTNNDHTRTLRFYSYADMLSDEMAQTSPNPGR
                     KPSLGYSLSSSHIKSSPQQRPSVVTNFSNPFIKRRDSATATQGGSKLTRRYSNTLLSR
                     SPPQPRAASQRQGNRSARSNFHVDSSGSDELSTDEDEDPHHQSLPPPASQPPAQLMGP
                     RISRANTQGSSSAGCSPLFVARSYSNTGPPASLGSPSIIRRRESSGIYPQPSINNVLM
                     HDDTLQVEKVGEVLKRRASNRKDNL"
     gene            <786986..>788557
                     /gene="TDEL0C04400"
                     /locus_tag="TDEL_0C04400"
                     /db_xref="GeneID:11500664"
     mRNA            <786986..>788557
                     /gene="TDEL0C04400"
                     /locus_tag="TDEL_0C04400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680492.1"
                     /db_xref="GeneID:11500664"
     CDS             786986..788557
                     /gene="TDEL0C04400"
                     /locus_tag="TDEL_0C04400"
                     /inference="similar to DNA sequence:INSDC:YNL073W"
                     /note="similar to Saccharomyces cerevisiae MSK1 (YNL073W);
                     ancestral locus Anc_2.223"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680540.1"
                     /db_xref="GeneID:11500664"
                     /db_xref="GOA:G8ZS37"
                     /db_xref="InterPro:IPR002313"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018149"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:G8ZS37"
                     /translation="MLRRLLVRCHHTVIDASRLEFTQRNNVIEKNLGQFYPSLSALPL
                     SKNPVSIQQFLAKYSHVDADDPESSCSVNGRIKNIRFSGKKICFVDLYDNCGEKSLQL
                     IINFKKVDSDDQESFESDLRFLKIGDYVEGIGYPGVSQRQKTLSLKCTQLPRILSCAQ
                     MPLPPRLSDSSKINQNRVVDYQVNGVQTLVLRHSIIRSIRKFLDNSQFVEVETPILSS
                     QSNGAAAEPFTTRSTALPEGSNRLELRVAPELWLKRLVVGGLDKVYEIGKVFRNEGVD
                     AVHNPEFTTLEFYKSFTSMEQLIALSEQLLKSILLDLRPLHSNEIIEALIAELQQTEW
                     KFNRVEFIPTLSQELNFDLTTIDLNDPSALYAILPKDLGLPPNLSPQQILNKLASIYI
                     EERYCNSLLPTLIYHHPAVMSPLAKTHPQDPTVTKRFEIFIRGREYINAYEEENCPQL
                     QLAKFQQQNMANQLYKDKESLSVDQKYVDAMKWGMPPVGGFGLGIDRLCMLLLNKDRL
                     EEVLSFGCLDDVNRQ"
     gene            <788707..>789606
                     /gene="TDEL0C04410"
                     /locus_tag="TDEL_0C04410"
                     /db_xref="GeneID:11500665"
     mRNA            <788707..>789606
                     /gene="TDEL0C04410"
                     /locus_tag="TDEL_0C04410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680493.1"
                     /db_xref="GeneID:11500665"
     CDS             788707..789606
                     /gene="TDEL0C04410"
                     /locus_tag="TDEL_0C04410"
                     /inference="similar to DNA sequence:INSDC:YNL072W"
                     /note="similar to Saccharomyces cerevisiae RNH201
                     (YNL072W); ancestral locus Anc_2.224"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680541.1"
                     /db_xref="GeneID:11500665"
                     /db_xref="GOA:G8ZS38"
                     /db_xref="InterPro:IPR001352"
                     /db_xref="InterPro:IPR004649"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR023160"
                     /db_xref="InterPro:IPR024567"
                     /db_xref="UniProtKB/TrEMBL:G8ZS38"
                     /translation="MSDLPPTVQQTLGSIHTRSFYSAIPQEVTESSSVILGVDEAGRG
                     PVMGPMVYGISFCTREYQDTVLIPKYAFDDSKKLTDPVRRDLFSKIYNNEITGVGYAT
                     TCITPVDISGGMFRFPPSKNYNLNEQAHDVTMKLIQGVLDRGVKLDHVYVDTVGQPAS
                     YQKKLEQRFPSVKFTVAKKADSLYCVVSVASVVAKVTRDIIVDLSRRNPEEIIGSGYP
                     SDPKTTAWLRSNQSPLFGWPHEMVRFSWQTCQTLMDNESTGSARVEWEEQFISSKKNM
                     AQQWAARSSPNDEAIITMDNWFN"
     gene            <789954..>791327
                     /gene="TDEL0C04420"
                     /locus_tag="TDEL_0C04420"
                     /db_xref="GeneID:11500666"
     mRNA            <789954..>791327
                     /gene="TDEL0C04420"
                     /locus_tag="TDEL_0C04420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680494.1"
                     /db_xref="GeneID:11500666"
     CDS             789954..791327
                     /gene="TDEL0C04420"
                     /locus_tag="TDEL_0C04420"
                     /inference="similar to DNA sequence:INSDC:YNL071W"
                     /note="similar to Saccharomyces cerevisiae LAT1 (YNL071W);
                     ancestral locus Anc_2.225"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680542.1"
                     /db_xref="GeneID:11500666"
                     /db_xref="GOA:G8ZS39"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="InterPro:IPR006257"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR023213"
                     /db_xref="UniProtKB/TrEMBL:G8ZS39"
                     /translation="MSSLLRAIPRVTRASLVSTVRNQFQLRCYASYPPHTIIGMPALS
                     PTMTQGSLAVWVKKEGDQLSPGEVIAEVETDKAQMDFEFQEEGYLAKILVPEGTKDIP
                     VNKPIAVYVEEQSDVAAFKDFKVEESSSKPTSEPVEKKETKEEKPTKSAAPEKKASKS
                     SAPTDRIFASPLAKTIALEKGIALKKVTGTGPHGRITKADVEAFLQKAPGATAGAGTT
                     APAATASYEDVEISNMRGIIGKRLLESTQSIPSFLVSSDISVAKLLKLRKSLNASANG
                     QYKLSINDILIKAISVAARRVPEANAYWLAEEGVIRKFKNVDVSVAVATPSGLLTPIV
                     KNAEAKGLSSISSEVKELVSRAKINKLTPEEFQGGTICISNLGMNNAVSFFTAIINPP
                     QSTILAIGTLKRVAIEDAGAENGISFDDKMTITGSFDHRTIDGARAGEFMKELKAVIE
                     NPLELLL"
     gene            <791601..>791783
                     /gene="TDEL0C04430"
                     /locus_tag="TDEL_0C04430"
                     /db_xref="GeneID:11500667"
     mRNA            <791601..>791783
                     /gene="TDEL0C04430"
                     /locus_tag="TDEL_0C04430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680495.1"
                     /db_xref="GeneID:11500667"
     CDS             791601..791783
                     /gene="TDEL0C04430"
                     /locus_tag="TDEL_0C04430"
                     /inference="similar to DNA sequence:INSDC:YNL070W"
                     /note="similar to Saccharomyces cerevisiae TOM7 (YNL070W);
                     ancestral locus Anc_2.226"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680543.1"
                     /db_xref="GeneID:11500667"
                     /db_xref="GOA:G8ZS40"
                     /db_xref="InterPro:IPR012621"
                     /db_xref="UniProtKB/TrEMBL:G8ZS40"
                     /translation="MALFPSFILSDESKERISKIVNMTHTVAHYGWIPFILYLGWAHT
                     ANRPNVLNLLSPLPSV"
     gene            <792021..>792956
                     /gene="TDEL0C04440"
                     /locus_tag="TDEL_0C04440"
                     /db_xref="GeneID:11500668"
     mRNA            <792021..>792956
                     /gene="TDEL0C04440"
                     /locus_tag="TDEL_0C04440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680496.1"
                     /db_xref="GeneID:11500668"
     CDS             792021..792956
                     /gene="TDEL0C04440"
                     /locus_tag="TDEL_0C04440"
                     /inference="similar to DNA sequence:INSDC:YIL134W"
                     /note="similar to Saccharomyces cerevisiae FLX1 (YIL134W);
                     ancestral locus Anc_2.227"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680544.1"
                     /db_xref="GeneID:11500668"
                     /db_xref="GOA:G8ZS41"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8ZS41"
                     /translation="MAFDLTPLQKEVIAGLATGSITTLVVHPLDLVKIRLQLLATNAN
                     NLGYSYVIGSILKGGQGKSLQIVKEAYRGLGINWFGNATAWALYFGLYRVSKDLAYRL
                     YTPGAEAGQDELRKDAKLTPLMYLSSGAISGALTSILTNPIWVIKTRIMSTNSREKSS
                     YKSTLDGIQKLLREEGARGLWRGLIPSLFGVSQGAIYFMMYDTLKHRFSSLRHYEGKV
                     NQDKNLKITETFVISSISKVVSVTAVYPFQLLKSNLQSFEAQRKQYTFSKLIRSIFEA
                     EGTMGFYKGLSANLLRAIPSTCITFCIYENLKNCI"
     gene            complement(<793168..>793985)
                     /gene="TDEL0C04450"
                     /locus_tag="TDEL_0C04450"
                     /db_xref="GeneID:11500669"
     mRNA            complement(join(<793168..793736,793952..>793985))
                     /gene="TDEL0C04450"
                     /locus_tag="TDEL_0C04450"
                     /product="60S ribosomal protein L16"
                     /transcript_id="XM_003680497.1"
                     /db_xref="GeneID:11500669"
     CDS             complement(join(793168..793736,793952..793985))
                     /gene="TDEL0C04450"
                     /locus_tag="TDEL_0C04450"
                     /inference="similar to DNA sequence:INSDC:YIL133C,YNL069C"
                     /note="similar to Saccharomyces cerevisiae RPL16A
                     (YIL133C) and RPL16B (YNL069C); ancestral locus Anc_2.228"
                     /codon_start=1
                     /product="60S ribosomal protein L16"
                     /protein_id="XP_003680545.1"
                     /db_xref="GeneID:11500669"
                     /db_xref="GOA:G8ZS42"
                     /db_xref="InterPro:IPR005755"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR023564"
                     /db_xref="UniProtKB/TrEMBL:G8ZS42"
                     /translation="MSTFEPVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRAEALNI
                     SGEFFRNKLKYHDYLRKATAFNKNRGPFHFRAPSRIFYKAVRGMVAHKTARGKAAMER
                     LKVFEGVPPPYDKKKRVVVPQALRVLRLKPGRKYTTLSKLSSSVGWKYEDIVAKLEEK
                     RKVRSAEYYAKKKAFNRKVTAATAASAESEAAKKLATFGY"
     gene            complement(<794446..>795081)
                     /gene="TDEL0C04460"
                     /locus_tag="TDEL_0C04460"
                     /db_xref="GeneID:11500670"
     mRNA            complement(<794446..>795081)
                     /gene="TDEL0C04460"
                     /locus_tag="TDEL_0C04460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680498.1"
                     /db_xref="GeneID:11500670"
     CDS             complement(794446..795081)
                     /gene="TDEL0C04460"
                     /locus_tag="TDEL_0C04460"
                     /inference="similar to DNA sequence:INSDC:YIL132C"
                     /note="similar to Saccharomyces cerevisiae CSM2 (YIL132C);
                     ancestral locus Anc_2.229"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680546.1"
                     /db_xref="GeneID:11500670"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZS43"
                     /translation="MDNTDYSELKLLSIWQSPPQKNLAKFVRQIIGSLNNRTLYYIDA
                     TNSFPLQEFQKIIAVEQKEVYDRIRIITCLDLSELSKTLNQVVQVLNIDKIQQQQRRK
                     EKDGENTNVEILLILNGLEIMFRNTQMECSPSESHLLLKDLLLKLRTIANNCEVGEPM
                     LRTVLTFPKEELLKFNSSNSQSHGNKRLKSTITNANTLAEYVAKFYADEIK"
     gene            complement(<795219..>797486)
                     /gene="TDEL0C04470"
                     /locus_tag="TDEL_0C04470"
                     /db_xref="GeneID:11500671"
     mRNA            complement(<795219..>797486)
                     /gene="TDEL0C04470"
                     /locus_tag="TDEL_0C04470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680499.1"
                     /db_xref="GeneID:11500671"
     CDS             complement(795219..797486)
                     /gene="TDEL0C04470"
                     /locus_tag="TDEL_0C04470"
                     /inference="similar to DNA sequence:INSDC:YIL131C,YNL068C"
                     /note="similar to Saccharomyces cerevisiae FKH1 (YIL131C)
                     and FKH2 (YNL068C); ancestral locus Anc_2.230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680547.1"
                     /db_xref="GeneID:11500671"
                     /db_xref="GOA:G8ZS44"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="UniProtKB/TrEMBL:G8ZS44"
                     /translation="MSHKDMTDSGVSHNTDHVNAINVNAYSPQQHQGLINAVISVLQT
                     PEQLTMVSKQYSNERNLATEVQAYAKISGRDWTYYVKGLEISIGRNTDSVASLANVDT
                     KNGPSPIDIDLGPAKVVSRKHAVIKFNMQHGGWELLVLGRNGAKVNFKRVQVGPAAPP
                     VLLSSGTILDVGGTQMMFILPEQEPFVSQTCVNHLIPKLVSRYGTNLENHYSRNDVNA
                     LLYDILKESDYVKRQPPPPQQQPQHQIRTFKMYGNGGTHNREYNQGMQIDAPRYINGE
                     ANLPAAGGFLHSGAANDAINQANSNPSYPSSNASVSQMGFPQSLDFASDLSRDENRNV
                     KPPHSYATMITQAILSTKEGVISLADIYKYISSNYAYYRFAKTGWQNSIRHNLSLNKA
                     FDKVPRRPNEPGKGMKWKISDDYQRDFLNKWNAGKIGKVRRGSSVARQLQLHLSKYNS
                     LPSQVEYTPEHTVIKQQNMQQNMPQTAKIITHADHEQSQHQWHSQMESALSVSPEAPS
                     PIPSRQNIQHSSQQQDQQQQPPFRPSHLMPPPNSGPRVNQNPTNNALVSFNNASSSTV
                     PGTSSGGSFSSAARKITPIITNTSSAPQASPTHGTLLRSPTKAFHITAMEAYTPERGS
                     GQQSRSPVANSAEANFPEQQSKESKVGHNDGNQDNSGGPKNDKSQANRSSPGVWNLLQ
                     FSSVNNTPAVVNNNDTKNLNSQSSEKQAIGNHGARDLDTKDVASSPLKRHHNQHGGKE
                     LILDTDGAKISIVND"
     gene            <799022..>801580
                     /gene="TDEL0C04480"
                     /locus_tag="TDEL_0C04480"
                     /db_xref="GeneID:11500672"
     mRNA            <799022..>801580
                     /gene="TDEL0C04480"
                     /locus_tag="TDEL_0C04480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680500.1"
                     /db_xref="GeneID:11500672"
     CDS             799022..801580
                     /gene="TDEL0C04480"
                     /locus_tag="TDEL_0C04480"
                     /inference="similar to DNA sequence:INSDC:YIL130W"
                     /note="similar to Saccharomyces cerevisiae ASG1 (YIL130W);
                     ancestral locus Anc_2.231"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680548.1"
                     /db_xref="GeneID:11500672"
                     /db_xref="GOA:G8ZS45"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G8ZS45"
                     /translation="MGDQQQQILQNKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSY
                     ECTYNQPTKRSNTSASTQSPQSANQQRPHGPSNGSGSSLNIPVSSTTTTTAGAIKKPY
                     GKDSKMQSQLMKYKQLFHDILPNLPDIDSLDVPTFTQIYRNFSANPQYASSILSDTVT
                     EYNLIAGDTTPRSSMATSPDGSLGSAHTEAVESIDGSIQSQMGREIKIILPPKPIALQ
                     FLKNVWEHCCVLLRFYHRPSFIEQFDELYETDPQNYTHNQMQFLPLCYSTMAVGALFS
                     KSMDVNKTQDNQGKNESNKGEDAAARDKFLEDEGYKYFIAARKLIDITNARDLNSIQT
                     ILMLFIFLQCSARLSTCYAYIGVAMRSALREGLHRSVSPDSGFSPIEIEMRKRLFYTI
                     YKLDVYVNAMLGLPRSISSNDFDQTLPIELSDENITEEGYFPENQKGKLSSAEIANQH
                     TKLIMILNVIVGELYPIRKTNNLIRHEVVTELELKLRQWLDGLPRELIPGIKDVPKEY
                     ETANKLLHLSFFHVQLILYRPFIHYLSRNIVANSPDSLSIQRARNSVDVARAAVNLAE
                     DMLRQNLLTGSYWYGSYTIFYSVAGLLFYIHEARPTDKASTTEYEAILKDAEVGRNVL
                     LQLKDSSMAADRTFNLLNKLFEKLNSKTIRLSAIHGKAADRTVQGRQVQQDLQQPITV
                     APQQIVDPYNTEPYYGPDLPGYLXXSKNTQSPSETSEDAANKSTKTISGVNTINTAAT
                     SNLSGNENDIFLKSDTTRLDGLFMFDGLNPEIFGGVNMPDNSFKGYDQLSMSGEPDPS
                     TTTTKGKNEPLESESYVPGVFDQLDVQLFGRFLPPYMSQPNGDQQATMQKNAKQ"
     gene            complement(<801727..>809247)
                     /gene="TDEL0C04490"
                     /locus_tag="TDEL_0C04490"
                     /db_xref="GeneID:11500673"
     mRNA            complement(<801727..>809247)
                     /gene="TDEL0C04490"
                     /locus_tag="TDEL_0C04490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680501.1"
                     /db_xref="GeneID:11500673"
     CDS             complement(801727..809247)
                     /gene="TDEL0C04490"
                     /locus_tag="TDEL_0C04490"
                     /inference="similar to DNA sequence:INSDC:YIL129C"
                     /note="similar to Saccharomyces cerevisiae TAO3 (YIL129C);
                     ancestral locus Anc_2.232"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680549.1"
                     /db_xref="GeneID:11500673"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR025481"
                     /db_xref="InterPro:IPR025614"
                     /db_xref="InterPro:IPR029473"
                     /db_xref="UniProtKB/TrEMBL:G8ZS46"
                     /translation="MNSAFTFPAQASDSGSFKFPVSNESGVSMPLNESQESNPSQSQS
                     NILIQAFESHINEPPPIIDIPPPLESVEDIVQVAPVVEPNRNDFKKAAEEGFVPVQDT
                     PPEQIAVMRATETSNNSLAEEYVTNLRQQMATDWKSTSEYALHILFTKFVRHAESKLN
                     LCLQHPLVSEPPIVDILGEGVDPVFDKIIESLGHIAKKKPKPVIDAMMFWRKTKSEIA
                     AVATELVEKLLSEYEAERVRPSLNKNPTMPSITPTHSKTLSNGSRFSHKRNNSSRSSA
                     GSRGLTEGHRLKDLGTQIENAKSAAFQADRKSLISIYILCRVLIEIVKQASDEGDEDL
                     SDKLEEIVFTQLKTTDPLSISSSIIKSSNWNSFAELLGWMSDSKFLSVSDRFIGDLEK
                     IPTYVNRDLEPGVHLLILGMRYLRLKNYPLEKFEETADFIKSIAKFFSKAENISVSLA
                     YAEVISQLLLPLAGSLTAEVNHPTWVEAMNTLLVSANKLLSESKYWASGFKLTVAVLC
                     ASPAEPFSQHWVPLVEKNVKKIRYKELSARVLFVVGLSRMVWVYLYRCPETLNNTTRT
                     LSKILTLYLNHKKKENWITTDLELINPLSDVLVTVGYAHPNFLMENAMIPLIRNSFNG
                     SNLDGINYEKLILAINTYRGLLMTNSKPEFPESDSRYYDLGLSDISIKRTEALTLNHE
                     EICGSIYTLFLILDSNIGSEVWSPENQHKQPSTPFEKFSFSFNNDNSNNNNRNLNIAL
                     FATLIETIPSCLCISVQVPFKSTIEIISRNAVHADLLIATSCQNALKALASKKNPYTL
                     ITWFAKYSFDFDEKTQSSYNMSYLSSSEYRKLLILYVELLECWLEEFQSSNIEEKQRE
                     TGLDGITLEPNLSNSGEANETEMLEWKNTVTVIEEVEGNGLFFLCSQDPNIRKLSIQI
                     LRIISKFDKAMMEKTVKLSRGHSRSSSRFAADSGTRLVDLLNECDFNDLIDSKKMFLS
                     VVERSRISKLNSKYKKGMLIKLAESDYSVDAALWLRVFPKLLSVIFESCPITMALCRS
                     IVCIRLVQVHEIILQIASKGDSRYREVSPEIVANQWKLFLIVACTSLTSTNDQKLHIP
                     TSNLQHGRKKSQQIFTVQHQKIKSATSIFKMVLPLLNSNSPIVREAIITGLSSMNVNI
                     YRAYIENIDKFLTSWKVSSSSNQMRVEMFHVLTILTRFLHEPTVSEDQWTLKRLSDIL
                     KHVKKFLEEDTIQYAYAYQPLRSYFADFLKSYYAVIKEVGLANELFPFQARASCFNYL
                     KEWCGYGERAYVAEERYSAMIKSTGTTAEIRTAMTAGTRVSKEVGLKRLALETMVVLC
                     SDPIRETLKDVPHMPIVVSFDTAGLLSWIEALFNAESEVIRAIGVRALENLLEKNREN
                     AKIFRDVALQCVSIHSRPDVGKFYFTTLCKVVLKMDDLILEENELVSLGLCGLVSDKE
                     DTRSYAVDLLSAVESQLHNSSYTKVFKERLASSSKAVYKSTAKEISSIFAELLPQEIC
                     SEIFSNLVRVLNLFQFDVKKDLLILMVPWVNKFTLKAIDDPETFVALNNLFYITIDLN
                     DELPLEVEQLWISLGRGNSFQNIHVSLEYIMTMSINHRNPAFVQQARDVVLYLANVPG
                     GIGLVDSLIQNLEPKCMIPMTKYPSVEPPNTEAFPYVANIWERLNYHGKSITFSKAHL
                     SIIFLVNLSTNPSEALKENIPTLLHISICLLDHYMPLIQESASKVLCELIFNMAPTHE
                     KSDETVELLRSKHNLWSYDNLLKDKNGARSPKAMDALARNILAIFSQVDGFHIEWQKI
                     SLKWATTCSVRHVACRSFQVFRSLLTFVDQDMLRDMLHRLSNTISDVSPDIQGFAMQI
                     LMTLNAITAELDAADLINFPQLFWSITACLNSIHEQEFIEVLSCFTKFLSKIDLDSPD
                     TVQCLVATFPSNWEGRFDGLQQIVMTGLRSANSLDITWKFLDKLNLLQDSRILANSDS
                     RLLFALISNLPRFLNAMTRKDFTSIQGAVDSMISLSEAYKQPSLSRLIDSLSKNKFRS
                     KKDFMSQVVSFISRNYFPTYSAQVLVFLLRLLLNKVGWVKVETMEILKFIFPLVDLKR
                     PEFTGVGADLISPLLRLLLTEYEAQALEVLDCVTNVSGSKMDKDVLRISMGNKNFKSN
                     SNVTTTLFGIPEESGWSVPMPTMTAATTRHNVHAVFMTCAVNAAGEELSEQPVSMDDI
                     VEFHADTDYGLGRTETNDSLSLAEEKDASLSHMWAELDNLDSFFTKDAVAASAVPHSG
                     LGILHDRTNSVETTQTEQTSTLESAPQLYDKKVSDILNGSLTKIPSNVSFKKSLADSF
                     AANTPNEGLVREPGSRSTYHSPQLYCDDSATPRSKNSNMLKSPTSSVLGAVSTNRIKA
                     TESPQDSLFRFEGFLRSSQRNARRKWQYHQHHQQLLSQTIHEQTLQSPYESENVTPPL
                     MTSSASPVMPTSASSAFSTNPDAFRGKQGTYKQTTSKSGNVKQSKSQKHYHLPHFSSN
                     RSSTKMTNSSGGDPEQKYSSSQLHDF"
     gene            <810605..>813673
                     /gene="TDEL0C04500"
                     /locus_tag="TDEL_0C04500"
                     /db_xref="GeneID:11500674"
     mRNA            <810605..>813673
                     /gene="TDEL0C04500"
                     /locus_tag="TDEL_0C04500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680502.1"
                     /db_xref="GeneID:11500674"
     CDS             810605..813673
                     /gene="TDEL0C04500"
                     /locus_tag="TDEL_0C04500"
                     /inference="similar to DNA sequence:INSDC:YIL128W"
                     /note="similar to Saccharomyces cerevisiae MET18
                     (YIL128W); ancestral locus Anc_2.233"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680550.1"
                     /db_xref="GeneID:11500674"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024687"
                     /db_xref="UniProtKB/TrEMBL:G8ZS47"
                     /translation="MDGLIVSEDLGTAIISFIANVDINDKKADQIASNLSESVIRKRI
                     KLLELVVALKEHLLADEASQRRKALYCLSSVLTKLPEDQLLKNEVSVIFSFYLSKLED
                     TELSKEAYSGLSSLAKMKYISLDNTKDLVKHLSQNYKPSSFLAPVRFFALQCMSNIYV
                     RNESKLISDLAFADGYVKCFLHVANGEKDPRNLLISFKLNRRISSTLKNISKFKEELF
                     DVLFCYFPITFKPPKNDPYKISNSDLKLELRLAISATPEFAEDAFGNLIDKLTASSFN
                     VKNDTLLTLKACIDNFGGESLLKNWLPLWNALKFEIIHNNEGGETTISNAESGSPDVN
                     NYQAALDVIKSCALQLSVFDVGAFDNFFSHVFEELKPNFVYDKDLRQSCSILAAIGSA
                     NTVTFDKVIENTLPLFLKSSSKTAKLKLVMMNLSFFLDSYIVVFNDDNTLHAQARSTN
                     KLAGFQDEILMILGKALTGTSKVETTVRTLSVIQFTKLVKMRDYLNRDEMALIIQYLT
                     ETILTDTNKNIYYACLEGLKTIGDLQEDLLYEMSLKKLLQLLPSDSKDKMFLREDEPI
                     EKENILKVILDFTNSKHRLVKESIIGLSAKLKIVASHKGTSDYCFLLASSLYTLLANN
                     ATLIRDTDASAIKEATEAPLLDMMTNTTAVTMEDHILTLLSNVLFFIELKTPLDTHQQ
                     QLVRFTELFDKDLQIFEKPNRGVLPFVKILGALNKECDFKESTSFFEKTVRLLKKNSL
                     SMSELERLGYLELLMVLVNKWLKESTVEEFSNWNDTSAVNLEVLTWIGKGLIMKNSPM
                     GVKFQRGLIKELGREDVGVFAAKLFEVFVIDITPMNRYKGISWNCNTKLLYKQKFFSE
                     MFPQLVDLYKNSADLSTKSNYLTGLSLILKQIPKTIIEPYMGNLLPLLLQALELPTAD
                     VKVSALSTLKDTAEKFHQLVTEHVQTLYTTLLKLITPGKHNNVQVRLLALELLLILSS
                     VVPLNYSLPYKIDIIRALEPVLDDNRRIVRKQCVITRQAFFELGQVPFEQ"
     gene            complement(<813706..>814332)
                     /gene="TDEL0C04510"
                     /locus_tag="TDEL_0C04510"
                     /db_xref="GeneID:11500675"
     mRNA            complement(<813706..>814332)
                     /gene="TDEL0C04510"
                     /locus_tag="TDEL_0C04510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680503.1"
                     /db_xref="GeneID:11500675"
     CDS             complement(813706..814332)
                     /gene="TDEL0C04510"
                     /locus_tag="TDEL_0C04510"
                     /inference="similar to DNA sequence:INSDC:YIL127C"
                     /note="similar to Saccharomyces cerevisiae YIL127C;
                     ancestral locus Anc_2.234"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680551.1"
                     /db_xref="GeneID:11500675"
                     /db_xref="UniProtKB/TrEMBL:G8ZS48"
                     /translation="MSSSSKHAELQANIAVNSLLSTLLPGAKKISSGIDGRRPKSSTK
                     VRGSKAQLIDRNLKKIVELQERDVESLKKRQRKMKKRAVRANKVENDKIQQLAKLSVL
                     ERHKKVGTLTVKEQKYLNKLVNRNVRTARSLDLEEEDKEALRELQQKIISQNSGVESA
                     KRSKKRRKTVKKFKEDIHPTVSDRRYPGLTPGLAPVGLSDEEDSSDED"
     gene            <814803..>818744
                     /gene="TDEL0C04520"
                     /locus_tag="TDEL_0C04520"
                     /db_xref="GeneID:11500676"
     mRNA            <814803..>818744
                     /gene="TDEL0C04520"
                     /locus_tag="TDEL_0C04520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680504.1"
                     /db_xref="GeneID:11500676"
     CDS             814803..818744
                     /gene="TDEL0C04520"
                     /locus_tag="TDEL_0C04520"
                     /inference="similar to DNA sequence:INSDC:YIL126W"
                     /note="similar to Saccharomyces cerevisiae STH1 (YIL126W);
                     ancestral locus Anc_2.235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680552.1"
                     /db_xref="GeneID:11500676"
                     /db_xref="GOA:G8ZS49"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029295"
                     /db_xref="UniProtKB/TrEMBL:G8ZS49"
                     /translation="MNTVSANPTVLPTNKGMLPTKEKTEIPSIHIPRPVTTAQLEQLL
                     YRYRAIIENKKENKLEIDAIERTLGEVSRDQDVYIQRLDKLRSGIKQGVSYDDDLLER
                     QLLALQLLGKDLDVPEELLLDQDENSLSGANSTDESEKLSPVKCSLDFEENVQNLGLS
                     EKFTNCAPTRLGDPSIESRVSSRIAKRISELERLPANLGTYSLEDALDFVTKDDIPSR
                     IDVAKIRALIELKGLKLLTKQKSLRQKLITNVTSQAHHSIPFLRDSPFTVAAQRSVQV
                     RSKTIVPQTVRLAEELERQQLLEKRKKERNLHMKKVNSIVDFVKEKQSETWSYRDRCL
                     QFGRLGQIAHNQIEKDEQKRMERTAKQRLAALKSNDEEAYLKLLDQTKDTRITQLLRQ
                     TNTFLDSLAQAVKVQQNEAMILRGEEVPPITDEEREKVDYYEVAHRVKEKVTKQPSIL
                     IGGTLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKKEPGPFL
                     VIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQRRSLQFQVRSGNFDVLLTTYEYIIK
                     DRSVLAKPDWAHMIIDEGHRMKNAQSKLSYTITHYYHTRNRLILTGTPLQNNLPELWA
                     LLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRR
                     LKKEVEKDLPDKVEKVIKCKLSGLQHQLYEQMLKHNALFVGAGTEGATKGGIKGLNNK
                     IMQLRKICNHPFVFDEVEGVINPTRENSPLLYRVAGKFELLDRVLPKFRATGHRVLMF
                     FQMTQVMDIMEDFLRMKGLKYMRLDGGTKTEDRTDMLKDFNAPNSDYFCFLLSTRAGG
                     LGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDTVEEVILERA
                     TQKLDIDGKVIQAGKFDNKSTAEEQEAFLRRLIESESSRDEEDKAELDDDELNEILAR
                     SEEEKILFDKMDEERVQLENKEAKSMGLKQSLPRLIEVDELPEVFTEDITAHLQPEPV
                     AVGRIRERKRVYYDDGLTEEQFLQAVEDESSTLEEAIEKRRKARAKRQGVSSPLGDEI
                     GTLESTAEPSINEAPAEEVVEEDEESSLVKPKRKSRSKRRRSVPVAEDQNGLDEAVDE
                     EGTAAEVKEPEKKKPKLKIKLTLKNDPLTPEESETNGVANSKVDKSKQSKTKKTKKAQ
                     NELLPVVENLLALMREQIDETDEHPRTTIFEKLPSKRDYPDYYTLIKHPIALDIVLRN
                     AKKGQYNSLEDVKQDLQVMYDNAKFYNEEGSWVYNDAEKLNEFTDQWFENN"
     gene            <818960..>819535
                     /gene="TDEL0C04530"
                     /locus_tag="TDEL_0C04530"
                     /db_xref="GeneID:11500677"
     mRNA            <818960..>819535
                     /gene="TDEL0C04530"
                     /locus_tag="TDEL_0C04530"
                     /product="60S ribosomal protein L9"
                     /transcript_id="XM_003680505.1"
                     /db_xref="GeneID:11500677"
     CDS             818960..819535
                     /gene="TDEL0C04530"
                     /locus_tag="TDEL_0C04530"
                     /inference="similar to DNA sequence:INSDC:YNL067W"
                     /note="similar to Saccharomyces cerevisiae RPL9B
                     (YNL067W); ancestral locus Anc_2.236"
                     /codon_start=1
                     /product="60S ribosomal protein L9"
                     /protein_id="XP_003680553.1"
                     /db_xref="GeneID:11500677"
                     /db_xref="GOA:G8ZS50"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002359"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="UniProtKB/TrEMBL:G8ZS50"
                     /translation="MKFVQTEQFIEVPQGVQVNIRSRVVKVTGPRGILVKNLKHIDVT
                     FTQISEKQIKVAVHNGDRKHVAALRTVKSLVDNLITGVTKGYKYKMRYVYAHFPINVN
                     VVDKDGKKFIEIRNFLGDKKVRLVPVREGVDIEFSTTQKDEMVLSGNSVEDVSQNAAD
                     VQQICRVRNKDIRKFLDGIYVSEKGVIEQEN"
     gene            <820460..>823525
                     /gene="TDEL0C04540"
                     /locus_tag="TDEL_0C04540"
                     /db_xref="GeneID:11500678"
     mRNA            <820460..>823525
                     /gene="TDEL0C04540"
                     /locus_tag="TDEL_0C04540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680506.1"
                     /db_xref="GeneID:11500678"
     CDS             820460..823525
                     /gene="TDEL0C04540"
                     /locus_tag="TDEL_0C04540"
                     /inference="similar to DNA sequence:INSDC:YIL125W"
                     /note="similar to Saccharomyces cerevisiae KGD1 (YIL125W);
                     ancestral locus Anc_2.237"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680554.1"
                     /db_xref="GeneID:11500678"
                     /db_xref="GOA:G8ZS51"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR011603"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G8ZS51"
                     /translation="MLRSISSSRTASGRLLKSCLLRRTTIGRSSAGVVVPFGFTSKRC
                     FASGTDTFLSTSNANYIDEMYEAWKNDPSSVHASWNAYFKNMGNTNISPASAFQAPPN
                     LVGGPTGSENLPLDKGVGSVDENVMTHLKVQLLCRAYQVRGHLKAHIDPLQISFGDDK
                     SKPIPKELTLEYYGFTERDLDKEINLGPGILPRFAKDGRTKMTLREIVNAMEKLYCRS
                     YGIQYTHIPSKEKCEWLRERIEIPTPFHYTIDQKRQILDRLTWSTSFESFLSTKFPND
                     KRFGLEGLEAVVPGIKTLIDRSVEMGVEDVVLGMAHRGRLNVLSNVVRKPNESIFSEF
                     TGSSSQDQAEGSGDVKYHLGMNYKRPTTSGKYVNLSLVANPSHLEAQDPVVLGRTRSI
                     LYAKNDLENKAKAVSVLLHGDAAFAGQGVVYETMGFVNLPEYSTGGTIHVITNNQIGF
                     TTDPRFARSTPYPSDLAKAIDAPIFHVNANDVEAVTFIFNLAAEWRQTFHTDAIIDVV
                     GWRKHGHNETDQPSFTQPLMYQKIAKQKSVIDVYTEKLVVEGSFTKADIEEHKKWVWN
                     LFEEAFEKAKDYKPTSREWLTAAWENFKSPKELATEILPHEPTNVQADTLKEVGKAIS
                     SWPADFEVHRNLKRILNNRGKSVESGNGIDWSTGEALAFGTLALEGYNVRVSGEDVER
                     GTFSQRHAVLHDQSSEKIYTPLKNLSEKQGDFTIANSSLSEYGVMGFEYGYSLTDPDN
                     FVMWEAQFGDFANTAQVIIDQFIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLER
                     FLQLANEDQRFFPSEEKLQRQHQDCNFQVVYPTTPANLFHILRRQQHRQFRKPLILFF
                     SKQLLRHPLARSELSEFSEGSFKWIIEDGEHGNSIGTKEETKRLVLMTGQVYTALHKR
                     RADLEDKTTAFLKIEQPHPFPFAQLRDAINSYPNLEDIVWCQEEPLNMGSWSYAAPRL
                     ATVLKETDNYKGHAVRYCGRNPSGAVAAGNKALHLAEEDAFLKEVFNSS"
     gene            <823788..>824663
                     /gene="TDEL0C04550"
                     /locus_tag="TDEL_0C04550"
                     /db_xref="GeneID:11500679"
     mRNA            <823788..>824663
                     /gene="TDEL0C04550"
                     /locus_tag="TDEL_0C04550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680507.1"
                     /db_xref="GeneID:11500679"
     CDS             823788..824663
                     /gene="TDEL0C04550"
                     /locus_tag="TDEL_0C04550"
                     /inference="similar to DNA sequence:INSDC:YIL124W"
                     /note="similar to Saccharomyces cerevisiae AYR1 (YIL124W);
                     ancestral locus Anc_2.238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680555.1"
                     /db_xref="GeneID:11500679"
                     /db_xref="GOA:G8ZS52"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:G8ZS52"
                     /translation="MTTENSRKIAVVTGASSGIGFAIARELAQNGYKVYACARRVEPM
                     EKLAKEFESGVIIPYRLDVTNGDEILELKRTLAAELPYRKLDLLYNNAGQSCTFPAID
                     VTNDMVEQCFKVNVFSHVNMCRELAQFLINAKGTIVFTGSIAGIGVLPFSSIYAASKA
                     AIHQYARDLHLEMKPLGVRVINAITGGVNTDIADKRPLPATSMYNFKESMEVFQHRQQ
                     MAKRHSPMTAEAYAEKLVRDILSNRDPVDVYRGTFASRMSWAILFVPYWVLEWVVNRK
                     FGMNKIYKVLRQKKE"
     gene            <825541..>826815
                     /gene="TDEL0C04560"
                     /locus_tag="TDEL_0C04560"
                     /db_xref="GeneID:11500680"
     mRNA            <825541..>826815
                     /gene="TDEL0C04560"
                     /locus_tag="TDEL_0C04560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680508.1"
                     /db_xref="GeneID:11500680"
     CDS             825541..826815
                     /gene="TDEL0C04560"
                     /locus_tag="TDEL_0C04560"
                     /inference="similar to DNA sequence:INSDC:YIL123W,YNL066W"
                     /note="similar to Saccharomyces cerevisiae SIM1 (YIL123W)
                     and SUN4 (YNL066W); ancestral locus Anc_2.239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680556.1"
                     /db_xref="GeneID:11500680"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="UniProtKB/TrEMBL:G8ZS53"
                     /translation="MKFSTALATTLIGANAIVSALPHMHVKRDEDCVTTVTDAHQHKR
                     AVAVEYVYQTVTVDGHGQTVGRISAVTESQTAVPTTLTPSTSSAEATTTSSPATAVTS
                     SSFEQKTTSTTSSSKTAETSTTSTSSSSAKVGSSTSSSAKATSTSTSSGGIYGDLAAF
                     SGPTEKFQDGTIPCSQFPAGQGVVAIDWINQGGWSGIENPDTSTGGSCADGSYCSYAC
                     QAGMSKTQWPSSQPADGRSIGGLYCKNGMLYRSNTNNDYLCEWGYPSAYVVSQLNQGV
                     AVCRTDYPGTENMVIPTYVGAGQSQPLTVVDQDTYYTWQGMKTSAQYYVNNAGVSLED
                     GCVWGNAGSGIGNWAPMNFGAGHTNGISYLSLIPNPNNRTPLNFNVKIVASDSSSVVQ
                     GECKYENGVYNGSGSDGCTVAVTSGSAHFVLY"
     gene            <827930..>828982
                     /gene="TDEL0C04570"
                     /locus_tag="TDEL_0C04570"
                     /db_xref="GeneID:11500681"
     mRNA            <827930..>828982
                     /gene="TDEL0C04570"
                     /locus_tag="TDEL_0C04570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680509.1"
                     /db_xref="GeneID:11500681"
     CDS             827930..828982
                     /gene="TDEL0C04570"
                     /locus_tag="TDEL_0C04570"
                     /inference="similar to DNA sequence:INSDC:YIL122W"
                     /note="similar to Saccharomyces cerevisiae POG1 (YIL122W);
                     ancestral locus Anc_2.240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680557.1"
                     /db_xref="GeneID:11500681"
                     /db_xref="UniProtKB/TrEMBL:G8ZS54"
                     /translation="MQDSSTNKQDFGLPERELSDELENRKIKLKVEDPASGSAAGRTS
                     DLKRTFMAEVGLEKYVELAETDEDIFNKLLELRIEQKRKEVEELRDSNLRTLNIVIGK
                     CIESDKISDDIIRTLLDVVNLPHRGEPNPSSSLKRRKRNSPAMSPRGHRRIASEVASI
                     NTNQAQVQSMPSPYSILYHNVPGPTPWLPQHYNTPLQTQYQFQNSVPAGLGVRTGRSR
                     EASILQNNENQKSDQFHSFSPANLVTTGNSGISGHHPGALSSRPSLMGVPTESPARGV
                     SGYLQPPQQIQPHYGIKTDPIPQRRFASHQRSQSANFINGPQTHMAKSPINELHASPQ
                     KPINFLIHTPKHPPPS"
     gene            <829514..>831187
                     /gene="TDEL0C04580"
                     /locus_tag="TDEL_0C04580"
                     /db_xref="GeneID:11500682"
     mRNA            <829514..>831187
                     /gene="TDEL0C04580"
                     /locus_tag="TDEL_0C04580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680510.1"
                     /db_xref="GeneID:11500682"
     CDS             829514..831187
                     /gene="TDEL0C04580"
                     /locus_tag="TDEL_0C04580"
                     /inference="similar to DNA sequence:INSDC:YIL121W"
                     /note="similar to Saccharomyces cerevisiae QDR2 (YIL121W);
                     ancestral locus Anc_2.241"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680558.1"
                     /db_xref="GeneID:11500682"
                     /db_xref="GOA:G8ZS55"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZS55"
                     /translation="MNNNEKEDIRKTPTEKDTESKHERLSLPGDNESMCSIDVEQSSC
                     TRTKSARLEPHYTSPPYSRFGRREKFLLVVQCAFTGFFSTIAAAIYYPVLTVIEDLFD
                     ISEEKVNITVVVYFIFQGISPTLMGGLADYLGRRPIVILSVLVYFSACVGLACSQSYA
                     QIIALRCLQAAGISPVIAINSGIMGDVTTRAERGGYVGYVSGCQVVGSAFGALIGAGL
                     SSRWGWRSIFWFLAIGSGACLVATVLFLPETKRTVVGNGSVTPKSVINKSPLLVIPVA
                     RHRLHLDNPDIETLENSTPLNLLAPFAVLKIPEVALLLTVAGLQFATWTTHQTALTTA
                     LSKHYHLSVAKIGLCFLPAGICTLISVVTSGRYLNWNYRGKIKRHKEWLKTQEELLLE
                     EYAGDIERVREKMENDCHYTFNIFRARLQPAIFTVLLSSAGFISYGWCLHVKAPLAAV
                     LCMSAFASLFSNCILTMSVTLIVDVFPSKASTATGCLNLFRCIFSAILIATLTRMTNK
                     MTSGGVFTFLGALTALSCSLLLVIIAQGKKISHKRRQQEKRLLEGKTET"
     gene            <831668..>833257
                     /gene="TDEL0C04590"
                     /locus_tag="TDEL_0C04590"
                     /db_xref="GeneID:11500683"
     mRNA            <831668..>833257
                     /gene="TDEL0C04590"
                     /locus_tag="TDEL_0C04590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680511.1"
                     /db_xref="GeneID:11500683"
     CDS             831668..833257
                     /gene="TDEL0C04590"
                     /locus_tag="TDEL_0C04590"
                     /inference="similar to DNA sequence:INSDC:YNL065W,YIL120W"
                     /note="similar to Saccharomyces cerevisiae AQR1 (YNL065W)
                     and QDR1 (YIL120W); ancestral locus Anc_2.242"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680559.1"
                     /db_xref="GeneID:11500683"
                     /db_xref="GOA:G8ZS56"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZS56"
                     /translation="MSNESIENDDISIESGEVPRLIHGDDSTKHGDMVMTNDKPIENN
                     GTISRNEAPYTLLSYGQKWGMVALLTMCTFWSSLGSPIYYPALRQLEKEFNIDEDKVN
                     VTVVVYLLFQGIAPTFSGGLADIYGRRPVIVIGMIIYVAVSVGLACSNSYGVLVFLRI
                     LQSACISPTIAISSGFVGDFTLKFERGTFVGATSGFALLGQAFGSLIGAALAAAWDWR
                     AIFWFLVIGCGVCMLIIFTLLPETKRTLVGNLSVKPKNILNRAPIFLLKPVQKRFKYD
                     NPDYDTLDPNVPKLDLTSALKITAQPEIILSLFPAGLQFAMWTLMLSAISSELSANPY
                     NYKLTIIGVCYLPAGIGGLVGSFITGRIIDIFYRKLTKKFEQDKENGTIPQETEFNVI
                     RARLLAGVPQNFIAVVSFLLFGWSVDKGWRIPAVLITSCVSSFCAMSTLSTSSTLLVD
                     LYPGKSSTATSCFNFIRCTLSAIFMGCFAKMKTSMTVGGTFTFMCGLVFIGNFLLLIP
                     MRYGMKWRNERALKAELKSSM"
     gap             833365..833384
                     /estimated_length=20
     gene            complement(<833405..>834640)
                     /gene="TDEL0C04600"
                     /locus_tag="TDEL_0C04600"
                     /db_xref="GeneID:11500684"
     mRNA            complement(<833405..>834640)
                     /gene="TDEL0C04600"
                     /locus_tag="TDEL_0C04600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680512.1"
                     /db_xref="GeneID:11500684"
     CDS             complement(833405..834640)
                     /gene="TDEL0C04600"
                     /locus_tag="TDEL_0C04600"
                     /inference="similar to DNA sequence:INSDC:YNL064C"
                     /note="similar to Saccharomyces cerevisiae YDJ1 (YNL064C);
                     ancestral locus Anc_2.243"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680560.1"
                     /db_xref="GeneID:11500684"
                     /db_xref="GOA:G8ZS57"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:G8ZS57"
                     /translation="MVKDSKYYDLLGVSVSATEIEIKKAYRKSALKYHPDKNPSAEAA
                     EKFKEVSSAYEVLSDSEKRQVYDQFGEEGLSGGAGGAGGFGGFGGYGDDIFSQFFGGA
                     PGGGRPRGPQRGRDIKHEIAVTLEELYKGRTAKLALNKQILCKGCNGRGGKEGAVKKC
                     SSCNGQGYKFVTRQMGPMIQRFQTECEACAGTGDIIDPKDRCKSCNGKKVANERKILE
                     VHVDPGMKDGQKIVFKGEADQAPDVIPGDVIFVVSEKPHKNFQRVGDDLVYEAEIDLL
                     TAVAGGEFSLEHVSGDWLKVAIVPGEVISPGMRKVVEGKGMPIAKFGGYGNLLVTFKI
                     NFPPNHFTSDENLKKLEEILPPRAKTTIPSKAHVEDCVLSEFDAAKYNRQNGRGGQSY
                     DDDDDDEHGGAEGVQCASQ"
     gene            complement(<834832..>835761)
                     /gene="TDEL0C04610"
                     /locus_tag="TDEL_0C04610"
                     /db_xref="GeneID:11500685"
     mRNA            complement(<834832..>835761)
                     /gene="TDEL0C04610"
                     /locus_tag="TDEL_0C04610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680513.1"
                     /db_xref="GeneID:11500685"
     CDS             complement(834832..835761)
                     /gene="TDEL0C04610"
                     /locus_tag="TDEL_0C04610"
                     /inference="similar to DNA sequence:INSDC:YIL119C"
                     /note="similar to Saccharomyces cerevisiae RPI1 (YIL119C);
                     ancestral locus Anc_2.244"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680561.1"
                     /db_xref="GeneID:11500685"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="UniProtKB/TrEMBL:G8ZS58"
                     /translation="MSAEPQADEQDRNERMQKYIDGIIAVTSLDGGGGVGGDGKGVGG
                     DEEDILMMKKKKKKEDPSTDESDSDDSSTYSIEIKRASPLISFASNGKKTRNKWKASE
                     DFALLRVLLDHAHLLTFVEYFKPMKKFWIKISQALNELHAGERNARQCHDRFKVLYAK
                     ALRIQDDLDEDDTYSGTLNSEAEQLLLHVRNTFTFSSGNITLKTQPAVASALPDETAQ
                     ATKLRQDQDQTTETQRKETETMQSYIFHVLSNLQEQIDLLRNHLRATDRKTQELSDTL
                     QDLIQAFHFPPPPSQHENQDEKRSSGDDARTKK"
     gene            <836143..>836985
                     /gene="TDEL0C04620"
                     /locus_tag="TDEL_0C04620"
                     /db_xref="GeneID:11500686"
     mRNA            <836143..>836985
                     /gene="TDEL0C04620"
                     /locus_tag="TDEL_0C04620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680514.1"
                     /db_xref="GeneID:11500686"
     CDS             836143..836985
                     /gene="TDEL0C04620"
                     /locus_tag="TDEL_0C04620"
                     /inference="similar to DNA sequence:INSDC:YNL063W"
                     /note="similar to Saccharomyces cerevisiae MTQ1 (YNL063W);
                     ancestral locus Anc_2.245"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680562.1"
                     /db_xref="GeneID:11500686"
                     /db_xref="GOA:G8ZS59"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR004556"
                     /db_xref="InterPro:IPR007848"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZS59"
                     /translation="MRVCPAYIRKVSRQDPLLAMLVGVCRGESQARQELRWMRQELVD
                     PARVRWACKLRSRQVPLQHVLGSQPFGAIDVLCRPQVLIPRWETEEWVCDLTSRLAGM
                     RLQIVDLCTGTGCVALHLQRSLSAARVTAVDCSASAIALAQCNAGRNELQLRLLQRDV
                     LGWQPDEIGRVDLVVCNPPYIPPDKLVRDARASVRFYEPRLALVGDKEFYENLVRVWL
                     SRTRAFVYEVGSEDQCAYVKKHAGKEWIVGTRKDARGEARVVYGYRDGDSEFARAFKG
                     YDNL"
     gene            837072..837145
                     /gene="TDEL0Ctrna5N"
                     /locus_tag="TDEL_0Ctrna5N"
                     /db_xref="GeneID:11500687"
     tRNA            837072..837145
                     /gene="TDEL0Ctrna5N"
                     /locus_tag="TDEL_0Ctrna5N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:11500687"
     gene            complement(<837302..>837877)
                     /gene="TDEL0C04630"
                     /locus_tag="TDEL_0C04630"
                     /db_xref="GeneID:11502019"
     mRNA            complement(<837302..>837877)
                     /gene="TDEL0C04630"
                     /locus_tag="TDEL_0C04630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680515.1"
                     /db_xref="GeneID:11502019"
     CDS             complement(837302..837877)
                     /gene="TDEL0C04630"
                     /locus_tag="TDEL_0C04630"
                     /inference="similar to DNA sequence:INSDC:YNL090W"
                     /note="similar to Saccharomyces cerevisiae RHO2 (YNL090W);
                     ancestral locus Anc_2.200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680563.1"
                     /db_xref="GeneID:11502019"
                     /db_xref="GOA:G8ZS60"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZS60"
                     /translation="MSENAVRRKLVIIGDGACGKTSLLYVFTLGKFPEEYHPTVFENY
                     VTDCRVDGIKVSLTLWDTAGQEEYERLRPFSYSKADIILIGFAVDDPESLINARTKWA
                     EEALRYCPDAPIILVGLKKDLRRSHEENAQGEKFVSLADAQQIAKQIGAKKYLECSAL
                     SGEGVDDVFELATRTSLLVNKEPGQQCCLIA"
     gene            complement(<838217..>842107)
                     /gene="TDEL0C04640"
                     /locus_tag="TDEL_0C04640"
                     /db_xref="GeneID:11500688"
     mRNA            complement(<838217..>842107)
                     /gene="TDEL0C04640"
                     /locus_tag="TDEL_0C04640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680516.1"
                     /db_xref="GeneID:11500688"
     CDS             complement(838217..842107)
                     /gene="TDEL0C04640"
                     /locus_tag="TDEL_0C04640"
                     /inference="similar to DNA sequence:INSDC:YNL091W"
                     /note="similar to Saccharomyces cerevisiae NST1 (YNL091W);
                     ancestral locus Anc_2.199"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680564.1"
                     /db_xref="GeneID:11500688"
                     /db_xref="GOA:G8ZS61"
                     /db_xref="InterPro:IPR025279"
                     /db_xref="UniProtKB/TrEMBL:G8ZS61"
                     /translation="MPPNSKKGKKKSKSKQHTKKGTSSEIQAKLYDEANDYPTSRVIK
                     RAPNGDVIVESLPTDEELDEDQKNSQSMESPMAFTLDSHWESLEPEEKKSILRIEKDE
                     VFDVIQNYQNSHNCNCSVCGRRHMAMDQEMERIYNTLYDLDRERDPEINPIKFHLSII
                     KELQNSKVQHQQDVASCGVNGGNNDDDQPVSEPGNIRDDVVKYFLSSNAVDSLKEEVM
                     HFKQNKQQQQILSGHGEGVENDEPPTTPVEQTVDPNIIRTPSISDDLHNKPVQEGESR
                     GMPADNEELQAKYLKFAKTFVSSHPKIAKEYVSRMMMYPDMRALTDDLMNNNGQGFVK
                     AIESFVAQKQGQLPDPVGAENSFDGFVEAANIKGQSLGDAKEFTTMLHNGKPLTPEEY
                     ANLQRHVADRMTNSYDAQRKEFKEVSQLERELFTRFMFGEDRKRFGDLIMQSFREKFD
                     DQYSNAAIGASLAAAAATTVSPIEMPGHDEINEDYDFDHGENDEDEEELDSNEYDESY
                     DDYSDYGDEDEIEQGDEEDEIRSDLDEENDDDEEPASERSHRYCAHDARVDQQHTCHE
                     HKSHVQDNGIPHGQQNGHYHPHHEHDEDFHDENDKYESSLDEADRLEEGRKLIQIAIT
                     KLLQGRIMESYHEKQAENNRLKLLQELEAEELKKKAKEEKKHKKREKEKEKKKAQQIA
                     KEEEKRRKEEEAEMMKKEAEEREKQRREAQRKKVEEVKRKKDEERRRKLEEQRRREEE
                     QERHRKIKEEQKRKRDEERRLKDEERKRLEEGKRQKEEELKLQEQLKLKADEEKRLQE
                     ERATENQTKMHLDQAVDRNIDGPSSQKPLFTSLQYSTPSPNMPYGNNVQPMPSYRSNN
                     VNDDILNMVSSATASKPVASSSGLQTLLDVGPGIPHDAGSQPLVSNGAQLFGPSSLMP
                     TGNYPGEEMSYNNMPCMMPPVSSSRNSASSGLGSQNFGLSSWNSYGSNPNLMKGFHQA
                     PLDLQREQRQHSVSAFGTNNTQPANEEYLAEEMNNIANMLSSAGLQDPSTTSRAGSFG
                     QLPLWGSQRDRSSISIPNSLAPRNTGLNIDANPSSEAVSTSEAPITGSTAQHSSIWDE
                     GSKDTIPTIAGEVTPMANKSRSATFSSSIWGPTHMSFLDEASDVSNTPTAQTNVENKR
                     IDREQENKDSVFVDSIYKTYLAFTPPGSQDYVPTNTIHQNSLCCTLDYPSFISYLLSM
                     HTSHNCDLLTSPAGSITHVRMSGPQNEKAQSSSRDRTDSMMSGAYFNQPETSMPPQLN
                     ETNSALGNGPAFGPQYFNLPHSMNHSSLTSNIWG"
     gene            <842766..>844808
                     /gene="TDEL0C04650"
                     /locus_tag="TDEL_0C04650"
                     /db_xref="GeneID:11500689"
     mRNA            <842766..>844808
                     /gene="TDEL0C04650"
                     /locus_tag="TDEL_0C04650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680517.1"
                     /db_xref="GeneID:11500689"
     CDS             842766..844808
                     /gene="TDEL0C04650"
                     /locus_tag="TDEL_0C04650"
                     /inference="similar to DNA sequence:INSDC:YOR087W"
                     /note="similar to Saccharomyces cerevisiae YVC1 (YOR087W);
                     ancestral locus Anc_2.198"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680565.1"
                     /db_xref="GeneID:11500689"
                     /db_xref="UniProtKB/TrEMBL:G8ZS62"
                     /translation="MSEDSATLPMFQEQCLAGHGDPTMGLKPPSSRQVLRIALNLKYL
                     LDKIIPTVYDVDKVTCPHSRIINQDVIKLVREACGGNPKDKSSVQRYQSVLLFALLKV
                     SSWYEELAAEELHNASLYELRSLAAQHLCRVIIEHEETVDLQFLFMEMLLRRYVINEN
                     DEDSEPASVIELAADMHLTVVIGSSGFQRCLKWLWRGWIIQSRDDASVFVREKLVAST
                     SFRDHFNPERIKTPMYQNIIQIIFSFVFLILYTVVVNDKNSTKVEPLDAKEICFYLFT
                     LGYVIDEMVKFFYIGSAYFSFWNAFNNTLYAIIGTSVFLRIISVGPIKTHYPAEYWDM
                     ISYRILSLAAPFVWSRLLLFLESVQFVGLMLVVLKHMMAESLVFFVMLFLMMIGFLQG
                     FIGLDSSDGKNEITGPIMTNLFITVLGAGGFDTFEEFAPPYAAILYYGYRFIVSVILL
                     NILIALYANAYQKVVDNAGDEYMALMCQKTLRFIRAPDEEVYVPPLNIVEAFVHPTTL
                     LLSTENARRLNHFIMTILYAPVLLVVALTEIRTARRIQYNRMKNLEDDANESDRAWDL
                     TDGFVDTGHDIFSQTENTGIHATRKKNGVSLKKQREAEKADPHFSVPKDWCKRVKKSV
                     QPVQEGFQSGIGWETFKLYNEVQERYEKTEEKIEKLNKTITNLVESLQELKLTKQE"
     gene            complement(<845203..>845838)
                     /gene="TDEL0C04660"
                     /locus_tag="TDEL_0C04660"
                     /db_xref="GeneID:11500690"
     mRNA            complement(<845203..>845838)
                     /gene="TDEL0C04660"
                     /locus_tag="TDEL_0C04660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680518.1"
                     /db_xref="GeneID:11500690"
     CDS             complement(845203..845838)
                     /gene="TDEL0C04660"
                     /locus_tag="TDEL_0C04660"
                     /inference="similar to DNA sequence:INSDC:YNL093W,YOR089C"
                     /note="similar to Saccharomyces cerevisiae YPT53 (YNL093W)
                     and VPS21 (YOR089C); ancestral locus Anc_2.196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680566.1"
                     /db_xref="GeneID:11500690"
                     /db_xref="GOA:G8ZS63"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZS63"
                     /translation="MNSSITSVKLVLLGEAAVGKSSIVLRFVSNDFTENKEPTIGAAF
                     LTQRVNIGDETVKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWV
                     KELHEQASKGIIIALVGNKIDVLESGEERKVAREEAEKLAEEENLLYFETSAKTGENV
                     NEVFLAIGEKIPLKKAEDQANQQHGLRITDDQRIDLASSTNGPVKASGCNC"
     gene            complement(<845981..>847660)
                     /gene="TDEL0C04670"
                     /locus_tag="TDEL_0C04670"
                     /db_xref="GeneID:11500691"
     mRNA            complement(<845981..>847660)
                     /gene="TDEL0C04670"
                     /locus_tag="TDEL_0C04670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680519.1"
                     /db_xref="GeneID:11500691"
     CDS             complement(845981..847660)
                     /gene="TDEL0C04670"
                     /locus_tag="TDEL_0C04670"
                     /inference="similar to DNA sequence:INSDC:YOR090C"
                     /note="similar to Saccharomyces cerevisiae PTC5 (YOR090C);
                     ancestral locus Anc_2.195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680567.1"
                     /db_xref="GeneID:11500691"
                     /db_xref="GOA:G8ZS64"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:G8ZS64"
                     /translation="MSLLVRSTALKRTSRTLLKCLSKKNFEKLIYRTYLADNGKFNTS
                     NHIKKSNAFPYTRDLNLALLSGGVLILSYSYFSSKSVVSLDTVKGLRHYSSNTDGQDP
                     SQQNGAKESGSQTANSSSGDSLVLLTEQEVNARLRDRQKSFLVNRGKGIVRYDVSQLP
                     SNHPIEDNHVEQVITVPVSSDDSQPEDLYFFGIFDGHSGSFTSTKLSQDLVRYVAQRL
                     GQFYEEEGGFLASSSKMDNAIVQAFEQLDNDIVYGSLRKLFREPTKENMVGCLPAISG
                     SCALLTAYNSLNSTVKVAVSGDSRALIAGLDKNGEWVVRSLSTDQTGDNPEEVERIRS
                     EHPGEPNAVRNGRVLGSLQPSRAFGDYRYKVKDVDGKTLADLPEHVRIYFRSKPRDFL
                     TPPYVTARPEITTTKIDSDTKFMVLGSDGLFELLSNEEIAGLVVKWIERNSGLKPALQ
                     SPENKLPHITDLSPDKESLRPAFRYKSRKDSEGFLMEDKNVATHLIRNALSAGGSKEY
                     VSTLVSIPSPMSRKYRDDLTVTVVFFGESDQTNDGTIQTNFEATTQPKSKL"
     gene            <848221..>849228
                     /gene="TDEL0C04680"
                     /locus_tag="TDEL_0C04680"
                     /db_xref="GeneID:11500692"
     mRNA            <848221..>849228
                     /gene="TDEL0C04680"
                     /locus_tag="TDEL_0C04680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680520.1"
                     /db_xref="GeneID:11500692"
     CDS             848221..849228
                     /gene="TDEL0C04680"
                     /locus_tag="TDEL_0C04680"
                     /inference="similar to DNA sequence:INSDC:YOR091W"
                     /note="similar to Saccharomyces cerevisiae TMA46
                     (YOR091W); ancestral locus Anc_2.194"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680568.1"
                     /db_xref="GeneID:11500692"
                     /db_xref="GOA:G8ZS65"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:G8ZS65"
                     /translation="MPPKRNQQQTKKKDNVDKTFGMKNKNRSTRVQKYIKQVESQSNP
                     EKEDLKRQRYEAKKRQEAEEAERRALFNPALDQRVRAGVDPKTVVCAMFKIGNCNKGA
                     RCKFSHDLSMGRKVEKKDLYSDVRKEKEQDTMDNWDEDKLRDVILSKHGNPKTTTEKV
                     CKFFIEAVENGKYGWFWTCPNGGDKCMYRHSLPEGFVLKTNEQKRMEREALENQPKIT
                     LEEFIETEREKLDKTKLTPITMENFAKWKRNHIIEKNNAESKEAEKKKPCGREVLLKL
                     FVENKKFDENDLADATQGSEWDLSEFTKALNETDDIKDYGDGSNPNFDIIKKENNTAS
                     A"
     gene            complement(<849297..>850979)
                     /gene="TDEL0C04690"
                     /locus_tag="TDEL_0C04690"
                     /db_xref="GeneID:11500693"
     mRNA            complement(<849297..>850979)
                     /gene="TDEL0C04690"
                     /locus_tag="TDEL_0C04690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680521.1"
                     /db_xref="GeneID:11500693"
     CDS             complement(849297..850979)
                     /gene="TDEL0C04690"
                     /locus_tag="TDEL_0C04690"
                     /inference="similar to DNA sequence:INSDC:YNL094W"
                     /note="similar to Saccharomyces cerevisiae APP1 (YNL094W);
                     ancestral locus Anc_2.193"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680569.1"
                     /db_xref="GeneID:11500693"
                     /db_xref="InterPro:IPR019236"
                     /db_xref="UniProtKB/TrEMBL:G8ZS66"
                     /translation="MNQYGQNMNMKSNIGGNDGALLNKRQRLLNLMKNTKDSYMHGWS
                     SGLPQRTLDSIRGTDSENPPDSNLPLDMDIQFYPTYTTKSEEGYETMVRLAVFSPGNP
                     ASRRNRILLSLCKQYLRPANPEAVDDANESKFDDPSTSESTLTAKSSASTLTLNGLHD
                     NGSPAPDELDVLKSRIAGFMIRKIPNLPIIIDLLSREGPGYYDTTLATTNNIGNISLR
                     IRSEFLPTDIRITLDTPTDFPKVITHRFPCNFIKPNGYGVISDIDDTIKHTGVTGDKR
                     SMFRSVFLNDINTWLINDVSRWYKKLKELFQADFFYVSNSPVQTYPTLYQYVSNHFPA
                     GPLFLKQYTGNLLSSIMTSSANRKLGAITQILKDFPNKKFILIGDSGEQDFEAYLSTA
                     SQYQEQICGIYIRCCKDSLSDMGLRETEVMHELNDIISEQYLSHKSKETRKKRPPPPV
                     SLLKPDLSPEQQKEIKESRLKPKNRDLPTLPPRPSEVQDLESSVYCTPSTQNDYGTYN
                     QFFDKKADAWRSRVLNGVRTLKSLNKDKPIRVMFFTDPKVPLEDYVNEVQRE"
     gene            <851474..>852871
                     /gene="TDEL0C04700"
                     /locus_tag="TDEL_0C04700"
                     /db_xref="GeneID:11500694"
     mRNA            <851474..>852871
                     /gene="TDEL0C04700"
                     /locus_tag="TDEL_0C04700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680522.1"
                     /db_xref="GeneID:11500694"
     CDS             851474..852871
                     /gene="TDEL0C04700"
                     /locus_tag="TDEL_0C04700"
                     /inference="similar to DNA sequence:INSDC:YPR047W"
                     /note="similar to Saccharomyces cerevisiae MSF1 (YPR047W);
                     ancestral locus Anc_3.328"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680570.1"
                     /db_xref="GeneID:11500694"
                     /db_xref="GOA:G8ZS67"
                     /db_xref="InterPro:IPR002319"
                     /db_xref="InterPro:IPR004530"
                     /db_xref="InterPro:IPR005121"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:G8ZS67"
                     /translation="MALRSVGIKWRGCLRLYSSVSGSVEVNGTKYAANAVYTNITPSI
                     VELTHRSLHLSESHPVGILREAIEKKLNSTDAAFSVYNQFKPVVTVHENFDSLGFPQD
                     HPGRSKSDTYYVNEKHLLRTHTSAHEMECFGRIAKGDSSKTGFLISADVYRRDEIDRT
                     HYPVFHQMEGCRVWKRQNPSAEGEEPAHIVQLREDLAKLEKQLAEQATKIVVEDDCTL
                     EGNPKQEHMTDLEVDLCSRHLKRSIELIMAEVFERKLESLRKSNTDVSEIPNVLKVRW
                     IKAYFPWTAPSWEIEVWWQGDWLELCGCGLAQEDVLKLAGFEPESHISWAFGLGLDRI
                     AMLLFEIPDIRLFWTKDQRFHEQFQKGVINTFQPYSKYPGTLRDVAFWLPEESSLKVH
                     ENDVMEIVRNVAGDLVENVKLVDEFVHPKSGRKSLCYRINYQSMDRNLTNSEVNDLQD
                     QVSQELAKKYNVQLR"
     gene            <853105..>854985
                     /gene="TDEL0C04710"
                     /locus_tag="TDEL_0C04710"
                     /db_xref="GeneID:11500695"
     mRNA            <853105..>854985
                     /gene="TDEL0C04710"
                     /locus_tag="TDEL_0C04710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680523.1"
                     /db_xref="GeneID:11500695"
     CDS             853105..854985
                     /gene="TDEL0C04710"
                     /locus_tag="TDEL_0C04710"
                     /inference="similar to DNA sequence:INSDC:YPR048W"
                     /note="similar to Saccharomyces cerevisiae TAH18
                     (YPR048W); ancestral locus Anc_3.329"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680571.1"
                     /db_xref="GeneID:11500695"
                     /db_xref="GOA:G8ZS68"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR028879"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:G8ZS68"
                     /translation="MNRSKSSKRIAILYGSETGNAQDFAAILSYKLHRLHLPHTLNSL
                     GDYTPHDILDCRNLFIICSTTGQGELPRNAIEASHGLNKKNTLWSFLKKRNLPADFLN
                     HLSVSFLGLGDSSYPKFNYAIRKLHNRIVSQLGAKELFHRLEADEQSMAGSNKGSGAS
                     IEAVYFEYEKRILKYLRETYPTRKVNGQIVERTEFAAEAYLEPPSCLLLDSDEDGHIV
                     QENLTFNGDDSVNVGTVKINDRLTHPEHFQDVRQFVFNGKKAHEYGPGDTISIYPCNS
                     DDSVKQFLEIQPHWKSVADKPLKLSHGIPNNLKDGGFVKPLTLRNLLKYHCDIMSIPR
                     TSFFMKVWTFATDVGRMERGREQLEQQREKLHQFATDEDMQDLFDYCNRPRRSLLEVL
                     QDFPSLKLPWEFALDYLPIIKPRLFSISSGPNDPNIELTIAIVRYKTILRRIRKGICT
                     NFIINLSPGDKFRYKVQNNNLFLNKELKEKPMILISPGVGIAPMMSLIRSDVSKNLKL
                     FFGNRMMERDFLYKEILQDWDKEERITLYTCFSRDPKNSPKFKYVQDILWSIGEFIAK
                     LIHDQGATIYVCGSSNKMPIQVRITILEILKKWVNFEDEDAAIRYMKDMEKDDRYLQE
                     TW"
     gene            complement(<855282..>858650)
                     /gene="TDEL0C04720"
                     /locus_tag="TDEL_0C04720"
                     /db_xref="GeneID:11500696"
     mRNA            complement(<855282..>858650)
                     /gene="TDEL0C04720"
                     /locus_tag="TDEL_0C04720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680524.1"
                     /db_xref="GeneID:11500696"
     CDS             complement(855282..858650)
                     /gene="TDEL0C04720"
                     /locus_tag="TDEL_0C04720"
                     /inference="similar to DNA sequence:INSDC:YPR049C"
                     /note="similar to Saccharomyces cerevisiae ATG11
                     (YPR049C); ancestral locus Anc_3.330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680572.1"
                     /db_xref="GeneID:11500696"
                     /db_xref="InterPro:IPR019460"
                     /db_xref="UniProtKB/TrEMBL:G8ZS69"
                     /translation="MSDNAFLINAITGEKITTDVKFFMSLDEFRDFISQKWRIPSEQL
                     LILLPFGNKLKSSGFRECLRSNTLDENEFYIYDRRLFSIIKEPLRRAHDSEALQDESY
                     KKAEVLLSNLVRDTLQKRESALLKPINSPLADADLRIESLNARSITSLLTTNLGWLSA
                     LEIDVHYFRNLMSECAAQTSEILRCLSVCEQYLRLYCYDVEKLYNSNVEFLNQLAQNG
                     QSSKWKECYNQVLHKLQGIEGPLERYVDLKTTEQNENSIKLLDQSINSKLKKVKRDLD
                     KNADLRAQITEAIALLQNNSTLKNMKDNLEETMLTRFDEIVEETRRRSRDFLEQDSID
                     SFNDGMEDIHSFLLNTKNEVSGKLFTIAQALYAQSEQVIERKHKLQINAILLLGQIAF
                     VQVETIGIKRKLLNECNKDLDLYQKNEIQFAKIEDIPLIYGLFLVEKYRRESWILQVL
                     SQTRSLAGEYEQIRNKEQDHRTKWTENFGSTASLFCRNLENFTESEKIEELFLNDVLS
                     HERQADEKVISVRHSLNKTRELIDEYIAQLRELKVGDNVSELISQSFSEAKSYQVTIV
                     RVRDSKESSTSASNQINGYRARIKKLESLLHDARYSNPGHWPSGILNTTFITPFHNSV
                     TTVSSKMSSSSLLETDRNLNVANVIEVENKLKNLQQINEKLRRDGETKDMHLSVTKSK
                     ITDLELETMAFKETMTYLNKELARLTDEEEKSRFENINQQNSFKQEMEAIIRENSKLF
                     SEFSRLKHRTEVDDTLKREAMNQAKKLDEELGQERRTLQEKTVAFEEEISKLNERLTL
                     LEEENKELKEKKQVIQEVEDEQKELTPPTDLAKESEKEENLAELRNQNRDTEATIYEV
                     FASDVFILENIGLLLSLDENNRIIIKRVKGLRRGQSQGVLDDSIQISEADVLVKSTIY
                     RDVKKMYDEVHNTDDMDKHKSLFEEVRKLYDNKLYETAVIRRFKDIETLAKKLTKENK
                     KKRGQLESHQNERLTLKNFQVGDLALFLPTREHNSPTESSVSSLNSSFSSVDLSTPPP
                     FDTVTMHPSSAGKDRISKKSKSRPWAAFTAFDESTRYFLKDENNMIKGKDWFVGKILT
                     MEKFIAEDTNSNPYKLPNGVSWFQVTAAMISCQV"
     gene            <858851..>859381
                     /gene="TDEL0C04730"
                     /locus_tag="TDEL_0C04730"
                     /db_xref="GeneID:11500697"
     mRNA            <858851..>859381
                     /gene="TDEL0C04730"
                     /locus_tag="TDEL_0C04730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680525.1"
                     /db_xref="GeneID:11500697"
     CDS             858851..859381
                     /gene="TDEL0C04730"
                     /locus_tag="TDEL_0C04730"
                     /inference="similar to DNA sequence:INSDC:YPR051W"
                     /note="similar to Saccharomyces cerevisiae MAK3 (YPR051W);
                     ancestral locus Anc_3.331"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680573.1"
                     /db_xref="GeneID:11500697"
                     /db_xref="GOA:G8ZS70"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G8ZS70"
                     /translation="MIVYKPLDLRNLLHFEHLKRLIDADLSEPYSIYVYRYFLNRWPE
                     LTYLAFDDESGTPDTPIGCVICKSELHRGSRMRGYIGMLAVETAYRGLGIAKTLVKNV
                     IEKMQEDGCDEIMLETEVENRAALNLYEGMGFIRMKRMFRYYLNEGDAFKLILPLTQK
                     SCIRTTFLNQNDELLL"
     gene            complement(<859442..>860218)
                     /gene="TDEL0C04740"
                     /locus_tag="TDEL_0C04740"
                     /db_xref="GeneID:11500698"
     mRNA            complement(<859442..>860218)
                     /gene="TDEL0C04740"
                     /locus_tag="TDEL_0C04740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680526.1"
                     /db_xref="GeneID:11500698"
     CDS             complement(859442..860218)
                     /gene="TDEL0C04740"
                     /locus_tag="TDEL_0C04740"
                     /inference="similar to DNA sequence:INSDC:YBR088C"
                     /note="similar to Saccharomyces cerevisiae POL30
                     (YBR088C); ancestral locus Anc_3.332"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680574.1"
                     /db_xref="GeneID:11500698"
                     /db_xref="GOA:G8ZS71"
                     /db_xref="InterPro:IPR000730"
                     /db_xref="InterPro:IPR022648"
                     /db_xref="InterPro:IPR022649"
                     /db_xref="InterPro:IPR022659"
                     /db_xref="UniProtKB/TrEMBL:G8ZS71"
                     /translation="MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSR
                     VLLVSLEIGIEAFQNYRCDHPVTLGIDLTSLSKILRCGNNSDTLTLIADDTPDTVLLL
                     FEDTKKDRVAEYSLKLMDIDAAFLKIEDLAYDCTLMMPSSEFSKIVRDLSQLSDSLNI
                     MITKETIKFVADGDIGSGSVILKPFVNMDKPEDSIKLEMDQPVDLTFGSKYLLDIVKG
                     SALAEKVGIRLSSEAPALFQFDLKSGYLQFFLAPKFNDEE"
     gene            complement(<860487..>860768)
                     /gene="TDEL0C04750"
                     /locus_tag="TDEL_0C04750"
                     /db_xref="GeneID:11500699"
     mRNA            complement(<860487..>860768)
                     /gene="TDEL0C04750"
                     /locus_tag="TDEL_0C04750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680527.1"
                     /db_xref="GeneID:11500699"
     CDS             complement(860487..860768)
                     /gene="TDEL0C04750"
                     /locus_tag="TDEL_0C04750"
                     /inference="similar to DNA
                     sequence:INSDC:YBR089C-A,YPR052C"
                     /note="similar to Saccharomyces cerevisiae NHP6B
                     (YBR089C-A) and NHP6A (YPR052C); ancestral locus
                     Anc_3.333"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680575.1"
                     /db_xref="GeneID:11500699"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:G8ZS72"
                     /translation="MAAPRETKKRTTRRKKDPNAPKRALSAYMFFANENRDIVRSENP
                     DVTFGQVGRLLGERWKALTPDEKTPYESKAEADKKRYESEKELYNATRA"
     gene            complement(<861311..>861622)
                     /gene="TDEL0C04760"
                     /locus_tag="TDEL_0C04760"
                     /db_xref="GeneID:11500700"
     mRNA            complement(<861311..>861622)
                     /gene="TDEL0C04760"
                     /locus_tag="TDEL_0C04760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680528.1"
                     /db_xref="GeneID:11500700"
     CDS             complement(861311..861622)
                     /gene="TDEL0C04760"
                     /locus_tag="TDEL_0C04760"
                     /inference="similar to DNA sequence:INSDC:YBR091C"
                     /note="similar to Saccharomyces cerevisiae MRS5 (YBR091C);
                     ancestral locus Anc_3.334"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680576.1"
                     /db_xref="GeneID:11500700"
                     /db_xref="GOA:G8ZS73"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="InterPro:IPR027102"
                     /db_xref="InterPro:IPR027247"
                     /db_xref="UniProtKB/TrEMBL:G8ZS73"
                     /translation="MSMFMNPYGSQDVRQEKIDIAEVQFEAMNVTFNNILKTCMEKCI
                     PHDIYSESDLNKGEMCCVDRCVAKMHYSNRLIGALVQSRNFAPESHLPHYNKYKTPPD
                     N"
     gene            <861756..>863936
                     /gene="TDEL0C04770"
                     /locus_tag="TDEL_0C04770"
                     /db_xref="GeneID:11500701"
     mRNA            <861756..>863936
                     /gene="TDEL0C04770"
                     /locus_tag="TDEL_0C04770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680529.1"
                     /db_xref="GeneID:11500701"
     CDS             861756..863936
                     /gene="TDEL0C04770"
                     /locus_tag="TDEL_0C04770"
                     /inference="similar to DNA sequence:INSDC:YBR094W"
                     /note="similar to Saccharomyces cerevisiae PBY1 (YBR094W);
                     ancestral locus Anc_3.335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680577.1"
                     /db_xref="GeneID:11500701"
                     /db_xref="GOA:G8ZS74"
                     /db_xref="InterPro:IPR002828"
                     /db_xref="InterPro:IPR004344"
                     /db_xref="InterPro:IPR027746"
                     /db_xref="UniProtKB/TrEMBL:G8ZS74"
                     /translation="MRVLLTNDDGPLNDQFSNYIRPFVQTLKRLYPHWQLTICVPHVQ
                     KSWIGKAHLAGKKLSAQFLYSKMDSDDNSYLGPFIQPQVALEGSKLPRQAINPEVSRD
                     DIEWILIDGTPASCSNIGLHHLATEPFDLVISGPNLGRNTSVAYITSSGTVGAAMEAV
                     IAGNEVKAVAVSWAYFNGNKNVNNSIMEMAARRSLQIIEHLYENWDPVTDFYSINIPL
                     INSLSLETKAVYTSVWENRWGPIFSGPNVGSATNNSEIEDGNEYQMISFNWAPDFKSH
                     TDSKHHRSDQMVDRDVIEDGLISVTPLRATFQSTSTLKGELELPCPLETQFEGVCAIT
                     IDPQEYIYLPLKSAFQKWLPSLKIVSELPKNDTAVIHYGDYEDLDMERLGQDPQYIAN
                     SYIYRKALIRKHYLTQTIQYYKAKNPNTILSKAYLESFNIDLDYAEFLDDALDENWEL
                     RQELESEQKWWILKPSMSDKGQGIRVFKTIDDLQTIFDSFDEDDTDDESNVQDDNKII
                     ISQLRHFIIQEYLDKPLLLPSMGNRKFHIRCYICCQGSLKVFVYNRMLALFAPNRFIP
                     LEQGKYSPTSVDDLVCHLTNTCLQSNKAKKSLSVVEFDALDEISSADKTKIKEQIHQI
                     AHDVFLAAMQVNSLNFQPLANAFETFGVDFLVGENLEVKLLEINAYPDFKQTGDDLKD
                     LINDLFDCTIEKLIYPLATGKEVRNANEKNNLVEVLDYSANNWQ"
     gene            complement(<863982..>865061)
                     /gene="TDEL0C04780"
                     /locus_tag="TDEL_0C04780"
                     /db_xref="GeneID:11500702"
     mRNA            complement(<863982..>865061)
                     /gene="TDEL0C04780"
                     /locus_tag="TDEL_0C04780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680530.1"
                     /db_xref="GeneID:11500702"
     CDS             complement(863982..865061)
                     /gene="TDEL0C04780"
                     /locus_tag="TDEL_0C04780"
                     /inference="similar to DNA sequence:INSDC:YBR095C"
                     /note="similar to Saccharomyces cerevisiae RXT2 (YBR095C);
                     ancestral locus Anc_3.336"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680578.1"
                     /db_xref="GeneID:11500702"
                     /db_xref="InterPro:IPR013904"
                     /db_xref="UniProtKB/TrEMBL:G8ZS75"
                     /translation="MTSSKPEETDDEQEYIQSFYRHAIRAKSGNYPPLRRSLDGTVIY
                     PSASGVSSNRGNKLLQKSELVTRRALDNSKSLNEECVYYNGSEHNLLQRRKRMKFQTP
                     GEVNGHKISDDKITDESYDYDCNLSKLVDVRKILTPIASLADITRHGSIKRSFEGKVL
                     RELSLQSIMMIEKEQNSVMRYSKLLEVFLGDHPEPLYESELNLPAYDHNLKLPEEDSA
                     DIDDKEIAPRQDGDANGEDPFFALPHVGGHAALLRLLPADNSPQILEDVETIRQLAQI
                     ALQRNEEFVRNLRKIRASLVKANRIRERILNWSREYSGLPEDGVTIPNALRVVKRGLI
                     SATTNMSMGGAREMEEEFEENNEAT"
     gene            <865264..>865953
                     /gene="TDEL0C04790"
                     /locus_tag="TDEL_0C04790"
                     /db_xref="GeneID:11500703"
     mRNA            <865264..>865953
                     /gene="TDEL0C04790"
                     /locus_tag="TDEL_0C04790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680531.1"
                     /db_xref="GeneID:11500703"
     CDS             865264..865953
                     /gene="TDEL0C04790"
                     /locus_tag="TDEL_0C04790"
                     /inference="similar to DNA sequence:INSDC:YBR096W"
                     /note="similar to Saccharomyces cerevisiae YBR096W;
                     ancestral locus Anc_3.337"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680579.1"
                     /db_xref="GeneID:11500703"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:G8ZS76"
                     /translation="MVIGTVLKCVVALYLLSSYKSLPGVYFIRFYSTVFPNIVLPYLT
                     GFKTKNLKKLAGSKYGCFGAVTMSTYASPFECDFYFHKSNSTYFEELDISRSELMTKI
                     FQKLFFISKRWPYIPVANVFTNFLKEIKPFEKYEVISQILCWDEKWIYVMSRFTKKER
                     TVLCSLSLTKYVLKDGRKTISPKDALDICGLYNDEVASISAKNLELLTEQSGFHETKP
                     LEGLKHEYLAI"
     gene            <866157..>867467
                     /gene="TDEL0C04800"
                     /locus_tag="TDEL_0C04800"
                     /db_xref="GeneID:11500704"
     mRNA            <866157..>867467
                     /gene="TDEL0C04800"
                     /locus_tag="TDEL_0C04800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680532.1"
                     /db_xref="GeneID:11500704"
     CDS             866157..867467
                     /gene="TDEL0C04800"
                     /locus_tag="TDEL_0C04800"
                     /inference="similar to DNA sequence:INSDC:YPR054W"
                     /note="similar to Saccharomyces cerevisiae SMK1 (YPR054W);
                     ancestral locus Anc_3.338"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680580.1"
                     /db_xref="GeneID:11500704"
                     /db_xref="GOA:G8ZS77"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZS77"
                     /translation="MPNILNNNDDIVNRQQRVNKSDWKYYRYKPSSDRIKGLLNLQMD
                     KTHLSQRESESRTVYESAKFSLPARYEVIQTLGKGSYGTVCSVKDRLNPQNQYPIAVK
                     KITNIFYREILLKRAIRELKFMIFFKGHKNIVNLLDLEIVSDKPYDGLYCYQELIDYD
                     LAKVIHSSVQLSDFHIKHLFYQILCGLKYIHSAEVIHRDLKPGNILCTLNGCLKICDF
                     GLARGLAPQFFTSKDNYHDITNYVATRWYRAPELILSEKAYDKSIDMWSTGCILAEFY
                     ARKPLFMGKDSMHQVHEIVKVLGAPSKEILVDYGSLKAWNTYHNLSGSSPTVSWQELY
                     PFAAIEALDLIDNLLKWHPKKRFTVEQALEHPFLGAVRNLDDEPVCPWGPFDFSYEYQ
                     LHSMPRLREFLIHEVSMFREERLRRNITKSKAVGDIKIVGDLQL"
     gene            <867670..>871932
                     /gene="TDEL0C04810"
                     /locus_tag="TDEL_0C04810"
                     /db_xref="GeneID:11500705"
     mRNA            <867670..>871932
                     /gene="TDEL0C04810"
                     /locus_tag="TDEL_0C04810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680533.1"
                     /db_xref="GeneID:11500705"
     CDS             867670..871932
                     /gene="TDEL0C04810"
                     /locus_tag="TDEL_0C04810"
                     /inference="similar to DNA sequence:INSDC:YBR097W"
                     /note="similar to Saccharomyces cerevisiae VPS15
                     (YBR097W); ancestral locus Anc_3.339"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680581.1"
                     /db_xref="GeneID:11500705"
                     /db_xref="GOA:G8ZS78"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:G8ZS78"
                     /translation="MGAQLSLSAQTSPSIAIFSYVDVLDEVHYLSQLNSSGFLKTCRA
                     LDPNGKIIIKVFIKPSEEYDLKEIKRLIDAEASSLATLPTALNYSKVVESSRAGYLIR
                     QHLKSNLYDRLSYRPYLSEIEMKFMVFQLLQALKDVHDLNITHGDIKTENILVLSWDW
                     LVLTDFSSNIKPTYLPEDNPGEFSFYFDTSKRRTCYLATERFDTKLHEKTRGSSGKTT
                     KEMDIFSLGCCIAEIYAEGRPLFNLSQLFKYKNNDYDVVSYLMEEIGNESLKNMIMDM
                     INIIPKKRLSCRQLLEKYRGSFFPEYFYTFTYEYFRTLATMGTSVPITGSICANTILE
                     DQVNVIDECCRKLYDDFGKICQELKYRLNLRQSDSSNESDNNENYVKNSIKLSNLGEL
                     ELKSNDSNEQAVREECALLFISFLSHGLRSLTSSDTKLRCLELLVAFAQYVSDENKVD
                     RVVPYLVASFDDEFPNVQATAIQALAQVLFMTENINPINENLFVDYLLPRIKKTLLQS
                     KQNSYVRMVIANCLGNLVTVAIRFQEVAYLSSSLNPAEAVTKGMDSLEITSKHNRRLL
                     QQVEALAVTLLIDSDTCVKMALLNNILVLCKFFGRERTNDVVLSHLITYLNDKDPSLR
                     IKLVQTIAGIAVLLGPITLEQYILPLLTQTINDSEELVVVSVLQSLKNLCRTGLIQKK
                     FFYDICTSVNSLILHPNVWIRQFSMLLIVEISNNLSKAEVYCVLYPIVRPFFEFDVEF
                     THDLMLSSCKQPVSRTVYNLLCSWSLRASKSLFWQQVPSNHVDAFGNSNITLITKNYS
                     KKNYGFGGLSASKAVVLSPNNEEIPLTIEDKNWIDKFKSVGLAEGDLWKLAALRGYIL
                     RTAKLISRKNEIMMSEENDNAKSYGQSTISLPNVMPKNVFFDIDFSNEPDKNQIMNTD
                     SVRTSSKGKLQGHLNSLPSVKDMNGSLLFTTKAAATTTPNLENIYVHLDFSTQHKNTP
                     TKVSMDNNDGAKFTVNNSYEGDVSTIKTFLHQIKILPPMREYKEFGPTISDTQHTKIT
                     HSPRGTLVTALNENYPVAVTGMAVSSGPVPYMVTGSVQGQLKLWNIAEIASGEIYSSS
                     LNYDLSSTITSITMLDGYDAFCVSTKDGRISVLRSLYQFDDNQLVFTALQPVRKIRIK
                     QSSKRETFATCLKSVVTENTSILVALTNTSDVIIYDIRTMDLLQKIESPPSHGAVTSF
                     CVSEKGSVLIIGTTKGVIDVWDLRFHVLISTWTFGDHTPISHLEECEALGKNVIAVVG
                     GFSGATLSIWNYCKIRCQQALINSDEQPSIENFIPHKKLQDQQKFGEVSTSETIRSIY
                     IIGEKVFLSSEETNDLFMLNVKNLASSSVLIGPNSRSSSVVPIQVTANLTYLLLRRGP
                     SSLGSNDTEHCNDSVNCIASINVDNAALLITSDNSGTIGVFS"
     gene            <872071..>875100
                     /gene="TDEL0C04820"
                     /locus_tag="TDEL_0C04820"
                     /db_xref="GeneID:11500706"
     mRNA            <872071..>875100
                     /gene="TDEL0C04820"
                     /locus_tag="TDEL_0C04820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680534.1"
                     /db_xref="GeneID:11500706"
     CDS             872071..875100
                     /gene="TDEL0C04820"
                     /locus_tag="TDEL_0C04820"
                     /inference="similar to DNA sequence:INSDC:YPR055W"
                     /note="similar to Saccharomyces cerevisiae SEC8 (YPR055W);
                     ancestral locus Anc_3.340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680582.1"
                     /db_xref="GeneID:11500706"
                     /db_xref="GOA:G8ZS79"
                     /db_xref="InterPro:IPR007191"
                     /db_xref="UniProtKB/TrEMBL:G8ZS79"
                     /translation="MDRLKPLKGRSRGLSVNSISDAQQQAMNSSLDNLQGDLSRVETQ
                     WNRILTEYSNPLELALSFLDDTSVGLGHRYVDFKQLKTRIGFDLQEAVNEHFQVLNTN
                     VASYSIAVNAITSAQDNIHQLKERAIQSTSNITMPKGSLKELNDDAMKQNEMIGILSA
                     VEELIQLPEKVEELIRSADYKNAQILLARGFLSATSHDLWALESLQILKQQLELQEHV
                     LFNNLIEELHDIIYSKKGTFISMRGILKDISSSQEGFSSLENYLYNVSNVDLSKDILS
                     VNAKLSQFLKNVQKPAFTSTLVQSMSISENEFERLFFLLSIINDLNKLPTALSILANR
                     AKEELHNIILKSTEEVRVNHPSLLKIAGSVNVDDDFGIPVKDVLSVVMRECFWKIFAK
                     FLVAAQGHRVVFDTVKKLFPSASRSNMYKFESVWTKLLDEIEVLLSRYLENSDIIVAD
                     GTRHRSGSAVSMPKKKESPLFTLQHNIEDSSTAKQHANELMALLKDIFPGITITASTE
                     LETIYVEEESFEQEEPLVSASIFNMKILLEPYLLFCQATSDIIPSELQKNNISSMKFF
                     KTFMNDRYFPSLEMTFSYFFEKKVESNNPYALENLESNKYVFKAAADFRLLLSKLLYV
                     LNTTHRFREKIFNAVVELLHRFYMYYFNLFEGLFSTSASTVQQRIISVWLADQDIMET
                     ESQILKGAEGSAAKESELLMKHCSAFSSKERGLRREDILNTVTVDAVIHFLGTVCWIL
                     SWLPGLRKVINTSNQQPDDMNVEKLRTDWCIFELNDSAALEQLNNLKIMMNSEVAGKF
                     DEIVNGFSSLQIKLYSAIRFDTKARCIYHISKIFNTADAWSTDVASIELDEHISSLIT
                     ELKTIENKIRQQLSEDSTDKVFTGIDSIVDWTFINGMDSIPVMNGNGVKRMLKNIKVI
                     QNACQNFVSETSMIDMSQILKLYSLCGSTESDLFQQIQEGNLNHCSKDILKTVLRLQF
                     SEELQRQIRRTSGSSRRVNSMPLNKRYNDALKRLGAP"
     gene            <875334..>877403
                     /gene="TDEL0C04830"
                     /locus_tag="TDEL_0C04830"
                     /db_xref="GeneID:11500707"
     mRNA            <875334..>877403
                     /gene="TDEL0C04830"
                     /locus_tag="TDEL_0C04830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680535.1"
                     /db_xref="GeneID:11500707"
     CDS             875334..877403
                     /gene="TDEL0C04830"
                     /locus_tag="TDEL_0C04830"
                     /inference="similar to DNA sequence:INSDC:YBR098W"
                     /note="similar to Saccharomyces cerevisiae MMS4 (YBR098W);
                     ancestral locus Anc_3.341"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680583.1"
                     /db_xref="GeneID:11500707"
                     /db_xref="GOA:G8ZS80"
                     /db_xref="InterPro:IPR006166"
                     /db_xref="UniProtKB/TrEMBL:G8ZS80"
                     /translation="MKDVVVVLDDDTTNDSRSSYVKKIKDGPEIFTLISEEEAPNIQD
                     RKDYPSSPRQVEIVPDTSAQYTKGSDEVYAPFHQDVNFTGEQDTPQSIEAIEIFNHSL
                     ESRKRKPYDILDEESSPFSESKGRKYRKGSNLVFDTSEMLRSYVDQDSKGVKTTDVRH
                     EESSEIFEDNMEELCISSPTTNRIRSQTLRSQSLRLFVQDSDDSSINRVKPSKALSQG
                     LREPIETNLGFEDSSCLHDEESKNNTHLTSTRETKQLNQGTFTDLSRLPIFSMSKKED
                     QILRQTKVDVDEKPKVLELELKKFLSDGEDTHISVSPDTSLNSQPYSSVNVSTKNKER
                     IGDDLQASEVSRLAPYIVHGRCYDDNESRMLIETWLKKDKRAFKESNQIPRTNEKARN
                     SIQIELPERLIENLKKACKGELESNIAPAVFQPSGDDSLPRMRFFRSCLSEYDFNHDV
                     YYPCEPITVEEYVNLVFYDARHFFEQYRNDKEYLFKDLRAISKAGKYLIIVLSDLNKL
                     EKSLEALENKKFKDKVESQLTGSQTSRFTGTKRKSESLEELSMKKFDIEQRLRFIDRL
                     WGVKIHTVASYAEFADSLPNLISIIGKQRMDPAIRFMRYSHINGRSGKDKTDVLRQTL
                     HQINRMPELKANSVVSAYPTFQALFKDFRKGELKSGLDGKHLMTEAMEKRLYKLFTCR
                     NPNASIG"
     gene            complement(<877540..>878409)
                     /gene="TDEL0C04840"
                     /locus_tag="TDEL_0C04840"
                     /db_xref="GeneID:11500708"
     mRNA            complement(<877540..>878409)
                     /gene="TDEL0C04840"
                     /locus_tag="TDEL_0C04840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680536.1"
                     /db_xref="GeneID:11500708"
     CDS             complement(877540..878409)
                     /gene="TDEL0C04840"
                     /locus_tag="TDEL_0C04840"
                     /inference="similar to DNA sequence:INSDC:YBR101C"
                     /note="similar to Saccharomyces cerevisiae FES1 (YBR101C);
                     ancestral locus Anc_3.342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680584.1"
                     /db_xref="GeneID:11500708"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013918"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZS81"
                     /translation="MEKLLHWSIVNAQEDKEAIAKVGQPDPKLLQQLFGGGGPDDPTL
                     MREAMAVVRNQEAELENRLVAMDNFEMLIENLDNANNIENMKLWTPLLETLSDSEEDL
                     RAAALSVIGTAAQNNEPTQNAFSKQEEGLMKIIQLANDTKEPLNVRLKAFYALSNLIK
                     NHTVLATEFLKSHGLDIIAPVLSDPSSKPKLKTRAVSLLNAFLSSVEVTEGLISTLRE
                     DGVVEAAICCLRSDSEVSIVDRVLNFLSRLITAGIKFTEEEVSELSLGMKNIEGLKEK
                     LNEDDFSTVKYVL"
     gene            complement(<878694..>880835)
                     /gene="TDEL0C04850"
                     /locus_tag="TDEL_0C04850"
                     /db_xref="GeneID:11500709"
     mRNA            complement(<878694..>880835)
                     /gene="TDEL0C04850"
                     /locus_tag="TDEL_0C04850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680537.1"
                     /db_xref="GeneID:11500709"
     CDS             complement(878694..880835)
                     /gene="TDEL0C04850"
                     /locus_tag="TDEL_0C04850"
                     /inference="similar to DNA sequence:INSDC:YBR102C"
                     /note="similar to Saccharomyces cerevisiae EXO84
                     (YBR102C); ancestral locus Anc_3.343"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680585.1"
                     /db_xref="GeneID:11500709"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="UniProtKB/TrEMBL:G8ZS82"
                     /translation="MVDFSLKKGRKYGKQAQGTTQPKSKPKAGKASNPYSDMNVSAQY
                     SQLPKINAKDKNKVASSMQRRLSVHNANYVPPKLDYSMPLPSSTAIGMTSFNENEEGQ
                     PQNVASDLRNFGNVPDGNNVGEQTSESIPKGVPFAFMKPESLRALLADPKFNAKTFVH
                     DALGDASAIEIDKFTSNLSELAIEVQEEARDNINTSYNEILNVNRDLGIASLELKQLR
                     SSAKELTEMMQQFFMMAEKRLQTENHLEQSHNAASPGLLPPVRAGSIGGNERDRSSVA
                     ILERIWDNQLSTLFKNVEGARKYISASPGRHILLESGDWIELNLATLKPLQSVHIFIL
                     NDMVLVAARPREKQKELVVAQCAHLRDVNVTPEGASQKRLSFSFGHTTRCIYECRDPQ
                     EGPRLLNVIRRAKDDFHDIFQAEEENARKIKESFSYLQSTQQTPGREGTKSPVKNARR
                     SLGSVTPGRNGGDAMDSYLFQKITMSMHSRSRSRDVTSVPQKLKFLDDGVEEIDIELG
                     RLKFGKAVDALNALETQLKKLADQGEDDDMMLHGLITLKINQRRDAVAAKLSHTITTT
                     SEMAPLIVAVKNMIKLGLSEDGLDLFLQNRSNYIQDLILQIGSLDNTANYLTQIAVIR
                     FQSIKKTIINFREIFQEDKDRFSSILVNWCREEADQHFLLIEKQLPNDEPISPASIRS
                     SRKQIDGLKSVGLDFVYKLDDFIRKNNHKIR"
     gene            <881043..>882584
                     /gene="TDEL0C04860"
                     /locus_tag="TDEL_0C04860"
                     /db_xref="GeneID:11500710"
     mRNA            <881043..>882584
                     /gene="TDEL0C04860"
                     /locus_tag="TDEL_0C04860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680538.1"
                     /db_xref="GeneID:11500710"
     CDS             881043..882584
                     /gene="TDEL0C04860"
                     /locus_tag="TDEL_0C04860"
                     /inference="similar to DNA sequence:INSDC:YBR103W"
                     /note="similar to Saccharomyces cerevisiae SIF2 (YBR103W);
                     ancestral locus Anc_3.344"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680586.1"
                     /db_xref="GeneID:11500710"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR013720"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8ZS83"
                     /translation="MSITSEELNYLIWRYLQETGNEVSALALQEETRVLEFDSKYGKE
                     VPLGTLVELVQKGILYTECDLLVENDGKVKPIDNTYLTQNFNLAQALQVEKEKGPNRL
                     TDGRFALEHENDSAGGKEDSEEDVKSWRTYKGAEEANKPNGFIRTLREVHKLAKIVTC
                     SWNPVIRSVLALGEKDSQARLLHFDDDNATIKNEYELKHPFAPNVVSEKATNEVTCLS
                     WSLNGQDIVTGTENGELRLWNSEGKLKNVLNFHRSPIICIKWNSDSTHFITADVENVT
                     IVWNALTGTALQHFELKAQESATDSLGVDLEWVENDKFIIPGPQGSLAVYQMGENKPI
                     GRLNGHQGPISVLKFNPSNNLLLSASDDHAIRIWRGGSGNSCNCFLGHSQSIVSADWI
                     DDDKVVSASMDGTVRLWSVVDNSLLAMSMTDGVPVFSGKLSKDRTKYAVGLMDGQITV
                     YDVQAPPEKRGSTNLSASIDPLPLHGTFQSPKDGDSSFDLSWCYDNDKLAVAYSIGDG
                     AIISM"
     gene            <882754..>883731
                     /gene="TDEL0C04870"
                     /locus_tag="TDEL_0C04870"
                     /db_xref="GeneID:11500711"
     mRNA            <882754..>883731
                     /gene="TDEL0C04870"
                     /locus_tag="TDEL_0C04870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680539.1"
                     /db_xref="GeneID:11500711"
     CDS             882754..883731
                     /gene="TDEL0C04870"
                     /locus_tag="TDEL_0C04870"
                     /inference="similar to DNA sequence:INSDC:YPR056W"
                     /note="similar to Saccharomyces cerevisiae TFB4 (YPR056W);
                     ancestral locus Anc_3.345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680587.1"
                     /db_xref="GeneID:11500711"
                     /db_xref="GOA:G8ZS84"
                     /db_xref="InterPro:IPR004600"
                     /db_xref="UniProtKB/TrEMBL:G8ZS84"
                     /translation="MDAITDPTFHTTKPKSQYAEETPSLLTLVIDTAPKLWAELDDEK
                     SQNANIISVFESIIVFLNAHLAFNSSNQVAVIAAHSQGIKYLYPKSNVGNNKATSSST
                     SGKDLSIINNDMYRQFRNVDETLVEELYKLFQEEKNQIDKVTQKSTLAGGISAGLTYI
                     NRISRELATIALKSRLLVITCGSGGGRDEIFQYIPIMNCIFSATKLKCPIDVVKIGGH
                     RESTFLQQTTDATNGVYLHLESTQGLIQYLSTAMFIDPSLRPIIVKPNQGSVDFRTSC
                     YLTGKVVAIGYICSVCLCVLSILPPGNKCPACDSEFDEMVIAKLRKSGR"
     gene            complement(<883776..>884171)
                     /gene="TDEL0C04880"
                     /locus_tag="TDEL_0C04880"
                     /db_xref="GeneID:11500712"
     mRNA            complement(<883776..>884171)
                     /gene="TDEL0C04880"
                     /locus_tag="TDEL_0C04880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680540.1"
                     /db_xref="GeneID:11500712"
     CDS             complement(883776..884171)
                     /gene="TDEL0C04880"
                     /locus_tag="TDEL_0C04880"
                     /note="ancestral locus Anc_3.346"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680588.1"
                     /db_xref="GeneID:11500712"
                     /db_xref="GOA:G8ZS85"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8ZS85"
                     /translation="MSLKRRSESLEFNERYADKDNRDTDGIICQVAPCHDIYVPIELY
                     ASHMTQYHDHRCEECGRNLVTECLLQLHLEELHNPFTSKTNLLYGCFEQHCVEKFKCH
                     RDRIAHLKNVHGYPDGFDFDVVRNGKCYQ"
     gene            <884301..>885359
                     /gene="TDEL0C04890"
                     /locus_tag="TDEL_0C04890"
                     /db_xref="GeneID:11500713"
     mRNA            <884301..>885359
                     /gene="TDEL0C04890"
                     /locus_tag="TDEL_0C04890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680541.1"
                     /db_xref="GeneID:11500713"
     CDS             884301..885359
                     /gene="TDEL0C04890"
                     /locus_tag="TDEL_0C04890"
                     /inference="similar to DNA sequence:INSDC:YPR057W"
                     /note="similar to Saccharomyces cerevisiae BRR1 (YPR057W);
                     ancestral locus Anc_3.347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680589.1"
                     /db_xref="GeneID:11500713"
                     /db_xref="InterPro:IPR023251"
                     /db_xref="UniProtKB/TrEMBL:G8ZS86"
                     /translation="MESQNGQSVDSVFGQTPAFALNDEQVDPAVVEYLNSVRQEALRT
                     SAVKVSEVKRHAADIYDEDDIAVKRAKPSTKSLESIENLNSRMDDWLSWFENAKKTVL
                     YDSPLPQRHTEESMNLLLNYLKQYLSGRAEEKGFVSHLLRVLKDLPEAEEDDAFELDE
                     GWAESVVKRLRNKRIEGIEDITMIISNDDSTTPMGFKQWYQYMQQNEPSQAAFGQIIN
                     TKNIWVLIQYMTQEWIKIISKFKKPPQAIRFSNWLLYILFNVPENLTADYTSSLRSLG
                     KKCQAIIRSDLESNTEGNVKRQALLLKNSLPSSLKDLGVRTPPGDLDVLLLSLYVIAI
                     IYRQKDLINWNTTLQVSR"
     gene            <885588..>886505
                     /gene="TDEL0C04900"
                     /locus_tag="TDEL_0C04900"
                     /db_xref="GeneID:11500714"
     mRNA            <885588..>886505
                     /gene="TDEL0C04900"
                     /locus_tag="TDEL_0C04900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680542.1"
                     /db_xref="GeneID:11500714"
     CDS             885588..886505
                     /gene="TDEL0C04900"