GenomeNet

Database: RefSeq
Entry: NC_016504
LinkDB: NC_016504
Original site: NC_016504 
LOCUS       NC_016504            1218070 bp    DNA     linear   CON 03-APR-2018
DEFINITION  Torulaspora delbrueckii CBS 1146 chromosome 4, complete genome.
ACCESSION   NC_016504
VERSION     NC_016504.1
DBLINK      BioProject: PRJNA79345
            BioSample: SAMEA2272433
            Assembly: GCF_000243375.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Torulaspora delbrueckii (Candida colliculosa)
  ORGANISM  Torulaspora delbrueckii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Torulaspora.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 1218070)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1218070)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-DEC-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE616745.
            Accession numbers for all the chromosomes in this genome project:
            HE616742-HE616749.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1218070
                     /organism="Torulaspora delbrueckii"
                     /mol_type="genomic DNA"
                     /strain="type strain:CBS 1146"
                     /db_xref="taxon:4950"
                     /chromosome="4"
     gene            <2747..>5899
                     /gene="TDEL0D00100"
                     /locus_tag="TDEL_0D00100"
                     /db_xref="GeneID:11503620"
     mRNA            <2747..>5899
                     /gene="TDEL0D00100"
                     /locus_tag="TDEL_0D00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680757.1"
                     /db_xref="GeneID:11503620"
     CDS             2747..5899
                     /gene="TDEL0D00100"
                     /locus_tag="TDEL_0D00100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680805.1"
                     /db_xref="GeneID:11503620"
                     /db_xref="GOA:G8ZSK0"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZSK0"
                     /translation="MPSVEDIACGILRNRRVSVAEPMGDIVYNEPSSFFDLIPHQYHG
                     DIIPNFRQGKKGTAAVRALVELVSNEVAPLLMWMVYFGVGHPYRFPELRQMAFAGSQR
                     NVYVNDTTRRLQLYSNYNKNKSSNIVLKRMDGVTSEYLFYFMTVLKQMQFWALGPDYK
                     PINISVETRVLKESISSEKKSERALRTYLFVDTAKGDLVPYKLFRNLLDELPEGDRTR
                     LNFRELRQAMCGVLRYYCNMTLQDQKDLHESLVHELMANHSVLTVFETYAVNHFNMSS
                     LSGSGTTNLQQRASERYISWLNLDDGASVEMWPSDDFANENSTRKFKLSSEYRRYEDL
                     EAAGRKIFGPEFSFRDENQRTITNDIYMGELPSRVVHAPTGYGKTEMFHLPLIALASK
                     KNCKHVSFVFVPYTVILADSMRRLKSKNLLRVNDVKHFIDTGYDGITDVYVGVFDDLA
                     QTQFASRIAEWGYANSLRSTERKIKLGYAIIDEFHNFHLEKYRKPQFEPIKRLSFDGF
                     EKLLFFSATAPAQIADAALQSIGFIGQATSLRETVLAEKECMRGIRGCSTPMSDLVQK
                     IPLSHVYKEFKHVSKPYQVAFKLLKSLFMNEPQAKAVVLLNSKRMVEWLAKEWELDLK
                     IVWNHGELNASEKARRADSFIRNQKENVLLGTKLATDGIDVHKLKMVIMVDYKPTIIE
                     FLQAGGRLRTCGMLYVLLDPKTAFKREKSDMAPMDFACPTTQMSRFYGLPLRNTDLHH
                     LQCCGSTNFLPANTEQLVLRVAKAATNTAYETKKDKDDRLTNNKRKAPDLPFLSMEKR
                     RMNRLFHRNGHYTNIFDHMGHGETLAQCLQLNGISSHFWPSGTLIEKGSCPNCLKLSG
                     LCVCPQDPMTYRQIACEALAVQRMVLDDEQYKKHLEESKPYFLDPVGYLLIYDKAKQN
                     LYDTVRSQYVWFENLIRRRVIVAAECLHGMKNSSLFNYTAEQIENIYLDKRAFMKEQQ
                     TEALEYFWCWEKRKCAKVWEREGQRRALASLHQLKTMAHIIAYIVIKWTEKAIVRKMR
                     RQWALTWPEVHHVASGERSP"
     gap             7199..7331
                     /estimated_length=133
     gene            complement(<9506..>10063)
                     /gene="TDEL0D00110"
                     /locus_tag="TDEL_0D00110"
                     /db_xref="GeneID:11502030"
     mRNA            complement(<9506..>10063)
                     /gene="TDEL0D00110"
                     /locus_tag="TDEL_0D00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680758.1"
                     /db_xref="GeneID:11502030"
     CDS             complement(9506..10063)
                     /gene="TDEL0D00110"
                     /locus_tag="TDEL_0D00110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680806.1"
                     /db_xref="GeneID:11502030"
                     /db_xref="UniProtKB/TrEMBL:G8ZSK1"
                     /translation="MWTSKNTLINWFILISGSLINKVSAEQWNPGNFSIAPNNISVGA
                     NITSDFSLSHNDSGLLDISYLHLNPPEELVETYEQYNTAVSDGDFSSGMAAYFKLAAM
                     ITNHTELITDIVNDKKYYNLYVTDEVVKAAEEYATKHGGDTEAIELFEAYLGAKPNAT
                     NAFWCNIVSDGDNTTESFYLGSKPL"
     gene            complement(<11668..>12189)
                     /gene="TDEL0D00120"
                     /locus_tag="TDEL_0D00120"
                     /db_xref="GeneID:11502031"
     mRNA            complement(<11668..>12189)
                     /gene="TDEL0D00120"
                     /locus_tag="TDEL_0D00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680759.1"
                     /db_xref="GeneID:11502031"
     CDS             complement(11668..12189)
                     /gene="TDEL0D00120"
                     /locus_tag="TDEL_0D00120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680807.1"
                     /db_xref="GeneID:11502031"
                     /db_xref="UniProtKB/TrEMBL:G8ZSK2"
                     /translation="MIKPTSTRLVFVLILIVCLSISASRPVADAQPLEKRTNWYYHSI
                     SCAAQGLFAYFRVDQPIWFKVQWWGVMTAENGGFIDTADQAWSACNACQRDNKISQGD
                     CRGEVKSLLKMAIMNVVKVTVGWATTSGVNPIMFVDGQNRRKRDLHQRTTTRRCPCLL
                     TLLCLIVYYLLLK"
     gene            <14810..>15271
                     /gene="TDEL0D00130"
                     /locus_tag="TDEL_0D00130"
                     /db_xref="GeneID:11502032"
     mRNA            <14810..>15271
                     /gene="TDEL0D00130"
                     /locus_tag="TDEL_0D00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680760.1"
                     /db_xref="GeneID:11502032"
     CDS             14810..15271
                     /gene="TDEL0D00130"
                     /locus_tag="TDEL_0D00130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680808.1"
                     /db_xref="GeneID:11502032"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:G8ZSK3"
                     /translation="MTSKDTVDLNSLRSTYDSNLLPREIFSKWSYVLINYKVFSSLLA
                     LELLFFGSLYCFEIRSKDIAILTFIIGIILVAFTGFITYLCSRDTGLTDENKLVFLKE
                     VTVARPGIDNERWNVVARRLNPIFYQNSRSATAYFFYDGEGMCVVLQTKLP"
     gene            <16898..>17509
                     /gene="TDEL0D00140"
                     /locus_tag="TDEL_0D00140"
                     /db_xref="GeneID:11502033"
     mRNA            <16898..>17509
                     /gene="TDEL0D00140"
                     /locus_tag="TDEL_0D00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680761.1"
                     /db_xref="GeneID:11502033"
     CDS             16898..17509
                     /gene="TDEL0D00140"
                     /locus_tag="TDEL_0D00140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680809.1"
                     /db_xref="GeneID:11502033"
                     /db_xref="InterPro:IPR001959"
                     /db_xref="InterPro:IPR010095"
                     /db_xref="UniProtKB/TrEMBL:G8ZSK4"
                     /translation="MVGEEITRDEGREKFIFIDPGIRTFLTGYNSGQNVVEIGKNAFV
                     RIEKLKHRRHKLQSKLDKLRTHKKRQNHRKALHRLDEKISRIVSDMHKKSALFLCKSY
                     ENIFMPKLNFHQCTRLNQKSRSSMTTIAHCSFNDRLVMKAEQLRVTSAIVVEEDYTSK
                     TCSKCGNIKQDLGPNKIYSCVKCSSVFDKDFNAATCSSIAVSI"
     gene            complement(<18358..>19098)
                     /gene="TDEL0D00150"
                     /locus_tag="TDEL_0D00150"
                     /db_xref="GeneID:11502034"
     mRNA            complement(<18358..>19098)
                     /gene="TDEL0D00150"
                     /locus_tag="TDEL_0D00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680762.1"
                     /db_xref="GeneID:11502034"
     CDS             complement(18358..19098)
                     /gene="TDEL0D00150"
                     /locus_tag="TDEL_0D00150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680810.1"
                     /db_xref="GeneID:11502034"
                     /db_xref="GOA:G8ZSK5"
                     /db_xref="InterPro:IPR024079"
                     /db_xref="InterPro:IPR029482"
                     /db_xref="UniProtKB/TrEMBL:G8ZSK5"
                     /translation="MKLTSLSLLALTAFGETLAAPVVSTNSSAELETVLVEQFSIWPE
                     PTFPEIYHTCNVTNTRMLNSAFKDSVEASAVAKRRLLDFGVDDVYYKRWFGNGSIFTV
                     MGVLDHLIESSKEGVLFRCDDVDGLCAENPDYFAGHHRESAPSETVICDYFYQSKKPL
                     STVCFDGTIVEVGPKHYAGIDLLHRYLHVPSMSLDYVGEFAEGLNETLEYVENNATYA
                     VRNTDNYLYYIADVYTSSVIPGGCLGDI"
     gene            complement(<23590..>25326)
                     /gene="TDEL0D00160"
                     /locus_tag="TDEL_0D00160"
                     /db_xref="GeneID:11502035"
     mRNA            complement(<23590..>25326)
                     /gene="TDEL0D00160"
                     /locus_tag="TDEL_0D00160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680763.1"
                     /db_xref="GeneID:11502035"
     CDS             complement(23590..25326)
                     /gene="TDEL0D00160"
                     /locus_tag="TDEL_0D00160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680811.1"
                     /db_xref="GeneID:11502035"
                     /db_xref="GOA:G8ZSK6"
                     /db_xref="InterPro:IPR001204"
                     /db_xref="UniProtKB/TrEMBL:G8ZSK6"
                     /translation="MALHQFDYIFAITMIFGFLDAFNIGANDVANSFASSISSRSLKY
                     WQAMVLAGICEFLGTVLAGARVSGTIKNNILDAKFYTDEPAVLMLTMSCALVGSATWL
                     TIATSIGMPVSTTHSIVGGTIGAGIAASGASGVVWGWAGVAQIIASWFIAPVLAGAIA
                     AVIFLISKYCVLEIKSIQRSIKNALLLVGLLVFATFSILTMLIVWKGSPNLELDKLSE
                     TETALGIVLTGAVACVIYFVFFYPFYRRKILNEDWTLTLLDIFRGPTYYFKPTDNIPA
                     MPEGHQLTIDYYEGRRFVEEVGAEDEENIKAGDISTISTQGKDRKEETIQKIDIVKTE
                     SVPEEEMSTRQYWWRLFKEGPKQWPLLLWLVVSHGWTQDVISAQVNDKDMLTGDIKGM
                     FKRSKFYDNRVEYIYSILQAITAATMSFAHGANDVANAVGPLSAVYDIWRKNEVASKS
                     EVPVWVLAYGGGALVIGCWTYGYNVIKNLGNKMILQSPSRGFSIELAAAITTVMATQL
                     AIPTSTTQIAVGGIVAVGLCNKDVKSVNWRMVAWCYCGWFLTLPIAGLIAGILNGIIL
                     NAPRFGGEYQMS"
     gene            complement(<25816..>26826)
                     /gene="TDEL0D00170"
                     /locus_tag="TDEL_0D00170"
                     /db_xref="GeneID:11502060"
     mRNA            complement(<25816..>26826)
                     /gene="TDEL0D00170"
                     /locus_tag="TDEL_0D00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680764.1"
                     /db_xref="GeneID:11502060"
     CDS             complement(25816..26826)
                     /gene="TDEL0D00170"
                     /locus_tag="TDEL_0D00170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680812.1"
                     /db_xref="GeneID:11502060"
                     /db_xref="GOA:G8ZSK7"
                     /db_xref="InterPro:IPR003710"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZSK7"
                     /translation="MTADKCKVLLIGSGGVGTIASYSLEYEDKAVVTSVLRSDYAIVK
                     EKGFTIDSIDYGHIECYRPTNIVNSVESAKEYGPFDYIVVVTKSLPDITNMVDVIAPA
                     VTSETAIVLIQNGIHIEEAYMERFPKNTVLSGVSMIGSSNKNGCINHETTDFLRVGVF
                     PNENVPKDKQDSICQKFVQIYNTGKNECVFDENVEFSRWRKLVYNATLNPVCALTQLD
                     VGRLEIFGAVDSIIRRAMKEVIAIAASDGVQLPESVIEFMIRSDDPVYYKPSMLIDYE
                     KGNYMEVEVILGNPIKIAQKNSVDAPILTLIYHFLSVLQCKIKEEKGALIVPKERPVA
                     AK"
     gene            complement(<27170..>28906)
                     /gene="TDEL0D00180"
                     /locus_tag="TDEL_0D00180"
                     /db_xref="GeneID:11502061"
     mRNA            complement(<27170..>28906)
                     /gene="TDEL0D00180"
                     /locus_tag="TDEL_0D00180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680765.1"
                     /db_xref="GeneID:11502061"
     CDS             complement(27170..28906)
                     /gene="TDEL0D00180"
                     /locus_tag="TDEL_0D00180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680813.1"
                     /db_xref="GeneID:11502061"
                     /db_xref="GOA:G8ZSK8"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:G8ZSK8"
                     /translation="MMVKKINDGCRGCVKENISCDRKRPNCRNCTRRKVSCKYPIQLK
                     WGGRPYKDKSKCVNLPADTMLVEGVLVAKERLIHREDKKKKVKDLLLVKEPLNFKYKE
                     AREDEPQNASQAVVQKSTVDSYLTVERFLGSPMRIRTLTFMPSTLNKPFRDARSELFQ
                     FFVDKTSSFFVVAHSDQNSNPFGTIIPQMARQCPTLMNLLIAFAGKHRNKLYSATNNM
                     IYLSLYELCTQDTNYDDLSRKLLEKSTGELMHKMMSPQERSSDSTLAGLLILMAVEIF
                     FGDHRSKWRRHLQAARRIVLEKLKNDSEAAGYRLIYRVENKPHCFLSRWFIYLNVVSI
                     LSSADFELQLETLPLLEVEFLFLTEQQLIKARRALEDIEATSGMDLMVLAFLARVAHL
                     LHKANNEDIDTAEIMRGAIELDFEIVTYLEESETARDALLQELREDPSQSITEERFRT
                     YEKLRHTNLIFGLTGSLVLRGRLLFMPHDSKMICNLLSRTTKLLTELTNSGAPAESCL
                     FFCIFCCGCELISPTMAAARPIYLEQLTLLQQRGMSSALQAKIIMEECWSTERHWWKL
                     LRENNLDFCFAI"
     gene            <29971..>31629
                     /gene="TDEL0D00190"
                     /locus_tag="TDEL_0D00190"
                     /db_xref="GeneID:11502062"
     mRNA            <29971..>31629
                     /gene="TDEL0D00190"
                     /locus_tag="TDEL_0D00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680766.1"
                     /db_xref="GeneID:11502062"
     CDS             29971..31629
                     /gene="TDEL0D00190"
                     /locus_tag="TDEL_0D00190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680814.1"
                     /db_xref="GeneID:11502062"
                     /db_xref="GOA:G8ZSK9"
                     /db_xref="InterPro:IPR000262"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR008259"
                     /db_xref="InterPro:IPR012133"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:G8ZSK9"
                     /translation="MRRVFKGIVNVNGIRPSLRVVRSTHNFAKTSITSGYQAGPKSRR
                     YDIKKASVATGATAFTALLSYFLFDQSEGDISASELRKHNTVHDCWIALNGEVYDVTA
                     FLQMHPGGVARLMEVAGGDATEKFYQIHSDSVFEKMKNNFIYIGKLKGSIDKTYTDEE
                     LRIIEMKQKIPPLSTLFSLSDFENVAKHVLPKSTFMYYATGSSDEFSIRENHYAYGRV
                     FFKPKMMQDRTGDLDLSTEFLGTKVDLPFYITAFAGSKLAHPLGEMNLQAASYAANVM
                     HMVPKMNSYSIDEFFEVVPDDQNHWYQYHFDTQEEIDNIEQLVKKVEKMPSVKGFFFN
                     VDLDDIGNREKDSRQRAAETVEPDVLNKLVPADFGEHPYMSWKIIDRILATTDLPVGL
                     KGVQRGEDVVIAAEKGIKAVVLSNHGGRQLDFSRPPLEVLAEARAMLKEKNLEDSIEI
                     YIDGGVRRGSDIIKALCLGAKGVGLGRPFLYAMAGYGEEGVSKLVSILQLEIQNNMRL
                     LGVRKIDDLNESFIDCKNLTLRNPKAGDSLYDEAYQPLIFQEFK"
     gene            <32432..>34135
                     /gene="TDEL0D00200"
                     /locus_tag="TDEL_0D00200"
                     /db_xref="GeneID:11502063"
     mRNA            <32432..>34135
                     /gene="TDEL0D00200"
                     /locus_tag="TDEL_0D00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680767.1"
                     /db_xref="GeneID:11502063"
     CDS             32432..34135
                     /gene="TDEL0D00200"
                     /locus_tag="TDEL_0D00200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680815.1"
                     /db_xref="GeneID:11502063"
                     /db_xref="GOA:G8ZSL0"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:G8ZSL0"
                     /translation="MSPELPTTGDIPLSPYFPNQMKENMKASVNEVIDEEQGSISELE
                     VKPQNEMVRGLKSRHIQLIALGDAIGTGLFIGSGGALSTCGPAPILISYIVMSFFVWT
                     IVNQLTEMVALIPLPGEASMYSLARMYVGRPLAFMCGWNLFYAMAMIAPSEITACAML
                     IQYWTDANSAIFISIFIVFSVAITMLPVRVFGESEFCVSSIKLLTIVGLIIVGIVIFF
                     GGGPSQDHILGFHYWKKPGAFKEHLVPGSTGKFLAVWTAIIKSGFSFVLVPETVASCS
                     AESASPRRNMPRACQRFVYRLALFYVAGVLVVTVVVGSDDANLLNAIHSGASNAAASP
                     YVIGIKEAGIKVLPHIINACILTSAYSCGTAELYGCSRILHSMAMKGDAPQIFAKVNR
                     FGVPYYSTAVACLFTLLAYLNCSKSSSLVFNWLSNIATISGFISWVFVSVTYTRFRTV
                     IDKLDLNDRIPFRRRFQKGFAYACIAFFVLLSLTNGYAVFIKGNWNTSDFFASYVTIG
                     FVAVLFIGSTIYYKELRFRDVSEIGREIIPKIDIADEDERNDVPVVPKNWGEKIWYTI
                     V"
     gene            <34669..>35061
                     /gene="TDEL0D00210"
                     /locus_tag="TDEL_0D00210"
                     /db_xref="GeneID:11502064"
     mRNA            <34669..>35061
                     /gene="TDEL0D00210"
                     /locus_tag="TDEL_0D00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680768.1"
                     /db_xref="GeneID:11502064"
     CDS             34669..35061
                     /gene="TDEL0D00210"
                     /locus_tag="TDEL_0D00210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680816.1"
                     /db_xref="GeneID:11502064"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR013813"
                     /db_xref="UniProtKB/TrEMBL:G8ZSL1"
                     /translation="MATQIQWEDVNGPSHSLLSPGYVTAKNSQLLFTSGCVGTDKSGK
                     LAEGVEAQTKLALENLKVVLEAGGSSLSNVLKVLLFVGDGSYASAVNSVYQEYFPGRP
                     GRSCVVVAFPDPAIKVELECVAVVPEKD"
     gene            <35539..>36954
                     /gene="TDEL0D00220"
                     /locus_tag="TDEL_0D00220"
                     /db_xref="GeneID:11502065"
     mRNA            <35539..>36954
                     /gene="TDEL0D00220"
                     /locus_tag="TDEL_0D00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680769.1"
                     /db_xref="GeneID:11502065"
     CDS             35539..36954
                     /gene="TDEL0D00220"
                     /locus_tag="TDEL_0D00220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680817.1"
                     /db_xref="GeneID:11502065"
                     /db_xref="GOA:G8ZSL2"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8ZSL2"
                     /translation="MTAATEPQTSYVFQGTVDKPGLQVVGGKSVYIDVEKDGVVHKNV
                     IDAMTGAAVGALGSADEDVFKIINEAARESTYSFCPLISNKSSEALSKFYIENSPEGA
                     FSSALWLTSGSESNENALRIVRQYYLERGLPEKVKLISRESSYHGFTLGAQSISWNPR
                     IEPFTPYLMDRKSVCLKMPPAYTYRFKEKAETEEQYTERLLGALEQQIIENGAGTIAA
                     IIVETLPGSTLGTTPPPKGYLKGIRALCNEYDIIFYLDEVMCGTGRCNPNGKLNCWEN
                     YLDASEAPDIQTIGKTIGSGYVTLAGVLIGPKIRNAFVNGSNSVFGGNTYSGHAFNCA
                     VALGIQKKILKENLTANIFKMGNLLGAKLKERLLSADNIAGDVRGVGGFWSIEFVKDR
                     ATKQIFDADLNVGPRFKQLCLENGVNVMGMPAFADGSCGDHALVAPAFIVTEDHIEEI
                     YEKIVKSVDDLTSILKQEGAF"
     gene            <37458..>38396
                     /gene="TDEL0D00230"
                     /locus_tag="TDEL_0D00230"
                     /db_xref="GeneID:11502066"
     mRNA            <37458..>38396
                     /gene="TDEL0D00230"
                     /locus_tag="TDEL_0D00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680770.1"
                     /db_xref="GeneID:11502066"
     CDS             37458..38396
                     /gene="TDEL0D00230"
                     /locus_tag="TDEL_0D00230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680818.1"
                     /db_xref="GeneID:11502066"
                     /db_xref="GOA:G8ZSL3"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:G8ZSL3"
                     /translation="MTVTSTKTPSFKLNTGALLPAIGLGTWKSSEEDAYTAVLSALKA
                     GYKHIDTAAIYRNERAVGKAIRDSGIPRDELFITTKLWSTQHRDPKAALDGSLERLGL
                     DYVDLYLIHYPVAFKTDRIEDGNPFCFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESG
                     KCKAVGVSNFSINNLKTLLESDEKFAVPAVNQVEIHPQLPQTELIDFCKSKDIVVEAY
                     SPLGSTGSQMLTDDTLQKIAEKXXDAQPAQILINWGISRGYCVLPKSVTPKRIEANAR
                     IIDIKKEDLLKVTNLIDILGPKRYLEPDWSPFPIFE"
     gene            complement(<38642..>40132)
                     /gene="TDEL0D00240"
                     /locus_tag="TDEL_0D00240"
                     /db_xref="GeneID:11502067"
     mRNA            complement(<38642..>40132)
                     /gene="TDEL0D00240"
                     /locus_tag="TDEL_0D00240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680771.1"
                     /db_xref="GeneID:11502067"
     CDS             complement(38642..40132)
                     /gene="TDEL0D00240"
                     /locus_tag="TDEL_0D00240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680819.1"
                     /db_xref="GeneID:11502067"
                     /db_xref="GOA:G8ZSL4"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZSL4"
                     /translation="MAEKQVGVVKETTRNDDEFLNGSAVSFTHESEIETGDELYIDPK
                     EEAALVRKLDFRLLPMLAFMYFLSSLDRSNIGNAYTSGMKEDLKLTSRQYSNAVSVFY
                     STYLAAELPAVLVLKRVNVRYYMSFLVFSWSIITLCNGFVQNHKSLIALRVLLGCFEG
                     GFFPAMTLIISMVYKQQEQAKRIAFFFGSASLSGAFGGLIAGGLSSVKTTGGLEGWRY
                     LYIIEGLVSVVASVWLFFGLPGHFEVIPFLNERERHLMNIRAKQRAKYMGLSDKFEWS
                     YVWDALKDFKTYTSFTIQFCQDVVMYGYSTFLTAILKLGLGYSGRKAQFMSIPVYLLA
                     AVVFLFSGFLSDRLRLRAPIFMGYNVIGAIGYILLLSVESASVKYFACYLITFSLYTG
                     TGLNISWLTNNVAPHYKRATALGLNQTLGNVSGAVAGQIYFKSPYKFGNSFSLGCIVL
                     SNILAFGQILVLRRINNKKERILRGELADDAKDRRGDRALDFKYCY"
     gene            <40555..>44409
                     /gene="TDEL0D00250"
                     /locus_tag="TDEL_0D00250"
                     /db_xref="GeneID:11502068"
     mRNA            <40555..>44409
                     /gene="TDEL0D00250"
                     /locus_tag="TDEL_0D00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680772.1"
                     /db_xref="GeneID:11502068"
     CDS             40555..44409
                     /gene="TDEL0D00250"
                     /locus_tag="TDEL_0D00250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680820.1"
                     /db_xref="GeneID:11502068"
                     /db_xref="GOA:G8ZSL5"
                     /db_xref="InterPro:IPR002821"
                     /db_xref="InterPro:IPR003692"
                     /db_xref="InterPro:IPR008040"
                     /db_xref="UniProtKB/TrEMBL:G8ZSL5"
                     /translation="MTVDTINKIRIAIDRGGTFTDCIGNPGTGKLEDDVVIKLLSVDP
                     KNYPDAPLEGIRRLLEVIRCEKIPRGTPLDISDVSSIRMGTTLATNCALERNGERCAF
                     ITTKGFKDILMIGDQSRPDIFDLNIKKTEPLYDMVVEIDERVTLEDFSEDPLCHKSEA
                     RENDNTVVGNSGEVVRVLKVPSIEEIRSSLQLIYQSGIRSIAVAFLHSYTYPLHEQLV
                     GRIAKAIGFTHVSLSSEVSPMIKHLPRAHSAVADAYLTPVIKKYLDGIESGLTNSSKT
                     SLQFMQSDGGLVEGHKFSGLKSILSGPAGGIVGYSSTCYDSENKIPLIGFDMGGTSTD
                     VSRYGDGQLEHVFETTTAGIVIQSPQLNISTVASGGSSRLFWENGLFRVGPESATADP
                     GPAAYRKGGPLTITDANLFLGRLVPEFFPKIFGPNEDESLDLKTTTKKLTELTETINK
                     DLGTSMTPDEVAYGFVKVANEAMARPIRAITEAKGHVVSDHRLVTFGGAGGQHAVAVA
                     ESLGISVVLAHRYSSILSAYGIFLADVVEESQEPCFFMLDGSKRMTKLQNRLDHLIEK
                     SKESLSIQGFPESQMVFEKYLNLRYEGTETSLMIMQHEGEYDFAKWFSEAHHREFGFS
                     FPEKAIIVDDIRIRAIGKSHVRDEESVDVQLKKYERVQVSAADDASLFKEVYFNDRRV
                     NTPVFRIDNMRYGSVINGPAILADGTQTNIIPENAEATVLKSHIFINLLSRGEKLTHG
                     VSDRIDPVMLSIFSHRFMDIAEQMGTQLTKTSVSTNVKERLDFSCALFDPSGNLVANA
                     PHLPVHLGSMSTCIAAQAKLWEDKLKPGDVIVTNHPEIGGTHLPDITIISPAFSEVDG
                     KLIFFVASRAHHADIGGISPGSMPPNSKELYEEGAAIYSELIVKEGKFQEELIRYLLL
                     EKPATYPNCSGSRRISDNISDLKAQIAANNKGINLIAKLMNANGRDTVVKYMEAIQLN
                     VSETIKKMLKQMTFHFNATKFSSEDLMDDGTVIKLNVSLDVEKEEYIFDFEGTSPQVY
                     GNLNAPEAITNSAILYCLRCLVNEDIPLNQGCLKPITVKIPKGSILSPIDGIAVVGGN
                     VMTSQRVTDVVLKAFNVMADSQGDCNNFTFGTGGTDPKTGAVAQGFGYYETICGGHGA
                     GADSWRGPGWNGTNAVHTNMTNTRMTDTEVFERRYPVILRQFAVRTGSGGKGKYKGGD
                     GAVREIEFRQPVQASILSERRVIAPHGINGGENGSRGLNIWIRGASQNVINLGGKNSV
                     HVKAGDRIIIETPGGGGCGRSE"
     gene            complement(<44685..>46628)
                     /gene="TDEL0D00260"
                     /locus_tag="TDEL_0D00260"
                     /db_xref="GeneID:11502069"
     mRNA            complement(<44685..>46628)
                     /gene="TDEL0D00260"
                     /locus_tag="TDEL_0D00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680773.1"
                     /db_xref="GeneID:11502069"
     CDS             complement(44685..46628)
                     /gene="TDEL0D00260"
                     /locus_tag="TDEL_0D00260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680821.1"
                     /db_xref="GeneID:11502069"
                     /db_xref="GOA:G8ZSL6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G8ZSL6"
                     /translation="MKEKRVSKACDVCKHRKKRCTGELPCDYCTRIGRTQECVYHSKV
                     PSKTVKVTERYILGLKTRIEELEQKLNHSGSPQGPGESVEGIPITSSEEYSTEVFDEV
                     PVGSSETSLNLGDSACAKYLIKIRQSLVRSCHIEDDTSVPNFKTITVETSPSAEKIEA
                     IAAESRPSIENAERWIDAASNAIGADYMFIESDYKSTVLAPLIYDGLGNNLSFIDYAS
                     ELTRFFSYLALGRMFIEHSSKQKSRSKFPGLIYFETVLKLQGELLGVSDRTANGSLVQ
                     SFLYAAYYALSLDKSSLASILVGCAIRMMFGLGFHKHPTTAKENRIFWLCYIYDRLVA
                     VRFGFPLNLDDLDVDVLSLPLVDEKGYYSVSLETCHFVSQVKLARITTRILRSIYTKN
                     SISFIQNCNAVLKELKTWFDDLPQNLILDLDDFNIENSRSTVNLHINYNYLIIITTRP
                     ALFYVFNKMLDGGNDEKKPRGIIQVLVDSCVQAAHLQSVVLAKLYHKGSMAKASFLDC
                     HYIFNATIILILAAFCQSMPYSSINLNCDLSAVLDRVQFNLNLLQKLSKYNISASNFN
                     RQLTEIIDLLSSKEVQSKFDGVFSTFEGHREPNETVRESIEFESLGRIDLGRVLDDIS
                     DSNSSGLALFDDEDFMRFSNSLF"
     gene            complement(<46997..>48043)
                     /gene="TDEL0D00270"
                     /locus_tag="TDEL_0D00270"
                     /db_xref="GeneID:11502070"
     mRNA            complement(<46997..>48043)
                     /gene="TDEL0D00270"
                     /locus_tag="TDEL_0D00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680774.1"
                     /db_xref="GeneID:11502070"
     CDS             complement(46997..48043)
                     /gene="TDEL0D00270"
                     /locus_tag="TDEL_0D00270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680822.1"
                     /db_xref="GeneID:11502070"
                     /db_xref="GOA:G8ZSL7"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZSL7"
                     /translation="MVVSEGCTVFVSGANGFIASHVVNELLSSGYKVIGSVRSQAKAD
                     QLLEHFSHPELTISIVSDISAAAAFDEIFSKYGQDIKVVLHTASPFHYDTEDCEKDLL
                     QPAVEGTKSILQAIKKYAAHSVERVVITSSDAAVTSYESDIDPKNLHTEDSWNSITWE
                     EACKDAEAAYYGSKTFAERAAWEFMHENEGKINFKLSTVNPVWVFGPQLSDSNATGRL
                     NTSCQYINDLVHSTPKTKLDMSIAGGYVDVRDVARAHLAAFQKAAAIGQRLVLCAGRF
                     TLVNIVDVLDKRFPKLKGKIASGDAEESKKLLSSLARYDYSKTNHILEFEFLPFEKTI
                     YDTAAQVLKVEGRL"
     gene            complement(<48348..>49550)
                     /gene="TDEL0D00280"
                     /locus_tag="TDEL_0D00280"
                     /db_xref="GeneID:11502071"
     mRNA            complement(<48348..>49550)
                     /gene="TDEL0D00280"
                     /locus_tag="TDEL_0D00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680775.1"
                     /db_xref="GeneID:11502071"
     CDS             complement(48348..49550)
                     /gene="TDEL0D00280"
                     /locus_tag="TDEL_0D00280"
                     /inference="similar to DNA sequence:INSDC:YJR148W,YHR208W"
                     /note="similar to Saccharomyces cerevisiae BAT2 (YJR148W)
                     and BAT1 (YHR208W); ancestral locus Anc_4.389"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680823.1"
                     /db_xref="GeneID:11502071"
                     /db_xref="GOA:G8ZSL8"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="InterPro:IPR005786"
                     /db_xref="InterPro:IPR018300"
                     /db_xref="UniProtKB/TrEMBL:G8ZSL8"
                     /translation="MMLHRQAISSRMTRMLPSFVRSMATTETPLDASKVKIIKTNTPS
                     KAQPNDQLVFGKTMTDHMLTIEWNRGKGWATPEIKPYAPLSLDPSCCVFHYGFELFEG
                     LKAYRTSDDKISMFRPDMNMKRMNKSAARICLPTFESEELIHLIGKLIQEDKHLVPEG
                     TGYSLYVRPTLIGTTNTLGVSVPDKALLFVICSPVGPYYKTGFKAVRLEATDYATRAW
                     PGGVGDKKLGANYAPCILPQLQAAERGYQQNLWLFGPEKYITEVGTMNVFFAFQNKET
                     GKKELVTAPLDGTILEGVTRDSVLALARENLDPNEWEVNERYFSINEVADRAAKGELL
                     EAFGSGTAAVVSPIKEIGWKGKDISVPLLPGEQSGPLTKQLASWIADIQYGRNKHDNW
                     SQIVAELK"
     gene            <50028..>50672
                     /gene="TDEL0D00290"
                     /locus_tag="TDEL_0D00290"
                     /db_xref="GeneID:11502072"
     mRNA            <50028..>50672
                     /gene="TDEL0D00290"
                     /locus_tag="TDEL_0D00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680776.1"
                     /db_xref="GeneID:11502072"
     CDS             50028..50672
                     /gene="TDEL0D00290"
                     /locus_tag="TDEL_0D00290"
                     /inference="similar to DNA sequence:INSDC:YER183C"
                     /note="similar to Saccharomyces cerevisiae FAU1 (YER183C);
                     ancestral locus Anc_4.388"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680824.1"
                     /db_xref="GeneID:11502072"
                     /db_xref="InterPro:IPR002698"
                     /db_xref="InterPro:IPR024185"
                     /db_xref="UniProtKB/TrEMBL:G8ZSL9"
                     /translation="MSAKQLLRKSVKALLRQVPRGVIESQSKAIADALIPLLGDAKNI
                     ACFMSMENGEVDTQYVLKQLFERGSAVYLPRCTSTRETGHVSLRESKKHHMHLTFHRM
                     TSWQQVTEMVPQGKYQLREPPKEDPAPLPAKLDVMLVPAVAFCLQNGARIGHGAGFYD
                     DFFQRYQLQHNGSKPLLIGLSLVEQIVDTIPVEPHDWQMDCIVSGDGEVSWVNR"
     gene            complement(<50732..>51457)
                     /gene="TDEL0D00300"
                     /locus_tag="TDEL_0D00300"
                     /db_xref="GeneID:11502073"
     mRNA            complement(<50732..>51457)
                     /gene="TDEL0D00300"
                     /locus_tag="TDEL_0D00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680777.1"
                     /db_xref="GeneID:11502073"
     CDS             complement(50732..51457)
                     /gene="TDEL0D00300"
                     /locus_tag="TDEL_0D00300"
                     /inference="similar to DNA sequence:INSDC:YER182W"
                     /note="similar to Saccharomyces cerevisiae YER182W;
                     ancestral locus Anc_4.387"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680825.1"
                     /db_xref="GeneID:11502073"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:G8ZSM0"
                     /translation="MLRGLGARLIRRQYATAAEQAAKQFVVRPKQTPRRWVPWTIFGV
                     SFLTGWMVTEHMTFTDLMAYWRYDSLPQTSEEVKKYKLELYNRSEQLPVVKQLQQAGY
                     MEVFPDRSKEVLLIDRALSTPGGVAIPPRFFYNPFTKETVGVYHLGMKLTGYPFIVHG
                     GILATVMEDLMRESVKFIRSKEGEMTKDLSISYKFPTFANQFVVIRTTKVEEFGKNIK
                     LNVEVTDQSGNRQLVNGRGTFIA"
     gene            <51649..>53109
                     /gene="TDEL0D00310"
                     /locus_tag="TDEL_0D00310"
                     /db_xref="GeneID:11502074"
     mRNA            <51649..>53109
                     /gene="TDEL0D00310"
                     /locus_tag="TDEL_0D00310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680778.1"
                     /db_xref="GeneID:11502074"
     CDS             51649..53109
                     /gene="TDEL0D00310"
                     /locus_tag="TDEL_0D00310"
                     /inference="similar to DNA sequence:INSDC:YHR207C"
                     /note="similar to Saccharomyces cerevisiae SET5 (YHR207C);
                     ancestral locus Anc_4.386"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680826.1"
                     /db_xref="GeneID:11502074"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:G8ZSM1"
                     /translation="MHLKIETLTLNDSAHQLADKSINPRAQQICDDVVLLWKEEPATE
                     DLDIIELHKRILLRHPEWHISHHTLQQVLTRHNLYATDEAELEVYSSLVEFPDVSGAI
                     QTLGLPKNVELIETGDEKGRGLFAKKEIRQGELILGESGPLAAIPPIDKLSLIQAGKV
                     CSLCGNSLGHSDHFVMMNGLDCNGCGAVWCNRNCKKTDVTHASLKHVKGKGSLTNASG
                     WAKFEKSCMENVFVAAYSVGVIYATSAVSKADENHVLQHFRSLAQVSQRARKQVSDST
                     NVGGTFDASSGAVTSEDPEPMWQQAYEYFKEAFPKSEDIDFESFLTYVGKFNLNQISG
                     QIYPIYSFINHDCEPNVRYEIDDKLRLKVFARKPIKAGEELLTTYVNPLHGVKLRRRE
                     LRVNWGFLCQCERCTKELTKRTVREKSSHLAVPLHSSNDSSRRKSSMRNARPDLKELL
                     KNGKEFDLEIPEQIGFPQRRRTSVRFDNNVTVAVEE"
     gene            complement(<53243..>54886)
                     /gene="TDEL0D00320"
                     /locus_tag="TDEL_0D00320"
                     /db_xref="GeneID:11502075"
     mRNA            complement(<53243..>54886)
                     /gene="TDEL0D00320"
                     /locus_tag="TDEL_0D00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680779.1"
                     /db_xref="GeneID:11502075"
     CDS             complement(53243..54886)
                     /gene="TDEL0D00320"
                     /locus_tag="TDEL_0D00320"
                     /inference="similar to DNA sequence:INSDC:YHR206W,YJR147W"
                     /note="similar to Saccharomyces cerevisiae SKN7 (YHR206W)
                     and HMS2 (YJR147W); ancestral locus Anc_4.385"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680827.1"
                     /db_xref="GeneID:11502075"
                     /db_xref="GOA:G8ZSM2"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014402"
                     /db_xref="InterPro:IPR027718"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:G8ZSM2"
                     /translation="MNVNSSSGTELSRPSTGVSMATVASNLKTPSNDFVRKLYGILER
                     CEYPDIVRWTETGESFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYDFHKVKKTPE
                     ERQTSQYGELSWEFKHPFFTIHNEEALDNIKRKTTVQKKILLDDSTVLLKPNEQHGLH
                     DNSAVNLILANSVTKDKFNLLKRRVDRLQKELELAKEEKYAAKLEFQKLNSKYNTIVE
                     SLITFKSVNDNLMTGFNQLCSMLSSRGFEVPQPFYDQMNRGGNLSKGALNEHKPQKSF
                     DLDTAAASMVPGTMPLAAPSHPSGAAPGDLSLPLAHITASKPPGGLDTNDTSVLKEGF
                     HVLLVEDDAVCIQLCSKFLRKYGCTVEVVTDGLSAISTLEKFRYDLVLMDIVMPNLDG
                     ATATSIVRSFDNHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIRYLK
                     DRVPLVKQQEERERTGDPPQTQPQSQPGSQPQSQPGSAPQTRSHSITQIRPQLQSHQS
                     MQSIEESVSQPSSTVSESDVNALIEDEPLLKKQRVQLKE"
     gene            complement(<55638..>57872)
                     /gene="TDEL0D00330"
                     /locus_tag="TDEL_0D00330"
                     /db_xref="GeneID:11502076"
     mRNA            complement(<55638..>57872)
                     /gene="TDEL0D00330"
                     /locus_tag="TDEL_0D00330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680780.1"
                     /db_xref="GeneID:11502076"
     CDS             complement(55638..57872)
                     /gene="TDEL0D00330"
                     /locus_tag="TDEL_0D00330"
                     /inference="similar to DNA sequence:INSDC:YHR205W"
                     /note="similar to Saccharomyces cerevisiae SCH9 (YHR205W);
                     ancestral locus Anc_4.384"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680828.1"
                     /db_xref="GeneID:11502076"
                     /db_xref="GOA:G8ZSM3"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:G8ZSM3"
                     /translation="MNFFGSKSSSANTDESDSKSSSTSGNNSTVGRNAGFFPNFTSQT
                     ATPTTAVSQSAYAMGTTGILSEDVLAHMKAMNDGTPGPPGINASSVTPGNSSTGTVPL
                     GDSHSAKGPRAATQAAKKPVDHLAPNHHDMASSTLGKQVGNHNIDSANLEAGVPRGTL
                     TVTIVEAKGLLTASMQSQPYVVCTFESSEFISNGPESVDNKQSHNVEGWNRKDLKKHR
                     PLYTHRSSSHLNKLNDEKQEGNDVNSSNPIWHHETTFDVLGDRSELDISVYDAVHDDM
                     FLGQVRLRPSIHSISRASQCQWHTLQSRVIDENIAGEILIKWHYTSTKKSHYGPQDFE
                     VLRLLGKGTFGQVYQVKKKDSKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTASKS
                     CPFIVGLKFSFQTPADLYLVTDFMSGGELFWHLQKEGRFSEDRAKFYIAELVMALEYL
                     HDNDIVYRDLKPENILLDANGNIALCDFGLSKAELKDRTNTFCGTTEYLAPELLLDET
                     GYTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVK
                     GLLNRNPRHRLGAVDDGRELRAHPFFADIDWNALRDKKIPPPFKPHLNSETDTSNFDP
                     EFTQASTSYMNKHQPLAATPLSPGMQAKFAGFTFVDESAMDDHYNTAYNNRKFLQTSY
                     FMEPGSFIPGNPNLPPDEDVIDDHADDDDGGFSVGKGAHGSQVDYEGDQHMDDEFVSG
                     KFEI"
     gene            complement(<58319..>60673)
                     /gene="TDEL0D00340"
                     /locus_tag="TDEL_0D00340"
                     /db_xref="GeneID:11502077"
     mRNA            complement(<58319..>60673)
                     /gene="TDEL0D00340"
                     /locus_tag="TDEL_0D00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680781.1"
                     /db_xref="GeneID:11502077"
     CDS             complement(58319..60673)
                     /gene="TDEL0D00340"
                     /locus_tag="TDEL_0D00340"
                     /inference="similar to DNA sequence:INSDC:YHR204W"
                     /note="similar to Saccharomyces cerevisiae MNL1 (YHR204W);
                     ancestral locus Anc_4.383"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680829.1"
                     /db_xref="GeneID:11502077"
                     /db_xref="GOA:G8ZSM4"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="UniProtKB/TrEMBL:G8ZSM4"
                     /translation="MLIHLAFSLLLLLRCGFSISDFDKYSFNRAELNHYKKQVKDLFY
                     FAHDNYLEKAYPFDELRPISCVPNVRNFDDPDDIIKNDVLGNFSVTLIDSLTTIAIFN
                     DRSKFRQVAELIKDRFPQKFDLDSTVQVFETTIRVVGGLISSHLYATDPSKQVYLGPE
                     YDGFLLDLAQDMADRLLPAYLTTTGLPLARINLKHGLVGLTADMVAENNVAAMASPMF
                     EFTMLSHLTNNEKYGAVTRYAMNKTWELKSELNLLPMSFNPETGQCYSHFTGIGASID
                     SFYEYALKGAVLFNDEHLHEIWHDSFEALKMYCKADWFFVNAHPTTGQMSAPWVDSLG
                     AFFPGLQVLAGDVEDAKFKNIMSLKLWDTFGGIPERWLFQKEVAQDAGLSLEEKKALK
                     ERANVPLEWYPLRPEFVESTYFLYRATRDPFYLNIGVAVLESFQTRFKYKCGFGGIQD
                     VMTGEAQDRMETFVLSETLKYLYLLFDEDNEIHHTRDNVVFSTEAHPMWISASTMKSY
                     SQNKYFTDLLYLQHLKACRDLDDQLKAKSNRRFFLKERLPEFAKTFFSEDKKTAIRHS
                     TKKWASFKKVCPVIETDTGPWQFSNVLNNFDRLFEIDHRYNDTLIKPLYLAASEPLEI
                     NTRFYTRWANQSHCNCRAPATTTSFELIMDMPGRGQLEQLPNGSITSDTLSGRWKFRI
                     EKLQPGLVDIYGQEITSAIFETADCKNLFKPSLQTGLYSPTLLYRITALNGMQLPSDG
                     QVVLNRTRLLEVPENANVLRQLFGYTPHHQLMFESTPIINLYLA"
     gene            <61531..>62316
                     /gene="TDEL0D00350"
                     /locus_tag="TDEL_0D00350"
                     /db_xref="GeneID:11502078"
     mRNA            <61531..>62316
                     /gene="TDEL0D00350"
                     /locus_tag="TDEL_0D00350"
                     /product="40S ribosomal protein S4"
                     /transcript_id="XM_003680782.1"
                     /db_xref="GeneID:11502078"
     CDS             61531..62316
                     /gene="TDEL0D00350"
                     /locus_tag="TDEL_0D00350"
                     /inference="similar to DNA sequence:INSDC:YHR203C,YJR145C"
                     /note="similar to Saccharomyces cerevisiae RPS4B (YHR203C)
                     and RPS4A (YJR145C); ancestral locus Anc_4.382"
                     /codon_start=1
                     /product="40S ribosomal protein S4"
                     /protein_id="XP_003680830.1"
                     /db_xref="GeneID:11502078"
                     /db_xref="GOA:G8ZSM5"
                     /db_xref="InterPro:IPR000876"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR013843"
                     /db_xref="InterPro:IPR013845"
                     /db_xref="InterPro:IPR018199"
                     /db_xref="UniProtKB/TrEMBL:G8ZSM5"
                     /translation="MARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSQGPHKLRESLPL
                     IVFLRNRLKYALNGREVKAILMQRHVKVDGKVRTDTTFPAGFMDVISLEATNENFRLV
                     YDVKGRFAVHRITDEEASYKLGKVKKVQLGKKGIPYIVTHDGRTIRYPDPNIKINDSV
                     KIDLASGKITDFIKFDTGKLVFVTGGRNLGRIGTIIHKERHDGGFDLVHIKDSLDNTF
                     VTRLNNVFVIGEPGKPYISLPKGKGIKLSIAEERDRRRAQQGL"
     gene            complement(<62426..>64174)
                     /gene="TDEL0D00360"
                     /locus_tag="TDEL_0D00360"
                     /db_xref="GeneID:11502079"
     mRNA            complement(<62426..>64174)
                     /gene="TDEL0D00360"
                     /locus_tag="TDEL_0D00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680783.1"
                     /db_xref="GeneID:11502079"
     CDS             complement(62426..64174)
                     /gene="TDEL0D00360"
                     /locus_tag="TDEL_0D00360"
                     /inference="similar to DNA sequence:INSDC:YHR202W"
                     /note="similar to Saccharomyces cerevisiae YHR202W;
                     ancestral locus Anc_4.381"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680831.1"
                     /db_xref="GeneID:11502079"
                     /db_xref="GOA:G8ZSM6"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006179"
                     /db_xref="InterPro:IPR008334"
                     /db_xref="InterPro:IPR014485"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8ZSM6"
                     /translation="MRVIAAAYLLAASVAAISLQHPFLQESEKTTHIRDLKIGQLNFL
                     HTTDTHGWLGSHLLQPDYDADWGDFVSFVSSFKKNRLNKDQDLLLIDTGDKHDGNGLT
                     DATNPNGVEAAQIFNEQDYDLMTLGNHELYMPENSILEYNTATSHKFKNKYVSSNVEF
                     INDDGHTVPFGNKYLYFETKNSKTRVLAFSFMFNFRRFNNRTNVVPPMEEVSKDWFYE
                     ATEKYDEDKVDLVLIFGHMPVTDMENREMYELHCFMRNIYPNTVIQYFGGHSHIRDFS
                     VFDERATGLQSGRFAETVGFLSIDNVTSETPSFFRRYIDFNKRSFKHHIGKNSAELKS
                     SKGRKVSDELRSLRKRLKLDEVIGYVPKTYFMSERSLDSEENLYNLIIHNVLPRLHSK
                     ITDTTIGRYIMINTGAVRYDLYKGPFTIDSEYIVLPFMNEWYYMELPNRIASKIAHYL
                     NKGPAIASLAPPNVASFSRSTGTCPFIDQPGLTEGYTTVDDGGCKGDDTKHNSQFDYL
                     TPNVVQHVKLVSEGPTDTVHFVFYSFLQPSILEAVNAIVRDEGGQASYDKSSCKVYGG
                     NSTKVLLREYISEISK"
     gene            complement(<64482..>65240)
                     /gene="TDEL0D00370"
                     /locus_tag="TDEL_0D00370"
                     /db_xref="GeneID:11502080"
     mRNA            complement(<64482..>65240)
                     /gene="TDEL0D00370"
                     /locus_tag="TDEL_0D00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680784.1"
                     /db_xref="GeneID:11502080"
     CDS             complement(64482..65240)
                     /gene="TDEL0D00370"
                     /locus_tag="TDEL_0D00370"
                     /inference="similar to DNA sequence:INSDC:YJR144W"
                     /note="similar to Saccharomyces cerevisiae MGM101
                     (YJR144W); ancestral locus Anc_4.380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680832.1"
                     /db_xref="GeneID:11502080"
                     /db_xref="GOA:G8ZSM7"
                     /db_xref="InterPro:IPR009446"
                     /db_xref="UniProtKB/TrEMBL:G8ZSM7"
                     /translation="MSLRHCCRYQIARPFVRYVGTGAAPAYANVSSNAARAPVRSAVT
                     GGGVASGYSNGLNKSLGGTPLETARTEASARAQEDKGIDWYTSWYGIGGKPFDDTVQK
                     HLATPLYTQDIEVKPDGLIYLPEIKYRRILNKAFGAGGWGLVPRSETIVTPKLVTREY
                     GLVCHGQLVSVARGEQDYFSDAGIPTATEGCKSNALMRCCKDLGVGSELWDPVFIKKF
                     KIDNCVEKFVEHVTTKKKRKIWLRKDRQVEYPYK"
     gene            <65435..>67726
                     /gene="TDEL0D00380"
                     /locus_tag="TDEL_0D00380"
                     /db_xref="GeneID:11502081"
     mRNA            <65435..>67726
                     /gene="TDEL0D00380"
                     /locus_tag="TDEL_0D00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680785.1"
                     /db_xref="GeneID:11502081"
     CDS             65435..67726
                     /gene="TDEL0D00380"
                     /locus_tag="TDEL_0D00380"
                     /inference="similar to DNA sequence:INSDC:YJR143C"
                     /note="similar to Saccharomyces cerevisiae PMT4 (YJR143C);
                     ancestral locus Anc_4.379"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680833.1"
                     /db_xref="GeneID:11502081"
                     /db_xref="GOA:G8ZSM8"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:G8ZSM8"
                     /translation="MGPRKRGSTPVATGTAGKDVDDPSLKYTKKGPDYELLSEKWLMR
                     SAPDSPKEYRIWLYVVTAIAFVARFYLLWYPKEVVFDEVHFGKFASYYLERAFFFDVH
                     PPFAKMMIAFIGWLVGYDGEFKFDDIGDSYEQNPAPYLAYRSFNALLGTLTIPVMFNT
                     LKELNFKAVTCAFASLLVAIDNAHVTETRLILLDAILIFAIALTVYCYVRFYKAQLRA
                     PFSWSWYGWLYATGMSLSFVISTKYVGVLTYATIGTMVAINLWQLTDVRAGLSLKKLF
                     SHVFKRLNGLILAPFVVYLFWFWIHFAILIKSGTGDAFMSGEFQETLGDSPLAKESKQ
                     VNYYDIVTIKHKETHVLLHSHWATYPQRYEDGRISSQGQQVTGYSVQDPNNEWEILPV
                     KELSSKSGQPLYLNEAFRLRHVATNSYLRAHDVASPFYPTNEEITTVTEEEANGEAYQ
                     QTLFTFQSLQKKDTETIVKTKGTLFRIFHVDTAVVLWTHNDVYLPEWGFGQQEVNGNK
                     KLTESSNNWYVDEIVNIDEERKAYVPKEIKQLSFFTKWSELQRLMFEHNNKLSSEHPF
                     ASQPYSWPGSLSGVSFWTNDAERKQIYFIGNIIGWWLQVISLGIYVGIIITDLVTRKR
                     AYYALGRITREKLYGPLMYFFVGWAWHYFPFYLMGRQKFLHHYLPAHLIASLFTAALW
                     ETIFSDCKSLDPEKDEDAPGVHYQHNPEIYTKYLWVAFGVMSLGVIVFFLYFSPFVYG
                     NVSLTPEQVVRRQWMNIQLSFAK"
     gene            complement(<67791..>68822)
                     /gene="TDEL0D00390"
                     /locus_tag="TDEL_0D00390"
                     /db_xref="GeneID:11502082"
     mRNA            complement(<67791..>68822)
                     /gene="TDEL0D00390"
                     /locus_tag="TDEL_0D00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680786.1"
                     /db_xref="GeneID:11502082"
     CDS             complement(67791..68822)
                     /gene="TDEL0D00390"
                     /locus_tag="TDEL_0D00390"
                     /inference="similar to DNA sequence:INSDC:YJR142W"
                     /note="similar to Saccharomyces cerevisiae YJR142W;
                     ancestral locus Anc_4.378"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680834.1"
                     /db_xref="GeneID:11502082"
                     /db_xref="GOA:G8ZSM9"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:G8ZSM9"
                     /translation="MVKVVETPLEGERLVRTDEDEVNGFSWVQIVDRVDNLPLDYGSN
                     EKFRENVYHLVTHTQIKVGFVLEFVVEELKAVCGSLFEEAFEADTALKELRFKNPSFD
                     GRNAQLDKIAKEMYLHSQLEGIKGWRDEKYVVCDYDGPYVLLERAMAGLMGIITYGAH
                     INGYVVDENTKSIKFWIPRRAATKPTWPLMLDNIIAGGLGYPCTIYETVLKESKEEAN
                     LDQEVIESNIKAAGVVSYLYFPVDIKDVTFKREADFIVGEAEYIYDLKLSVDIIPTPN
                     DGEVDSFNLLTLEQTVKALVDGEFKPNCALIMVDFLVRHGYITPENEPKFLQLVTRMH
                     RMLPFPTLN"
     gene            <68989..>70122
                     /gene="TDEL0D00400"
                     /locus_tag="TDEL_0D00400"
                     /db_xref="GeneID:11502036"
     mRNA            <68989..>70122
                     /gene="TDEL0D00400"
                     /locus_tag="TDEL_0D00400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680787.1"
                     /db_xref="GeneID:11502036"
     CDS             68989..70122
                     /gene="TDEL0D00400"
                     /locus_tag="TDEL_0D00400"
                     /inference="similar to DNA sequence:INSDC:YHR201C"
                     /note="similar to Saccharomyces cerevisiae PPX1 (YHR201C);
                     ancestral locus Anc_4.377"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680835.1"
                     /db_xref="GeneID:11502036"
                     /db_xref="GOA:G8ZSN0"
                     /db_xref="InterPro:IPR001667"
                     /db_xref="InterPro:IPR004097"
                     /db_xref="UniProtKB/TrEMBL:G8ZSN0"
                     /translation="MLKGVTSFLQYLREVHIKELPVPSSVKVVYGNESADFDSVVSAL
                     AYAYCSFQMHPEDPLIPIVNIPKKELFLRRDIVRALERSKVSEDLLFFAEDLKSLKER
                     FGPLTAVLVDHNSVEATMGPYIAAVVGVVDHHKDAGLHPDVKPRVIRTAGSCSSLVIR
                     YWHKYLPVSAFKDIGLLCLGAGLIDTSNFSSKVEDPDKEALNLYEKLFPDLDRELFYK
                     QIKRDKDDLSGFSIENILKKDYKQFEVQDSGAENKILIGISSVVKPLSWFYENFGGES
                     RFRDECVKTQTQRMVDLYIVMTAWMDGGTFKRELVILSSAPELCQDIVENISDTLQLE
                     DKSLTTKTASSPQYYRTFQQLNTSASRKQVAPCVSHAFQNIKL"
     gene            complement(<70112..>71182)
                     /gene="TDEL0D00410"
                     /locus_tag="TDEL_0D00410"
                     /db_xref="GeneID:11502037"
     mRNA            complement(<70112..>71182)
                     /gene="TDEL0D00410"
                     /locus_tag="TDEL_0D00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680788.1"
                     /db_xref="GeneID:11502037"
     CDS             complement(70112..71182)
                     /gene="TDEL0D00410"
                     /locus_tag="TDEL_0D00410"
                     /inference="similar to DNA sequence:INSDC:YJR141W"
                     /note="similar to Saccharomyces cerevisiae YJR141W;
                     ancestral locus Anc_4.376"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680836.1"
                     /db_xref="GeneID:11502037"
                     /db_xref="InterPro:IPR019193"
                     /db_xref="UniProtKB/TrEMBL:G8ZSN1"
                     /translation="MKTEGLSFLVEHLPRIGTTSIDICAVGQPVIVSRGPGKLCVEDT
                     EENKATILLPCEEFVGEQAKFTTVSPGCYRLRLKSREEVVNAFNCNNKAQNVFMSLPE
                     GKWSKKELIESKGFRILCLTCRTDIINEQNCFKINEMPSEFWMELMDYWHCHKPHDIS
                     KENEYSVRYNSLKPLKGEILLGSAFFLAQQDTFAGRVKTENGFLQCAKCSASLGEETQ
                     DHLFKIYKWQVLLKKSNKEEDVFPPEQDVVFTLLNLIKGYSTRYVLLESESSKLFVWL
                     FAIGIDVTLPDNRVLTNCIKVLYCDEISEKETKGSNIEQLKVKPVPMRHFVQMLEQIH
                     ESLPSSVKQFDLWRVSYIKITA"
     gene            <71318..>76282
                     /gene="TDEL0D00420"
                     /locus_tag="TDEL_0D00420"
                     /db_xref="GeneID:11502038"
     mRNA            <71318..>76282
                     /gene="TDEL0D00420"
                     /locus_tag="TDEL_0D00420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680789.1"
                     /db_xref="GeneID:11502038"
     CDS             71318..76282
                     /gene="TDEL0D00420"
                     /locus_tag="TDEL_0D00420"
                     /inference="similar to DNA sequence:INSDC:YJR140C"
                     /note="similar to Saccharomyces cerevisiae HIR3 (YJR140C);
                     ancestral locus Anc_4.375"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680837.1"
                     /db_xref="GeneID:11502038"
                     /db_xref="UniProtKB/TrEMBL:G8ZSN2"
                     /translation="MSTFNALNFTHHDELLEAEEHSRELQIEESFKIFQGALFDLKAK
                     RYTEADAKFEELFSMEVLKPNKWGFYKYSSPTLDSLRYLAYRNRGMYYYSYLTDNYSK
                     LEAQDIIDIILKVLEHLVESIQHSEADSSVTQLLTQIFGSYKSKKLERLTLEYELTKH
                     ENHLFLLGRRRKGLLPKLKEIVGQYQDLLKDIKEDELSDNLITKDLMGVKLHKTPNLA
                     LSPILEDIRKMKTIDENTMKELDGFEIPLKNSSWEAIASSLKHLVPHIKTSLLITKST
                     DPYGEVEFPIETVKFVIKKSEEEVSAKEEIEQDDSEVHDASRDSSASVSPEVLNGKTT
                     EVQTDIPAAEPNTKKRPLDESESQHFVQRSSKRFREKDPDATEENTLKVHLIFLSDLA
                     LLLSKLQYTVPFSSEDFSLEMALPESSELLTQYDLMECIKVWTSWHTDIYMHSDTKST
                     AATSKGSNHTGFLQVNTLLKSNVFGDKTNCLSELSILDEETVQPFLEVTREHAMHFQE
                     VRFRLLLALLSLDDNSGKRLIVDQSWSSNLFETIEWFFFGIEKSLYLFIAENVSKYSY
                     LALSVYEIMVNMMGSICEEIAAKNYMVARPVTSIIQKNQLEKKIDRWYDLLVKHSSAD
                     DKWLIYFEWARYCYLQYCCEIIDDRLPSALNSIKQRLDGLGEDFQAIFPNYRHIPPLH
                     LSAIHSQSRKIKIIRKISVVDASGDEQKDEDAQQHISLLQQNLLLDLYPERERPNDIL
                     EMLSFISNSPFLLKVKLWEVLFTFYLNKNQINDVLQTYFHVLTFFSKFLSSKQYCDKP
                     SKGRQQLLLTTQSNIASFTSKLTSALLRETRPDVRCIDRENFKLLLKTFFMFYPILYY
                     ESSVKNVVSARSFFRKATKSSGRMKDTIADLATLLVYFASKEASTIVPPQEGSFTAEL
                     IECFHRLLGSFKFCDASNGNFLKLSESLLCRYADSDSLAPLKQILWCRYHYLIAGDNF
                     QPVQHVTKAILMDKGNSVPLGIYLIKLQYQGKNPLLASGTKASLKPVFDSIIDTIGDP
                     MASGNHTVERNKFLVEEYLDHPITAQSFHNAFVGKRCLKLTTPNDELQECINAGLFYV
                     AGIQAFNLYRARKKSMQARPSELDSIITMLKNDIIYDTSRFESWYMLGRCYAFIVEDD
                     LMWTSDKLTVPEKKSVIALTQRKAILCYAMCLQIFFAKEQRNHEDESIIQRALEALGN
                     ELISGKLKPMEKLCFSWRRPHVALKLTTEGELIQEKQSDAILISTFNIDQAILLCLQR
                     ANLLRSRPLDGNEKNWMNFYHIGKLLFKSDKSQHWMVAYQNVMESCILASESSVPKDP
                     ILEPHYYLVNMCYKAVKEGIISPSAALSSISNDKAFFTQEKAFWTSDAALTMDYQKKV
                     FYDKTIKLLTFILASDKKKWHHRPRYRIARILFQDFNNIEGALNEMANFMSIKSTHKN
                     LVNIWKPDLERAGKHFVYTYQYVMFYLDMLERKGDYNSIGLVCKKIRRFGSGMAYVNK
                     AAEHATTLYTQCARCKLHIDEKACVEKLLPSLHYQQFLAITDQLLKSFKLEDYPEDIT
                     QALKIAYQLKRGNNGIAFDGICLAIFFHYFYLPVSATMPAQDISSPDLLVQGEKLKGF
                     TTNSTTVSKAGSPSPTSQKAAVPRKRVSKKDAFDKIRLVADKIT"
     gene            <76440..>77519
                     /gene="TDEL0D00430"
                     /locus_tag="TDEL_0D00430"
                     /db_xref="GeneID:11502039"
     mRNA            <76440..>77519
                     /gene="TDEL0D00430"
                     /locus_tag="TDEL_0D00430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680790.1"
                     /db_xref="GeneID:11502039"
     CDS             76440..77519
                     /gene="TDEL0D00430"
                     /locus_tag="TDEL_0D00430"
                     /inference="similar to DNA sequence:INSDC:YJR139C"
                     /note="similar to Saccharomyces cerevisiae HOM6 (YJR139C);
                     ancestral locus Anc_4.374"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680838.1"
                     /db_xref="GeneID:11502039"
                     /db_xref="GOA:G8ZSN3"
                     /db_xref="InterPro:IPR001342"
                     /db_xref="InterPro:IPR005106"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR019811"
                     /db_xref="InterPro:IPR022697"
                     /db_xref="UniProtKB/TrEMBL:G8ZSN3"
                     /translation="MSGKVVNVVAIGCGVIGSAFLDQLLAMKSPITYNLILIAESKTS
                     LISKDYKPLSLQNGWRSALQNSQQSSLSLEDMLEFLKKSPQPVILVDNTSSAHISGFY
                     PNFIRNGISIATPNKKAFSSDLKIWDDIFAAKPTDGLVYHEATVGAGLPIIGTLRDLI
                     QTGDEVEKIEGIFSGTLSYIFNEYSTTEANDVKFSDVVKKAKELGYTEPDPRDDLNGL
                     DVARKVTILARISGLKVESPTAFPVQSLIPKPLESVASSDEFLSKLSQYDDDLSKLKQ
                     EAAAENKVLRFIGKVDLATKEASVGIQKYDASHPFAALKGSDNVISIKTKRYVNPMVI
                     QGAGAGDAVTAAGVLADAIKIAQRV"
     gene            complement(<77593..>82176)
                     /gene="TDEL0D00440"
                     /locus_tag="TDEL_0D00440"
                     /db_xref="GeneID:11502040"
     mRNA            complement(<77593..>82176)
                     /gene="TDEL0D00440"
                     /locus_tag="TDEL_0D00440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680791.1"
                     /db_xref="GeneID:11502040"
     CDS             complement(77593..82176)
                     /gene="TDEL0D00440"
                     /locus_tag="TDEL_0D00440"
                     /inference="similar to DNA sequence:INSDC:YJR138W"
                     /note="similar to Saccharomyces cerevisiae IML1 (YJR138W);
                     ancestral locus Anc_4.373"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680839.1"
                     /db_xref="GeneID:11502040"
                     /db_xref="GOA:G8ZSN4"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027244"
                     /db_xref="UniProtKB/TrEMBL:G8ZSN4"
                     /translation="MFTSLRGKSQRPISSIPSEAPRANNTTNANSISLSAGNLIVGSY
                     QSSRPYGQRNLEMNRATGSPAGNRSSGNQTLMNTSATSSTPIPVSTPNTGVKKNKSHQ
                     LELAYHESRYSNYSVMLNLSETPEIAEGDICELRTYHKVPGPSGRKIYFIARDFDAES
                     KRRTKSSQVSVLSGQLQSLLDLPTRSKVWVQLKKRESCEADLVELHIKDCLLNRGDMW
                     SLSSQSVGSCVFSGQKLSFLGSIRATVKGIYRDGKKRLSGYLGESTRIVFRSESARLI
                     FLIQITDEMWNFEESGEQLFQKMVNSLFPKIFKRWKEIDTHHSITIAFVCSVDMSKVP
                     FRDLKPGEILKNSTDYFRIVVDQVHAIHWVEIMETLRKEFMKLTKDILNKKTEEGHSA
                     IKGRFSPVIKSNILESVNFATTILTDPFKQPDLRHTTTHVMIITPGSGLYDVDYDLLK
                     LTGKKLLSLEMTMDLICLSRAPLHIVPLFRYLDYENKMYHCSPTWLSIFFWNDTSEGW
                     FPRCKIYDLQMMGLTENDVMQDVSIERLRNEKQVRAISQLMDVYDDSVFRCKPAKEDT
                     TGQSVKTSTGAKKPQSIDKSAQNNSPLEWNAPRFAGAVIEEAQKTKVLASMYTVNEDG
                     EFDADGAGDSLSPIGTRGQTAVDTLKGITKKSSVKDLTHKIVGKLMPGWDQEAKKGKT
                     NIDGINIAGERQLTHTGLSNSKQLPGSGSNVGSSESTPIIMKTLDALSQHEKQRTISP
                     VRDISMRESVSTVNSSKNGDSRQHHGRGRRANNGENKNKLVDSNWMEVSNPSMPVSSE
                     LAGQMLPVRWKDVLPRYVAKKYSKWRSFTTPAELPITISDFPTKEDFENNFIFRNHSV
                     TLNVDHEAPDRTHRHLLRDMIYMRLLTGFQICVGKKAKMIELSKSQENKETPIAKYVD
                     GDWATIKVYMMIDSEIHRLSCGVDGVIDVQRYLRKYEENPYEQVPTYIPLVKTRYESE
                     YRPAELDPLHVTRESFNWNQIDQVLAGYGDCSSKKKKPYGYRSKMVVLPADVPSNTYS
                     SVINGRNETLTPEEIRLEGLRKLITSINRSKRRTVKDNSARNNKKEEIQQEIMFYTGS
                     LFQFIHEQKESLEKSAIDYKDSIFASDKMQLKKDADMKKVAYEMQHGNNPLTLVNRKW
                     HWKKHQNSFIGAEMVNWLISNYGDIDTREDAVEYGQNLMEEGLFVHVLNKHSFLDGHY
                     FYQLSPQYVIDQKSLEKVSSDDKSNADSRRVAKGDSISVSSGSKAAAPSIEFSVSNSQ
                     RSIQDESGIKNTDEISDKPTVVLSSSVVIDVDLAGKSYKSETCTVHYDKVHNPDHCFH
                     IRVEWLTTTPKLLDDLVGNWSRLCERFGLKLIEIPWTELCTIPSINPFHSFVDIKLAI
                     NPWEDPEFKDLEVLATSKFYYHMFLLKASGFLLDNRAATFIQEGECEFDIVYSWGKPE
                     FKYAQYIHNTGAYIAEIRENGNLFLAPNNIYLSRVNRGNVVGKSQSSPQWALDAQMVM
                     LDFRETCTNYEKLREVLLEGKEKWIEEQFYDDF"
     gene            complement(<82361..>83170)
                     /gene="TDEL0D00450"
                     /locus_tag="TDEL_0D00450"
                     /db_xref="GeneID:11502041"
     mRNA            complement(<82361..>83170)
                     /gene="TDEL0D00450"
                     /locus_tag="TDEL_0D00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680792.1"
                     /db_xref="GeneID:11502041"
     CDS             complement(82361..83170)
                     /gene="TDEL0D00450"
                     /locus_tag="TDEL_0D00450"
                     /inference="similar to DNA sequence:INSDC:YHR200W"
                     /note="similar to Saccharomyces cerevisiae RPN10
                     (YHR200W); ancestral locus Anc_4.372"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680840.1"
                     /db_xref="GeneID:11502041"
                     /db_xref="GOA:G8ZSN5"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR027040"
                     /db_xref="UniProtKB/TrEMBL:G8ZSN5"
                     /translation="MVLEATVIVIDNSEYSRNGDFPRTRFEAQIDAVEFIFQAKRNGN
                     PENTVGLISSAGSNPRVLSTFTSEFGKILAGLHDTKIEGSIHLGTAIQIAALTLKHRQ
                     NKVQHQRIVVFVCSPVKDHKNDLLKLAKKLKKNSISVDIINFGEADSNAQILEEFIET
                     VNNSQEESSHLVTVTPGPRLLYEHIASSPIILEEGATGMGGFDGGAGGGDGAFMDFGV
                     DPSMDPELAMALRLSMEEEQQRQQRLRQHQQEQETEQHQGEEPKRKTEGSS"
     gene            <84079..>88356
                     /gene="TDEL0D00460"
                     /locus_tag="TDEL_0D00460"
                     /db_xref="GeneID:11502042"
     mRNA            <84079..>88356
                     /gene="TDEL0D00460"
                     /locus_tag="TDEL_0D00460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680793.1"
                     /db_xref="GeneID:11502042"
     CDS             84079..88356
                     /gene="TDEL0D00460"
                     /locus_tag="TDEL_0D00460"
                     /inference="similar to DNA sequence:INSDC:YJR137C"
                     /note="similar to Saccharomyces cerevisiae ECM17
                     (YJR137C); ancestral locus Anc_4.370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680841.1"
                     /db_xref="GeneID:11502042"
                     /db_xref="GOA:G8ZSN6"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR005117"
                     /db_xref="InterPro:IPR006066"
                     /db_xref="InterPro:IPR006067"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G8ZSN6"
                     /translation="MTAPSVSTIVGALLKFAQAADSSKVFYTTASKAGKSEVSDVEGS
                     IQLLNNQDPFSEITQQLTKNSLTTVFTDESTLLKGLPHLYSLSGFPVVINADLRLQEY
                     SVITSFKDLSLPILVSSDQETAIKNADLANEISTQSLEPVLHFINYSKITNKIGVEVP
                     ATTLADQPRDLSTIPFVNFTTLGGEFNSPSVLVVNFSAYGQDFAKNLPSNASLLDIRT
                     YRPWNFDQFVELIPTTIKKIAIVQGSNQKSDTNGFEPLLLDFFTDFNKIVERNIDSIV
                     ITNVGALTDVKSSLKEIVSNVELEKPDLALFLGEATIDDEKAAIELSSSIKSALSLEN
                     AYLKVLKQLFSSNLQILNEYQSSTVLSNSPEYGYGRYLKEDQRRQELLALAKNSLDPS
                     LYHTVDGSKFVQLLSKWISLHDQNLDEASLKEANETAYQIFDILENNQDSKTALEFLK
                     IAPSTEDYNFKSRWLIGSDAWSYDLGNSGVHQVLFSKKNLNVLLIDSEPYEQTKNSQQ
                     RKKDVGLYAMSAGNVYVASVAVYASYTQLLTAIIEASKFNGPSIVLAYLPYNTEDDTP
                     IEVLKETKNAVESGYWPLYRYDPSNSNEDEVFKLDSSVIKKELQSFLDRENKLTLLSK
                     RNPELARNLEQSASDSITAKQEKRAKAAYDQLLEGLSGPPLHIYFASDGGNAASVAKR
                     LGTRASARGLKSTVLSMDDIILEELPGEENVIFVTSTAGQGEFPQDGKAFWDGIKANT
                     DLDLASLNFSVFGLGDSLYWPRKEDKHFYNRPAQQLYKRLELLTANPIVPLGLGDDQD
                     ADGFQTGYGPWESELWKSLGVDNATVPDEPKPWNNEDMKLASDYLRGTIVEGLADEST
                     GAIHAYDQQLTKFHGIYMQDDRDIRETRKSQGMEPYYIFMARVRLPGGISTPEQWLVL
                     DRLADETGNGTLKLTTRATFQLHGVVKRNLKHTIRAMNSTLMDTLAACGDVNRNVMVS
                     ALPGNAKVHGQVAAVGAEISEYFLPKTTAYHEIWLSGPEERDYDSNWPSIFENRKEGP
                     TKKKTLVSGNALVDIEPLYSKIYLPRKFKVNITVPPYNDVDVWSSDIGLIAIVDEKSQ
                     ELQGFNFYVGGGMGTTHNNKKTYPRTGSSFGFVSTEEVIPAIEAVMIIQRDNGDRENR
                     KHARLKYTIDDMGTDVFKQKVEEIVGWKFAPEKSYQIDSNQDFFGWVKDETGLNHFTC
                     FIENGRVEDRLDLPQKTGFKKIAQLMQKNKSGHFRLTGNQHALICGIKDEHLDEIKQL
                     MKKYKLDNTDFSALRLSSASCVGLPTCGLAMAESERYLPELITKLENILEEYGLRHDA
                     VVMRMTGCPNGCARPWLAEVALVGKAPDTYNMMLGGGFHGERLNKLYRASIKEEEILK
                     ILRTLFKRWSLERLDDEHFGDFLIRVGVIKPTLEGKYFHDDIAEDAL"
     gene            <88616..>89557
                     /gene="TDEL0D00470"
                     /locus_tag="TDEL_0D00470"
                     /db_xref="GeneID:11502043"
     mRNA            <88616..>89557
                     /gene="TDEL0D00470"
                     /locus_tag="TDEL_0D00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680794.1"
                     /db_xref="GeneID:11502043"
     CDS             88616..89557
                     /gene="TDEL0D00470"
                     /locus_tag="TDEL_0D00470"
                     /inference="similar to DNA sequence:INSDC:YHR199C"
                     /note="similar to Saccharomyces cerevisiae YHR199C;
                     ancestral locus Anc_4.369"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680842.1"
                     /db_xref="GeneID:11502043"
                     /db_xref="GOA:G8ZSN7"
                     /db_xref="InterPro:IPR016087"
                     /db_xref="UniProtKB/TrEMBL:G8ZSN7"
                     /translation="MLLSNCLKRGPFTGLRGLKRAKPIVSCARRSASSAVKGQLSKTK
                     RSNIALVYGAAAGIAGIATLASFDKLWSDANIKDNAEATVNVDSSVSPFPTKLGPPEL
                     PLSTEYMLLGYGFRSVTFLSFRVYALGIYIADQDRHLIPDVLDSKFMSTAFIDTDSSK
                     THSDNVKAALDDPSKSSVLIGNVLDSGARMLAKLTPVRNTDFNHLRDGFVRTILNHPE
                     AKDNQEKLSTGLAKLKEAFTEKGKVAKDDDLLVELQANGGLQFSYYNRKKDQVVAMGH
                     VDEPLVGKYLFSQYMSGPKPLSPSTKESVATHIAAMV"
     gene            <89720..>90952
                     /gene="TDEL0D00480"
                     /locus_tag="TDEL_0D00480"
                     /db_xref="GeneID:11502044"
     mRNA            <89720..>90952
                     /gene="TDEL0D00480"
                     /locus_tag="TDEL_0D00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680795.1"
                     /db_xref="GeneID:11502044"
     CDS             89720..90952
                     /gene="TDEL0D00480"
                     /locus_tag="TDEL_0D00480"
                     /inference="similar to DNA sequence:INSDC:YJR136C"
                     /note="similar to Saccharomyces cerevisiae YJR136C;
                     ancestral locus Anc_4.368"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680843.1"
                     /db_xref="GeneID:11502044"
                     /db_xref="InterPro:IPR018870"
                     /db_xref="UniProtKB/TrEMBL:G8ZSN8"
                     /translation="MLVKKIESFNLKFVGIKIPEISELELTELCKESTEVLPRDVFLS
                     FILNLSYLTLNKGTIGRISIETVHRLITKSRVNEEEIVKWLIENLQPLLLRTEDRRRD
                     TVKSGLRPSVGMSLKDDEARRIWKERGGIRSIPLFYVVLLHLQHRNVSSNLWWITPGI
                     LNLLDDTTDLAGIKLRGVLLLRTFLSNAFKDQTHWISFKETGLFKLYEPILLNMCYYL
                     PPSYSSDESLKVWREVFPTLNSLYTTQFKNREIICRKYQGKFLSEFLLQQAIPRINLT
                     SETLAIYTLDSLISLMKILDTSTLYHMSRIIYTLGEYLLRNPFFTAFEGLLRKTLDTL
                     EVLVAVCPPERLSAHKFDLLALILIGFDKCKQEGKLTDELMNNFRRLLQSLEAKGCDY
                     SGDKEEVLKYKNVEELFC"
     gene            complement(<90997..>91260)
                     /gene="TDEL0D00490"
                     /locus_tag="TDEL_0D00490"
                     /db_xref="GeneID:11502045"
     mRNA            complement(<90997..>91260)
                     /gene="TDEL0D00490"
                     /locus_tag="TDEL_0D00490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680796.1"
                     /db_xref="GeneID:11502045"
     CDS             complement(90997..91260)
                     /gene="TDEL0D00490"
                     /locus_tag="TDEL_0D00490"
                     /inference="similar to DNA sequence:INSDC:YJR135W-A"
                     /note="similar to Saccharomyces cerevisiae TIM8
                     (YJR135W-A); ancestral locus Anc_4.367"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680844.1"
                     /db_xref="GeneID:11502045"
                     /db_xref="GOA:G8ZSN9"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="UniProtKB/TrEMBL:G8ZSN9"
                     /translation="MSSFSPADLGNLDDNSKKEIATFLEAENSKQKVQLSIHQFTNTC
                     FKQCVPSINNADLSSQEEQCLTNCVNRFLDTNIRIVKGLQSIQ"
     gene            <91474..>92172
                     /gene="TDEL0D00500"
                     /locus_tag="TDEL_0D00500"
                     /db_xref="GeneID:11502046"
     mRNA            <91474..>92172
                     /gene="TDEL0D00500"
                     /locus_tag="TDEL_0D00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680797.1"
                     /db_xref="GeneID:11502046"
     CDS             91474..92172
                     /gene="TDEL0D00500"
                     /locus_tag="TDEL_0D00500"
                     /inference="similar to DNA sequence:INSDC:YJR135C"
                     /note="similar to Saccharomyces cerevisiae MCM22
                     (YJR135C); ancestral locus Anc_4.366"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680845.1"
                     /db_xref="GeneID:11502046"
                     /db_xref="UniProtKB/TrEMBL:G8ZSP0"
                     /translation="MEDDTSSDELLQVYVESLETHIELKRDFLRQVQDVIGGISGPAQ
                     PEGDWKDLLAKPLFRPERSDPIGLCMASVSHTTRLETTKEWITHMESHLPGLEAMLEN
                     QKGMNYDLGVLIELLEKRLDSTASPTVKKSPQSPEARNEQLWNELEHFVKNYLSMDLV
                     DAEDAGKDLFSDVFPLIKRLLDGDGTLKTTDFHHCSKGLYRLLLRSNLINVVEGPNSV
                     RYVKLLDFANRDLS"
     gene            complement(<92197..>94533)
                     /gene="TDEL0D00510"
                     /locus_tag="TDEL_0D00510"
                     /db_xref="GeneID:11502047"
     mRNA            complement(<92197..>94533)
                     /gene="TDEL0D00510"
                     /locus_tag="TDEL_0D00510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680798.1"
                     /db_xref="GeneID:11502047"
     CDS             complement(92197..94533)
                     /gene="TDEL0D00510"
                     /locus_tag="TDEL_0D00510"
                     /inference="similar to DNA sequence:INSDC:YHR197W"
                     /note="similar to Saccharomyces cerevisiae RIX1 (YHR197W);
                     ancestral locus Anc_4.365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680846.1"
                     /db_xref="GeneID:11502047"
                     /db_xref="UniProtKB/TrEMBL:G8ZSP1"
                     /translation="MSSEPFPVTELAKRLESCDDSEFIAILKCLRSPAYVNEQLLKSE
                     LGLLVTKTLALLRSSHEIAIWRGCQTAVVICTYNPLVLCAHAGQLLAAIYSKLEQKVD
                     YYSSSTPQTKVLLQTLVFALSSLMNLMRGKPSLSREGLVPKLKAIIPTLITLAQYEPR
                     LTLPTLKILLYKNTTTFRPFANKFRVVLVNLIISEYEHFDKKTKQLLSDNFAYLHLIK
                     LQGSAAEDEAQAHHKSYQDDNWRIGIFSVLSQFKPILDICGEILDLEQDNELQKLINS
                     LTFTNNTKGSEASDFLSGLKLDMNYPITLLEITRRLNLLVDLLSSFLSLPTPYPVRIP
                     LGTCISISEALLSMTRNFLPLRRDVRGDAELSSVIRDLLPQIQFSGIKLLSSISQTYG
                     KLCLSMLPSILGSLELFIPLQQKSSKIDLDRCASLKSEMIGLFNLVNSFLPHMGHHMQ
                     EVDFFTKLVEVALHLTKDASTVDLVFNQQATNTLNNRKNLKKKQKKDNSSGSLSDLYT
                     HPEKFKLESSDRLLCEVNHFLRGIISTWKVPSSQQLRILKYTISTAVQFKQQQGFIPK
                     SLLELLRTEVLYPGDERVSILPLAVSLLKESSDEVFDILCHPRLPLSVIHHVKPLPEY
                     VEESFEDEEEEEEEEKKDLVEEDTVAAAVSESLSHSAQEQAITTSFKSKQVVIEELTA
                     VEPTRTTDIQEEPENDIIFKKREREEETTAPEELKRSKIISEATVTVVKQPIVTESKK
                     VQVPATEENGASSDDDSEFEIPNIHLSDDEDDEDDSEE"
     gene            <94918..>96915
                     /gene="TDEL0D00520"
                     /locus_tag="TDEL_0D00520"
                     /db_xref="GeneID:11502048"
     mRNA            <94918..>96915
                     /gene="TDEL0D00520"
                     /locus_tag="TDEL_0D00520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680799.1"
                     /db_xref="GeneID:11502048"
     CDS             94918..96915
                     /gene="TDEL0D00520"
                     /locus_tag="TDEL_0D00520"
                     /inference="similar to DNA sequence:INSDC:YJR134C"
                     /note="similar to Saccharomyces cerevisiae SGM1 (YJR134C);
                     ancestral locus Anc_4.364"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680847.1"
                     /db_xref="GeneID:11502048"
                     /db_xref="InterPro:IPR022091"
                     /db_xref="InterPro:IPR022092"
                     /db_xref="UniProtKB/TrEMBL:G8ZSP2"
                     /translation="MEGGSKKLTLEERLSLAAAKGKRKTKKQGTGSPAQSPTPIDLTN
                     KQSNEISNAIVLNEPKAENENADDNSKLSQSSATDIALNGEYYNDDKDTFLNSLRKSK
                     PWSSWLPADIHDLSSVELLKVLEPHIKEMVKQNMQPPKIDNSASSLVKVIKEKEEIIS
                     QLRQEGENFSKTELRLSTNNKALRKQVSDLEEQIVVLQEELFQKVNALEKASVAAEDS
                     RIQIDELQNQLNELKQENANSKLLEEKLAQTKDRLNQSQNLLDAKNNDFKEEKSKWQK
                     DKESLTSTTREQILLLESNLEQLRIELETSKQGASVGDDGDHWKEQYTVLRNELQDNR
                     QNWNALEEALNTRLTSLEGQLDEARKAEKALTSKLSASDEEKKDLYAKLEKATNERGT
                     VQHELKELQDENKALQRSLEDLTDDFKLLQKQYNIQKTHLERKIDSSEEREGKPSLPL
                     DEDEPPVDSSNFEDEWILPSMISSIGHSDAPIELKDKLNNVDYESVKSVTELEKERLE
                     LDMNDIPNEASDLGSLSKLGISRQHSSSVNIRNKSDAPASNQMSAQMVGKLASEIRRF
                     EVEVSSLKSQCERVQKEKNSANNELVRLMEENESLKKLELEKCSLSKEVENLQSKLET
                     SLQLLGEKAERAEELENDVQDLKDMMKQQIQDMMDLREANH"
     gene            complement(<97170..>98966)
                     /gene="TDEL0D00530"
                     /locus_tag="TDEL_0D00530"
                     /db_xref="GeneID:11502049"
     mRNA            complement(<97170..>98966)
                     /gene="TDEL0D00530"
                     /locus_tag="TDEL_0D00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680800.1"
                     /db_xref="GeneID:11502049"
     CDS             complement(97170..98966)
                     /gene="TDEL0D00530"
                     /locus_tag="TDEL_0D00530"
                     /inference="similar to DNA sequence:INSDC:YHR196W"
                     /note="similar to Saccharomyces cerevisiae UTP9 (YHR196W);
                     ancestral locus Anc_4.362"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680848.1"
                     /db_xref="GeneID:11502049"
                     /db_xref="InterPro:IPR011044"
                     /db_xref="UniProtKB/TrEMBL:G8ZSP3"
                     /translation="MKFHHNNIQYCRSTSILRVNLVSSEPISMISKQDLIASFSPDAR
                     QFAFQTNVSQKNVIDIYPLEASNGYNVNSSLVSHIDYESNDLRVTEIFHLGWCSSLVE
                     DSKQRVKRKNGDENNVELDTDTDRENFFVNAVSPGKIVIFSSSGKDIVNIVQNKSSIL
                     HVSLEDAYIWLLDNENAIKKLQYNQAKQIKSFHIVDGKDEEITYFKALRNDRATYLCY
                     ASKDRVYVIDPSKRRPTTVATLAVGTCISSEILENGDLAIGTETGLSVFNLESKSLVQ
                     EWQTEAKILRVIKDTVLCLNSEGEILAFRLGTDIPICKIKVVDSQIIEFVRVADSVMV
                     AWLNVNEPSFKLISLGDLNGNDEIIINDQKDDKLDGNELATEGKQEPHSSEDDDEQQQ
                     EDVIVSRKKVTKAEQDELSKSLVQALESLEDAKILEIVCSDKWNEHRVKSFIITQLIA
                     DDALSKFYEVTALAFQHNPWENNEISSLWMKWLLTLKGDLFFNSSSQSKHAKKQARRL
                     RASLKASGDCLPVLLGIQGRLEMLKRQSQLREELAQVNLTETEGEEEVETVLNEEEQE
                     PSEANDEYNNSISYANGESDTFVDASEFRSPA"
     gene            complement(<99165..>102314)
                     /gene="TDEL0D00540"
                     /locus_tag="TDEL_0D00540"
                     /db_xref="GeneID:11502050"
     mRNA            complement(<99165..>102314)
                     /gene="TDEL0D00540"
                     /locus_tag="TDEL_0D00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680801.1"
                     /db_xref="GeneID:11502050"
     CDS             complement(99165..102314)
                     /gene="TDEL0D00540"
                     /locus_tag="TDEL_0D00540"
                     /inference="similar to DNA sequence:INSDC:YJR132W"
                     /note="similar to Saccharomyces cerevisiae NMD5 (YJR132W);
                     ancestral locus Anc_4.361"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680849.1"
                     /db_xref="GeneID:11502050"
                     /db_xref="GOA:G8ZSP4"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZSP4"
                     /translation="MDVNTLLQCFACTLDHDAGIRADAERHLKQASCQPGFLGACLDI
                     IASSEVPLNIKMSASLYFKNKSVYGWSGKHIGKNELLDYEIDNDEKPVVKDALIKAML
                     QCSKTSPGCIRVLKSALAVIIGEEYSQGRWDSLLSESLGLLTASDIDLAYVGLICLSE
                     IFRSYRWKENDARQELEHMILQYFPDLLSFANDSLLQDGKNMNNPKIGEMVKLILKIY
                     KFVTYHDLPFTLQRSEMFIPWANFFVSVIQTPLPEEVLSISDTDTRSLNPWVKCKKWS
                     YAILYRLFQRYGSDSLTKRFNYDEFKSLFRDQFLPHFLQLLFQQVELWGSNRLWLSNA
                     SVYYILSFIEQTIVQKHTWKLIKEHYNTILQHIISPLLTPNEDMLDSFENDPQEYIHR
                     NLELWDDSYSPDLAASSLLTTSVTKRGKTTLEPTLQFVIQTLQANMSTIENMPLENAV
                     KVESSLRIFSCIIDRLTVNNSPYLGQMESFMKAFVFPFFSSPHGFLRTRACEICSKAG
                     EVQFEDSTVIEVIYKGIMQCLNEETGCLPVQLLAALALQTFIHNEQFQQALSAVVLPT
                     MQKMLYLSNEFESDTISGVMQDFVEQFAEQLQPFGVELMNTLVQQFLKLAIDLNDVAN
                     TEANNILDADDVPDETDKQMAALGILSTTISILLSFENSPEIVKNLEQSFYPAAEFIL
                     KNGIEDFYRECCEFVENSTFLLREITPISWKILELIGEANRKEESMVSFYLEDFMLVF
                     NNYTIYGKDELKKNEFYTNIIWEVYRKSSISEESDLDELIIVFDLAQKLILALEGNLQ
                     ASYRQQFLEDAIKSIVVEKETLKKNIIFGVTAFNVIISSIVSSPLVSLQFLKHHECLQ
                     FFFEMWLSFYAPNVKRIFDIKLSILALLSIICQVPLEAFSELSMESTVQHLTPIMLEL
                     VSRVPGALKNMEERRKEYSSDSFKPEAFNDWENEDDAYDDNEETGEEALKEQLELLKG
                     DSDVLKFVNGRSFEDGENFDDLEEDPLTGSILDSINIYEVLKTSMMSLQQSDLNRYAC
                     FVKNMPPEDQTLLSQLLSL"
     gene            complement(<102528..>103490)
                     /gene="TDEL0D00550"
                     /locus_tag="TDEL_0D00550"
                     /db_xref="GeneID:11502051"
     mRNA            complement(<102528..>103490)
                     /gene="TDEL0D00550"
                     /locus_tag="TDEL_0D00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680802.1"
                     /db_xref="GeneID:11502051"
     CDS             complement(102528..103490)
                     /gene="TDEL0D00550"
                     /locus_tag="TDEL_0D00550"
                     /inference="similar to DNA sequence:INSDC:YHR195W"
                     /note="similar to Saccharomyces cerevisiae NVJ1 (YHR195W);
                     ancestral locus Anc_4.360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680850.1"
                     /db_xref="GeneID:11502051"
                     /db_xref="UniProtKB/TrEMBL:G8ZSP5"
                     /translation="MARPVAAQGLFSLGTSITLVKLVKKLMEGGTVEEWWNVSPQAQQ
                     SSTYIVDYPIITTEPRNIHNQKLTWPQVLRFFIEQVEEMDLQLACFVLFLCLLGPLIW
                     SLLDTKSSSAAGNSLLHNVSTQTEQEPEEKVTERHFHYDPAERALLQFGRSKSESVLS
                     VFKYSPIQFDYNEPEEEVDEIVAGCTIKTEPIQKTPLEILEEKRRSGVVKPFAPIDQE
                     VILRLDTALSSQKQFKDSSQLCPKVEHQVLVQNSSGNISPGNREAPSVKSAGSLPSFR
                     GAPLERASSAQSLSFLQIQISPRKTSHVEVQVNPEQAYSQPFTY"
     gene            complement(<103641..>105413)
                     /gene="TDEL0D00560"
                     /locus_tag="TDEL_0D00560"
                     /db_xref="GeneID:11502052"
     mRNA            complement(<103641..>105413)
                     /gene="TDEL0D00560"
                     /locus_tag="TDEL_0D00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680803.1"
                     /db_xref="GeneID:11502052"
     CDS             complement(103641..105413)
                     /gene="TDEL0D00560"
                     /locus_tag="TDEL_0D00560"
                     /inference="similar to DNA sequence:INSDC:YHR194W"
                     /note="similar to Saccharomyces cerevisiae MDM31
                     (YHR194W); ancestral locus Anc_4.359"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680851.1"
                     /db_xref="GeneID:11502052"
                     /db_xref="GOA:G8ZSP6"
                     /db_xref="InterPro:IPR012571"
                     /db_xref="UniProtKB/TrEMBL:G8ZSP6"
                     /translation="MNRALTVLGRAVGFNAQLSKMKLKMVPLKSSHWVLPSQLRPAQC
                     HRSLLRSGTNMKPLQLRWYSTQQPPLKPESKKPPSPSAFKFITERDRLLAQATGFLEK
                     LRINVRWVLTKSTRPFNTDDIGAFISWVLVSNVLLIILGTTTFTSLVLYLMNTVLAQE
                     YLATKIGNFLTKNTSLSVVFESAIVPEWSSGKIRFNKVFVSRRPKVSHSFTKGSQIEA
                     LQRTKLGLSDRLLFSREDFDDGNYTQYDLTIDQLDISLSFTKWLNGKGILDEVSINGL
                     RGVVDRTHVVWKPNDDPRNYKNIHQPGDFEITNFAMNDVLFTLYQPNGFRPFQVSIFN
                     CDLPQLRKHWLFYDILNANSISGTYDNAMFTIHKKFNVENTPFSSSNASPWKRVTRLR
                     VDNLAIDHLNAGIDGPFGWITDGQVDMIGDALLPDKEADASQMTEVITEIGDRLYKEA
                     QRHALLPFPQRPTASEIDPDQYFMMDFSLKLHNVKAEVPLFTHELGYINNALIRPIVG
                     YINSTRTYIPIRCRVVKNISDFEGSWTIYDCLLMRDLSAEVYDAFAEYVADDRKRSVR
                     LMRVGFWSLQIMLQVILMSLGAIA"
     gene            <105710..>106225
                     /gene="TDEL0D00570"
                     /locus_tag="TDEL_0D00570"
                     /db_xref="GeneID:11502053"
     mRNA            <105710..>106225
                     /gene="TDEL0D00570"
                     /locus_tag="TDEL_0D00570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680804.1"
                     /db_xref="GeneID:11502053"
     CDS             105710..106225
                     /gene="TDEL0D00570"
                     /locus_tag="TDEL_0D00570"
                     /inference="similar to DNA sequence:INSDC:YHR193C"
                     /note="similar to Saccharomyces cerevisiae EGD2 (YHR193C);
                     ancestral locus Anc_4.358"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680852.1"
                     /db_xref="GeneID:11502053"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR002715"
                     /db_xref="InterPro:IPR016641"
                     /db_xref="UniProtKB/TrEMBL:G8ZSP7"
                     /translation="MSFLPEQSNVSMLSKNEQKAKELISKLGLKPLPGISRVTFRKKD
                     NQIIAIDHPEVYRTAGGNYVVFGEPKVDNFTQKLAAAQQQAQTTDVAPAAGDVSNSPD
                     AIQADMQAAAESSAPASKIEDTEDLDAGDLAADDIDLVVEQANVSKGQAIKALKEHNG
                     DIVNAIMSLSK"
     gene            complement(<106263..>107051)
                     /gene="TDEL0D00580"
                     /locus_tag="TDEL_0D00580"
                     /db_xref="GeneID:11502054"
     mRNA            complement(<106263..>107051)
                     /gene="TDEL0D00580"
                     /locus_tag="TDEL_0D00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680805.1"
                     /db_xref="GeneID:11502054"
     CDS             complement(106263..107051)
                     /gene="TDEL0D00580"
                     /locus_tag="TDEL_0D00580"
                     /inference="similar to DNA sequence:INSDC:YHR192W"
                     /note="similar to Saccharomyces cerevisiae YHR192W;
                     ancestral locus Anc_4.357"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680853.1"
                     /db_xref="GeneID:11502054"
                     /db_xref="InterPro:IPR019273"
                     /db_xref="UniProtKB/TrEMBL:G8ZSP8"
                     /translation="MFSAIRGWGSGSKRTLVQRYTDELSQITAQIHELDRKLKKRQVT
                     MDNLQSHLTYYGSGITASVFAYLYWKCEGSWLMPSMGVIGCIVLLTVIKYGAYRVDQW
                     VRDRQSIKLGKLRALHQKKLERLKEETNYHATNSIIQRFSQGEDQSEDAMVLMDEELK
                     NKYKELHNLKDELAHFRQDDRLKDKHERDKWFDKVINAVAGGDTVNGMFLPVVCPKCK
                     GQTGLYHLGNRSFKYVCPLCGWTIDNTQQESKQHEDTKKEDSSM"
     gene            <107178..>107564
                     /gene="TDEL0D00590"
                     /locus_tag="TDEL_0D00590"
                     /db_xref="GeneID:11502055"
     mRNA            <107178..>107564
                     /gene="TDEL0D00590"
                     /locus_tag="TDEL_0D00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680806.1"
                     /db_xref="GeneID:11502055"
     CDS             107178..107564
                     /gene="TDEL0D00590"
                     /locus_tag="TDEL_0D00590"
                     /inference="similar to DNA sequence:INSDC:YHR191C"
                     /note="similar to Saccharomyces cerevisiae CTF8 (YHR191C);
                     ancestral locus Anc_4.356"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680854.1"
                     /db_xref="GeneID:11502055"
                     /db_xref="InterPro:IPR018607"
                     /db_xref="UniProtKB/TrEMBL:G8ZSP9"
                     /translation="MPSVTISTSQIRSLLDSDQKQVGVTTPMGNMMLEIQGDLEIPST
                     AQEDDDRFSKSEGSDIVKFGLLHINSENKIATLFIGKKQRLLGFVVKLDTPLGLLKFN
                     HDSRTVEMQDVFSYKIIFKNRPLPIM"
     gene            complement(<107576..>109213)
                     /gene="TDEL0D00600"
                     /locus_tag="TDEL_0D00600"
                     /db_xref="GeneID:11502056"
     mRNA            complement(<107576..>109213)
                     /gene="TDEL0D00600"
                     /locus_tag="TDEL_0D00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680807.1"
                     /db_xref="GeneID:11502056"
     CDS             complement(107576..109213)
                     /gene="TDEL0D00600"
                     /locus_tag="TDEL_0D00600"
                     /inference="similar to DNA sequence:INSDC:YJR131W"
                     /note="similar to Saccharomyces cerevisiae MNS1 (YJR131W);
                     ancestral locus Anc_4.355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680855.1"
                     /db_xref="GeneID:11502056"
                     /db_xref="GOA:G8ZSQ0"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="UniProtKB/TrEMBL:G8ZSQ0"
                     /translation="MFGQGLIGLLVATLAAFYYLYGQQSSRASLYESSSEVRDEIETV
                     FLETWRDYSLHGWSYDVYSPLSHSHRNMPRSGDPMGWIIVDALDTMFMMYNGSTTHRN
                     ELLKDILEVQVWIDNQLSYNIDAEVNIFETTIRMVGGLLSAHYYSSQLEMGNPDIYLN
                     KAVDLCDRLAAAFDTSESGIPYSSVNLRTGQAIKNHVDDGASSTAEFTTLQLEFKYLS
                     FLTKNDTYWKLAENVYPALYQSNKLLDAYHGLAPIYTYPDSGRFMGQNIRFGSRGDSF
                     YEYLLKQYLFTHEKLYYDLYRQSMEGMKRHLIGKSRPSGYTYIGEKPFGLTGSLDPKM
                     DHLVCFMGGLLAMGATEGYPIQEARKKALWDSQREEDWKLAQELTHTCYQMYHQTPSG
                     LAAEIVVFNDGRPIPDNAWLSPSGDFYIKPADRHNLQRPETVESIMFLYHLTKDDKYR
                     QWGYEIFSNFVKHTCEVLDDSHNIYLSLKDCVSLPTIKSDNIESFWLAETLKYLHLLF
                     QDDVDLTKVIFNTEAHPFPVLDVGQLRELGLKTGWSP"
     gene            <109396..>111354
                     /gene="TDEL0D00610"
                     /locus_tag="TDEL_0D00610"
                     /db_xref="GeneID:11502057"
     mRNA            <109396..>111354
                     /gene="TDEL0D00610"
                     /locus_tag="TDEL_0D00610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680808.1"
                     /db_xref="GeneID:11502057"
     CDS             109396..111354
                     /gene="TDEL0D00610"
                     /locus_tag="TDEL_0D00610"
                     /inference="similar to DNA sequence:INSDC:YJR130C,YML082W"
                     /note="similar to Saccharomyces cerevisiae STR2 (YJR130C)
                     and YML082W; ancestral locus Anc_4.354"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680856.1"
                     /db_xref="GeneID:11502057"
                     /db_xref="GOA:G8ZSQ1"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8ZSQ1"
                     /translation="MSSTIATRIGESIPPNTNHAVSVCLPTWDATVGYEEADPAVVDK
                     MTTGYPRFFIHKSIKRLCEVLGDKYAKESETCLCFPSYNVAKRCREFIVVKAAEEDAN
                     KPPVKVRILQLATSKPMNAEEAKWKRECKIAVVFAAKEHFPLMKQYWQHTGEIISSRL
                     AEYVLHELFIVERSSQAVETKEIRGEEEFIEQRFGRNLDFSLADHAKMLIKTRIATKV
                     VEDEDVESGNGQEAVPSSEDPVEQSAAFDHMETRMPIDEVPSTIPAEPIDAVHAVESS
                     EENDRRRTLHVNPETDVLLFPSGMASIFTAHRMLLNYDAQRVSRSRFSSSNGGATAGS
                     QSSSYLVGYGEPYKKTVMFGFPYTDTLSILRKFNHTHFLGQGDSTAMEDLKKILQSGE
                     QILAVFMEAPSNPLLKMGDLLELRQLANLYGFFIVVDETAGGFVNIDVLPHADVVCSS
                     LTKIFSGDSNLIAGSLVLNPQGKLYDFAQQWLLAQKEYEDTLWCEDALALERNSRDFV
                     QRTIQVNHNTEYLLNKVLIPLEGKLFKKIYYPSLTSPETKRHYDAVKCSIDAGYGGLF
                     SLTFFNLAQARVFFDSLQLCKGPSLGTNFTLACPYAILAHYQELDEVARYGVEKSLVR
                     VSVGLENRESLCQVFQHAIAEALKISTD"
     gene            complement(<111421..>111603)
                     /gene="TDEL0D00620"
                     /locus_tag="TDEL_0D00620"
                     /db_xref="GeneID:11502058"
     mRNA            complement(<111421..>111603)
                     /gene="TDEL0D00620"
                     /locus_tag="TDEL_0D00620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680809.1"
                     /db_xref="GeneID:11502058"
     CDS             complement(111421..111603)
                     /gene="TDEL0D00620"
                     /locus_tag="TDEL_0D00620"
                     /inference="similar to DNA sequence:INSDC:YML081C-A"
                     /note="similar to Saccharomyces cerevisiae ATP18
                     (YML081C-A); ancestral locus Anc_4.353"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680857.1"
                     /db_xref="GeneID:11502058"
                     /db_xref="GOA:G8ZSQ2"
                     /db_xref="InterPro:IPR006995"
                     /db_xref="UniProtKB/TrEMBL:G8ZSQ2"
                     /translation="MLKRFSTPILKPYWPFFVGGAIMYWTFGKVANLSANSNEFINDP
                     RNPRFARGEKPVELKQ"
     gene            <112037..>113032
                     /gene="TDEL0D00630"
                     /locus_tag="TDEL_0D00630"
                     /db_xref="GeneID:11502059"
     mRNA            <112037..>113032
                     /gene="TDEL0D00630"
                     /locus_tag="TDEL_0D00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680810.1"
                     /db_xref="GeneID:11502059"
     CDS             112037..113032
                     /gene="TDEL0D00630"
                     /locus_tag="TDEL_0D00630"
                     /inference="similar to DNA sequence:INSDC:YIR029W"
                     /note="similar to Saccharomyces cerevisiae DAL2 (YIR029W)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680858.1"
                     /db_xref="GeneID:11502059"
                     /db_xref="GOA:G8ZSQ3"
                     /db_xref="InterPro:IPR005164"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR015908"
                     /db_xref="UniProtKB/TrEMBL:G8ZSQ3"
                     /translation="MSIKLCGEEDFNKRVTSEFRAVDVVGKKLGGVVESFSDEWFAAA
                     SNLIEPTVPIRDATRFVHAGAWYDGWETRRHNEQEYDWVILRMGVAAAHLVGAEVDTA
                     FFNGNHAPFVSVDALYDEQASGIGEDDPRWVNIIEKFECNPSQKHFVIRKEGLTKEKF
                     THVKLKMYPDGGIARFRLYGQVVPPALAQDAFLDLASVCNGAVAQAVSDQHFGSADNL
                     LLPGRGHDMSDGWETKRSREPGHVDWVIIQLGRKTSYLDHVVIDTAHFRGNFPQFVTV
                     HGSNGSDEWIELVGKSRTGPDQEHKFTVAKDVELTHLKITIIPDGGVKRIRAIGR"
     gene            <113100..>114083
                     /gene="TDEL0D00640"
                     /locus_tag="TDEL_0D00640"
                     /db_xref="GeneID:11502083"
     mRNA            <113100..>114083
                     /gene="TDEL0D00640"
                     /locus_tag="TDEL_0D00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680811.1"
                     /db_xref="GeneID:11502083"
     CDS             113100..114083
                     /gene="TDEL0D00640"
                     /locus_tag="TDEL_0D00640"
                     /inference="similar to DNA sequence:INSDC:YJR129C"
                     /note="similar to Saccharomyces cerevisiae YJR129C;
                     ancestral locus Anc_4.352"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680859.1"
                     /db_xref="GeneID:11502083"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZSQ4"
                     /translation="MDPTNQLLYDRLYQRCPAPVLLKWMQETPGLKIHVADFIEQLKL
                     VETQNAYYVKAIVKALIDNVELLDEEGQGTGIETLVTDVWLSEWLYEKYVALLDVKQP
                     SATTTDVIQYRISPQVKVKIEETPYLISASGTTGFRTWEAALYLSLYLATSCPITEGS
                     KVLELGAGTGMVSATLALTNPGRLDKLYVTDGDWHLTQQARKNFSLNGIETSNTYFEQ
                     LRWNEDPVPTKLDYVVAADVTYDSTVVPDLCKCIAQSLTPRTTCLVAATVRNENTTST
                     FESTAKEMGLDCQLQMTTETDYRSQSLLEKTLLFRPLQAPVRIYRISPHAH"
     gene            <114327..>114521
                     /gene="TDEL0D00650"
                     /locus_tag="TDEL_0D00650"
                     /db_xref="GeneID:11502084"
     mRNA            <114327..>114521
                     /gene="TDEL0D00650"
                     /locus_tag="TDEL_0D00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680812.1"
                     /db_xref="GeneID:11502084"
     CDS             114327..114521
                     /gene="TDEL0D00650"
                     /locus_tag="TDEL_0D00650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680860.1"
                     /db_xref="GeneID:11502084"
                     /db_xref="UniProtKB/TrEMBL:G8ZSQ5"
                     /translation="MALHNYIYLKHKSHDPSCHKLLARDHDSRPTPVPSVSPQDSTSS
                     VSSAPAASCDKTTTNQCKTT"
     gene            complement(<115547..>116641)
                     /gene="TDEL0D00660"
                     /locus_tag="TDEL_0D00660"
                     /db_xref="GeneID:11502085"
     mRNA            complement(<115547..>116641)
                     /gene="TDEL0D00660"
                     /locus_tag="TDEL_0D00660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680813.1"
                     /db_xref="GeneID:11502085"
     CDS             complement(115547..116641)
                     /gene="TDEL0D00660"
                     /locus_tag="TDEL_0D00660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680861.1"
                     /db_xref="GeneID:11502085"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:G8ZSQ6"
                     /translation="MSTKEIGKPNSWECEDADVDVPKKYFTSVITWAYYESTKSYDLL
                     MMIGWYGGLMYGLYSTIFTSHIWRFQILFLLLEASVVLAPVICMTLIERRAGYLISRN
                     NKKLAEATKEVFSSKQENLVLGWDKVASVLNRKFYVAGDWKTPYCIFDGAKCESYFRR
                     HVLKSMAEEDASEDCEKSCLRAAVDIYRRRIIDQFEWDKYDTPVLADDNFLAGSDHKE
                     FTWRLRNTLKDLHFIVYFVTSLFVLLAGTRSLLLCMIMTILMFATIAARPPLELSTTR
                     SRIRLLATIADVAPREDMDRWDVVARRMNAYLSQDSNSDAGIFFDGKDYLEFFEKQLK
                     PLMSKKIKDYRVATYELVPLIADVVEGPST"
     gene            <117923..>121522
                     /gene="TDEL0D00670"
                     /locus_tag="TDEL_0D00670"
                     /db_xref="GeneID:11502086"
     mRNA            <117923..>121522
                     /gene="TDEL0D00670"
                     /locus_tag="TDEL_0D00670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680814.1"
                     /db_xref="GeneID:11502086"
     CDS             117923..121522
                     /gene="TDEL0D00670"
                     /locus_tag="TDEL_0D00670"
                     /inference="similar to DNA sequence:INSDC:YJR127C,YML081W"
                     /note="similar to Saccharomyces cerevisiae RSF2 (YJR127C)
                     and YML081W; ancestral locus Anc_4.351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680862.1"
                     /db_xref="GeneID:11502086"
                     /db_xref="GOA:G8ZSQ7"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8ZSQ7"
                     /translation="MFPDSGALQISSVYQHSDESVVSTNMASAAKGELETGGLLPIPK
                     KSRTIKTDKPRPYLCPICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLR
                     HQHKLHGSLVGSSSPSNISSSNSLTEISDVGTLSTNDMEKHIIKVAGNKEAILPTPSN
                     PLARTAAQLKKDAREAAATGKTCSSISPLTTNSAVSSSSSLNSMSNRDSSISLEAVSK
                     KSLSPVIAEQSDKNPPKRRKRHASFSATSAFTYINDNQTSQQVLKELHSIQDVPHQVG
                     FSTPQLNAQQLLEKFAESGVVDADLLGLPSDFCLDEYVAAESSHRQDQQPGEDYFSQP
                     TENNSGAQNASSEPFSNIPMTPSAFLHNAPSLVNFLTMGSTAGGAGGFAGITAGDSNL
                     TSFKYEPFETESYLEMPTEKINAGNKSVGTSRNTELPQEDLWISDLVGNSRREPAFKL
                     DFEHFNDIGFVDTFTNKSSSATPMIMDAATVNSFSPASGKSQSASQPIKLLQKDRTSI
                     SPASNPSSGSTQYHPEKRRASFSLGPAVSSLFNSRQKDLFQMISEFQVLNSSPSPRTS
                     SSGESPLSPGDASAKYRKGSRLILFDAEFREAIIRETNLQSKQFPKLDELNAYVNLYQ
                     SEFHRYFPFIHLHSLVPSMNNLLIILSITMIGALYAFHSSHAMLLSNIARLKVRDRLN
                     DIHNNFETTPLSLIQSMVLLTFFGIFSNDSNVTNGMSNKVMMLIKLVKSSKLNMPLET
                     LQTPPIESDHVLEFQDNPEVLNRIRSQYNTPQQIHRNFKYFITAQARIRTCHIILLIS
                     NLFTSLVGLEGVFHSIDLKCGVPCFHERLFACEDAIQWARNLKKYHIVLDSKFSLIQL
                     SNGEDYSHCLMYISTGSQYYYENSKISFRTLLSMLISVHEKIFLERNNMKYEANEQVN
                     EIKWRMNSRPVIDAMLKHWEAIFIKSGGTLACHEENIPMINENPAMRLIIPLHLFANI
                     RKCLDLRRVMNRIWLKDWEGMNEGLSCMSSNKDSLREASSFALNIVRFWAETVSVMKN
                     AERTAIRTPIFSITCIFSSILIVAEYMRRVEAWAQDFDPSNPTAQILNASDRMFWLKS
                     EQVLKKVEEHLLPKGYNSQSYAEFLRSQAKGALDVDVLDNELARRAMKPDTPTEETKE
                     VIIKARLSSRSLYLGVRILGDAPIWPIALLFAHALQARAIYNLEDRSTLSKPE"
     gene            <121782..>123065
                     /gene="TDEL0D00680"
                     /locus_tag="TDEL_0D00680"
                     /db_xref="GeneID:11502087"
     mRNA            <121782..>123065
                     /gene="TDEL0D00680"
                     /locus_tag="TDEL_0D00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680815.1"
                     /db_xref="GeneID:11502087"
     CDS             121782..123065
                     /gene="TDEL0D00680"
                     /locus_tag="TDEL_0D00680"
                     /inference="similar to DNA sequence:INSDC:YML080W"
                     /note="similar to Saccharomyces cerevisiae DUS1 (YML080W);
                     ancestral locus Anc_4.350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680863.1"
                     /db_xref="GeneID:11502087"
                     /db_xref="GOA:G8ZSQ8"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:G8ZSQ8"
                     /translation="MTQNVNDVLDEIKAKKMLGRQLFESIGSPTKIVAPMVDQSELAW
                     RILSRRYGATLAYTPMFHAKLFATSEKYRRDMWCEIDGNPEIDRPLVVQFCANDPEYL
                     LQAARLVQDKCDAVDLNLGCPQGIARKGRYGSFLMEDWDLIHKLIRQLHDNLDIPVTA
                     KIRVFPEREKTLEYAKMVLDAGAQFLTVHGRLREQKGQKTGLADWEIVKYLRENLPVD
                     TVFFGNGNILYPEDISRGIKHIKCDAIMSAEGNLYNPGIFNTHESEQKDDAFPRVDHV
                     AREYFEIVRKYKESQASRIAMKSHMFKILRPLLPHHTDIRAALASLNAKTPFEEWEEK
                     VIKAVESVVEAIFAQENIQELDQVVKGAVELWGGFYVTVPYWRCQPYFRPVNGVTADK
                     RLTEGLKAQSESESNDNKRKAESALQRGNEKEVKV"
     gene            <123209..>123841
                     /gene="TDEL0D00690"
                     /locus_tag="TDEL_0D00690"
                     /db_xref="GeneID:11502088"
     mRNA            <123209..>123841
                     /gene="TDEL0D00690"
                     /locus_tag="TDEL_0D00690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680816.1"
                     /db_xref="GeneID:11502088"
     CDS             123209..123841
                     /gene="TDEL0D00690"
                     /locus_tag="TDEL_0D00690"
                     /inference="similar to DNA sequence:INSDC:YML079W"
                     /note="similar to Saccharomyces cerevisiae YML079W;
                     ancestral locus Anc_4.349"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680864.1"
                     /db_xref="GeneID:11502088"
                     /db_xref="InterPro:IPR009327"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:G8ZSQ9"
                     /translation="MVESLESATIDGVVEAEISPCHFTLFPSSEPPTALQQIIDDWGL
                     IEHQEGGYFKETDRSPFLMTVLDQHSAVGQGIEGSSGTVSRNYSTLIYYLLTSNRPIG
                     KFHKNKNRITHILQRGKGQYVLIYPNGQVKSFKVGFDYQNGEISQWVVPGEVYKASFL
                     IPNEEFSNGLLISEVVVPGFDFEDHSFMSGRDELVDLVGDEKAAKLEFLL"
     gene            <123998..>126361
                     /gene="TDEL0D00700"
                     /locus_tag="TDEL_0D00700"
                     /db_xref="GeneID:11502089"
     mRNA            <123998..>126361
                     /gene="TDEL0D00700"
                     /locus_tag="TDEL_0D00700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680817.1"
                     /db_xref="GeneID:11502089"
     CDS             123998..126361
                     /gene="TDEL0D00700"
                     /locus_tag="TDEL_0D00700"
                     /inference="similar to DNA sequence:INSDC:YJR126C"
                     /note="similar to Saccharomyces cerevisiae VPS70
                     (YJR126C); ancestral locus Anc_4.348"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680865.1"
                     /db_xref="GeneID:11502089"
                     /db_xref="InterPro:IPR007365"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="UniProtKB/TrEMBL:G8ZSR0"
                     /translation="MSQGANGESNRESEPLLNGYSSFGSEYLDSRRPSSGLPSIARLR
                     SGTITSIRSTYETVKEHMDKKKFAYLVLASLFLYLGFVGAFAPRTSLARDLRRIHASR
                     LTDAEVYRIYLNALYSENHAGEHLKNYTSQLHGTGDAHVLDYTVSELRKLGFDPKLER
                     YYPWVSEPVDTQVALYVDDTITFNATLKEECVAEDPSSCNLIEKRAYHGYSASGNVTS
                     QYIFANYGSLEDYTFLLDNGVDIDGKVHVIRYGKLLPGLKVKNAELFGASGVLMYTDP
                     YDDGRITKKNGFKMYPAGPARHESSIERGSVAFMNYFPGDPTTPGYPSKFPGTERLSP
                     AGKVPTIPSIPISAKEIAPILQLLNGKGVRLGSGGNIDGFEYFSGPSDLNEQVKLYNQ
                     QHNSIIEITNVIVEISGIFSEYDILIGNHRDSWTAGGAGSPNSGSAVLLEIARGMSEL
                     LKHGWKPLRPVKLISWDGGELSMLGSSEYVENHAEILKRSALVYLNLESAITGSQFSC
                     KSNPLLEDVIRNAAKYTDLGDGDEGTLYDEWKRATNLTNDHLDGIADYVPFQYHLGIP
                     SASFEFSNNKTCDAVVPYHSIYDTYTWMEKFVDKDYRHHNTLAVLTGMTSLMLCEREP
                     TVFKVHPYFKDINKWYQKWHQEVLSLFPSDRELRETAQTVADNLQGVTFNETILFDTQ
                     NIELNDLCTRDFATYEFYKKIRIYLQLMRANNKLKQIDQMFLTHRGLLERPWMKHSIY
                     APDRLTGYDVDVLPGLHEALLDHDRDGVLQWLSILLTQISNVKSLLQ"
     gene            <127174..>128301
                     /gene="TDEL0D00710"
                     /locus_tag="TDEL_0D00710"
                     /db_xref="GeneID:11502090"
     mRNA            <127174..>128301
                     /gene="TDEL0D00710"
                     /locus_tag="TDEL_0D00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680818.1"
                     /db_xref="GeneID:11502090"
     CDS             127174..128301
                     /gene="TDEL0D00710"
                     /locus_tag="TDEL_0D00710"
                     /inference="similar to DNA sequence:INSDC:YJR125C"
                     /note="similar to Saccharomyces cerevisiae ENT3 (YJR125C);
                     ancestral locus Anc_4.346"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680866.1"
                     /db_xref="GeneID:11502090"
                     /db_xref="InterPro:IPR001026"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:G8ZSR1"
                     /translation="MSLEDTLANVSLYDAKKYFRRAQNVVFNYTDMEAKVREATNNEP
                     WGASTTLMEQISQGTYNMREREEILGMIFRRLTEKRANEWRQIYKALQLLDYLIRHAS
                     ERFIDDTRSSISLIKMLESFHYIDSQGRDQGINVRNRAKALAELLSDDETIRAERKKA
                     RETAKKYKGVAGGSATVNRQMNPRAGFNSTRVHGISVSAESDEEEDDIVPSGAFRDIS
                     SKEPSATASAEVVLAAPEDVPVKSHAEEDDEDEFADFQSAVPSTGTDATHQTNDQYTP
                     AANSFAAAPLPEILPAIATETKKSDPFSSLFSTAKKSSDNIEPIRKSQVQTPNAIQMP
                     NTVENDDDDDLFGEMTGAGASHQPQEKTATAKTGEIDLLSF"
     gene            <128482..>128961
                     /gene="TDEL0D00720"
                     /locus_tag="TDEL_0D00720"
                     /db_xref="GeneID:11502091"
     mRNA            <128482..>128961
                     /gene="TDEL0D00720"
                     /locus_tag="TDEL_0D00720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680819.1"
                     /db_xref="GeneID:11502091"
     CDS             128482..128961
                     /gene="TDEL0D00720"
                     /locus_tag="TDEL_0D00720"
                     /inference="similar to DNA sequence:INSDC:YML077W"
                     /note="similar to Saccharomyces cerevisiae BET5 (YML077W);
                     ancestral locus Anc_4.345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680867.1"
                     /db_xref="GeneID:11502091"
                     /db_xref="GOA:G8ZSR2"
                     /db_xref="InterPro:IPR007233"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:G8ZSR2"
                     /translation="MAIYSFWIFDKHCNCLFNREWTLAANSSSGTVNSKQNEETAKLL
                     YGMIFSLRSITLKLSQSPPANEIRSISTGKYRVHTHCTASGMWFILTTDFKQQSYGQV
                     LQYIYSHIYVKYITHNLLAPFDLAENPSETRGQGTRKINNRHFIAALESFLAPMIMQ"
     gene            complement(<129036..>131456)
                     /gene="TDEL0D00730"
                     /locus_tag="TDEL_0D00730"
                     /db_xref="GeneID:11502092"
     mRNA            complement(<129036..>131456)
                     /gene="TDEL0D00730"
                     /locus_tag="TDEL_0D00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680820.1"
                     /db_xref="GeneID:11502092"
     CDS             complement(129036..131456)
                     /gene="TDEL0D00730"
                     /locus_tag="TDEL_0D00730"
                     /inference="similar to DNA sequence:INSDC:YML076C"
                     /note="similar to Saccharomyces cerevisiae WAR1 (YML076C);
                     ancestral locus Anc_4.344"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680868.1"
                     /db_xref="GeneID:11502092"
                     /db_xref="GOA:G8ZSR3"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8ZSR3"
                     /translation="MSLRKHDVKEGELPTFGVAVSSVNSYDKNDQLVLGDIDIRTRAV
                     IEGASPNDPRALGPTQLETNDGGQIKRNSFACVSCHSLKQKCVPSDPHDIYRKPCERC
                     LRNFKLCKFDLSKRTRKRRRRDTTDSPVYMESSTKAQLSSSLPEQQSTPYGAARNLPH
                     IWSGIAPPATDSATIQRLNASSLSSSASPVFGDSRNFTPEENRNGEIEKQVDMSHLYL
                     MKPIFKRQLHSLLLYQKGKVGEISRKLDAWANQWNELVQEGTTSFATVSDPISRNLIS
                     MKEAEIRYELWKSEFSSRFKFVKSSSTLSLNQLRQEKPILLSVIMSCVSVVMTSKDTT
                     MEKNMKLDNFVLNLITDQIFKLNHKSIELVESLLTLCLWYNFPEWSNKTRYHIFNYVC
                     VCLIKDLGPNSVSRAFGMFSDEDPSKRKRKSKTPLELYDNSARLIILVYISSLNISIF
                     LKQPIQARWSLLIEKACEELLGNTETKTEEELYHPDDDKTLVVFARLNFILEKVHIYL
                     HEIREEHEYTGMSDSHFKHLTEKFQSQLTVIFVQMPKDRHRELSFFYSVEAYLYQYII
                     NNYAASQKRMTTAETLPLDVSEAFQKCYNYCASALEEFVKMTPKLVASLPLFHMSRII
                     YTVGLLLFKLRYSTLIVPCFQQFKMLTENSIPLVNKVAETLEQCSKIYEFNNFLFKFQ
                     YVVALFAQTYANKVGEVMNNTSKRSHENNDTVVNHSQTEAIVPELGELLDSNSADKFS
                     HGRPNGADPAAVSNGQTAPFVATEVQSSPANSADTINDYLTDVDSLMWGFNVLNDEFW
                     TDIFTNDL"
     gene            complement(<132064..>135189)
                     /gene="TDEL0D00740"
                     /locus_tag="TDEL_0D00740"
                     /db_xref="GeneID:11502093"
     mRNA            complement(<132064..>135189)
                     /gene="TDEL0D00740"
                     /locus_tag="TDEL_0D00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680821.1"
                     /db_xref="GeneID:11502093"
     CDS             complement(132064..135189)
                     /gene="TDEL0D00740"
                     /locus_tag="TDEL_0D00740"
                     /inference="similar to DNA sequence:INSDC:YLR450W,YML075C"
                     /note="similar to Saccharomyces cerevisiae HMG2 (YLR450W)
                     and HMG1 (YML075C); ancestral locus Anc_4.343"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680869.1"
                     /db_xref="GeneID:11502093"
                     /db_xref="GOA:G8ZSR4"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR002202"
                     /db_xref="InterPro:IPR004554"
                     /db_xref="InterPro:IPR009023"
                     /db_xref="InterPro:IPR009029"
                     /db_xref="InterPro:IPR023074"
                     /db_xref="InterPro:IPR023076"
                     /db_xref="InterPro:IPR023282"
                     /db_xref="InterPro:IPR025583"
                     /db_xref="UniProtKB/TrEMBL:G8ZSR4"
                     /translation="MVLQSQFGQSAKLLAYVARFSAKRPIHVILITLLMSAIAYLSVV
                     QYYVSGWQLASTSVFSADSPDADGLFEECTHYYRGPNSDVWNLLSSEEAKSKAVPQHY
                     YLFNLDFESENETISLPHPDNIFYETNNNKYVLKTEPSIEQSFTSQDGTQWRLSNYRN
                     RLFEIQHFLTTVYKNLKTRFLESEPFDIIIVGAAHLTMIYSVVSLFSDMSKTGSRFWL
                     SLSAMVNSACALFLALYTTQSIVNRPVSLLSLIEGLPFIAVIVGFKHKVRLTAYTLQS
                     FERMGITKMTTDKALFDAMCIEGRRLLQDYVLCLVAFIGCSIYARKLETLKNFCILSA
                     FILFFELILTTTFFSAVLALKLEINVIHRSTVIKQTLEEDGVIPSTANLIYGALTKSK
                     TSVLQSNAAVTFVKLSLIGAFVAINFYNFGAGWASETFTSLYSFNTTASLPEFIHTHD
                     SGNLGKQVIISIAPVQYYRPMKAYHQVEDILLRLLRYVSMAIRDRLISKLVFFALAIS
                     ATINIYLLNAARIHTSFTADEISKKKIAKKEEKIAAVTDTHAKKVVTTVSKKTAVAVD
                     SSSTTDEDETDSDINGFPERPLQELEQLYKDGQVCSLRNKEIALLVTNSILPLYALEK
                     VLRNTTRAVAVRRKALAILADAPVLSTDRLPYKHYDYDRVFGACCENVIGYMPLPVGV
                     IGPMIIDGVSYHIPMATTEGCLVASAMRGCKAINAGGGAATVLTKDGMTRGPCVRFPT
                     LARSGACKMWLDSEEGQNKVKKAFNSTSRFARLQHVQTALAGDLLFVRFRTTTGDAMG
                     MNMISKGVEFSLKQMVEEFGWSDMEIVSVSGNYCTDKKSAAINWIEGRGKSVVAEATI
                     PGDVVRKVLKSDVSALVELNISKNLIGSAMAGSIGGFNAHAANLVTAVYLALGQDPAQ
                     NVESSSCMTLMKEVDGDLRISVSMPSIEVGTIGGGTILEPQGAMLDLLGVRGPHPTDP
                     GANARQLAKIVACAVMAGELSLCAALAAGHLVQSHMTHNRAKKPANAAPVADPKEIER
                     LTEGSKSCIKS"
     gene            complement(<136206..>137423)
                     /gene="TDEL0D00750"
                     /locus_tag="TDEL_0D00750"
                     /db_xref="GeneID:11502094"
     mRNA            complement(<136206..>137423)
                     /gene="TDEL0D00750"
                     /locus_tag="TDEL_0D00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680822.1"
                     /db_xref="GeneID:11502094"
     CDS             complement(136206..137423)
                     /gene="TDEL0D00750"
                     /locus_tag="TDEL_0D00750"
                     /inference="similar to DNA sequence:INSDC:YLR449W,YML074C"
                     /note="similar to Saccharomyces cerevisiae FPR4 (YLR449W)
                     and FPR3 (YML074C); ancestral locus Anc_4.342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680870.1"
                     /db_xref="GeneID:11502094"
                     /db_xref="GOA:G8ZSR5"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /db_xref="InterPro:IPR026257"
                     /db_xref="UniProtKB/TrEMBL:G8ZSR5"
                     /translation="MSDLLPLATYNLNIEPYTPTPAIDVTRPVTVRITMAALNPEAYD
                     DEKKPSTLRIVKRNPDFDDEDDLLNGDYDEDEVDEEEEEDEEEEEEVKPKSKSNKKAE
                     EDDDDEDDEDEDDEDDEDDEFEEYILLTLSPKGQYQQAIDITIAPEEDIQFVVTGSYA
                     ISLTGNYIKHPFDAVNMDEDDEDDEEEQYYDSDEYDLTPDEDEIIDDELDDQLDDLED
                     ASDVEARVTELIEQETEDKKNKKNNKRKQEDKEVEPETKKSKKEKKEKKEKPVEKKKV
                     EFKKDLEEGPTKKSQEKPKTKVLEGGITIEDRTVGKGGQAKKSSKVGMRYIGKLKNGK
                     VFDKNTSGKPFVFKLGHGEVIKGWDIGVAGMAVGGERRIIIPAAYAYGKQALPGIPAN
                     SELTFDVKLVSLK"
     gene            complement(<137704..>140814)
                     /gene="TDEL0D00760"
                     /locus_tag="TDEL_0D00760"
                     /db_xref="GeneID:11502095"
     mRNA            complement(<137704..>140814)
                     /gene="TDEL0D00760"
                     /locus_tag="TDEL_0D00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680823.1"
                     /db_xref="GeneID:11502095"
     CDS             complement(137704..140814)
                     /gene="TDEL0D00760"
                     /locus_tag="TDEL_0D00760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680871.1"
                     /db_xref="GeneID:11502095"
                     /db_xref="GOA:G8ZSR6"
                     /db_xref="InterPro:IPR003100"
                     /db_xref="InterPro:IPR003165"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:G8ZSR6"
                     /translation="MQKTRHSSVDQPFNVEKRLDYGTKGTPVEVLTNHVRLSLGDDAP
                     GRKKVASDDAWWKTATIYTYHIDFIGKQNPAGRGPPQKGPPPAISKPKKYELLDDLFE
                     EDKTLAKYKDRIAFDGQDTLYSRVPLEEFSLFNGCWKVGKKKNSTAGAGKKGKSEIAE
                     ELVAQITLQFASKITLKDIYKATMSEDPEEQENKMSAADKTALLYLLGAKFLTSKDPI
                     FQMQGNKFFIFNEKAKSIPFQIGGFLICGFTISIVYSRGTVLLNAINVALPFYKHVKY
                     LPGDRKFKQNEKVRFTLMDWIIECYQQINGKGRGPKRTAEPSSKDLNLFLTKNMDIKN
                     LIKGLKVYRYYINYSVNSDGTPKPPSKMPAKGIVDFARETADSLKFKTLPSAMTKSAK
                     SVAGEKEITVNTTSYFAKKYNIKLKYPDVKMVSLGGKNIVPAECLTIVPGQKLKGQIY
                     DEKTMIDFTAIRPEEKFKLINNLALPPLTNALNSENKGKAGAVKFEFLKVPSRVIDAP
                     VVQYKKSNVTYIDAPFGTKSTNGKAPSEETKGKWNLTNHQFIHTSKDIYNLRPIFIND
                     SSREPPVTVLERLTASVKKFAKDAAAVDVNFDTSGRPILINEFSAPVRRRVDSGNEKG
                     RGRGRGAPRGRGRGRGGFGGGGGRPSFVYEITPGEQQLVQLLEKIPEKVYILLVLNRG
                     NDSAIYNRLKEIVDRRFGVLNSCVVWESFSKNSAQYNTNAVMKMNLKLQGTNHSLSDK
                     DLELLIDKESGLPFLVIAADVTHYPEKDQNSIAAMVGSYERTFSKFPGDYLLQDQPGE
                     EIISRIGEFVASRLDIYKANNKGKLPPKILYYRDGTSETQLSQVVKIEVKGLKEALRK
                     YGSRKKGAKKYDPPVTCVVVAKRNLVRFKPLHENATNAEGKTVAVQSMGNVMPGTVVD
                     REITSPAHFDFFLQSQQALAGTGVPCHYWCVYNENHFDSDYLQAISHALCYTFGRSST
                     SVKVVSPVYYADLLCTRAAQFFKANFEILSAEFQKERKNKDDVIVPTKLLPPVHKNIR
                     SVMYYI"
     gene            complement(<141176..>141869)
                     /gene="TDEL0D00770"
                     /locus_tag="TDEL_0D00770"
                     /db_xref="GeneID:11502096"
     mRNA            complement(join(<141176..141691,141855..>141869))
                     /gene="TDEL0D00770"
                     /locus_tag="TDEL_0D00770"
                     /product="60S ribosomal protein L6"
                     /transcript_id="XM_003680824.1"
                     /db_xref="GeneID:11502096"
     CDS             complement(join(141176..141691,141855..141869))
                     /gene="TDEL0D00770"
                     /locus_tag="TDEL_0D00770"
                     /inference="similar to DNA sequence:INSDC:YLR448W,YML073C"
                     /note="similar to Saccharomyces cerevisiae RPL6B (YLR448W)
                     and RPL6A (YML073C); ancestral locus Anc_4.341"
                     /codon_start=1
                     /product="60S ribosomal protein L6"
                     /protein_id="XP_003680872.1"
                     /db_xref="GeneID:11502096"
                     /db_xref="GOA:G8ZSR7"
                     /db_xref="InterPro:IPR000915"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:G8ZSR7"
                     /translation="MSAQAAPKWYPSEDVKVAKKTRKASRPQKLRASLVPGTVLILLA
                     GRFRGKRVVYLKNLEDNTLLVSGPFKVNGVPLRRVNARYVIATSTNVSLEGVNVEKFN
                     VEYFAREKLTKQQKKEANLFPEQQNREVKAERVEDQKSVDKALLAEIKKTPLLKQYLA
                     ASFSLKSGDKPHLLKF"
     gene            complement(<142296..>146939)
                     /gene="TDEL0D00780"
                     /locus_tag="TDEL_0D00780"
                     /db_xref="GeneID:11502097"
     mRNA            complement(<142296..>146939)
                     /gene="TDEL0D00780"
                     /locus_tag="TDEL_0D00780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680825.1"
                     /db_xref="GeneID:11502097"
     CDS             complement(142296..146939)
                     /gene="TDEL0D00780"
                     /locus_tag="TDEL_0D00780"
                     /inference="similar to DNA sequence:INSDC:YML072C"
                     /note="similar to Saccharomyces cerevisiae TCB3 (YML072C);
                     ancestral locus Anc_4.340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680873.1"
                     /db_xref="GeneID:11502097"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR017147"
                     /db_xref="UniProtKB/TrEMBL:G8ZSR8"
                     /translation="MDESTGHGREDQAYVPRKGNIHQKERGGLTKDMLDHYGDEMLDD
                     KSEEKDKMTNKKRAENNHDAGKAPSGKDVLVASSASNGSKMPAPNLQGTVGSVPLEHI
                     RPDDFKYAPPRKPNQYDTSMTLPGKLDTVTENKIKDAMNSHASDSLFPWMNVGEFNPS
                     RKKTSSVSDARVVKAYILENFYNDWYYNVSLISATCFFAWLLAYLRFSWWSLWFVFFC
                     SGSVFASEYRRYINCARDDLKRTTVEETLFQRTETTLWLNSFLSKFWVIYMPVLSQQV
                     KDIANPTLAGVAPGYGIDALSLDEFTLGTKSPSIKGIKSNTKGGKDVVEMIWSFAFTP
                     NDVSDMTQREAKQQIKPKVVLGVTLGKSFVSKTLPVIVEDINVAGKMRVVIKFGNAFP
                     DIKVVSVQLLEPPLMEFGLKPIGGDTLGLDVMSFLPGLKTFVKTMINANVGPMLYAPH
                     HLDIDVEELVASQANDAVGVLAVTVKSAKDLQSSDYVGGTVDPYICFKSEKPSPGAQT
                     DLRTTIKSDVKNPVWNETTYILLNDLNQKLTISCLDFNDLRKDTLIGNVEINLQDLLQ
                     NPVVEDASSDLLHGITTKGTLKYSMHWFPVVRDKNDEDADVVVSDNGARYNSQEDKEN
                     AEKEKKEAEEKEDEPIIDEPRKQLDEDEDEDEDEDTDAGIVKLTLQNIKNLIGTDTSS
                     GTLSPSAVLYIDGKEIKRFRTLKRIDEPSWNETVEVFVPSKGDSDLKLEVFDENFDNH
                     PLCTYAASLDEAINSLSLGRASVPGNPRGEIFMNLQWKPVHVTGAFAAGNAVKEPIGA
                     LRVHIRDAAVTSDLSGIGDIDPYFTLLVNGHINYKSSHFSENSSPLFNKVLYLPIVSE
                     NQNITLDLYDYQSVGKDRTIGGVKIPINRVIQLDAKTGKYRAIDKSDEVLKLQLKDRS
                     LKERGDYINVSLSFVPIVPVFSPEECTLMEKNEKELKERMSEFEKSQAKLKEEHKEKP
                     DDYEELEIDDPFEEEKERLNKKEKLTLEQLLERNSGVLTMQMFRGKLSKSPAHLQIYV
                     DEVPFPRYISPKSRDGRLPAASATVFIRDLKHSKITLRVSGSSIAKKPSDVVSEKTFD
                     TYKILKDSYVTGAKLSFNGCNVELSCLYVPTAVEIPSVDTYLDTGRLRLKVISAKDVL
                     AKDRNGYSDPFFEIYVDCSKVHKSEVIKKTLSPVWNETVELTVPSRDRDKVEIHLFDW
                     DRAGDNDDLGKVLLDLSSVKAGDTFNWELPIDTQGTLQLQGTFYPEYVKPPVNANQIK
                     KAGFASKTLGNISHAGVSTIKTGALGVTSVGMGVATGGIDKGARLLKKPFNRHDASKK
                     MKNLTKEQKNEEQNTDAEYRSLSFSEVRASLDADRTVPNNDYAPVQSLDPNTQLPASD
                     GPDARDSSNGNSSTQSYNQHTRNTSTASSFARTLAPNGTYRGSVTILATEQLGKNVQV
                     KVSLAQGGRLKQLYKTKNQKVDEKGIARFDETCAFKASPQANLVFGVTSHHKLTKDRE
                     IGIAQITLNDPQLQQGDQIAVKLAEGKVLFKIDYASEADHTPPVPSIPEHYKN"
     gene            complement(<147299..>148633)
                     /gene="TDEL0D00790"
                     /locus_tag="TDEL_0D00790"
                     /db_xref="GeneID:11502098"
     mRNA            complement(<147299..>148633)
                     /gene="TDEL0D00790"
                     /locus_tag="TDEL_0D00790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680826.1"
                     /db_xref="GeneID:11502098"
     CDS             complement(147299..148633)
                     /gene="TDEL0D00790"
                     /locus_tag="TDEL_0D00790"
                     /inference="similar to DNA sequence:INSDC:YML071C"
                     /note="similar to Saccharomyces cerevisiae COG8 (YML071C);
                     ancestral locus Anc_4.339"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680874.1"
                     /db_xref="GeneID:11502098"
                     /db_xref="GOA:G8ZSR9"
                     /db_xref="InterPro:IPR007255"
                     /db_xref="UniProtKB/TrEMBL:G8ZSR9"
                     /translation="MSMDLVLGSLLGADLVLEKAELQYCSGFLNHVLQSDTKSYEAYF
                     SSRPVNGSVVEHIAEIDAEISVVERKLRSLLVENKVDVVREVVNNEGAVEGKMTVIRQ
                     ELEQLWELDNGTDQRKEIDDFLETNDQVEEKQEDQFQNALKRLKSRILRNEQDGSTGG
                     LAIVLENLDKTTDLMELPFLARTCIRTGHYQEAVMLYTYSKSLLVKFPGSSIIEGIHR
                     NVAEETTTTMLTGLLRLLSTNLTANSLKKVLNYLASIPPFDDRDKSSLLQVYSYMRYN
                     FIQQEYSSYSFEVDQSNDALLEMIIKKRIEVLREHTHMSLSVFMEQHQFTTIPVAIPL
                     DKRLSKEPENENDTSMSENATDECETSPLMLQFVNQCVGYFLKELLDVHMQNKLSDSV
                     CLQLIYCSFRLRDLNPNYHHLFLNKICESNLFTAEQLKYAIDKRRELASKYS"
     gene            <148846..>149883
                     /gene="TDEL0D00800"
                     /locus_tag="TDEL_0D00800"
                     /db_xref="GeneID:11502099"
     mRNA            <148846..>149883
                     /gene="TDEL0D00800"
                     /locus_tag="TDEL_0D00800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680827.1"
                     /db_xref="GeneID:11502099"
     CDS             148846..149883
                     /gene="TDEL0D00800"
                     /locus_tag="TDEL_0D00800"
                     /inference="similar to DNA sequence:INSDC:YLR447C"
                     /note="similar to Saccharomyces cerevisiae VMA6 (YLR447C);
                     ancestral locus Anc_4.338"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680875.1"
                     /db_xref="GeneID:11502099"
                     /db_xref="GOA:G8ZSS0"
                     /db_xref="InterPro:IPR002843"
                     /db_xref="InterPro:IPR016727"
                     /db_xref="UniProtKB/TrEMBL:G8ZSS0"
                     /translation="MEGVYFNIDNGFIEGVVRGYRNGLLTGNQYINLTQCDTLEDLKL
                     QLSSTDYGNFLSSVPTEALTTSVIQESASDKLYQEFNYIRDQSSGKTKKFMDYITYGY
                     MIDNVALMITGTIHDRDKAEILQRCHPLGWFDTLPTLTVATDLESLYETVLVDTPLAP
                     YFRDCFDKADELDDLNIELVRNKLYKAYLEDFHSFISENVDQPACEVMQSLLEFEADR
                     RSINIALNSLQSPDIDPELKSELLPDLGKLYPLGTSHLAQASDFEAVRSAVNNVYDYR
                     GILESGNLEDHFYKLEMELCRDAFTQQFTVSTIWSWMKSKEQEVRNITWIAECIAQNQ
                     RERINNYISVY"
     gene            complement(<149946..>150536)
                     /gene="TDEL0D00810"
                     /locus_tag="TDEL_0D00810"
                     /db_xref="GeneID:11502100"
     mRNA            complement(<149946..>150536)
                     /gene="TDEL0D00810"
                     /locus_tag="TDEL_0D00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680828.1"
                     /db_xref="GeneID:11502100"
     CDS             complement(149946..150536)
                     /gene="TDEL0D00810"
                     /locus_tag="TDEL_0D00810"
                     /note="ancestral locus Anc_4.337"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680876.1"
                     /db_xref="GeneID:11502100"
                     /db_xref="GOA:G8ZSS1"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:G8ZSS1"
                     /translation="MSREQGHSTYKKTDESIYSAENEVETPIKFSALDILRILGGLVL
                     LYSVCCKFFSGKWFFLVSRSTSVIPDDLLSIPEYWLQRNATPITFTFDELSQYNGESD
                     SERILLSIKGHIFDVTRGSRFYGKWGAYKKFTGTDCSKLFSYPQWDMSVLGKKCSSDL
                     SDCTATELARVDSWLQFFRKKYPEIGYLRRSEPNRY"
     gene            complement(150692..150763)
                     /gene="TDEL0Dtrna1R"
                     /locus_tag="TDEL_0Dtrna1R"
                     /db_xref="GeneID:11502101"
     tRNA            complement(150692..150763)
                     /gene="TDEL0Dtrna1R"
                     /locus_tag="TDEL_0Dtrna1R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGA"
                     /db_xref="GeneID:11502101"
     gene            <151394..>153451
                     /gene="TDEL0D00820"
                     /locus_tag="TDEL_0D00820"
                     /db_xref="GeneID:11503631"
     mRNA            <151394..>153451
                     /gene="TDEL0D00820"
                     /locus_tag="TDEL_0D00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680829.1"
                     /db_xref="GeneID:11503631"
     CDS             151394..153451
                     /gene="TDEL0D00820"
                     /locus_tag="TDEL_0D00820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680877.1"
                     /db_xref="GeneID:11503631"
                     /db_xref="GOA:G8ZSS2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8ZSS2"
                     /translation="MGSYESKKRTRPCVSCKRQKLKCQYKESLPCERCIKHGMACYFP
                     TTQKQSATAKQSLHETVLPRYQSPPPLQSNPPEASVVPNTLPKPRIREAKSTTVLPSG
                     LPTSLLPNNGNLWAYSGEQRADFLQTALESMLTIFQHNQIQHEQQIKVLQNQVNQQNH
                     VVIRDQSRAGPSAVALPSVSEIIDNGGPKEQVTDFRKLGIISKTEAAELLHIFCTKMS
                     GHMFGYSSEELTLEELWDQSPLLLASICTVACPHHPLLQYKKTRLQESLRWLASELLN
                     HSDSIDSNVEHIILGLIIAFLWLESNQLYISVAIQLARMWRLDQQPDKNKESKLWRLW
                     YLLYIADGTQNLMSHKSPSIRKQTEPLIASVREMLVSNVEDPALQEVLKRNCMKGTTP
                     TTDQLHLLNEVEHSKIEVNPHTLQNMHLCGLVEYHMAIESLFHGGTIQDTLTSAHKLL
                     QPKNFGAPWETNMDLDKWMISWTITLQNIDVQNDAWCLKSTLLYYNFARMHINTRWLS
                     ERQASLENPDWLQIWSNASADRSALIDASHDISHSAAISLLKLATKDKDVSSLFQFLP
                     NHVYLMLFFASMIVLEAPSAYSLSDPSTIKRLQQGFKLVKTFRGMLASQTSSDAEFTR
                     KIDNSVQSLMAAFIDRCVQVTNSSKVNNRIEEIIQDPTDSLDSETTRKTISAWPSVNH
                     GHP"
     gene            <153636..>154685
                     /gene="TDEL0D00830"
                     /locus_tag="TDEL_0D00830"
                     /db_xref="GeneID:11502102"
     mRNA            <153636..>154685
                     /gene="TDEL0D00830"
                     /locus_tag="TDEL_0D00830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680830.1"
                     /db_xref="GeneID:11502102"
     CDS             153636..154685
                     /gene="TDEL0D00830"
                     /locus_tag="TDEL_0D00830"
                     /note="ancestral locus Anc_4.335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680878.1"
                     /db_xref="GeneID:11502102"
                     /db_xref="GOA:G8ZSS3"
                     /db_xref="InterPro:IPR004148"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:G8ZSS3"
                     /translation="MVPKMYGSPIQEPISGKVKSSQTSRALVRTRKIGSQKVDPKFNE
                     LQSKFRTIYANIEALYHSCEDYKTSVRSFFYNSINLIELFRLILEDATEDSHDCLTPG
                     SALESSPIPMCEERQRTTEILEYFYATSGLPSNQRDFCISKLSKQMYAIARRLDEDFK
                     FFDHGVQTPLKTVYQVCSNISRLITARNNASSEYMGMKERIAEYEYMMQNSHSRDNHN
                     FERLEYDEELKDARAKFEILNQLLKNNLEIFTELISKFMKEWFMVYYYSTLRITYALY
                     HFSWTSPEFKKIALKGLTSPHHELISNSHILAQFHAQNDVVTREVEKLNIVDFDRFYK
                     TSVETIDRIFMESFF"
     gene            <154967..>156724
                     /gene="TDEL0D00840"
                     /locus_tag="TDEL_0D00840"
                     /db_xref="GeneID:11502103"
     mRNA            <154967..>156724
                     /gene="TDEL0D00840"
                     /locus_tag="TDEL_0D00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680831.1"
                     /db_xref="GeneID:11502103"
     CDS             154967..156724
                     /gene="TDEL0D00840"
                     /locus_tag="TDEL_0D00840"
                     /inference="similar to DNA sequence:INSDC:YML070W"
                     /note="similar to Saccharomyces cerevisiae DAK1 (YML070W);
                     ancestral locus Anc_4.334"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680879.1"
                     /db_xref="GeneID:11502103"
                     /db_xref="GOA:G8ZSS4"
                     /db_xref="InterPro:IPR004006"
                     /db_xref="InterPro:IPR004007"
                     /db_xref="InterPro:IPR012734"
                     /db_xref="UniProtKB/TrEMBL:G8ZSS4"
                     /translation="MSAQVKSFEVSDALESSLRGFASANPSITLVPEEKVLFRKTEKK
                     NVALLSGGGCGHEPTHAGFVGKGMLGGAVCGDIFASPSTKQILNGIRLVSQSSSGVLL
                     IVKNYTGDVLHFGLSAERARALGIDCRVAVVGDDVAVGREKGGMVGRRALAGTVLVHK
                     IVGAFAEEHSEKYGVQGCEKVANIITNNLVTIGSSLDHCKVPGRKFESELNEKQMELG
                     MGIHNEPGVKVLEPIPSTEELISKHMLPKLLDPADKDRHFVDFDKDDKVVLLINNLGG
                     VSNLIISSIAAKTTDFLKKDYNITPAQTITGTLMTSFNQDGFSITLLNATKATKQLNK
                     EFKEVDCVFKLLNAPTTAPGWPIAPNSEEAPSYNKDLLKDEIKVKDAGSYDFDKFSKW
                     MQSGAEKLIKAEPHITSLDNKVGDGDCGYTLVAGAKGITENLDKLSKESLSEATAQIS
                     DFIESSMGGTSGGLYSILISGFSQGLIEACKDEKEPVTPELTAKAFDYALDTLYKYTR
                     ARPGSSTMIDALEPFIKEFSSSKDFSKAVKAAEEGAKSTATFEAKFGRASYVGDSSQV
                     EDPGAVGLVEFLKGVQSAL"
     gene            <156905..>158527
                     /gene="TDEL0D00850"
                     /locus_tag="TDEL_0D00850"
                     /db_xref="GeneID:11502104"
     mRNA            <156905..>158527
                     /gene="TDEL0D00850"
                     /locus_tag="TDEL_0D00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680832.1"
                     /db_xref="GeneID:11502104"
     CDS             156905..158527
                     /gene="TDEL0D00850"
                     /locus_tag="TDEL_0D00850"
                     /inference="similar to DNA sequence:INSDC:YML069W"
                     /note="similar to Saccharomyces cerevisiae POB3 (YML069W);
                     ancestral locus Anc_4.333"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680880.1"
                     /db_xref="GeneID:11502104"
                     /db_xref="GOA:G8ZSS5"
                     /db_xref="InterPro:IPR000969"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013719"
                     /db_xref="InterPro:IPR024954"
                     /db_xref="UniProtKB/TrEMBL:G8ZSS5"
                     /translation="MSTDFDRIYLNQSKFNGRFRIADSGLGWKATASGGSSANQAKAP
                     FLLPATELYTVQWSRGCRGYELKINTRNQGVVQLDGFSQEDFNLIKNDFHRRFNVQIE
                     LKEHSLRGWNWGKADLARNEMIFAVNGKPSFEVPYARINNTNLTSKNEVAIEFNIQDE
                     QYQPAGDEMVEMRFYIPGQVEDENEDEMPKKEDGEDVEMTKEPKEKKTMAEAFHEELK
                     EKADVGEVAGDSIVSFQDVFFATPRGRYDIDIYKNSIRLRGKTYEYKLQHRQIQRIVS
                     LPKADDIHHLIVLSIEPPLRQGQTTYPFLVMQFQKDEETEVQLNLEDEDFDANYKEKL
                     MKQYDAKTHIVISHVLKGLTGKRVIVPGAYKSKYDQCAVSCSYKANEGYLYPLDNAFF
                     FLTKPTLYIPFSDVSSVNISRAGQTSTSSKTFDLEILLRSNRGSTTFANISKEEQQLL
                     EQFLKSKNLRVKNEDKEAQERLQSALGSDSDDEDVIMGSAAEDEESFDEEFHASSEDD
                     DIAEEFNSDAASSDEEGEGSGSERPSKKAKVE"
     gene            <158917..>160293
                     /gene="TDEL0D00860"
                     /locus_tag="TDEL_0D00860"
                     /db_xref="GeneID:11502105"
     mRNA            <158917..>160293
                     /gene="TDEL0D00860"
                     /locus_tag="TDEL_0D00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680833.1"
                     /db_xref="GeneID:11502105"
     CDS             158917..160293
                     /gene="TDEL0D00860"
                     /locus_tag="TDEL_0D00860"
                     /inference="similar to DNA sequence:INSDC:YML068W"
                     /note="similar to Saccharomyces cerevisiae ITT1 (YML068W);
                     ancestral locus Anc_4.332"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680881.1"
                     /db_xref="GeneID:11502105"
                     /db_xref="GOA:G8ZSS6"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002867"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G8ZSS6"
                     /translation="MGERANLTDDLKILRDMYPEMKTCNDSHNEIMDSSKVTGILPFK
                     VSLPEDITVTYNDQRLVLSELTEDSLKFTIDSTLYPDLRRGIKFTIESQWMSQRDQEK
                     IRDAIYQEFGVFTDSSLDTFEPSTPTLMLLFGFLTSDIAKELFDCNERHCNSQEEFKL
                     FAAISSVIEREKMERSNFDCCICMETKKGSKMIALPCGHLLCLLCTKSYFKALIEEGN
                     LTRVRCPECEYQELDLNKLQSYSEIKKVIFEPTIPLDFFKGILCDEICLRYADLFYSQ
                     AASKLSQHCLYACVTCRRCNKWCVKEDLNDSMIECKSCEYVFCFDCLHSWHGYVNRCG
                     KKVEMPRNVIEEYVELMDTVSERKRALEAKYGKKIIEHEAKDFLAERMLDLAVEEEGS
                     DLQRCPKCRTVVQRSEGCNKMKCAICDTMFCYLCAVDLYPEDPYAHFKNPKSGCYARL
                     FEGMPGAS"
     gene            complement(<160357..>160920)
                     /gene="TDEL0D00870"
                     /locus_tag="TDEL_0D00870"
                     /db_xref="GeneID:11502106"
     mRNA            complement(<160357..>160920)
                     /gene="TDEL0D00870"
                     /locus_tag="TDEL_0D00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680834.1"
                     /db_xref="GeneID:11502106"
     CDS             complement(160357..160920)
                     /gene="TDEL0D00870"
                     /locus_tag="TDEL_0D00870"
                     /inference="similar to DNA sequence:INSDC:YLR445W"
                     /note="similar to Saccharomyces cerevisiae YLR445W;
                     ancestral locus Anc_4.331"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680882.1"
                     /db_xref="GeneID:11502106"
                     /db_xref="UniProtKB/TrEMBL:G8ZSS7"
                     /translation="MDGKSSSQKQVSLKRSGVEVPRLSELAAEWQTKKYGEQIQDQVL
                     KDKILIRIKEATALIKDSASKQEGVGGDHVYRMEWDQLYDISANVMDEYTKNVDTILT
                     QLDQLYRVCIKHLLETQHYVLLTLQEIILVARSVFLKDSQTGATVVGRAEEWMKLKEH
                     QLDRKGAELDRSASAIKCAIERLTAKD"
     gene            complement(<160996..>162108)
                     /gene="TDEL0D00880"
                     /locus_tag="TDEL_0D00880"
                     /db_xref="GeneID:11502107"
     mRNA            complement(join(<160996..162011,162078..>162108))
                     /gene="TDEL0D00880"
                     /locus_tag="TDEL_0D00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680835.1"
                     /db_xref="GeneID:11502107"
     CDS             complement(join(160996..162011,162078..162108))
                     /gene="TDEL0D00880"
                     /locus_tag="TDEL_0D00880"
                     /inference="similar to DNA sequence:INSDC:YML067C"
                     /note="similar to Saccharomyces cerevisiae ERV41
                     (YML067C); ancestral locus Anc_4.330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680883.1"
                     /db_xref="GeneID:11502107"
                     /db_xref="InterPro:IPR012936"
                     /db_xref="UniProtKB/TrEMBL:G8ZSS8"
                     /translation="MAGLRSFDAFPKTDETHQQRSFKGGLSSVMTYLFLLFMCWTEFG
                     SYFGGYVDQQYKVDGEVRETFQINMDMYVNMPCNLLHINVRDKTMDRKVVSKELSMQN
                     MPFFVPYGTMVNDMKKIATPDLDEILGEAIPAQFRERMDPSVLEASLGSDVTFDGCHI
                     YGSVPVNRVAGELQITAKGWGYQDFEKAPVSEINFSHVINEFSYGDFFPYIDNPLDNT
                     AKISIVDRLMGYLYDTSIVPTVYEKLGAYVDTNQYAVSERQFDQKSTKRGSTTVPGIF
                     FRYDFEPLSISIKDRRLSFIQFIIRLVALLSFVVYIASWTFRMVDLTLITVMGPKWSL
                     RYQPNSDSKGLLER"
     gene            complement(<162248..>163315)
                     /gene="TDEL0D00890"
                     /locus_tag="TDEL_0D00890"
                     /db_xref="GeneID:11502108"
     mRNA            complement(<162248..>163315)
                     /gene="TDEL0D00890"
                     /locus_tag="TDEL_0D00890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680836.1"
                     /db_xref="GeneID:11502108"
     CDS             complement(162248..163315)
                     /gene="TDEL0D00890"
                     /locus_tag="TDEL_0D00890"
                     /inference="similar to DNA sequence:INSDC:YML066C"
                     /note="similar to Saccharomyces cerevisiae SMA2 (YML066C);
                     ancestral locus Anc_4.329"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680884.1"
                     /db_xref="GeneID:11502108"
                     /db_xref="UniProtKB/TrEMBL:G8ZSS9"
                     /translation="MLIFKRLIVWIILFVIALTQLLLYIPNFSCRGSSACLDQFNFSI
                     IGSSSVTQDFINSIKEFLKLLSYLAIDMGWSRDLTDSDIYREEKLVDTFDSENVYKVN
                     YFGYCKKRHGERLYCVQNWGSGMDVLGILVRDIGIQLGMLSASHQNDTRLLGDSMVLT
                     YHLALSSLRRFLRGDQGNALSKLVISKDDYASSKSDAKTSRYSKGVDMAYLLKVANKF
                     LLLIELCELSTSLLFLTAVICFGIALSMGIKLRIIPLVLKIMISALASLATITFTGTI
                     IYFLALRSLQPSKDPLQSSTKWDIIKINLGPGFIIGCIRYAIQIILIPLAFLIARHYS
                     AREKETKEAKIEPPGFQNDWL"
     gene            complement(<163477..>164703)
                     /gene="TDEL0D00900"
                     /locus_tag="TDEL_0D00900"
                     /db_xref="GeneID:11502109"
     mRNA            complement(<163477..>164703)
                     /gene="TDEL0D00900"
                     /locus_tag="TDEL_0D00900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680837.1"
                     /db_xref="GeneID:11502109"
     CDS             complement(163477..164703)
                     /gene="TDEL0D00900"
                     /locus_tag="TDEL_0D00900"
                     /inference="similar to DNA sequence:INSDC:YLR443W"
                     /note="similar to Saccharomyces cerevisiae ECM7 (YLR443W);
                     ancestral locus Anc_4.328"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680885.1"
                     /db_xref="GeneID:11502109"
                     /db_xref="UniProtKB/TrEMBL:G8ZST0"
                     /translation="MRIGRILRFAEDLTAFETLVLWIRLISSALIIALGLAITIGPVT
                     APRTFRVAKFGTKSTDIIGGLFKELKEAVEVYGSTDVNNGVGLTTSEIFILTAYTASQ
                     INDVPQYIAVSIYGRCDISFNTTQALNKKGEVVEVRNSSMVEVCHRTGRDYVFDYREV
                     LSQLGMDIVLVYAYDQEVSAPLGLSNTYNEYMKELRRKKVNMANLLISALVLEGAILI
                     LTLWYYTIKGRLINPLKERILGHTISLLSLVVFILGLTGTISLAWLALKLKNRIITEL
                     SVYGFTYGLGFTWFTCLWLFAFGILVSTLAWSGLEWCMSDVQQPYNDGTQNNILRYQT
                     GVFTDAGDASSNNLSDDGESSDNHLRLTRSGGRNASVDSDSAEEVELQDIALYSSDDS
                     DVNFKRTLNPSSTMYF"
     gene            <164983..>167841
                     /gene="TDEL0D00910"
                     /locus_tag="TDEL_0D00910"
                     /db_xref="GeneID:11502110"
     mRNA            <164983..>167841
                     /gene="TDEL0D00910"
                     /locus_tag="TDEL_0D00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680838.1"
                     /db_xref="GeneID:11502110"
     CDS             164983..167841
                     /gene="TDEL0D00910"
                     /locus_tag="TDEL_0D00910"
                     /inference="similar to DNA sequence:INSDC:YLR442C,YML065W"
                     /note="similar to Saccharomyces cerevisiae SIR3 (YLR442C)
                     and ORC1 (YML065W); ancestral locus Anc_4.327"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680886.1"
                     /db_xref="GeneID:11502110"
                     /db_xref="GOA:G8ZST1"
                     /db_xref="InterPro:IPR001025"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZST1"
                     /translation="MANTQRDLNGWQVVTTDEHGNIIGDDRRRSRKRGGAELAFLQRL
                     NDGLTFGRGDSVIMKDPATGSYSVYLIHEIRLNTLNNIVELWAFSYLRWFELQPQFYY
                     AKFEPELAAENRPPEFYRDKLVNEIDKGEIYLTAELSEIWLKDFLAVANIMDEAKRKE
                     VGEKFEEDKDFLVRYICEPTGENFAPFNIAKERKLLLNSDPKGFEEHLKRLSVPKSLN
                     SQRKSSHRRKHGANGKGAPSSSDIKLEPDTDSASEDSDDAWEANVSKVVKPSKSPEVV
                     SYKEESDSSPDTSSSPSSGAYDDAQETSESSPVLVSRESKEREENGKKKAQVVPDVSS
                     TEESANDEEKEPEFEPHLVERLSSEPSLTESDYNSSSGGEQDVPLSQVTSKRQKPKKE
                     QTIKKKRKVEVTPTPDSRSSVASNSLARKFTKRNVVRAKKKYTPFSKRFKSVNDIPDL
                     TELAEFNQMNDGLDVAALENKLRTPKKHEVVETIFSKIKKQLYSSHDREEIMKSESFQ
                     DFLPARENEFASIYLSIYSAIESGSATTVYVAGTPGVGKTLTVKEVIKELQRSSDQNE
                     LPLFQFVEINGLKMVKPTDSYEFLWNKIMGESLTWGAAMESLEFYFNKVPRNKKRPVV
                     VLLDELDALVNKTQDIMYNFFNWTTYENAKLIVIAVANTMDLPERQLGNKVSSRIGFT
                     RIMFTGYTYEELKKIIEFRLKGMNNSFFYEDTKTGSAYIMEDVQEEELPSHIKKVQLR
                     MTDDAIEIASRKVASVSGDARRALKVCKRAAEIAEQHYMAKHGYSYDGQQTSKSDIDD
                     AEDANDQEGVQTVHISHIMRALNETTNSQSTRFISRLSFTGKLFLYALLKLMKKTGLQ
                     EQQLGDIIDEIRLLIEANAKNKFVEEISRVLFHQGSDVTPEQLRIVSWDFVINQMIEA
                     GIIIKQSMKNEKISCVKLNISSEDVKKALEQDESLKGL"
     gene            complement(<167879..>168568)
                     /gene="TDEL0D00920"
                     /locus_tag="TDEL_0D00920"
                     /db_xref="GeneID:11502111"
     mRNA            complement(<167879..>168568)
                     /gene="TDEL0D00920"
                     /locus_tag="TDEL_0D00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680839.1"
                     /db_xref="GeneID:11502111"
     CDS             complement(167879..168568)
                     /gene="TDEL0D00920"
                     /locus_tag="TDEL_0D00920"
                     /inference="similar to DNA sequence:INSDC:YML064C"
                     /note="similar to Saccharomyces cerevisiae TEM1 (YML064C);
                     ancestral locus Anc_4.326"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680887.1"
                     /db_xref="GeneID:11502111"
                     /db_xref="GOA:G8ZST2"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR017231"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZST2"
                     /translation="MSEAQEQQELPKAKNRVDVQVGLVGDAQVGKTSLMVKYVQNVFD
                     EEYTQTLGVNFLKRKVSIRSTDIVFSLMDLGGQREFINMLPIASLGSSAIVFLFDLTR
                     PETLSSIKEWYRQAHGLNETAVPLLVGTKYDLFVDLDPEYQEQLSRTSMEYAQVMDAP
                     LIFCSTAKSINVQKIFKIALAKIFKLTLTVQEINDVGDPLLIYRHLGNQRHDSDEVSR
                     RSSPSTRSSTS"
     gene            <169201..>169968
                     /gene="TDEL0D00930"
                     /locus_tag="TDEL_0D00930"
                     /db_xref="GeneID:11502112"
     mRNA            <169201..>169968
                     /gene="TDEL0D00930"
                     /locus_tag="TDEL_0D00930"
                     /product="40S ribosomal protein S1"
                     /transcript_id="XM_003680840.1"
                     /db_xref="GeneID:11502112"
     CDS             169201..169968
                     /gene="TDEL0D00930"
                     /locus_tag="TDEL_0D00930"
                     /inference="similar to DNA sequence:INSDC:YLR441C,YML063W"
                     /note="similar to Saccharomyces cerevisiae RPS1A (YLR441C)
                     and RPS1B (YML063W); ancestral locus Anc_4.325"
                     /codon_start=1
                     /product="40S ribosomal protein S1"
                     /protein_id="XP_003680888.1"
                     /db_xref="GeneID:11502112"
                     /db_xref="GOA:G8ZST3"
                     /db_xref="InterPro:IPR001593"
                     /db_xref="InterPro:IPR018281"
                     /db_xref="InterPro:IPR027500"
                     /db_xref="UniProtKB/TrEMBL:G8ZST3"
                     /translation="MAVGKNKRLSKGKKGLKKKVVDPFTKKEWYDIKAPSTFKNRNVG
                     KTLVNKSTGLKSASDALKGRVVEVCLADLQGSEDHSFRKVKLRVDEVQGKNLLTNFHG
                     MDFTTDKLRSMVRKWQTLIEANVTVKTSDEYILRVFAIAFTRKQANQVKRTCYAQSSH
                     IRAIRKVISEILTREVQNSTLAQLTSKLIPEVINKEIENATKDIFPLQNVHIRKVKLL
                     KQPKFDLGSLMTLHGEGADEETGKKVSGFKDEILETV"
     gene            complement(<170061..>171107)
                     /gene="TDEL0D00940"
                     /locus_tag="TDEL_0D00940"
                     /db_xref="GeneID:11502113"
     mRNA            complement(<170061..>171107)
                     /gene="TDEL0D00940"
                     /locus_tag="TDEL_0D00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680841.1"
                     /db_xref="GeneID:11502113"
     CDS             complement(170061..171107)
                     /gene="TDEL0D00940"
                     /locus_tag="TDEL_0D00940"
                     /inference="similar to DNA sequence:INSDC:YML062C"
                     /note="similar to Saccharomyces cerevisiae MFT1 (YML062C);
                     ancestral locus Anc_4.324"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680889.1"
                     /db_xref="GeneID:11502113"
                     /db_xref="GOA:G8ZST4"
                     /db_xref="InterPro:IPR008501"
                     /db_xref="UniProtKB/TrEMBL:G8ZST4"
                     /translation="MTSTNPLQTEQVRNKVLYSEVDVQHNGYLEALGKVTKLAKSILN
                     SGLQSYEAQENVQFGIEHVQELEQNASLKFMEYQSSLDVKKLAQENWEQSNHETIDTM
                     ETNMPSMISDLRSAHESLQERIERVRVLYDSVTKVNTEAENLLEGNTSLTATLSEWEE
                     ELGAPLTDKLIKKGYLREAGTSGGEQRYRAYDNFTKGPKELKHMNQSIKEDISRLTNE
                     LGSYKEKWLQDAEIFTRITSVLKEELIKRDMNVDIDMEEEEEEDEEEEEEDDEEEEGH
                     EQEQEEEIEEEEDENDDEEQEEDYDENLHDDEPVEEGINEDNPVRDTISHNEPVADEG
                     MTEDAGVINDIENR"
     gene            <171275..>173329
                     /gene="TDEL0D00950"
                     /locus_tag="TDEL_0D00950"
                     /db_xref="GeneID:11502114"
     mRNA            <171275..>173329
                     /gene="TDEL0D00950"
                     /locus_tag="TDEL_0D00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680842.1"
                     /db_xref="GeneID:11502114"
     CDS             171275..173329
                     /gene="TDEL0D00950"
                     /locus_tag="TDEL_0D00950"
                     /inference="similar to DNA sequence:INSDC:YLR440C"
                     /note="similar to Saccharomyces cerevisiae SEC39
                     (YLR440C); ancestral locus Anc_4.323"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680890.1"
                     /db_xref="GeneID:11502114"
                     /db_xref="InterPro:IPR013244"
                     /db_xref="UniProtKB/TrEMBL:G8ZST5"
                     /translation="MLEHQLYLLASVFATRRDAEHLKRLLIHYEARQELYDAVCVLWP
                     EMDDPAHLRFLFDSKCDEDLNGQDLLVQLVGADDNLIPIVEMDHNTILERTTVTKQYV
                     KSRLADLKDDERHQLTNIEAKWMRRRMLLCNRFKPQHAALYKPLWDLVEKDSVFLAWI
                     HGIIEPLEHINKRLGRSTSIEEFEQMEPSQVFEIILKSETEFHTTVINREIIPFLTNN
                     NLYNLFLDRVFSKNNFPLNSACNLRIFHHLLTELRHSFKEAQYDSQIQSRAAEIIFEN
                     SSNVLITSGSSELSNLLSSIDDNIQVENYTIKVTRLKHYAECIQSVYKRYNLEELYSI
                     SQEGEESQLAQFSSVVREQMLSNNTNRNIADTISLIMDVMGSEDATVFTCLSSTQKAS
                     AFIETALELGKFDLLNEFLVKFNSNVEEDVLVKYFWHFFNKASNGLSTRPEMRNAQKT
                     LKLLNTRSNHKYNHMTALLEVANELSKYSLNLGKGVPFKPSDILDFSSRPLELISLLL
                     ELNPDLYTDIWKTVGIFKKLKMGLQNTTLSSEPSDEEYASILALHIDHSLANMDFNFA
                     LDKTKKLLKLDHISKHWPTIFQVGKFIDPLWPDGEAPVDILAVQMDILGDLLHVCPVE
                     ESEAIVSQWSALELELITRDPINAQYSEDGLGESSNSSQANVLLNGVSSKFTSLLSGS
                     RR"
     gene            complement(<173404..>176253)
                     /gene="TDEL0D00960"
                     /locus_tag="TDEL_0D00960"
                     /db_xref="GeneID:11502115"
     mRNA            complement(<173404..>176253)
                     /gene="TDEL0D00960"
                     /locus_tag="TDEL_0D00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680843.1"
                     /db_xref="GeneID:11502115"
     CDS             complement(173404..176253)
                     /gene="TDEL0D00960"
                     /locus_tag="TDEL_0D00960"
                     /inference="similar to DNA sequence:INSDC:YML061C"
                     /note="similar to Saccharomyces cerevisiae PIF1 (YML061C);
                     ancestral locus Anc_4.322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680891.1"
                     /db_xref="GeneID:11502115"
                     /db_xref="GOA:G8ZST6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010285"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZST6"
                     /translation="MFLWLQSSRKAALLNHKIKVTAGRNILPGRRTVMTIRRLSKSSS
                     SVQRTLKTSRKEIHTPRNDYDELNDLLSDSDGWEDDIHVERVTPVIKNGVQSSSAKVR
                     NEFSDADDSMICELLQSKKIGKSLAGASSEPFRHYPPRNSFSSHTSDGLRRPIVESTQ
                     QGDLYATEDSRLLLSLLRGEDSSRISENHNAISKGNTTKSELEQAGVSLTLGTKDLEE
                     NFLLGELDEREVAQNIPESGTVLLNDIRNEDQVKIALEEVQDVKPSNVSRSIDIVSEP
                     EGDRSFEIVEEPERVQYAEKFALLTQRPGLQSTQELEKRLKLNPKVKIIVPVRLSKEQ
                     EDVLRLAEAGHNIFYTGSAGSGKSVLLRELIKILKKKYGDDQVAVTASTGLAACNIGG
                     VTVHSFAGVGLGNGEVTKLYRKVRRSRKHMKRWESVSALVIDEISMVDGELLDKMDFI
                     AQKIRKNRKPFGDIQLIFCGDFFQLPPVSKDNNNPTKFAFESSLWKEGIDMTILLTKV
                     FRQQGDTKFIEMLNKMRLGQIDAETEREFKKLNRPLPQDEIIPAELYSTRSEVERANY
                     SRLSRLPGKAHIFHAIDGGALEDRELREKLLQNFLAPKELQLKIGAQVMMIKNIDATL
                     VNGSLGKVIDFIDPETYMFYETIIRNPDLPAESLTKLKDNPELLKETWAAYCEDEDND
                     TPVRQKTIKDAFCKNDPEESVAQLGESIFDFLKDQSTDDSETRENLERKRELLRQVHE
                     SSKAKRKLPLVRFKTSDLSTRTILVEPESWAIEDDNEKSLVSRVQLPLMLAWSLSIHK
                     SQGQTLPKVKVDLRRVFEKGQAYVALSRAVSREGLQVLNFDKSRIKAHQKVVDFYSTL
                     VTAEHAIKQLDPKVTTSENNKRRKTEPEPNVVLNQRRTRQARSRSKSQNAQSGIAAML
                     LQRANGNQTNVRRNRSLAENLATIDSTEESDRHAL"
     gene            <176595..>177758
                     /gene="TDEL0D00970"
                     /locus_tag="TDEL_0D00970"
                     /db_xref="GeneID:11502116"
     mRNA            <176595..>177758
                     /gene="TDEL0D00970"
                     /locus_tag="TDEL_0D00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680844.1"
                     /db_xref="GeneID:11502116"
     CDS             176595..177758
                     /gene="TDEL0D00970"
                     /locus_tag="TDEL_0D00970"
                     /inference="similar to DNA sequence:INSDC:YML060W"
                     /note="similar to Saccharomyces cerevisiae OGG1 (YML060W);
                     ancestral locus Anc_4.321"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680892.1"
                     /db_xref="GeneID:11502116"
                     /db_xref="GOA:G8ZST7"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR012904"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:G8ZST7"
                     /translation="MSKFAQINIANGELYLENVLQAGQAFRWVLNEVKNHYSSTMKIG
                     SKGRYSVVILRQPSPEVLEYASLDNTCDLKVLKEHLVKYFRLEVSLHDLHSKQWLPND
                     SRFEDFKPKGVRMLGQEPWETLVSFICSSNNNISRITKMCHGLSTNYGNKLGTFDSLD
                     YFSFPTSDEIANKASEEQLRELGFGYRAKYIMETAKQMVQDKKEKGFTDDTQFLEYLR
                     SHMTYEQMREHLMTYTGVGPKVADCICLMGLRMDEVVPVDVHVGRIAKRDYQFQAKKS
                     DIKDLAERYRSMPITRKKINFELDLIRLMFLKKWGPYAGWAQGVLFSNEIGKTSGVTS
                     SGVIKRRKLEVKVEVNNDVVNEVVTEEEVQYSNTGRPKRKVVSELKVEAYADV"
     gene            complement(<177812..>178765)
                     /gene="TDEL0D00980"
                     /locus_tag="TDEL_0D00980"
                     /db_xref="GeneID:11502117"
     mRNA            complement(<177812..>178765)
                     /gene="TDEL0D00980"
                     /locus_tag="TDEL_0D00980"
                     /product="mitochondrial 54S ribosomal protein YmL4"
                     /transcript_id="XM_003680845.1"
                     /db_xref="GeneID:11502117"
     CDS             complement(177812..178765)
                     /gene="TDEL0D00980"
                     /locus_tag="TDEL_0D00980"
                     /inference="similar to DNA sequence:INSDC:YLR439W"
                     /note="similar to Saccharomyces cerevisiae MRPL4
                     (YLR439W); ancestral locus Anc_4.320"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL4"
                     /protein_id="XP_003680893.1"
                     /db_xref="GeneID:11502117"
                     /db_xref="GOA:G8ZST8"
                     /db_xref="InterPro:IPR010729"
                     /db_xref="UniProtKB/TrEMBL:G8ZST8"
                     /translation="MLCKRTFQTAAKACARTRYTKPKPKPQPRERVNLPSQRTHHDND
                     LIISAPVPPTVENIKCPDDHPLWQFFADKKFMRTSEELDSQSRSWTIPELRRKSFDDL
                     HSLWFTCLKERNILARENHLLKNNVEGFQDNYQDVSEKIRTTMWRIRHVLSERDWAFK
                     IAKEEFASEREAFTAVFEKEFLEAPAEEDEESFEKLSRFQHSVFGISEFIDDNVVNRT
                     FVDGLKLVANLKVRKFASRDTTIQKFLEETRSQTITDAGESFVLFTAENNVNDIKEAC
                     QAVEELRKSGNSVSKYVELDTVAKYIRQLAQAQTSKETTAH"
     gene            <179089..>179346
                     /gene="TDEL0D00990"
                     /locus_tag="TDEL_0D00990"
                     /db_xref="GeneID:11502118"
     mRNA            <179089..>179346
                     /gene="TDEL0D00990"
                     /locus_tag="TDEL_0D00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680846.1"
                     /db_xref="GeneID:11502118"
     CDS             179089..179346
                     /gene="TDEL0D00990"
                     /locus_tag="TDEL_0D00990"
                     /inference="similar to DNA sequence:INSDC:YLR438C-A"
                     /note="similar to Saccharomyces cerevisiae LSM3
                     (YLR438C-A); ancestral locus Anc_4.319"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680894.1"
                     /db_xref="GeneID:11502118"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:G8ZST9"
                     /translation="MSLETPLDLLKLNLDERVYVKLRGARELIGTLQAFDSHCNIVLS
                     DAVETIYQLESGELKSTEKNSEMIFVRGDSVTLITTPPDDE"
     gene            complement(<179414..>184342)
                     /gene="TDEL0D01000"
                     /locus_tag="TDEL_0D01000"
                     /db_xref="GeneID:11502119"
     mRNA            complement(<179414..>184342)
                     /gene="TDEL0D01000"
                     /locus_tag="TDEL_0D01000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680847.1"
                     /db_xref="GeneID:11502119"
     CDS             complement(179414..184342)
                     /gene="TDEL0D01000"
                     /locus_tag="TDEL_0D01000"
                     /inference="similar to DNA sequence:INSDC:YML059C"
                     /note="similar to Saccharomyces cerevisiae NTE1 (YML059C);
                     ancestral locus Anc_4.318"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680895.1"
                     /db_xref="GeneID:11502119"
                     /db_xref="GOA:G8ZSU0"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR001423"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:G8ZSU0"
                     /translation="MNSQVSSNDSRRSSEPQLPQLPQQLNVSHNNEGWMAALFNFTWV
                     ISYFLVGTTVFITKWSTYLMTLCLLRVPRWVFIKTNKQHLTISFPTFLVLATLTAYVI
                     YCIMKGNVFAQYKRLIPDEAEDELNPELLKKSSILRNSQSKSTNKLIEGKERTGNKYS
                     GYGDPDDDSYRTSHLDQFLSAIKIFGYLEKPVFHDLTKNMRTQKMDEGEILLLDSSIG
                     FAIVVEGTLQIYHKVEQEDTLDGDKNVSSKNDEGFETLECLKDTESPIDYSHIEDFDD
                     FTNDEQTDASAYIRLKNGFGKFQLLNTVKPGNPVSSLVNILNLFTEPSRNMDWENLAS
                     RSPSVDVSAFPSPFNTFSANMKDELPVENHSNLSSVASPSSLNHCTTPDNLEISDDNL
                     PSVAIPKVVARAATDCTIAIIPPQAFANLTAKYPQSASHIIQMILTRLYRVTFQTAND
                     YLGLTKEIMDMEVLLNKTVSYDLPFYLKEAVVRMADDEHSSDGLDIKSSLNLDNRESS
                     SLAKESRANVSKTVERPKLRSPNNYASTASLRGSRHVVLGSRDHLNPGDLLSSVPLSR
                     KESSGTGGSKVQDKLVTPISSPLSPKNYQNSASLYSKTSNQASHYSTTSSMLSRGVNS
                     LANKRPSNNGSSTSGFHPALRDEDLKTRSFSAAQEETEESSLRMALVEAMFTYLGISR
                     ENMVAPPTPPSTSIDGESSSRNPSSTNLRHNSIMTSSGLFLTPYATPSSTSATSANLR
                     ILPSDYAITSQKQKPKKRKVYREEVSPNLDYESAKSEFSQGIEVQFFKQGSVLVEQNS
                     KGKGLFYVISGKIDVTVYSRRPERKINSNRRDKAEDHKVENLLFTVGAGGVAGYLSSL
                     IGYKSFVNLKARTDVCLGFLPNRVLERLCSKYFMIYLRIAETLTSLLSPKMLKFDYAV
                     EWIQLSASDTLFKQGDPANGIYLVLNGRLRQLQRKEEEKSADDEANLYERDDTDGGDT
                     DRLETTGELAQGESFGEVEVLTAMDRVGTIVAVRDSELARIPRSLFELLALEHPSIMI
                     RVSRLVARKILSNGNGQSGSSKNDKGPNFDFSDPISQTRPTNVNYNHNSPQHHTTPGT
                     ITYRTLTILPITSGLPVEEVAMKLVHAFKQVGRSTIGLNQRTALTHLGRHAFDRLAKL
                     KKSGYFAELEEMYETVVYIADTPVNSSWTKTCIAQADCVLLLANAAASPEIGEYEKLL
                     LNSRTTARTELIMLHSDRFVDPGSTHKWLRYRNWVDSHHHIQFAVDPLGVEGDTKHAG
                     LNSGAFGLMDKLIQGEFSKKTQQNISKLVPDSIKSRMENFSSKFSDRKRHYYSPAHKN
                     DFLRLARILSGQAIGLVLGGGGARGISHLGFLQAIEEQGIPIDMIGGTSIGSFIGGLY
                     AKDYDLVPIYGRVKKFAGRIASIWRMMTDLTWPVTSYTTGHEFNRGVWKAFGDARIED
                     FWLQYYCNSTNITESVQEIHSFGYAWRYIRASMSLAGLLPPLEDRGSMLLDGGYLDNL
                     PVWEMKARGCNTIFAVDVGSVDDRSPMDYGDSLNGFWIVLNRWNPFSAHPNIPNMAEI
                     QMRLGYVASVNALERAKRTPGVLYARPPIEEYATLDFGKFREIYEIGAQYGHVFLDEL
                     QRQNKMPYIPGSKTNALEEDVPEFLLHRRNSI"
     gene            complement(<184494..>185792)
                     /gene="TDEL0D01010"
                     /locus_tag="TDEL_0D01010"
                     /db_xref="GeneID:11502120"
     mRNA            complement(<184494..>185792)
                     /gene="TDEL0D01010"
                     /locus_tag="TDEL_0D01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680848.1"
                     /db_xref="GeneID:11502120"
     CDS             complement(184494..185792)
                     /gene="TDEL0D01010"
                     /locus_tag="TDEL_0D01010"
                     /inference="similar to DNA sequence:INSDC:YLR438W"
                     /note="similar to Saccharomyces cerevisiae CAR2 (YLR438W);
                     ancestral locus Anc_4.317"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680896.1"
                     /db_xref="GeneID:11502120"
                     /db_xref="GOA:G8ZSU1"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR010164"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8ZSU1"
                     /translation="MSTANLSSKQTVEYEQKYSAHNYHPLPVVFHKASGAHVWDPEGK
                     EYLDFLSAYSAVNQGHCHPKIIEALVDQASKLTLSSRAFSNDSFAEFAKYITEYFNYE
                     MVLPMNTGAEAVESALKLARRWGYETKKIPEGQAIVLGAEGNFHGRTFGAISLSTDEE
                     DSRKNFGPFLVNTTSESPATKRKVRYGVVEDIEAAFKSHGDKIAAIILEPIQGEAGIV
                     VPPTDYLTKVQKLCREYNVLFICDEIQTGVGRTGKMLCYEHSPDVKPDVVLLGKAISG
                     GVYPVSCVLSSKEIMLTLAPGSHGSTYGGNPLASRVAIAALKVVKDEKLVERAQELGE
                     LLQKELEALQKESNGAISEVRGRGLLTAIVIDPKKANGRTAWDLCLIMKDHGVLAKPT
                     HQHIIRLAPPLTISKEDLLKGVQVIKESLAKLPTAPKSDH"
     gene            <186767..>187186
                     /gene="TDEL0D01020"
                     /locus_tag="TDEL_0D01020"
                     /db_xref="GeneID:11502121"
     mRNA            <186767..>187186
                     /gene="TDEL0D01020"
                     /locus_tag="TDEL_0D01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680849.1"
                     /db_xref="GeneID:11502121"
     CDS             186767..187186
                     /gene="TDEL0D01020"
                     /locus_tag="TDEL_0D01020"
                     /inference="similar to DNA sequence:INSDC:YLR437C,YML058W"
                     /note="similar to Saccharomyces cerevisiae YLR437C and
                     SML1 (YML058W); ancestral locus Anc_4.316"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680897.1"
                     /db_xref="GeneID:11502121"
                     /db_xref="InterPro:IPR013900"
                     /db_xref="UniProtKB/TrEMBL:G8ZSU2"
                     /translation="MAETSPVKRQLQIPIQPQQEAYEFQSKLGALGMRIRQSVDQGYK
                     VPVTQQEQGFSNCCVQDNSGVTIPEYKRVPLSTPAPMLVNQRTVSSTSSLEMWEDSLD
                     QRLNVIDGDMMRNKLGSNDLEVLFNGPSKRNWEQAEF"
     gene            <187325..>190846
                     /gene="TDEL0D01030"
                     /locus_tag="TDEL_0D01030"
                     /db_xref="GeneID:11502122"
     mRNA            <187325..>190846
                     /gene="TDEL0D01030"
                     /locus_tag="TDEL_0D01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680850.1"
                     /db_xref="GeneID:11502122"
     CDS             187325..190846
                     /gene="TDEL0D01030"
                     /locus_tag="TDEL_0D01030"
                     /inference="similar to DNA sequence:INSDC:YLR436C"
                     /note="similar to Saccharomyces cerevisiae ECM30
                     (YLR436C); ancestral locus Anc_4.315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680898.1"
                     /db_xref="GeneID:11502122"
                     /db_xref="InterPro:IPR026705"
                     /db_xref="UniProtKB/TrEMBL:G8ZSU3"
                     /translation="MGNTDSKLAALYRDQVVRLARPDGETTSVVPLVQEETELKKLVA
                     LYLNKERGCDLFNPFYVDFVSSGNTLTMELFNTLVSPTELSNIITVNATNFINLLRYT
                     ALQVVILSNSLDASSTTLLEGQLVQLLVCIRILTKMVPVYLQRCKLQDIFWTRNSNHI
                     FGLSDEEPAELPPLGLLLVRALVKLLFIEGFTIASRGSPGSFTHLLWENGVSTQDTTY
                     HHQSPVIDSNRLEILNLVLAMCSSDLYQPRDFIPEPSKKINRFLFCLTTLTPEYDLIC
                     TVASIINLVCRFCSNYQEETTIPYHDLGYKQNHQQHLPALRHTLVLSSLQLLNLMCYN
                     DWNRAETFKFTLSLKLQSSNDIENLLPNMVLSYLTTFNREFDLKLILTSFAKIFKLPV
                     DLAIEQESNPLNFLSRRPSSTNLNDQTNTTNNQESTNENNDSTTLPPVSPLLVEWLIL
                     FTRLLQMNKCFENYVADKIANRLIIFSVYYLNFYNDVPEISTALIPLCSNLTLMLSSR
                     KLVLSKLLDRFTPNYYTNKIPNFFKLSTGNINNITYRDFTLIHLCNMAISDIKNNVRP
                     RPWLFELIYNILPIPLNLKDEELAQLSSKRQSKALKYGGLSYNASMTLVQLISKMSNK
                     KYLTTFCVGNLTKSYLTCPGFKLDLLALTLRAVLVYIYLYFDEALNLVFAITRHLRVF
                     SQVRDSIDAISKALSTTGIVEGVGKIQMHDYVEYVFNPRLLQDDVEFDQNDSINNSNS
                     NESSAQNLFFDKEKKKDDDDDDNDGGEEESTSIGELSAKEQSLDGTEIEISKVQSNVK
                     TCEIYEQADMSQSSIFSDKTLFNSFRPQLPVGITSKSKAKLRASGAFSKSWVGADTLR
                     ALIRAIRVILHQHPSIATITTTDYYTLIDQISQSKDKFKQTIIQALPVSVREMKEADP
                     IKINLSESNFVYQKWLQIIIWSDILNTHSGPYSLSPAFTGLNSANNGTNLTKEPTMDS
                     ITPTMPNLERWNSNGSTLSRTNSNNSSLLSYFSTQNHEAIPNSPLELNSSHHVTSPQL
                     NNSRNKNATSGNGHSFFRFSWTGFNKNEEYSPINEEECFNGKPSSSANNPRRNVFTLD
                     PGILKPNAWAGTQVRLFNIRRQEKEEFSLLDMTSSLLKRFKFASNASVNSLDTITPNS
                     TPAPSRPYTPRDSFSSNHTMFSTPKQL"
     gene            complement(<190949..>191563)
                     /gene="TDEL0D01040"
                     /locus_tag="TDEL_0D01040"
                     /db_xref="GeneID:11502123"
     mRNA            complement(<190949..>191563)
                     /gene="TDEL0D01040"
                     /locus_tag="TDEL_0D01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680851.1"
                     /db_xref="GeneID:11502123"
     CDS             complement(190949..191563)
                     /gene="TDEL0D01040"
                     /locus_tag="TDEL_0D01040"
                     /inference="similar to DNA sequence:INSDC:YLR435W"
                     /note="similar to Saccharomyces cerevisiae TSR2 (YLR435W);
                     ancestral locus Anc_4.314"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680899.1"
                     /db_xref="GeneID:11502123"
                     /db_xref="InterPro:IPR019398"
                     /db_xref="UniProtKB/TrEMBL:G8ZSU4"
                     /translation="MSSTAYDLAVVEAPTEAKNLQFEDEKQQARFELGVSMMVYKWEA
                     LEVAVANSWGGPSSAEKRDWITAIVVDLFKSEKIVDAATIEETLLYAMIDEFDTNVED
                     ESTVPIAVGIIDIYKQCQVQDYSTVEQLYTKWVEKQNSGESAKVITIEEDPLNPDASS
                     CDEGDEEDEDEGEGEEDIEMNDQPSSGPVVDEDGFELVQKKGRR"
     gene            <191904..>193577
                     /gene="TDEL0D01050"
                     /locus_tag="TDEL_0D01050"
                     /db_xref="GeneID:11502124"
     mRNA            <191904..>193577
                     /gene="TDEL0D01050"
                     /locus_tag="TDEL_0D01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680852.1"
                     /db_xref="GeneID:11502124"
     CDS             191904..193577
                     /gene="TDEL0D01050"
                     /locus_tag="TDEL_0D01050"
                     /inference="similar to DNA sequence:INSDC:YLR433C,YML057W"
                     /note="similar to Saccharomyces cerevisiae CNA1 (YLR433C)
                     and CMP2 (YML057W); ancestral locus Anc_4.313"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680900.1"
                     /db_xref="GeneID:11502124"
                     /db_xref="GOA:G8ZSU5"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8ZSU5"
                     /translation="MPNSKSEAQANTDKINAALKIIESKPPKATLKGEANLEVYTLED
                     GRRVSTKERVIKNVAPITSKISTDEELFDKKTGLPNHEFLREHFKREGRLHESQALRI
                     LEMAASCLSKEPNLLHVPAPVTVCGDIHGQYFDLLKLFEVGGNPETTAYLFLGDYVDR
                     GSFSFECLIYLYALKLNFNGHFWLIRGNHECKHLTSYFTFKNECLHKYTLKVYEACCR
                     SFNTLPLAALMNGQYFCVHGGISPELTSVQDVNRINRFREIPSRGLMCDLVWADPIET
                     YDEDADDTTMDKFTPNTVRGCSFAFNYQAACEFLQRTGLLSIIRAHEAQDAGYRMYKN
                     TKTLGFPSLLTLFSAPNYLDTYKNKAAVLKYESNVMNIRQFNMSPHPYWLPDFMDVFT
                     WSLPFVGEKVTEMLVSILNICTEDELGEDTPIIRERVGKSIEEVEEEPEKTAEPVEDA
                     THTKSILEDEARRKALRNKILAIAKVSRMYSVLREEREKVKYLKHLNAGVLPRGALAH
                     GSDGLNETLSTFERARKQDLVNERMPPSLDQTNKNDFYDELLKRAERKK"
     gene            complement(<193670..>195421)
                     /gene="TDEL0D01060"
                     /locus_tag="TDEL_0D01060"
                     /db_xref="GeneID:11502125"
     mRNA            complement(join(<193670..194784,194971..>195421))
                     /gene="TDEL0D01060"
                     /locus_tag="TDEL_0D01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680853.1"
                     /db_xref="GeneID:11502125"
     CDS             complement(join(193670..194784,194971..195421))
                     /gene="TDEL0D01060"
                     /locus_tag="TDEL_0D01060"
                     /inference="similar to DNA sequence:INSDC:YML056C,YLR432W"
                     /note="similar to Saccharomyces cerevisiae IMD4 (YML056C)
                     and IMD3 (YLR432W); ancestral locus Anc_4.312"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680901.1"
                     /db_xref="GeneID:11502125"
                     /db_xref="GOA:G8ZSU6"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001093"
                     /db_xref="InterPro:IPR005990"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR015875"
                     /db_xref="UniProtKB/TrEMBL:G8ZSU6"
                     /translation="MVRDCATALEYLKTFEEKDGLSVEQLMDSKTRGGLTYNDFLILP
                     GKIGFPSSAVTLQTKLTKKITLNAPFVSSPMDTVTESDMAIHVALLGGIGIVHHNCSP
                     EDQAAMVKKVKKYENGFINSPVVIPASATVGQAKAMRQKFGFAGFPVTENGQLYSKLI
                     GIVTSRDIQFVEDDSLPISEIMTKEVVTGAQGITLAKGNDILKETKKGKLPIVDSEGN
                     IVSMLSRSDLMKNQTFPLASKSFATKQLLCGASIGTMPSDRERLKLLVEAGLDVVVLD
                     SSQGNSIFQLDLIKWIKQTFPDLEVIAGNVCTREQAASLIAAGADGLRIGMGTGSICI
                     TQEVMACGRPQGTAVYNVSKFANEFGVPCIADGGIQNIGHLVKALALGASTCMMGGML
                     AGTTESPGEYFYRDGKRLKTYRGMGSIDAMQKTGGKDNAATSRYFSEADHVLVAQGVS
                     GAVVDKGSVKKFIPYLYNGLQHSLQDIGVQSLEEFNESVDAGNIRFEFRTASAQLEGG
                     INNMHSYEKRLHD"
     gene            <196096..>197379
                     /gene="TDEL0D01070"
                     /locus_tag="TDEL_0D01070"
                     /db_xref="GeneID:11502126"
     mRNA            <196096..>197379
                     /gene="TDEL0D01070"
                     /locus_tag="TDEL_0D01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680854.1"
                     /db_xref="GeneID:11502126"
     CDS             196096..197379
                     /gene="TDEL0D01070"
                     /locus_tag="TDEL_0D01070"
                     /inference="similar to DNA sequence:INSDC:YLR431C"
                     /note="similar to Saccharomyces cerevisiae ATG23
                     (YLR431C); ancestral locus Anc_4.311"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680902.1"
                     /db_xref="GeneID:11502126"
                     /db_xref="UniProtKB/TrEMBL:G8ZSU7"
                     /translation="MALDDILRQNAEITDLLHILVELHGRALQDQGPSDRLEGIRRDI
                     LICFNDLCTLNDMLTSCDGEIRDEIQVLQKAKDKFTRLNRKRQLLLKERDKWTEETPV
                     SVKDQSEQNVVVDTRYRRVLDQYLDLVGANNTTLVEDHSQGDVSRETVLQSVKVLHSC
                     HDNVLQSVKQLKELLNDITKDQAFIEKEMKAQVARIRRETSAIDDELRKNSSKRKNLL
                     AKVGLALPDETSTAQKLFHLKLNDQRDKQLELEQEDIASHANEFLDMKIASLQDQLTH
                     RKDDSYQLIHVRDSWSDCVDSVKNLEDRLRSALTGDLTELPTDRVGSWIKENIEELSS
                     IISSTNNRILITLVSHEREVIENAYDEISQSSKPIEPSSPIRNKHSSPPFLVANKSPP
                     KIGLSDKTAQSLSNNNGASGSNSLTMLKDKSQKKD"
     gene            complement(<197455..>203661)
                     /gene="TDEL0D01080"
                     /locus_tag="TDEL_0D01080"
                     /db_xref="GeneID:11502127"
     mRNA            complement(<197455..>203661)
                     /gene="TDEL0D01080"
                     /locus_tag="TDEL_0D01080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680855.1"
                     /db_xref="GeneID:11502127"
     CDS             complement(197455..203661)
                     /gene="TDEL0D01080"
                     /locus_tag="TDEL_0D01080"
                     /inference="similar to DNA sequence:INSDC:YLR430W"
                     /note="similar to Saccharomyces cerevisiae SEN1 (YLR430W);
                     ancestral locus Anc_4.310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680903.1"
                     /db_xref="GeneID:11502127"
                     /db_xref="InterPro:IPR024481"
                     /db_xref="InterPro:IPR026852"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZSU8"
                     /translation="MGPDAQVEERQAAARKYLPIIEKVYAGVNNDISESSLLGELLKL
                     IAQLPKDFHLFCDPDFRPLSIFCLTIFSFNEQETMTWLKNRFNPTLASCDKCILNFTR
                     GKCKMLQHFAIQRHVPHEHVAKFNDIVCLWRIEAILPVLHQISNKDNTAVEVTRDIEL
                     AVFECLCNPHMLRLNKEFKMTFDVIFKFLYLSKQPFLDSENSELMRTFIAGMIYCWCE
                     GTPEQIQWARTILKKLHTEKFSLTASNMTSDILEEVNIHVLFLQNPANWNEVVVSQFW
                     SRLISVFSFFDEDALIDNFEVPNNIESLRKTYRFPIESIFKLWYHHLGKTYRDKPLEF
                     LLRALSMFLDKLGSEFWSKIEPYTFHSILDIVFDRDSFAQKLIRIQDNKIAEDDIELV
                     LSFSGCLTDMVSWTLMFYHSLTESKKIQMVKKVSMAFLRVIANQPSLKSIPKACLMNS
                     STALLTAVLTIKNEERDKLYERDDFEVVLYSKTDSRALLNNPLIQDVVIRSATHPDEL
                     YPGLGNSTTSVSTSAMMVLTKCMNFDILMLCQTSYKLYAGKHINNIPFTDALLDNLTK
                     KLDLRSFHDGPLLAKQLLVSLRDINGLLIISSKEPAAVRHNADVKRFLVLCTGLVAKF
                     ADILPKQLSNVLTDSEAAQGFWSCIFSPNTELYQAATNILYDTFDVEGRLEGIQVILA
                     GNFTGHLSAINRVLHQLIQCEFYEPCPRAIRVLMDVVSAFTDPVGGVFSNFSTLRNNK
                     TDSELCHFWELTWSFLDTIYRCTLTWATKYEYSELENFTKDTLDLSRTLVDSYREFLD
                     IFQDTKVDFFESVLKAMKNMLYWLRLSDEALLDSCVKLIVSASDLAMEKDIKFSDDLV
                     EQMAKYGSKAKKYSNKLSEQQMSEILTKAKSFDRELTEKIIAEAEDYHKEKALMKLGS
                     PAPSSMSPSPAVESKADFLQRKALASSITGRPKTSQSKITSFGTMQAGSMPRISTKPT
                     KPLSKMELARRQLLSNRVVHPPSNTVFHSKTRTAADRNGESSSDESDGDIEVARELFA
                     TAKAKGEGIQTLDINGKAVRKSTNAERAKIEEENMRKRLNVDLNPLYETVLQWDYSRR
                     SDYPDDESPDKYSKVKDSFNSVNEYRKVIRPLLLLECWQGLCSTRDREDFKPFSVIVG
                     NRTAVSDFYEVYASASKTMIQDAGITESDIIVLAYFPGNEQVSTMRNEDFKKASHTCL
                     AKVKTLKNTKGNKVDVTLRIHRKHNFSKFLTLRSEIFAVKVMQMTTVEREYSTLEALE
                     YYDLVEQILRAAPSQSVEVDSSEVDFVKSNYKLNSSQAKAIVNTVSKEGFSLIQGPPG
                     TGKTKTILGVIGYFLSTRNTLPSNVIQAPKGSVSLSTEQLLKKQKILICAPSNAAVDE
                     IVLRLKDGITNRQGGKFQPSIVRVGRSDAVNAAIRDLTLEEQVDKQVSQKNYEFSNNP
                     DLEKKFSSTVAQRRELRAKLDAENGSASSSLSTEDIAKLQIKIRELSKELNELGRQRD
                     EIREKNSVNYRNRDLDRRNAQARILASSNVICSTLSGAAHDVLASLGVKFDTVIVDEA
                     CQCTELSAIIPLRYGGKRCIMVGDPNQLPPTVLSGAASNFGYNQSLFVRMEKNSSPYL
                     LDVQYRMHPAISKFPSAEFYNGRLKDGPDVEILNIRPWHKNAPLTPYRFFDIVTGKES
                     QNAKSMSYVNTEEIRVAIELVENLVNKYERELDFSGKIGVISPYKEQAMTMRRQFRSH
                     FGASIAQYVDFNTIDGFQGQEKEIIIISCVRADDSKTSVGFLRDFRRMNVALTRAKTS
                     MWILGHQKSLVKNKLWRNLITDAQGRGCLEFACPGFLNKKNHNAQRTLERFRGSHDGP
                     KMDDEYNPYERDQYKKIQKTKRKHEETNASGKALGRGNTPSAAGAVGVKKKKSSIFGG
                     PSVVEAGKHANGPYIKEKGSSKQVETSTKATDNRHVLFSDNVQVIPQTGDENMDANRN
                     AIADHQGAAKSRSSDDENDYVPRPVEMKTDLRHQESESVADEDDYHPADAPNGLRDCA
                     VPTSVSPISQNVSPAGSPSTVSNETGHNGQKATGRRQKSSTPFIPRRRQQHR"
     gene            complement(<204076..>206004)
                     /gene="TDEL0D01090"
                     /locus_tag="TDEL_0D01090"
                     /db_xref="GeneID:11502128"
     mRNA            complement(<204076..>206004)
                     /gene="TDEL0D01090"
                     /locus_tag="TDEL_0D01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680856.1"
                     /db_xref="GeneID:11502128"
     CDS             complement(204076..206004)
                     /gene="TDEL0D01090"
                     /locus_tag="TDEL_0D01090"
                     /inference="similar to DNA sequence:INSDC:YLR429W"
                     /note="similar to Saccharomyces cerevisiae CRN1 (YLR429W);
                     ancestral locus Anc_4.309"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680904.1"
                     /db_xref="GeneID:11502128"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015048"
                     /db_xref="InterPro:IPR015049"
                     /db_xref="InterPro:IPR015505"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8ZSU9"
                     /translation="MSGKFVRASKYRHVFGQPAKKELQYENVKVTNNAWDSNIIKTNG
                     KFISVTWNASGGGAFAVIPVEEVGKSPDQVPLFRGHTAQVLDTDFDPFNDHRVASGSD
                     DCKIGIWDIPEGYSFRNHIDENGDVIDIQPTKMLTGHSRKVGHVLFHPVSQNVLASSS
                     LDYTVRIWNVETGENLITLKHPDMVTSMSFSYDGNHLATVARDKKLRVWDIRNNKIVS
                     EGLAHAGAKNQRVVWLGNSDRLATTGFSKLSDRQIGIWDAFNLEKGDLGGFYTVDQSS
                     GILMPFYDPDNKILYLAGKGDGNIRYYEFQNDELFELSEYQSTEPQRGFAVAPKRMVN
                     VRDNEVLRCFKTVVDQYIEPLSFYVPRRSEEFQEDIYPAAPSDKPALTAEEWFSGKSV
                     DGPILVDMKNIYEGSEPTFKESKKENKPVSSTPLKEEKKAQEQIEKPVERSVEKPDEK
                     STVTEKEATNEQRNVSTASQKPSSINTSLKSDDSVDKLLKKASTFDKANDAEDPSKET
                     SGWDEEDEKPAPVEINKTKELSKGTNGTKENSAAQSPQKSTGSSISTATSTVPSTAPS
                     TATEQAVPAAKTEAAVTTAAASSSGKSLGLKQSVEKLSGLVVTLEEIVEKLVHSNLEK
                     DERLQRLELKIEELAGRN"
     gene            complement(<206296..>208239)
                     /gene="TDEL0D01100"
                     /locus_tag="TDEL_0D01100"
                     /db_xref="GeneID:11502129"
     mRNA            complement(<206296..>208239)
                     /gene="TDEL0D01100"
                     /locus_tag="TDEL_0D01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680857.1"
                     /db_xref="GeneID:11502129"
     CDS             complement(206296..208239)
                     /gene="TDEL0D01100"
                     /locus_tag="TDEL_0D01100"
                     /inference="similar to DNA sequence:INSDC:YLR427W"
                     /note="similar to Saccharomyces cerevisiae MAG2 (YLR427W);
                     ancestral locus Anc_4.308"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680905.1"
                     /db_xref="GeneID:11502129"
                     /db_xref="GOA:G8ZSV0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:G8ZSV0"
                     /translation="MDREMAVKNSGNSEREIPEILSGGGRRESSGKSQRTSHPKGKDG
                     RNAATKAHGYHGGNHRQRGKQQKPGNGRRRDDSESYDLDMSLQDELINGNYRLRGRKA
                     QVSINHLLQFQLPEIEREQEGRLRKGNRRRNQGETHIHLHGDSFINANYRLLLDDRFD
                     YKEQSADPNAPVPGEKIVRVIVPRGQNCPICLSEEPIAPHMVACGHIFCLSCLLNFFS
                     VEDTVKDKNTYAQKKKLKECPLCGSIVRPEKVKPVLAEEARAHDVPEPGKAATLKLMC
                     KPHGSILPLPVLLGTDPLAVGDAPSLDLPLVADYAHMVKCSASKAMELYQKDLEGILN
                     QYEIDKILYNDEGKYYKMAIDYVNDKIANIISQQDVDNLEGIDQSIANLNLGTDLKEK
                     YNDSNAFFFYQTSFSSPIRFFLSPLDVKILLTAFHQYSKFPEELNVMVENVNYSSVLT
                     PEMTNRYKYFGHLPLGTEIAFIEIDWRENNILPKEVYQHFVVELKQRRRKLSQRKHKE
                     DKQRIDHQRKLEREHAEFYRRENGELSSTQDFLDREIALSNESFLDSLSSINQTSQDL
                     TNGNNEDRERKPALKERTIWGTSIPVSRDEKSSKENEEFEAMLLQKMQQDEADESSGD
                     AGRKKGKKKKGKVMLFSSAHRTL"
     gene            <208655..>209167
                     /gene="TDEL0D01110"
                     /locus_tag="TDEL_0D01110"
                     /db_xref="GeneID:11502130"
     mRNA            <208655..>209167
                     /gene="TDEL0D01110"
                     /locus_tag="TDEL_0D01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680858.1"
                     /db_xref="GeneID:11502130"
     CDS             208655..209167
                     /gene="TDEL0D01110"
                     /locus_tag="TDEL_0D01110"
                     /inference="similar to DNA sequence:INSDC:YML055W"
                     /note="similar to Saccharomyces cerevisiae SPC2 (YML055W);
                     ancestral locus Anc_4.307"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680906.1"
                     /db_xref="GeneID:11502130"
                     /db_xref="GOA:G8ZSV1"
                     /db_xref="InterPro:IPR009582"
                     /db_xref="UniProtKB/TrEMBL:G8ZSV1"
                     /translation="MSKPINVYSIPELRQTLDEALPATFARLKYKQSFQLIDAKLVLG
                     YSMAAIAAGSFLLDKKFKYSQVVGYQKALLVIYGGLSVLYWYFTKYIEKSTVYEGRSP
                     AGEKVSVKTRFEKKEPIYLVDFRLDDKTEVSVGLPATEVFNEAGYLQNELLFQWLERQ
                     LKVLSSKKSQ"
     gene            complement(<209195..>210178)
                     /gene="TDEL0D01120"
                     /locus_tag="TDEL_0D01120"
                     /db_xref="GeneID:11502131"
     mRNA            complement(<209195..>210178)
                     /gene="TDEL0D01120"
                     /locus_tag="TDEL_0D01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680859.1"
                     /db_xref="GeneID:11502131"
     CDS             complement(209195..210178)
                     /gene="TDEL0D01120"
                     /locus_tag="TDEL_0D01120"
                     /inference="similar to DNA sequence:INSDC:YLR426W"
                     /note="similar to Saccharomyces cerevisiae YLR426W;
                     ancestral locus Anc_4.306"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680907.1"
                     /db_xref="GeneID:11502131"
                     /db_xref="GOA:G8ZSV2"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZSV2"
                     /translation="MVNIDDLVRFVISTRFIIITFLCTLLTCRSLKLSLVPLLMHGLL
                     QTLYKANLAYKCGGQFKWKSLLEFKSCKVVITGGSSGLGRSIVKNLLDTFPNVTILNV
                     DIKTSPEANDRLIDYICDLRNSQALNATLKEIKVNHGSEIRLLVNNAGVRSRYEGFKE
                     LKCQDVNDVFAVNSVAPMRFIQELTPHESSDEQCFVVNVTSSLGILSAAKAAAYAASK
                     AALICFHKSYTFELESKGVSNIRTLLVVPGQLDTDMFSGFEPPRQFFAPVLDREKVAK
                     KIVDYVELGMRGDLSAPLYAKFAYVLMAMPYSVQTIVRKMSKMDDCLPNDD"
     gene            complement(<210319..>214203)
                     /gene="TDEL0D01130"
                     /locus_tag="TDEL_0D01130"
                     /db_xref="GeneID:11502132"
     mRNA            complement(<210319..>214203)
                     /gene="TDEL0D01130"
                     /locus_tag="TDEL_0D01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680860.1"
                     /db_xref="GeneID:11502132"
     CDS             complement(210319..214203)
                     /gene="TDEL0D01130"
                     /locus_tag="TDEL_0D01130"
                     /inference="similar to DNA sequence:INSDC:YLR425W"
                     /note="similar to Saccharomyces cerevisiae TUS1 (YLR425W);
                     ancestral locus Anc_4.305"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680908.1"
                     /db_xref="GeneID:11502132"
                     /db_xref="GOA:G8ZSV3"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G8ZSV3"
                     /translation="MYSNGNRDRIRRPSKNEDIVLPELPPLNTNNPFLDNSLQHGDEV
                     SIGWTPVEERHNHQQEPQDSQKRYSFPGNRHLPQTPPRRNSKDSNSITSPTSSSTSRR
                     HSARRPPPPPIPQAITSPTNSVASSRIYKSPFVGEAAIKCTLSPEPRVYRSPFVGEPV
                     LAETAHMATSPTQRSFEDMPYVTFNNVEFSKRALPPLPTSTSENDNLNIFNVQPPPVL
                     GGVRHTSNNSRLSDSLGSYYSDSNYAFNGSSARHNSFGSVLGGKPLDQVPSITAPTQP
                     FSIDSLDENKLYQCYSVYRLSDIYEWILKVYFEWFNEYIFGKIEFFQMVQLLLEFQMP
                     KSFDQDTIDSNVDRIIESLVAQNAVRFEQDGQSVITIIVAGLDVSGIFTQLLPCYSFL
                     DTTLAPSETSLCYSLTCVSRQPNEREEIKLSEIINNSVGVWTDYWKLSQEDISEINPR
                     EVQRQSFIFDLIILEERSLNMANAAVEIYGKSFDPSLLPDEPDFAERAFDIFLPLIRL
                     HKEFLLGPILWKLKTRGKFIDGVGKIYLKWCNEAHDIYLRYASDMATVHAVITSEKEH
                     DTKFAHWLRAIDNLPEISRSKMYHDVIFFGGFFKSLQNLPITLNSILKNTEPSSEDYE
                     YLKLVIKEVEKLSAEVNRVHGLAIDRRTLVRFSKQLVFRSTGDSNTVGYVNLATNDEE
                     EENKPSQDRLDLGLANPERKMLMTGMAMKKRELWLEPTPVYIVLLDNYFLITEAIIKG
                     NQKRYKLAERPIPIDYLSLEERRKFEHPQSAGSSMRDLAPRDSTSSNMSPMTGIRPNL
                     ISAASSVSRSIYNPANNERKPNLTEISNANPEAPDMSFKVRNTATNESFTFITTTPDE
                     CQRWKLAVLDCFRRSSYANNSSGFELQVLTTQFAFAEKEAPVNLPVAPEGSVIDVALR
                     EYEKSKCPPSAVRPTLNFSSLTLVLEGKMFLILATDYGVHMRNESDHEQEFVKVLQSK
                     DVRRMEVNLRLGLLFVLDGRLLCYFSISSIMAAYYSADKRSAENRIVGVVVSDKVGCF
                     KFAEDFGNSRQLLYERKGRIFVMTPEYDRMTKVLKYFKTYKEYKLSSLNSSLSTLDVV
                     DDIIVFRKCFIVCTSKGCVVYHDAFNDDGISIPTFTNDQDVTALLKHPHLSSNPFRTA
                     IESSSKKDSSKQKMAEYVKKDIATSKTKPITCFQISLTNGYLVVYDEAVIRVDRQGQI
                     ANWKLDILVLDFYCTGASFHKGYLTLIGDSLVQVYRINDSEVSMSKLVPIQIIKGKKV
                     RLVNSDRNGEPVVALSHPSLANRQLLVALKPR"
     gene            complement(<214858..>216612)
                     /gene="TDEL0D01140"
                     /locus_tag="TDEL_0D01140"
                     /db_xref="GeneID:11502133"
     mRNA            complement(<214858..>216612)
                     /gene="TDEL0D01140"
                     /locus_tag="TDEL_0D01140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680861.1"
                     /db_xref="GeneID:11502133"
     CDS             complement(214858..216612)
                     /gene="TDEL0D01140"
                     /locus_tag="TDEL_0D01140"
                     /inference="similar to DNA sequence:INSDC:YML054C"
                     /note="similar to Saccharomyces cerevisiae CYB2 (YML054C);
                     ancestral locus Anc_4.304"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680909.1"
                     /db_xref="GeneID:11502133"
                     /db_xref="GOA:G8ZSV4"
                     /db_xref="InterPro:IPR000262"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR008259"
                     /db_xref="InterPro:IPR012133"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:G8ZSV4"
                     /translation="MFARSTRTVAQVVRKAPSRSLLARRGISGLHIQRNGLPKNRHFI
                     TGAVALASLSTLLWISDRPTIDNGTVKDSTKKSIDPKEVEKHNAPDDCWVVIDGYVYD
                     LSDFIPSHPGGPAVIRANAGKDVSAIFDPLHAPDVIEKYIAPEKRLGPLEGQMREELI
                     CPPFAPGDSVDEMAEKQQLRAELPPLEHISNIYDFEYLASQILSKQAWAYYSSGSDDE
                     VTMRENHSAYHRIFFKPKVLVDVANVDTSTEFLGLPVDVPFYVSATALCKLGNPKEGE
                     KDIARGCGSGPKKVVQMISTLASCSLKEIIEAAPSKDQIQWFQLYVNSDRKACDELLA
                     EAEKLGAKAIFVTVDAPSLGNREKDAKVKFSADKSGPEAMERTKERKQKAKEVEEQGA
                     SRALSKFIDPSLSWNDVVEMKKKTKLPIVIKGVQRAEDVLKAAELGIDGVVLSNHGGR
                     QLDFSRSPVEVLAEVAPMIKEKNLDKDFQIFVDGGIRRGTDILKALCLGAKGVGLGRP
                     FLYANSTYGKEGVEKLIERLSFELEMDMRLLGVNSVKELGPELLDLTALKSRSVEVPK
                     DYLYNQAYKKASFTDFET"
     gene            217442..217515
                     /gene="TDEL0Dtrna1N"
                     /locus_tag="TDEL_0Dtrna1N"
                     /db_xref="GeneID:11502134"
     tRNA            217442..217515
                     /gene="TDEL0Dtrna1N"
                     /locus_tag="TDEL_0Dtrna1N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:11502134"
     gene            complement(<217621..>218223)
                     /gene="TDEL0D01150"
                     /locus_tag="TDEL_0D01150"
                     /db_xref="GeneID:11503629"
     mRNA            complement(<217621..>218223)
                     /gene="TDEL0D01150"
                     /locus_tag="TDEL_0D01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680862.1"
                     /db_xref="GeneID:11503629"
     CDS             complement(217621..218223)
                     /gene="TDEL0D01150"
                     /locus_tag="TDEL_0D01150"
                     /inference="similar to DNA sequence:INSDC:YKL196C"
                     /note="similar to Saccharomyces cerevisiae YKT6 (YKL196C);
                     ancestral locus Anc_4.303"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680910.1"
                     /db_xref="GeneID:11503629"
                     /db_xref="GOA:G8ZSV5"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR010908"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:G8ZSV5"
                     /translation="MKIYYIGVFRSGGEKALELSEVKDLSQFGFFERGSVGQFMTFFA
                     ETVASRTSGGQRQSVEEGNYIGHVYCRSEGLCGVLITDKEYPVRPAYTLLNKILDEYM
                     IAHPVSDWKNVSETNASLHMKELEMYIRKYQDPSQADAIMKVQQELDETKIVLHKTIE
                     NVLQRGEKLDNLVDKSESLTASSKMFYKQAKKTNSCCIIM"
     gene            <218435..>219478
                     /gene="TDEL0D01160"
                     /locus_tag="TDEL_0D01160"
                     /db_xref="GeneID:11502135"
     mRNA            <218435..>219478
                     /gene="TDEL0D01160"
                     /locus_tag="TDEL_0D01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680863.1"
                     /db_xref="GeneID:11502135"
     CDS             218435..219478
                     /gene="TDEL0D01160"
                     /locus_tag="TDEL_0D01160"
                     /inference="similar to DNA sequence:INSDC:YKL195W"
                     /note="similar to Saccharomyces cerevisiae MIA40
                     (YKL195W); ancestral locus Anc_4.302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680911.1"
                     /db_xref="GeneID:11502135"
                     /db_xref="InterPro:IPR010625"
                     /db_xref="UniProtKB/TrEMBL:G8ZSV6"
                     /translation="MYRTGITRSVRQLSSRRAGLVCRASSKNLVRRAYSSAAHGEPSG
                     SSGDPLHWSLGAAAALSAIYFVYPFEKKPKENKEEAKEEPQQESSEKSEQEPEQAQET
                     EQEPEQGSEENSQDNEFEQKDAEPEQQSEQKEPKQQSEQKTPEQQSEQPDQKPKKEEA
                     VTSTDAHQTDKDVKSDEEIQRTEEEKLAPTDEEAQQEGAYNPDTGEINWDCPCLGGMA
                     HGPCGEEFKAAFSCFVYSEAEPKGIDCVEKFQHMQDCFRKYPEHYAEQIKDEDEAVAS
                     QNGQSENAKDAEKPQSKNEPKNEPKNELKNEPKEEPKEEPKEKPKEKPKEESKEDKSK
                     AESNSSTDATEKN"
     gene            complement(<219548..>221554)
                     /gene="TDEL0D01170"
                     /locus_tag="TDEL_0D01170"
                     /db_xref="GeneID:11502136"
     mRNA            complement(<219548..>221554)
                     /gene="TDEL0D01170"
                     /locus_tag="TDEL_0D01170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680864.1"
                     /db_xref="GeneID:11502136"
     CDS             complement(219548..221554)
                     /gene="TDEL0D01170"
                     /locus_tag="TDEL_0D01170"
                     /inference="similar to DNA sequence:INSDC:YLR424W"
                     /note="similar to Saccharomyces cerevisiae SPP382
                     (YLR424W); ancestral locus Anc_4.301"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680912.1"
                     /db_xref="GeneID:11502136"
                     /db_xref="GOA:G8ZSV7"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="UniProtKB/TrEMBL:G8ZSV7"
                     /translation="MPSEKNCRFFENRMDPYGYSDEDRTEDEGDKKPNFFTNGGTEMS
                     KKYGIGAKLLSKMGYVAGQGLGKDGSGIAHPIQAEQRPMPSVGLGMMSSLGDKYNERY
                     DSSDDEEQAPRSHDVAFEKSDVKVMSKDNKVQDRHQTQLNRILSDLQSKLNLKISPGF
                     LERISSTSFDQKVELERLATSLLNGQERITTIDDRIKILEAEVAELDDEGRLLYDIDE
                     SLKKNSTILNKADCIMGLSDTDLVDSLLANILRREYLMQDDIVVPTSENLDQLVGLAE
                     ILRYQMDTSSTQLNRTQSTIYKLIFKRFLKFWEGFTVNKEQTNMMISLMLDFEPLLKF
                     ISCFDYVLETFIYPKLIRALASWNITGNDEFPPRVWVFDFLVITKLQTRNKLEELAVE
                     KLSNYCDSWYHRDSEVIRKADLLFMQELLGKKYHEVVDSKLLPKFLDQLWEKHFDPLA
                     ELEDWESASIEEGSLYYSRMLKRYQYYFSDEVYNTLITAMFNEYNKVLYQWLIYSEQE
                     DVSKAKHWFFWQINAMFRDATPIEIELKEIRKTMALLNDSAHQPIHDESFNLFRRLRL
                     ELKEPTETAKTGTYTVQNIPMRKVVPHFKDVVEDFCAENAYVLQKLQGQYTQLPYGVH
                     KDTLAPVFKISRGNSSVDIAMKDDILWVRNDKGSFVPTYLYELK"
     gene            <221744..>222997
                     /gene="TDEL0D01180"
                     /locus_tag="TDEL_0D01180"
                     /db_xref="GeneID:11502137"
     mRNA            <221744..>222997
                     /gene="TDEL0D01180"
                     /locus_tag="TDEL_0D01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680865.1"
                     /db_xref="GeneID:11502137"
     CDS             221744..222997
                     /gene="TDEL0D01180"
                     /locus_tag="TDEL_0D01180"
                     /inference="similar to DNA sequence:INSDC:YLR423C"
                     /note="similar to Saccharomyces cerevisiae ATG17
                     (YLR423C); ancestral locus Anc_4.300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680913.1"
                     /db_xref="GeneID:11502137"
                     /db_xref="GOA:G8ZSV8"
                     /db_xref="InterPro:IPR007240"
                     /db_xref="UniProtKB/TrEMBL:G8ZSV8"
                     /translation="MKEPDLELFVSNARKTLVEAQVLCQEASMRISGAKGSLSRWQQE
                     VSKIKFMIISLKNQGEFLYKCILKVGIGENLIKKEWSQGLLVDLIDSMKSWQEQLTTR
                     IAQLDGVDNKLVSSDDNGEHVKLGDFIPKENAHILNERLKEIPIIRRQIDNIKSQYSN
                     MMKKVQEQVIQTKLKNLETLFEEKYGPSSTGSIELGESYLLEMTNLEHELVEYLNSLT
                     DHFDKCRLLQSGELQGQNKQELLEIVTRDNSELSSVLVTLRDTIEDVDKLLLKFRITL
                     EKNMADGNQLQTDIQKNVSEFQKYQEYLVIFRDISELISTFRETCLQEIQVTQELCDF
                     YENFEASYYKLTEEADRRRSVAKQMEDLISDCENKLQKLSNDDHKARERFLSLNGDYL
                     PETIWPGKIDDFTPLYSLQYTIKDI"
     gene            complement(<223050..>224453)
                     /gene="TDEL0D01190"
                     /locus_tag="TDEL_0D01190"
                     /db_xref="GeneID:11502138"
     mRNA            complement(<223050..>224453)
                     /gene="TDEL0D01190"
                     /locus_tag="TDEL_0D01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680866.1"
                     /db_xref="GeneID:11502138"
     CDS             complement(223050..224453)
                     /gene="TDEL0D01190"
                     /locus_tag="TDEL_0D01190"
                     /inference="similar to DNA sequence:INSDC:YKL194C"
                     /note="similar to Saccharomyces cerevisiae MST1 (YKL194C);
                     ancestral locus Anc_4.299"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680914.1"
                     /db_xref="GeneID:11502138"
                     /db_xref="GOA:G8ZSV9"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002320"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:G8ZSV9"
                     /translation="MTIKGIDLGRNTPLLDSMLRQRLTSCRSFGCRMYSTKPAVSTNA
                     TTAHDVSNKQRLFFTDPISPGSVFFLPNGTKIFNKLVQFMKLQQEHKYGFKEVVTPLV
                     YRKSLWEQSGHWDNYKDDMFRVEGNDSSKEEYGLKPMNCPGHCLIFKKFDRSYSELPV
                     RLSDFSALHRNEASGALSGLTRVRKFHQDDGHIFCTPEQVEEELAKCLKLVDMCYTKI
                     FPLGKDSQFESYVMELSTRPESYIGELAMWNHAEDVLKGVLERTGKQWELNDGDGAFY
                     GPKIDIKVSDQTGKYHQVATIQLDFQLPERFDLRYKDKDNTYKRPIMIHRAVFGSLER
                     FMAMLIDSCEGKWPFWLSPRQAMVIPVNTRKDDQMKASKELVSYLRHEADAENDTPVP
                     LNSFHFNVDIDDRAEPVGYRIKDALMKDYSYLIIIGDKEVETSKFAIRTRQDRKLEHL
                     TSEEIFAKFSDLERHYR"
     gene            complement(<225035..>225433)
                     /gene="TDEL0D01200"
                     /locus_tag="TDEL_0D01200"
                     /db_xref="GeneID:11502139"
     mRNA            complement(<225035..>225433)
                     /gene="TDEL0D01200"
                     /locus_tag="TDEL_0D01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680867.1"
                     /db_xref="GeneID:11502139"
     CDS             complement(225035..225433)
                     /gene="TDEL0D01200"
                     /locus_tag="TDEL_0D01200"
                     /inference="similar to DNA sequence:INSDC:YJL104W"
                     /note="similar to Saccharomyces cerevisiae PAM16
                     (YJL104W); ancestral locus Anc_1.257"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680915.1"
                     /db_xref="GeneID:11502139"
                     /db_xref="GOA:G8ZSW0"
                     /db_xref="InterPro:IPR005341"
                     /db_xref="UniProtKB/TrEMBL:G8ZSW0"
                     /translation="MAHRAFIQVVITGASVFGKAFAEAYRQAASQTVKQGANAARAGS
                     ASAEYGGITLDESSKILNMEDKENLNLDKINQRFKYLFDVNDAEKGGSFYLQSKIYRA
                     AERLKWELAQQEKAEQPPNTSQKGTDPSKQ"
     gene            complement(<225620..>227938)
                     /gene="TDEL0D01210"
                     /locus_tag="TDEL_0D01210"
                     /db_xref="GeneID:11502140"
     mRNA            complement(<225620..>227938)
                     /gene="TDEL0D01210"
                     /locus_tag="TDEL_0D01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680868.1"
                     /db_xref="GeneID:11502140"
     CDS             complement(225620..227938)
                     /gene="TDEL0D01210"
                     /locus_tag="TDEL_0D01210"
                     /inference="similar to DNA sequence:INSDC:YJL105W,YKR029C"
                     /note="similar to Saccharomyces cerevisiae SET4 (YJL105W)
                     and SET3 (YKR029C); ancestral locus Anc_1.256"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680916.1"
                     /db_xref="GeneID:11502140"
                     /db_xref="GOA:G8ZSW1"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:G8ZSW1"
                     /translation="MSAKGPDEQSLLEDASTLLMFSKTRTASSGNDDKDMQQPHTVPI
                     SRAESENVSPGNPRGSLGPASIALLPRDGKDKIRSESVSPTSGGRSNISEKGMVAAAA
                     LAAAATVPLPLKPGQRRKTSREEPANESVDSRVMGEWPVPDSYIVDIDSGIISCICGF
                     SDDDGFTIQCDHCNRWQHAICFNIRDIETAPEHHLCNTCQPRKLDPKRARRKQMEKLQ
                     RQNRNKNSDSTHRDARNATDPSNDYRRTSSTEINNNEHSNGTGNNNGNKTNNDNEGEE
                     SQADYDNMERLEEATEETNVKKRKEDGDIALGNGLKRKKDNALYLSAKDAYLALYLPI
                     EKNEFKDKYAGLFIEKHNDDDWVIPYNKDEFKPIPTAVKPYAELSSVKIFPGFAKLGL
                     YLSEDCSRNDFICEFLGEVDFQKSYLLDPRNHYRIWGTTKPRVLFHPHWPIHIDARLC
                     GNVARYMRRSCKPNVELATIRMPATNELKFVLRATRDIENGEEIHIGWQWDLRHPIWQ
                     IINGTATFDSLNDPDKYLLIHSIDIVLGVCDCACGNSNKDCNLQKVKKFSQSLYKTVK
                     SKMNNRYKLNEILNQYQGKKRRQPPILSRMAKEVLENEERAPKVLADYNEKKLAITCG
                     CSARQWWAVIEGSANGIKPYKQSLMDKQDAKYSVDASSSTFDPTKYDESKVADISQLP
                     IPIVLEVPLKYPTGAEIGKRAAPESSANPPDTQAIASDKSASYPSISARAKPEERSHS
                     SSAASLPDLADNSKGTLKKKLSFADYRKKQHR"
     gene            complement(<228529..>230451)
                     /gene="TDEL0D01220"
                     /locus_tag="TDEL_0D01220"
                     /db_xref="GeneID:11502141"
     mRNA            complement(<228529..>230451)
                     /gene="TDEL0D01220"
                     /locus_tag="TDEL_0D01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680869.1"
                     /db_xref="GeneID:11502141"
     CDS             complement(228529..230451)
                     /gene="TDEL0D01220"
                     /locus_tag="TDEL_0D01220"
                     /inference="similar to DNA sequence:INSDC:YJL106W"
                     /note="similar to Saccharomyces cerevisiae IME2 (YJL106W);
                     ancestral locus Anc_1.255"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680917.1"
                     /db_xref="GeneID:11502141"
                     /db_xref="GOA:G8ZSW2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8ZSW2"
                     /translation="MLSRKANKDSVPVTPPDIHNPPSYIPLRSIDGRYQIIEELGNGS
                     FGSVSLARAHFDITQCNGDDSKLYRRTLMNQIDAEHENSICKRQGLVAIKTMMTKLST
                     LHDYTRVREIKFILSIPANKHLIQIFEIFIDDRNFQLHIVMEAMEQNLYQMMRHRRRR
                     VFSIPSLKSILAQILAGLNHIHDSNFFHRDIKPENILISPSTRYFDKEWLIEGNYTDN
                     YVVKLADFGLARHVTNKNPYTAYVSTRWYRSPEILLRNGYYSRPLDIWAFGCVAVEIT
                     IFKPLFPGSNEMDQIWKILEVLGTPHSTRESARTGYVSNGGQWESAKNLAQRINMKFP
                     YVEGTGFQELISSSQLQSLADVVRLCLKWDPNERATTRDLCLMPFFQNTVADLRETPT
                     PITTNTEQALIFAGIDSSRSTHSKRQLIFHSKELDNSHSSRPMNIIDDEPLAKKTFSI
                     NEFLKNHTDNVPIDPPPQIDTDSTISENQDDIEFCHISNTFENDHLVQNLPNLTSNTK
                     FTSDSIHNLQKLADDIDAMNKQGDTDLFFNTQHESGDKNYVHYSHQDNGHNQELHLLN
                     NNVLMNSDHSSIQPVNRLLDNMSIDDSFKNNTNMNAIPRSFLLQKDMTNVNHPNDSNN
                     MELTSETNQHFGNITF"
     gene            <231054..>233594
                     /gene="TDEL0D01230"
                     /locus_tag="TDEL_0D01230"
                     /db_xref="GeneID:11502142"
     mRNA            <231054..>233594
                     /gene="TDEL0D01230"
                     /locus_tag="TDEL_0D01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680870.1"
                     /db_xref="GeneID:11502142"
     CDS             231054..233594
                     /gene="TDEL0D01230"
                     /locus_tag="TDEL_0D01230"
                     /inference="similar to DNA sequence:INSDC:YJL108C"
                     /note="similar to Saccharomyces cerevisiae PRM10
                     (YJL108C); ancestral locus Anc_1.254"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680918.1"
                     /db_xref="GeneID:11502142"
                     /db_xref="InterPro:IPR010619"
                     /db_xref="InterPro:IPR024528"
                     /db_xref="UniProtKB/TrEMBL:G8ZSW3"
                     /translation="MSGPEKGKKPSFLSKIDKSHSSNSHVAARDESDSGSDLEFEAGR
                     SNNLPSFKQRDAAEGSKSKQLIELDAARTIRHTSANYQDDGEDDGELDKHYQEKVARF
                     GGHRSSTSSSEGEYKNVRFKSNTEEYEDDKSNRSSHSSRSSDDEDKLDHFKQFFHRGA
                     SQKRGMRNLNGDDDEDDDEEKGVLSKFINNFSQNGGLAPGFSTEKQKENDDIEKQAEE
                     NDIPMVDFSEAAQQIVHAHSGSNEKQTLTAPDRTASDGETAYESGSQTPTSHSSFVAA
                     PMEHYIEGEQGDDEAYGDDYDPFVENTAYVAPPTKVRGGVLGSLLKMYQNEDLNSTYS
                     SVSLNDSDTATPALTPTSSRLKLPKANNLKKLNPIRKSNAELGEGSKSDLPSFKNTRP
                     KGKKSRIPKFKKKMATEARITVHIADLLQRHRFILRMCKSLMLYGAPTHRLEEYMIMT
                     SRVLEIDGQFLYLPGCMIVSFGDATTRTSEVQLVRCAQGLNLWKLHQVHTIYKRVVHD
                     TMSAAEGNVIIDKILQDKNLYPPWVCVFLYGFCSATVTPYAFGGDWINLAISFFMGSC
                     VGALQYIVSQRSNMYSNVFEVTASVVVSFCGRAFGSIKHGICFGAVTQGSLALILPGY
                     IILCGSLELQSRNIVAGSVRMFYAIIYSLFLGFGITLGAALFGWMYKGATNETSCSYP
                     ISPWFRFLFVPAFTIGISLINQAHWTQLPVMTIISCSGYVVTYWAGTHFQNSTEFTAA
                     LAAFLIGLMGNLYSRVWKGLAVSAMLPAIFVQVPSGVASQSSLLSGLQSANQLINHNG
                     TSDTADLSSSMSFGITMIQVSIGITVGLFASTLFIYPFGKKKTGLFSL"
     gene            <234068..>239152
                     /gene="TDEL0D01240"
                     /locus_tag="TDEL_0D01240"
                     /db_xref="GeneID:11502143"
     mRNA            <234068..>239152
                     /gene="TDEL0D01240"
                     /locus_tag="TDEL_0D01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680871.1"
                     /db_xref="GeneID:11502143"
     CDS             234068..239152
                     /gene="TDEL0D01240"
                     /locus_tag="TDEL_0D01240"
                     /inference="similar to DNA sequence:INSDC:YJL109C"
                     /note="similar to Saccharomyces cerevisiae UTP10
                     (YJL109C); ancestral locus Anc_1.253"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680919.1"
                     /db_xref="GeneID:11502143"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012954"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR022125"
                     /db_xref="UniProtKB/TrEMBL:G8ZSW4"
                     /translation="MSIDRNVQSKDENKNLDNAINGYLMLVSSKWHLAPTLHATEWLV
                     RRFQIHICNAETFLLSAINYYQTPTFKRILSIIKLPPLFNSLSSFVRSERNPSNVTII
                     KLFNDMGFLKMYANYLNKCIKKKTTYTNQMLFTSCCFINLIAFNSNNDEKLNDLVPIF
                     LEIAAKLLASNSVDCQIAAHCILVVLAAALPLKKVIILAATETILANLESAKAKNSAL
                     VTICKLWQTLKGPGNVDQFPAPLYELLESRLGLDFIIEHLKKSERASCDKFVTSYIRA
                     IARYDHSKLSEIVKILNEIELENFEERLIVTDLIHLSEVLEDKSQLITLFEYFVSINE
                     NLVLKCINSLNISRELFEIKLTTSLFKINEESNENDIMKALSAEKGSNGNTHSLSFKE
                     FLEKHSSHINTSNKSMLAEGDETFGKLLSLFVEAVGRTFPAGLFLSSFFTTMESRITF
                     LVRVLISPAAPIALKSISLSNISKYINSIDKESNVFTLVPCLICALNDVSKNVRLGVK
                     RVLAQIAKRPFTKHYFMSNKLYGENKEIPMLSPKDGEFWLTHFLNAYIIENYDISTLI
                     IPKKNEKVYLLFWGNQALLMPLPSPKTIILKYLNAKLTSSSGANTALFADFISSYLNN
                     REEWEERCRNNKTKFDEFEGSLVNLISPKERNDFMIDFIIDSLKSNYEALAGLVAEKL
                     QKIFSSLKFNQQLKIVQSILETAATGDAVPAYDAVGTLQSLPLDTNIFVSILSQNRIH
                     TDSELSELPKRRRRRSSANKAALQKEEVSHIAEAHLRKLTIILEALDRSKVGGSEPLL
                     SNLLWLVSDLETLEKDGGLPVLYAQETLASCMLNTINSLNDGSAPKPKNVRADVVVSA
                     IRNSTSPQVQNKLLLVVGALANLDSETVLHSVMPIFTFMGAHSIRQDDEFTNQVVENT
                     IQTIVPALLKNSENAKDEVEFLLMSFTTALQHVPKHRRVKLYSTLVKSLGPSRAIAPF
                     LFLIAQQYSADIKSFKISEARNLVEFIKSLMTNFDVIEQLNGLCEYLSLLKLLISANE
                     NEEEKESLKLRAPFTGGILNFPHVEFLSFLQNALTFIDKTIEETEVGYYDINGSFKIK
                     VYSALLDTRNDDLFVKKVRSKFGSFLESLLAFINQVSKQCLKSQGENEDSATEMELTD
                     TEGDIKKTLFLLLSHLLNVLPVRDFVDAVLPLFSISEDEDIRYHLTLVIGTKFAEEGP
                     EASSAAEQVIVILLERIPIEKDCYNNIQVSFNTVASLVTTFGSNLPKPLVTDVLKLAT
                     ENLNSTKSEVIISSLAVVTSCIQALGVKSIAFYPKIVPPALKIFQDLQDDEENYLREQ
                     LQLAILLLFAALIKKLPSFVMSNLADVFKVILFSGDVSVSTRLSIISLIVENVDLKEV
                     LKVLYKLWDQYVSTTTDSIAVSLFLSALQSTVETIDKKSATSQSPIFFKLLLVLFEYR
                     SISGFDDNTINRIESTVYQIANTYVLKLNDKVFRPLFVILVRWSFDGEGVTNTSMTEV
                     ERLTSFFKFFNKLQENLKVIITSYFTYLLEPVSELLKKFVNRKIVNVNLRRVVLNSLT
                     SSFKYDRDEYWKSTSRFELICEPLVDQLSNVEGVIGKYLVKAIASLAANNNRVDEHNK
                     FMHRLLVKHMKATCSSNEKLWAVRALKMIYSKVGESWLVLLPQLVPTIVELLEDEDEE
                     VEHEVRSGLVKVVENVLGEPFDRYLD"
     gene            <239372..>240112
                     /gene="TDEL0D01250"
                     /locus_tag="TDEL_0D01250"
                     /db_xref="GeneID:11502144"
     mRNA            <239372..>240112
                     /gene="TDEL0D01250"
                     /locus_tag="TDEL_0D01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680872.1"
                     /db_xref="GeneID:11502144"
     CDS             239372..240112
                     /gene="TDEL0D01250"
                     /locus_tag="TDEL_0D01250"
                     /inference="similar to DNA sequence:INSDC:YKR030W"
                     /note="similar to Saccharomyces cerevisiae GMH1 (YKR030W);
                     ancestral locus Anc_1.252"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680920.1"
                     /db_xref="GeneID:11502144"
                     /db_xref="InterPro:IPR007881"
                     /db_xref="UniProtKB/TrEMBL:G8ZSW5"
                     /translation="MSTLPTSNRNFHQNVSDGSSIPIVLRRLYRTPKNLDFETALWEM
                     IHLIFKPRKAFRSFYYQHQTKHQWARDDPSFFILQIGLLLLSSMVWSIVYGHSFLGFI
                     RMMMNMIFIDFFLFGFAVATTFWLILNRPYFKFRSASESQVEWAYCFDVHCNAFLIIW
                     VLLYFLQFVLLPIIKLHRWIGLFVGNTLYCLAFGHYFILTFYGYSQLPFLKSINFMLI
                     PALAFAVLYIISLIGIDLSQVLSFYKYQ"
     gene            complement(<240286..>241683)
                     /gene="TDEL0D01260"
                     /locus_tag="TDEL_0D01260"
                     /db_xref="GeneID:11502145"
     mRNA            complement(<240286..>241683)
                     /gene="TDEL0D01260"
                     /locus_tag="TDEL_0D01260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680873.1"
                     /db_xref="GeneID:11502145"
     CDS             complement(240286..241683)
                     /gene="TDEL0D01260"
                     /locus_tag="TDEL_0D01260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680921.1"
                     /db_xref="GeneID:11502145"
                     /db_xref="UniProtKB/TrEMBL:G8ZSW6"
                     /translation="MMCRKSSAPMSTNLYPLTEFDNESPVLPCEQTNHPSRMKAFKRR
                     SCTLNYLYKNVMDKKHSADIVSIEHLGKDPAPNSRASTPKSSQNSSRMNSSSTLSLSL
                     AGDSRAPKTRNPISFYENDLNLTRFSSNSSTVDLPTTGRIKLPRRAHSSQEIKKVSSF
                     KNEPIGISASNPDIKEVITKAETPGKESDDDVSKILCDEISTALNDDIFEKEFSFDNK
                     WVDDDAFNSLKDHSDVSSSSHSPLTDSALKSSANPISRRDSLILQNFKGDLNALTKKK
                     TRNSISSKSNSSRLQLRLDTLRMKSESTRDTQRFHSDVTNTDSDTLLRYWTTNTDIRT
                     KSVSEGINRELKSVTRCNSYSGRPGGKMIVSMINQLSIEKQGESQMGNISSSSPSEST
                     LSAHPAIKNINCTQNDLLLTNFLDDNLHRRNSEDMFEDKALTSIGDKELRSSIVRGRS
                     HSNRMWLESERLEFD"
     gene            complement(<242013..>246668)
                     /gene="TDEL0D01270"
                     /locus_tag="TDEL_0D01270"
                     /db_xref="GeneID:11502146"
     mRNA            complement(<242013..>246668)
                     /gene="TDEL0D01270"
                     /locus_tag="TDEL_0D01270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680874.1"
                     /db_xref="GeneID:11502146"
     CDS             complement(242013..246668)
                     /gene="TDEL0D01270"
                     /locus_tag="TDEL_0D01270"
                     /inference="similar to DNA sequence:INSDC:YKR031C"
                     /note="similar to Saccharomyces cerevisiae SPO14
                     (YKR031C); ancestral locus Anc_1.251"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680922.1"
                     /db_xref="GeneID:11502146"
                     /db_xref="GOA:G8ZSW7"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR015679"
                     /db_xref="InterPro:IPR016555"
                     /db_xref="InterPro:IPR025202"
                     /db_xref="UniProtKB/TrEMBL:G8ZSW7"
                     /translation="MGGVQGDSAVVPGIYEARELGGDIEEESQSDNGGDEDREAAYKN
                     LTFHGVPNSAVQDGPDEGEEDVERCRSPSGKRKSFIQDQQFDIWRKEFKQAFRKVAVL
                     SKLKAARNVKQQHRESLALQHAPIDEKDRYTQKLASDLLDSLAAGCPAALFASTHFLR
                     DEHGQRRAPLLLAMLGVRVEPLAPGYMSREEDEGNRNEVPKTEDNNANDDDDSSSIFE
                     GVFKKGEDGPKGLYKLHLEYGIGENRLKWCVIKSYKDLSNLHSRLKLVSFQENTMNKL
                     YIDHNRYHRFYLPHFPRIDDHETSMFVKQPTTRLDVAISSSSSSHSSTSSLNFSMDRI
                     KVKHLQDLIDEPEDLTQPMYLRIERYLRLLNIALCLRPQANRLFQFYELSPIGNLLSY
                     EEHHQSKQGYLIIRSTAKSQGWRVSHFKFNDFKEMIERHTTKWFLVRHSYILYVSDLY
                     STTPLDVFIMDSKFKIKFSGSRDGDENLTELDWNAKNSKIGTKLLITLQNGERKLQVI
                     CKSESSLKQWVSSISHAAHNTVWTKRHRFDSFAPIRRNAFCKFLVDGRDYFWALSEAL
                     RMAEDVIYIHDWWLSPELYMRRPVNGNQEFRIDRILKERAEKGVKIFIVVYRNVANTV
                     GTDSLWTKHSMLSLHPNIHLIRSPNQWLQNTYFWAHHEKMTVIDNTIAFMGGIDLCYG
                     RYDTPEHVLKDDHDLLKDQIFPGKDYSNARVCDFYDLDKPFESMYDRRKVPRMPWHDV
                     HMMTVGEAARDMARHFVQRWNYLLRQKRPSRPTPLLTPPSDFYRGAAENFTFLPDAET
                     ESTCEVQVIRSAGAWSLGLKETEKSIQNAYLKLIEASEHFIYIENQFFISTSHWDGVV
                     IENNIGDAIVDRIIRANSEGKTWKAFILIPLMPGFDSPIDQPEASSVRVIMQCQYQSI
                     SRGETSIFSRLKKLNIDPLQYIQFFSLRKWAAIGPQDKLVTEQLYVHAKVLIADDRSC
                     IIGSANINERSQLGNRDSEVAMIIRDTDLVKSKMEDKDYYAGRFAFELRKRLMREHLG
                     CNVDLVEIVERKFGHLEELAKMNYKTLNTLSGPSKKSDMMNSAMVEVAYREVFDVEYS
                     DSWKAKFSGNSDIKQHGILSFTTDDSGKQDDKPADGPLDSMDPNSYQKTKLPDRKASI
                     EKEIPSRSIKNYHSFNYRAGEENVGIRDNKPVSSDPRLTNNEKHKEDVEGLGLDGWKK
                     VTKKFKETVTEQLREWAFTALGSDLTIRKREQRRSFLPDKNDIEEYLCDESTSYGQRW
                     DMLKRISYLQHLSFKNKSANKQNSNSKTDREPRFGNESKSDHEAHVEILEDQELDDDC
                     IDDLLVQMAPNFEAREDASQKLFNLRFIDPYSFDDPICPSFYEDLWFSIALRNTLLFR
                     LVFHCQPDNAVQSWRDYKEYCRMSEEFSDNQDALIDLEKRPQNASHRASSTSAVPGKG
                     DLPLNKEAAVTVEKGTKIAEVPQEGLHRGAGKGDSPRPGETQSKRSKATALRMRLSGS
                     LLFGFNQRIFDKYTARRILERVHGHLVVFPTEWLAKETESKNWFYNVDRIPPIDIYD"
     gene            <247241..>248317
                     /gene="TDEL0D01280"
                     /locus_tag="TDEL_0D01280"
                     /db_xref="GeneID:11502147"
     mRNA            <247241..>248317
                     /gene="TDEL0D01280"
                     /locus_tag="TDEL_0D01280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680875.1"
                     /db_xref="GeneID:11502147"
     CDS             247241..248317
                     /gene="TDEL0D01280"
                     /locus_tag="TDEL_0D01280"
                     /inference="similar to DNA sequence:INSDC:YJL110C,YKR034W"
                     /note="similar to Saccharomyces cerevisiae GZF3 (YJL110C)
                     and DAL80 (YKR034W); ancestral locus Anc_1.250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680923.1"
                     /db_xref="GeneID:11502147"
                     /db_xref="GOA:G8ZSW8"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:G8ZSW8"
                     /translation="MTSEVSSSNVSNSEAQRGLYYPFPGGKPGVTLTSSCSSTSESMA
                     DGSASCSSSTSSPSSMEKGQSGSPICKNCLTSTTPLWRRDENGALLCNACGLFLKLHG
                     RPRPISLKTDVIKSRNRKGTHHHQHQQSDSVVEKQHTRTHSDEKKRKLPVQPVLKKQR
                     VVEDNESKDICSAANTLEILMSGDSMKPKIEPKLPPSQANTQLPHLSTLLGDVRSQSN
                     PPVSLVDQPMETSKSLHFEPKNKPYIHESIPVSTSSSTSSLVRGNSISQRYNSPPRAQ
                     TPPAGSAQRVSTLPAPVNVPLPCNEPQEKLPLNTVLQNEEDVIKLKTRINELELVTDL
                     YKRHIFELDEKCKTLQCEIQSLRN"
     gene            <248459..>249067
                     /gene="TDEL0D01290"
                     /locus_tag="TDEL_0D01290"
                     /db_xref="GeneID:11502148"
     mRNA            <248459..>249067
                     /gene="TDEL0D01290"
                     /locus_tag="TDEL_0D01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680876.1"
                     /db_xref="GeneID:11502148"
     CDS             248459..249067
                     /gene="TDEL0D01290"
                     /locus_tag="TDEL_0D01290"
                     /inference="similar to DNA sequence:INSDC:YKR035W-A"
                     /note="similar to Saccharomyces cerevisiae DID2
                     (YKR035W-A); ancestral locus Anc_1.249"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680924.1"
                     /db_xref="GeneID:11502148"
                     /db_xref="GOA:G8ZSW9"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:G8ZSW9"
                     /translation="MSRNPAAGLENTLFQLKFTSKQLQKQAQKASKEEKQESNKLKKA
                     LNESEEIARIYASNAIRKKNERLQLLKLASRIDSVASRVQTAVTMRQVSGSMASVCRG
                     MDKALQSMNLQQITMIMDKFEQQFEDLDASVNVYEEMGTNSDAVIVDADKVDELLNKV
                     ADENGLELRQSARLDNLPEIQQPEVNEEKEDKLAQRLRVLRG"
     gene            complement(<249141..>250790)
                     /gene="TDEL0D01300"
                     /locus_tag="TDEL_0D01300"
                     /db_xref="GeneID:11502149"
     mRNA            complement(<249141..>250790)
                     /gene="TDEL0D01300"
                     /locus_tag="TDEL_0D01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680877.1"
                     /db_xref="GeneID:11502149"
     CDS             complement(249141..250790)
                     /gene="TDEL0D01300"
                     /locus_tag="TDEL_0D01300"
                     /inference="similar to DNA sequence:INSDC:YJL111W"
                     /note="similar to Saccharomyces cerevisiae CCT7 (YJL111W);
                     ancestral locus Anc_1.248"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680925.1"
                     /db_xref="GeneID:11502149"
                     /db_xref="GOA:G8ZSX0"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012720"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:G8ZSX0"
                     /translation="MNFGNQTPTIVVLKEGTDASQGRGQIISNINACVAIQEALKPTL
                     GPLGSDILIVTSNRKTTISNDGATILKLLDVVHPAAKTLVDISRAQDAEVGDGTTSVT
                     IIAGELMKEAKPFLDEGISSHVIMKGYRRAVDLATAKIQEICVDISNNENDSRQLLER
                     CAKTAMTSKLIYKNADFFVKMCVDAVLSLDREDLDDKLIGIKKIPGGSMEESLFINGV
                     AFKKTFSYAGFEQQPKKFTNPKILSLNVELELKAEKDNAEVRVEHVDDYQAIVDAEWQ
                     LILDKLTQIEVSGANIVLSKLPIGDLATQFFADRNIFCAGRVSSDDMDRVILAVGGSI
                     QSTTTDIREEHLGTCEVFEEMQIGSERYNMFQGCPKAKTCTLLLRGGAEQVIAEVERS
                     LHDAIMIVKRALQNKLIVAGGGAVEMEISRYLRNYSKTIAGKQQLVINAFAKALEVIP
                     RQLCENAGFDAVEILNRLRMAHSKGEKWYGVDFESESVGDNFAKFVWEPALVKINALN
                     SATEAANLILSVDETITNKESQPANAGMAPPPGRGRGLPMQ"
     gene            complement(<251119..>253248)
                     /gene="TDEL0D01310"
                     /locus_tag="TDEL_0D01310"
                     /db_xref="GeneID:11502150"
     mRNA            complement(<251119..>253248)
                     /gene="TDEL0D01310"
                     /locus_tag="TDEL_0D01310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680878.1"
                     /db_xref="GeneID:11502150"
     CDS             complement(251119..253248)
                     /gene="TDEL0D01310"
                     /locus_tag="TDEL_0D01310"
                     /inference="similar to DNA sequence:INSDC:YJL112W,YKR036C"
                     /note="similar to Saccharomyces cerevisiae MDV1 (YJL112W)
                     and CAF4 (YKR036C); ancestral locus Anc_1.247"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680926.1"
                     /db_xref="GeneID:11502150"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8ZSX1"
                     /translation="MSKNEQISQLGNALSTTAAAIFGSQNMEDTILSYSSPYKKVLHQ
                     AMTNLGSDGAIVSFRKRNNASGSFQSLSSAENGKSFFKNKFTDSKTSFKVLSYLSDDL
                     LKDIPNERLDLDVSSHNRLLKENGESKSKKKDTNQGPSLFQGFEASLPIIDEALNNRG
                     EGIKTIKESEEQGNEGYYDMGDRFMLPQGIKTEKITESYSKKFLNGLSEQVSDNLDLL
                     EIQKKVAASEIREIDLKLQHLKLMRESVFKRIARIEQNELFLENNLNLVRDRQSFLEE
                     YGLEVDSEVENESSSESLTSVSRSIADDQVIEQETSEGEQDQEPDDGANSDDHTDNAK
                     STNISPLMSRSIYQKLKTKEENPSKKLHNFYHDHNKKHRKTFPTLQQYYPRGSIINEF
                     KEAHNDSITCLDFDVPFGTLCTAGHLDHSIKIWDLSQKKQTGQMAGHLASISCMQIDN
                     RYNMLITGGRDAVLKMWNLNLGAQLYQEESDAIPSSETACVYTFDSHVDEITALSFDS
                     GHLVSGSQDRTVRQWDLTSGKCLQTIDLSFAGRLSQTSSNSGSGLLTSTDTSPIIGAL
                     QCFDAALATGTRDGAVRLWDLRSGKIIRTLEGHTGAVTSLKFDSKNLITGSLDRSVRI
                     WDLRTGTLADAFAYESPVLSLDFDFQSIVVANNEQTIQVVDRDDDKHWECGEENKYTD
                     STAQFVRYKDGYMVEGRSSGDVVAWAL"
     gene            complement(<253429..>254301)
                     /gene="TDEL0D01320"
                     /locus_tag="TDEL_0D01320"
                     /db_xref="GeneID:11502151"
     mRNA            complement(<253429..>254301)
                     /gene="TDEL0D01320"
                     /locus_tag="TDEL_0D01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680879.1"
                     /db_xref="GeneID:11502151"
     CDS             complement(253429..254301)
                     /gene="TDEL0D01320"
                     /locus_tag="TDEL_0D01320"
                     /inference="similar to DNA sequence:INSDC:YKR037C"
                     /note="similar to Saccharomyces cerevisiae SPC34
                     (YKR037C); ancestral locus Anc_1.246"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680927.1"
                     /db_xref="GeneID:11502151"
                     /db_xref="GOA:G8ZSX2"
                     /db_xref="InterPro:IPR013966"
                     /db_xref="UniProtKB/TrEMBL:G8ZSX2"
                     /translation="MSETLDLCIEEINRSIESISTLYFKPPGIFHNAVVHDQQGRGYS
                     SIITKLIRDCNPKEELSLFKMDKQERIHTRKDGKRGNLDYLVERDAHLRRNRHIGIPD
                     EKPIIQVPKEFYLKQHDEALAEKRKLVKGYNFDMESGVNSSGSNVYDLLLSKFKDEEV
                     VSLIHALQNGSVLMGSEDGESRRKTMFVEDFPTEAILQVLHEVSTQWPLAEYKQAYSQ
                     HLNDYSNFNSEIELLRGEIQLQEEQLHLHKVNSSSSHVVARLIEKERRDIDALEKELI
                     RQQELIKNTIETSG"
     gene            complement(<254422..>255582)
                     /gene="TDEL0D01330"
                     /locus_tag="TDEL_0D01330"
                     /db_xref="GeneID:11502152"
     mRNA            complement(<254422..>255582)
                     /gene="TDEL0D01330"
                     /locus_tag="TDEL_0D01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680880.1"
                     /db_xref="GeneID:11502152"
     CDS             complement(254422..255582)
                     /gene="TDEL0D01330"
                     /locus_tag="TDEL_0D01330"
                     /inference="similar to DNA sequence:INSDC:YKR038C"
                     /note="similar to Saccharomyces cerevisiae KAE1 (YKR038C);
                     ancestral locus Anc_1.245"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680928.1"
                     /db_xref="GeneID:11502152"
                     /db_xref="GOA:G8ZSX3"
                     /db_xref="InterPro:IPR000905"
                     /db_xref="InterPro:IPR017861"
                     /db_xref="UniProtKB/TrEMBL:G8ZSX3"
                     /translation="MVNLNTVRPKNGRDYYIALGLEGSANKLGVGVLKHPLLPQHEDG
                     DLSFNCHAEILANVRDTYITPPGEGFLPRDTARHHKNWCIRLIKQALKEASIVNPSLD
                     IDVICFTKGPGMGAPLHSVAIAARTCSLLWEVPLIGVNHCVGHIEMGREITKAVNPVV
                     LYVSGGNTQVIAYSEKRYRIFGETLDIAIGNCLDRFARTLRIPNAPSPGYNIEQLAKR
                     CANKETLLELPYTVKGMDLSMSGILAYIDSLAKDLFRGNKKNKTLFDPKTGEQKVTVE
                     DLCYSLQENLFAMLVEITERAMAHVNSNQVLIVGGVGCNVRLQEMMQMMCEDRANGQV
                     HATDERFCIDNGVMIAQAGLLQYRMGDVVKDLKETVVTQKFRTDEVYVAWRE"
     gene            complement(255715..255786)
                     /gene="TDEL0Dtrna1D"
                     /locus_tag="TDEL_0Dtrna1D"
                     /db_xref="GeneID:11502153"
     tRNA            complement(255715..255786)
                     /gene="TDEL0Dtrna1D"
                     /locus_tag="TDEL_0Dtrna1D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:11502153"
     gene            256828..256900
                     /gene="TDEL0Dtrna2R"
                     /locus_tag="TDEL_0Dtrna2R"
                     /db_xref="GeneID:11503623"
     tRNA            256828..256900
                     /gene="TDEL0Dtrna2R"
                     /locus_tag="TDEL_0Dtrna2R"
                     /product="tRNA-Arg"
                     /note="codon recognized: CGU"
                     /db_xref="GeneID:11503623"
     gene            complement(<257445..>259457)
                     /gene="TDEL0D01340"
                     /locus_tag="TDEL_0D01340"
                     /db_xref="GeneID:11503643"
     mRNA            complement(<257445..>259457)
                     /gene="TDEL0D01340"
                     /locus_tag="TDEL_0D01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680881.1"
                     /db_xref="GeneID:11503643"
     CDS             complement(257445..259457)
                     /gene="TDEL0D01340"
                     /locus_tag="TDEL_0D01340"
                     /inference="similar to DNA sequence:INSDC:YJL101C"
                     /note="similar to Saccharomyces cerevisiae GSH1 (YJL101C);
                     ancestral locus Anc_1.265"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680929.1"
                     /db_xref="GeneID:11503643"
                     /db_xref="GOA:G8ZSX4"
                     /db_xref="InterPro:IPR004308"
                     /db_xref="UniProtKB/TrEMBL:G8ZSX4"
                     /translation="MGLLSLGTPLEFLESRDQNENVRQNGVEQLLYVFQAASKRDNDP
                     LYWGDEIEYMMVDFDDNKQNAMLDVTHDEVLTTLNTDEYALCAAHNVHFHPEYGRFML
                     EATPNVPFKGYPGEYIEFNMQQRRYVAGLAYDKLPKNGSERLELLTLAVFPRMGCTDS
                     VNIPDVWKHKKNTASCSLFLPDEVINRHIRFPTLTKNIRTRRGEKVCIQVPMYKDRNT
                     PEKDDTVRERDWFPREDKESKLASKPGFIYMDAMGFGMGCSCLQTTFQAPNLDKARIL
                     YDFFANFAPVTLALSAASPIFKGWLADQDVRWSVISDAVDDRTPQERSVQPLLPEYNK
                     DGYGGIAPELYDKVQRIPKSRYSTVDLFLGGSKFFNRSYNDTEVPVNERVLNSLLENH
                     IAPLDYDLAKHFAHLYIRDPLVIFQENIYQDNKTSTNHFENIQSTNWQTLRIKPPTQE
                     AVPDNKDVPGWRVEFRPLEIQLTDFENAAYSIFTYLLAEYLLTFSEEVNPYMPMSQIW
                     QNMETAHKRDALREEEFYWKDSFEADNGKTSELTINEIFHNKNNGIFAKFINPILCHK
                     GFVHERWEELKESSEHLRLYYYLKLISNRASGKTPSIAKFLRDFVLDHKDYKQDSRVS
                     KIINYDLLELCGRITRLDDSNGELTKLFGSEIATYLPRSKLKVKKN"
     gene            <259935..>261524
                     /gene="TDEL0D01350"
                     /locus_tag="TDEL_0D01350"
                     /db_xref="GeneID:11502154"
     mRNA            <259935..>261524
                     /gene="TDEL0D01350"
                     /locus_tag="TDEL_0D01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680882.1"
                     /db_xref="GeneID:11502154"
     CDS             259935..261524
                     /gene="TDEL0D01350"
                     /locus_tag="TDEL_0D01350"
                     /inference="similar to DNA sequence:INSDC:YJL100W"
                     /note="similar to Saccharomyces cerevisiae LSB6 (YJL100W);
                     ancestral locus Anc_1.266"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680930.1"
                     /db_xref="GeneID:11502154"
                     /db_xref="GOA:G8ZSX5"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="UniProtKB/TrEMBL:G8ZSX5"
                     /translation="MKQADHCGGSNLVTSNTYDWLQYRDELDERRKGSGGNLGVLDSS
                     FPHDHWEIQYSVFKPLERYNTSLPSLDRGRAKQHFLDVVKECIEALNVKRIELSRIKT
                     GSSGSYFVYGTEGQTLGVFKPKEEEPYGPLSPKWSKWAHRTFFPCFFGRSCLIPNLGY
                     ICESAACLLDQRLQTNLVPYTDTVILESSKFYDKRQTWLFLCTVEPRKQKKLGSFQLF
                     LKDYVGADEFLDKFPLPGMYRDNLPKMKKDQSSATSGSCDENLATVVSTTPDKFEWTG
                     ANLTKFRLELEKLIILDYIMRNTDRGLDNWMIKVEPVNDGFEWDIKLAAIDNGLAFPW
                     KHPDEWRSYPYGWLYLPLQILAQPFSEATRSHFLPILTDVKWWDESYREFTSLFSKDS
                     DFKLRMWKKQWAVLKGQAFNVVETLKDLRQGPLELVRRTRCLVVEETMQVPTLNPIMS
                     AAISESMPLEASSPMALYSTPKGVSEHTQHLSGISPAAFPSATNCANPHDHNEEHIST
                     MKTVIIERLQVVNSTPVFTWY"
     gene            <261767..>264034
                     /gene="TDEL0D01360"
                     /locus_tag="TDEL_0D01360"
                     /db_xref="GeneID:11502155"
     mRNA            <261767..>264034
                     /gene="TDEL0D01360"
                     /locus_tag="TDEL_0D01360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680883.1"
                     /db_xref="GeneID:11502155"
     CDS             261767..264034
                     /gene="TDEL0D01360"
                     /locus_tag="TDEL_0D01360"
                     /inference="similar to DNA sequence:INSDC:YJL099W,YKR027W"
                     /note="similar to Saccharomyces cerevisiae CHS6 (YJL099W)
                     and BCH2 (YKR027W); ancestral locus Anc_1.267"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680931.1"
                     /db_xref="GeneID:11502155"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015374"
                     /db_xref="UniProtKB/TrEMBL:G8ZSX6"
                     /translation="MNLLRLAKSNSSKPTVAKNSKQHGASGFFPEDDVLNSQESKKPN
                     ASPYSLKEFPRIIEHRFGESLGNRTRMLSELVASEKLRLGPPDMVHVTLLDKFYKEEI
                     GEYFYITGVDLSSESMPIAFLKMMRFDRSERQRSDENQISTYCCVNIFRQLDIRIRYE
                     SDNNYQINAVDCRTGTTTVQLSDEIWQETFVSCCLRSLITNVDSVRKLPGLVEYPFAI
                     SHGGINNCQRVIKTLCQFLPRFLECGWNSSKSVHATILHNYLTEALMLFLSVAPGLID
                     YAIETLRELIKDDPSNEFYYCIVLIAIMEQDGEKDLEMISLLNQVLEPLLLELDNAPP
                     RDSSSLLLINCIAELLNLQARFLLKREDYEMALSVAKISSGLSSDSFDAWFYLAKCYI
                     KLEDYEQALMAINCMPHLPNFDKIDQALCYDPTLIGYYKRPLGGTVSRCDLTSFEISN
                     ISGTLKISKEAELREIIFGRIVMPNESERGKITEIWNNSCLSLGPIYGPHSHNLINFV
                     SPQEVKSVADIKLLARNTMAKLLSWFDEKVYELLLEISSKLGWNGLLKLRSDLFVMEK
                     EYSDENTVKLNPDGTIPTNLKRKRLCERWLDQQFLDLYEDLRISTSSDGRRDVLYSGL
                     EWELLGLILLRTWNWQDAVACLRTSIMARFDIVSCKKLLALYMAQDSHDTNAMDPDVV
                     LELVTQKISYECRFYDSFQIQNLQVLYKLSEHLGTNIVRNRVMALPLAERGIVSMVES
                     MLDWVKEMTASNRID"
     gene            <264344..>267565
                     /gene="TDEL0D01370"
                     /locus_tag="TDEL_0D01370"
                     /db_xref="GeneID:11502156"
     mRNA            <264344..>267565
                     /gene="TDEL0D01370"
                     /locus_tag="TDEL_0D01370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680884.1"
                     /db_xref="GeneID:11502156"
     CDS             264344..267565
                     /gene="TDEL0D01370"
                     /locus_tag="TDEL_0D01370"
                     /inference="similar to DNA sequence:INSDC:YJL098W,YKR028W"
                     /note="similar to Saccharomyces cerevisiae SAP185
                     (YJL098W) and SAP190 (YKR028W); ancestral locus Anc_1.268"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680932.1"
                     /db_xref="GeneID:11502156"
                     /db_xref="InterPro:IPR007587"
                     /db_xref="UniProtKB/TrEMBL:G8ZSX7"
                     /translation="MSGSFWKFGQDYTTESAISKLLNRAFIKINDEESRPEDSKENKN
                     SGILSIDEKNLEKDEHKEDNEDEEILDDDEEEEHSDTGKLEDEDVEESEANDSCLPTS
                     EAEYADYRPNLDVLDELLDDEELYTELMCSNFKLLIFLKYPEVLSKLIDYVTNQSVLE
                     EDVDGSDLPEEVNDDPVIEEEGAVFEKGKKDDESKVEEEQSADNISEISEETSITLPP
                     ESEEQVESRRACMAAEILSADVWPISSAIMENEALLPRLWSIMDHSSPLSIVASTYFM
                     KINERLLDMDITGMMNFILKQENVADRFLNHIVNPPLMDFLLKVISTDKPDTPTGFIE
                     TFKKQDLIPKLLDHLNPEYETAVQSAAGDFLKAFVTISANSNNELASGIGPNELTRQL
                     VSEEMMEKLIKIMLKGGTSLSNGVGIIIELIRKNNSDYDFVQVMYTTLETHPPSDRDP
                     IYLGHLVKLFAKYMPLFDNILVETTLPPLETPFGSIEPLGFERFKICELVAELLHCSN
                     MTLINEPIGESLVHDRDIARTKLLSSERENDKEVEKKEEPGDEQQEVSKKMASLKLES
                     RETEDSDSNSDLEGNAEKQEVENTDVEIHSEESSEPEVTEKSLRENPIVGDQLKIALH
                     DTKIITTILNMFFRFSWNNFLHNVVFDIVQQIFNGPLKTGYNRFLLADLLVQANITKL
                     IMDGDKKCADYEKETGLRLGYMGHLTLIAEEVAKFSAYVEEMKVTFSDSAIWESLNEP
                     SWKEYMETVLAETREKYNTVLGDFADDEEEEGNADDVINEHDIGEEADESGDREGNIN
                     GSNSYRNFLESAHEDNEEVNGEDNDLESSTYYEYINGDGSKTRLHLNPSIDYDAPHEN
                     VAGELLANSDTADEDNRFSNYMSHQLGRSFNSSHYGADEFADDQDDEDADDENTESND
                     ETWTAASDAFSLNGTTRRSAPSNAETYDKNVFQHQFELDGVGDEDDYMDPNDDGQSYA
                     KPNHPLYSNIITPTASHRPTNSTYDRNGFNDAEDDISDDSDAELEDLGAGGVKDSSIG
                     EDDTEAGYSLCRSTSKDNLSWDENEQDRLMEVVNYNRQQNTGK"
     gene            <267761..>268417
                     /gene="TDEL0D01380"
                     /locus_tag="TDEL_0D01380"
                     /db_xref="GeneID:11502157"
     mRNA            <267761..>268417
                     /gene="TDEL0D01380"
                     /locus_tag="TDEL_0D01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680885.1"
                     /db_xref="GeneID:11502157"
     CDS             267761..268417
                     /gene="TDEL0D01380"
                     /locus_tag="TDEL_0D01380"
                     /inference="similar to DNA sequence:INSDC:YJL097W"
                     /note="similar to Saccharomyces cerevisiae PHS1 (YJL097W);
                     ancestral locus Anc_1.269"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680933.1"
                     /db_xref="GeneID:11502157"
                     /db_xref="InterPro:IPR007482"
                     /db_xref="UniProtKB/TrEMBL:G8ZSX8"
                     /translation="MARKAVVSPFGYLPLYNLLSAFAWGYILYSVVSIYPKVGQPHFY
                     EETKKTVTYVQCGAIIEIINSALGIVRSPLLTTFAQVASRLMIVLGIFEGLPQTPAAH
                     TMVYVTLLSAWSATEVVRYMFYFYSLCAKEGPSILLTFLRYNLFWVLYPLGVASELLI
                     VYSALPLAESNYGAVYKWFLVASMLAYIPGFPVLFGHMVTQRKKVMKGLRNGSQAKKQ
                     "
     gene            <268713..>269210
                     /gene="TDEL0D01390"
                     /locus_tag="TDEL_0D01390"
                     /db_xref="GeneID:11502158"
     mRNA            <268713..>269210
                     /gene="TDEL0D01390"
                     /locus_tag="TDEL_0D01390"
                     /product="mitochondrial 54S ribosomal protein YmL49"
                     /transcript_id="XM_003680886.1"
                     /db_xref="GeneID:11502158"
     CDS             268713..269210
                     /gene="TDEL0D01390"
                     /locus_tag="TDEL_0D01390"
                     /inference="similar to DNA sequence:INSDC:YJL096W"
                     /note="similar to Saccharomyces cerevisiae MRPL49
                     (YJL096W); ancestral locus Anc_1.270"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL49"
                     /protein_id="XP_003680934.1"
                     /db_xref="GeneID:11502158"
                     /db_xref="GOA:G8ZSX9"
                     /db_xref="InterPro:IPR028909"
                     /db_xref="UniProtKB/TrEMBL:G8ZSX9"
                     /translation="MFLRRLAQPLCKFTVLPPLRTAVNHSVVRNFHSTRCALQEIPEA
                     SKQIDLKPLKLSNELYAVFKIHNRPYLVTEGDKVILPFKVKEADVGDVLSLTDVVTIG
                     SRNYRLVDYPIDSSLYTLKATVLEKTKRAFEVREVTKRRNRRVRHAKSKGDLTVIRIA
                     ELKLN"
     gene            <269367..>273656
                     /gene="TDEL0D01400"
                     /locus_tag="TDEL_0D01400"
                     /db_xref="GeneID:11502159"
     mRNA            <269367..>273656
                     /gene="TDEL0D01400"
                     /locus_tag="TDEL_0D01400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680887.1"
                     /db_xref="GeneID:11502159"
     CDS             269367..273656
                     /gene="TDEL0D01400"
                     /locus_tag="TDEL_0D01400"
                     /inference="similar to DNA sequence:INSDC:YJL095W"
                     /note="similar to Saccharomyces cerevisiae BCK1 (YJL095W);
                     ancestral locus Anc_1.271"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680935.1"
                     /db_xref="GeneID:11502159"
                     /db_xref="GOA:G8ZSY0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZSY0"
                     /translation="MPFLRKITGSGHSHSRSGSASSIKTWSLDSPTSLERHSTRPTKS
                     SRKSGTSEYRNSVASSGSCGNSNTAGHDNGTGLLVVPDIDEFTNSPQMNDKNNLKNDS
                     RNPSGGSINSLSFDKLILSWDPTDPDEWSMQRVSSWLKFHEFPESWIVFFKKYQLSGH
                     KFIKLLAHDNFAVYEKYLPQSKYASYTRFQYLLKQTMSKNVTNNHIRQKSTEKAKESR
                     SSSESLKSKHKKANSLQEATSSRSASESALSPTTLNSSKSDDKLGGQPLRTHQKTSSA
                     SALYRRSLISLRGSSTGNLLEGKTPSNIKLNIPSRPQSIVETNGSSKPGSPPNSPHYP
                     GLFRRHQKSSSSESSLLNALFGSQSNVTIDDEQDKSSYQTANASADSLSKGKHNAIEG
                     NTVSSNISSPNPIEEKSSLWGKLRRRSQLIGPANVPQSPQLVTLNPASSLSTPNIGTP
                     PTASDASIGTLTPKYTDVKTAQATPSSSKRHPIYSTDRSNRNDNNDTYTPASFLLDKK
                     FYPLKTKDSQDDIYILITKDNRSFIPMNIGMIESLEELKESVTLMLSVNHNDITIHLT
                     DFGCEIGSALPDDTLESLRSSLFCNTAGKLYIKDQSKSSSRPRAATLSNEMNHSVKSL
                     KSKNSFRSVTNSMMYSTDEVSIVTSSSDLTSFDDHASGTARRYPQTPSHYYDAVAANN
                     GEEINYWNYKDPAQEASKSPRPLRSSSQVKKEKYPPFELAPEKGRMGSFQILRKEDSN
                     EIDFNKRRESPYVQPELAPRREAPKPPTNSSPQKSLSISSRVSTPRLRRSSTRRKAPG
                     NPKLAPPSPSGEAVSPSSDSVVNSYTPGSSHVLVPQPYKGASEGSRKLKTEDEQMASS
                     ISAFISKQRTNRSDSIASNSGSVRHMRSPPLGRGNSRRIVSSASAADVFDENDITFAD
                     APEFTDSGSDSSDDIIWSTSGKSRETETEKEGIQRNSSGDNSQDRSQSNEENDGGAAL
                     NRKMTLRPSPEVVYQNLEKFFPHANLDKPVLEGVTPPASPRSVDTIGMSRAFGLSNAG
                     NSSNSNTPAISPNKSTKQSFREDEKGFLRDRLPKRAKTIRTIAHEASEARKQSVKLGR
                     QNTKMWGTKTVEVTDKRMVSINNTKNSRGQYKEFAWIKGEMIGKGSFGAVYLCLNVTT
                     GEMMAVKQVEVPKYGSQNEQIIHTVEALRAEMSTLKNLDHLNIVQYLGFEAKDHMNSL
                     FLEYVAGGSVGSLIRMYGRFDEVMIKHLTTQVLRGLSYLHSRGILHRDMKADNLLLDQ
                     EGVCKISDFGISRKSKDIYSNSEMTMRGTVFWMAPEMVDTAQGYSAKVDIWSMGCVVL
                     EMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQSGRDFIDACFQIDPEARP
                     TADKQLSHPFILEKENFDFKSTKLAELIKSNDKVNSTKLRVSSHEKSQLEL"
     gene            complement(<273697..>276306)
                     /gene="TDEL0D01410"
                     /locus_tag="TDEL_0D01410"
                     /db_xref="GeneID:11502160"
     mRNA            complement(<273697..>276306)
                     /gene="TDEL0D01410"
                     /locus_tag="TDEL_0D01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680888.1"
                     /db_xref="GeneID:11502160"
     CDS             complement(273697..276306)
                     /gene="TDEL0D01410"
                     /locus_tag="TDEL_0D01410"
                     /inference="similar to DNA sequence:INSDC:YJL094C"
                     /note="similar to Saccharomyces cerevisiae KHA1 (YJL094C);
                     ancestral locus Anc_1.272"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680936.1"
                     /db_xref="GeneID:11502160"
                     /db_xref="GOA:G8ZSY1"
                     /db_xref="InterPro:IPR004771"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="UniProtKB/TrEMBL:G8ZSY1"
                     /translation="MAVGGVISGGNPFIWNSGSPLTLWLFQVCLILVTCNLVNIPFSK
                     IRQPKVISEVIAGVILGPTVLGQIPNFTKTMFPAASIPGLSLTSNLGIILFMFFLGLE
                     VDKGFIKKHLKKALSIGLFSLTIPFGFGCLFAVPLYNTYMGNHTETGHVKFTVFMVFI
                     AVSISVTAFPVLCRILNELCLIKERAGIVVLGGGIINDILGWILLALSVILSNSTADP
                     VNTVYILLCTLGWFLFISYPIGFVLRWALVRTHELERSKPSPMATMCVLFIMFISAYF
                     TDIIGVHPIFGAFMAGLIVPRENNYVVKLAERMEDIPNIVLIPIYFAVAGLNVDLTLL
                     NEGRDWGYVFASIGIAISTKIVSGSVAARIHGLFFRESLAVGVLLSCKGIVEIVVLTV
                     GLNAGIISRKIFGMFILMALVSTFLTTPLTLLVYPESYRRDLRTRMNKEIESVEESTN
                     EVSNIEEKESTVMSLKSFEDVKNFHITKIINITSSTETISSSLELLNHLLIGQVVTGP
                     APGTSRGKELSRKSSNSTVKPSFSKVKKLSRVWSRGDDSETALTIIEEDPLGFELEIP
                     LKAVHLRLLTERTADLLQSSSLQNDDQESTVNTDSILQIFDIFSRLSRIQFSSEVIFS
                     TVRERAANILSMQKNPTDLVVLPLRGATSEINGSEISSGEHYGDFSQIYSHILGLNDL
                     PANFFGTIFSSLKASSAVLISNSGDRAYINRFKKRYFNLLLPRPILTSSDFLALHLLL
                     LICYHNGAGGDHPHGTIYINSKNSEFVDQLNDLYADRNWYNETIVNITSVNYGQESHF
                     DSASASFVEAVMDSSLAETPHEDNLEESTFILSESFSQGETSFSEEAKSAILHGANRK
                     FNVLITHYYSDAQ"
     gene            <277050..>280451
                     /gene="TDEL0D01420"
                     /locus_tag="TDEL_0D01420"
                     /db_xref="GeneID:11502161"
     mRNA            <277050..>280451
                     /gene="TDEL0D01420"
                     /locus_tag="TDEL_0D01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680889.1"
                     /db_xref="GeneID:11502161"
     CDS             277050..280451
                     /gene="TDEL0D01420"
                     /locus_tag="TDEL_0D01420"
                     /inference="similar to DNA sequence:INSDC:YJL092W"
                     /note="similar to Saccharomyces cerevisiae SRS2 (YJL092W);
                     ancestral locus Anc_1.274"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680937.1"
                     /db_xref="GeneID:11502161"
                     /db_xref="GOA:G8ZSY2"
                     /db_xref="InterPro:IPR000212"
                     /db_xref="InterPro:IPR013986"
                     /db_xref="InterPro:IPR014016"
                     /db_xref="InterPro:IPR014017"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZSY2"
                     /translation="MASNATLEGIIATLNEQQRVAVQFDHTKALQVIAGPGTGKTKVL
                     TSRVAYLLLHHRIKPQDIIVTTFTNKAAKEMIDRLNTMLQGSSIRVSDIMIGTFHSVC
                     LKILTRYGHKIGLRKDWRIIEESEIDKIMQEMIEKMPDTIRDQANSMARKVNLCLPKR
                     GSDEWAVHAKPVRKHISRLKAYAILPEEYNKDPNYDQALAYFYDKYQAELSKVNALDF
                     DDLLMYAFRLLSRERCLPYVQHVLVDEFQDTNGIQMDLMFLFAKANHHLSRGITVVGD
                     PDQSIYAFRHALALNFDAMSNKCPIECSRVVLVENYRSSQKILDTSETLIKQQVKGRA
                     DRLPLRAQFDCEFAPVYIEFPAAFLEGPSLIREMLYLKALPNMFTYNDFAILVRQRRQ
                     IKNVETALIEHGIPYKIIRGHAFWELKETVSMLNLLKCVYSESEKHAILSALQYPARG
                     LGAASIGKIKIALDTISGTAFQGLRQICDKKVDLVIPAKGRTALKEFINMIEYCQKLS
                     EAPNSTTLSDIFDRLYDGSGMRHEYLYLDGKKKSEIEGDQEPNFSNPRHKNVMLLKNY
                     FIGTDMASLETSADSSLAERSSETQRHGVSITTKSGINNHIRNFFLSLSLFSIEANDS
                     ELDKAKRIEQEKVGFVTISTIHGAKGLEWPVVFIPGCEEGIIPSIFGDDKAQDGGEND
                     DEEDGDEDKNDIKRRNDTPASPKSKLVNIDNSLDEERRMFFVAQTRAKHLLYHSTAAS
                     ERSEGPSRFLTEELLSTMADQQKLFDSVASIKNFYLHMGKKPPVEGKFKLKRLVEDYA
                     RFIENNRERFVWNGEFIVHTFKFDLTKNSDSTFSSGFTTAAAQLQNSADSPTVTQTVF
                     GNSARSSRTSSPTRSKYSISSSPKKMYAPQSKSRGEMSSTSPVKEFAPVSPTGSPTKK
                     RSFAPCYRPTRNAPNALQCNRRLFAPGQDVPKLKSEISASSPSEESSLLSRNISKLKE
                     SNATISDRKSEDARVVKMENPEEREAFVSTFKKTYNPQRSKRRLVTTPINITDTDTSS
                     HIKAEDKTFDYSVSNDDDGLNTTAAELLHNPDDMIIDTRPIISNAKTLADAAKKSSRS
                     EEDREKRSSQKVKKENSSSQIDIFSQLSRAKKKAKLSDGEIIIID"
     gene            complement(<280580..>282034)
                     /gene="TDEL0D01430"
                     /locus_tag="TDEL_0D01430"
                     /db_xref="GeneID:11502162"
     mRNA            complement(<280580..>282034)
                     /gene="TDEL0D01430"
                     /locus_tag="TDEL_0D01430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680890.1"
                     /db_xref="GeneID:11502162"
     CDS             complement(280580..282034)
                     /gene="TDEL0D01430"
                     /locus_tag="TDEL_0D01430"
                     /inference="similar to DNA sequence:INSDC:YJL091C"
                     /note="similar to Saccharomyces cerevisiae GWT1 (YJL091C);
                     ancestral locus Anc_1.275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680938.1"
                     /db_xref="GeneID:11502162"
                     /db_xref="GOA:G8ZSY3"
                     /db_xref="InterPro:IPR009447"
                     /db_xref="UniProtKB/TrEMBL:G8ZSY3"
                     /translation="MSTLKERKEDFVTGLNGGSILEINLITSVALTAYVCWNLLSIRG
                     NINVFIDFALNWITLLLSITVYSNAISLLQILIVVPCVVLFYISSSKSKSQKTETNSR
                     EKQPKPFQLEKKPFITVYRGSMLVLTALAILAVDFQVFPRRFAKVETWGTSLMDLGVG
                     SFVFSNGVVSSRVIIKEKMNPSSRPCMIKRALNALRSGGTLLIIGLLRLYFVKNLEYQ
                     EHVTEYGVHWNFFMTLSLLPPVLVLLDPITEWIPRPAIAALISVMYELVLIKGDGFLE
                     FLILAPRRNFIEANREGIVSFLGYCSIFLWGQTTGFYVLGNKPTINNLYRPSVESLQR
                     PSGKRSVTMWNNLSTVSPLWGLFIWTFIHTATAQGILSHDPYYASRRFANLPYVSWVV
                     AYNTGLLFFYCLIDKLFSGTNKGCAVPPSLDALNSNGLVMFLLANLLTGATNMSMSTI
                     DASVGTAMIVLTMYALVIAAISLFLYRNKIFVKL"
     gene            complement(<282138..>283949)
                     /gene="TDEL0D01440"
                     /locus_tag="TDEL_0D01440"
                     /db_xref="GeneID:11502163"
     mRNA            complement(<282138..>283949)
                     /gene="TDEL0D01440"
                     /locus_tag="TDEL_0D01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680891.1"
                     /db_xref="GeneID:11502163"
     CDS             complement(282138..283949)
                     /gene="TDEL0D01440"
                     /locus_tag="TDEL_0D01440"
                     /inference="similar to DNA sequence:INSDC:YJL090C"
                     /note="similar to Saccharomyces cerevisiae DPB11
                     (YJL090C); ancestral locus Anc_1.276"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680939.1"
                     /db_xref="GeneID:11502163"
                     /db_xref="GOA:G8ZSY4"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:G8ZSY4"
                     /translation="MKPLLNLTFCPTGFNDEDTSRSVSKKILKLGGFYSRDLTRQANV
                     LVIGKTRQTNKYRFTVRYRHDVVFIDLQTIDTLYERWLAGDDITQSGSLKPGISSTEN
                     ILNLLRSRYSAPPLADFYIFIGRIASYPVDQLESMCQAMKCYKCNSSHFVKDCKSRHD
                     QKTVVFISDTLQGARVQAAIEQGIPIVHYKWILDCQRRNATLEYDPYYLVSNIPENTP
                     FEKIGRESCECWGDLINPPPLLQGTAAVNPSVNLFQKFKSKGDKIWEKAMSKSEPPPP
                     LDDSLVRLPPPEQTLNDESREDSIFKSSTFHISKQFPESHSEILRRVIDQNGGLLLSD
                     SQYLVVPSNVPLDCMEEAESDQTLVTEFFIERCLHYKTLISPPDSWSKPFLRTTDVRI
                     LPSPTLLHDESQPLQVAITGFHGVELLHLNKILKTMEPMGINFVEYLNKKTDLLLINL
                     PSLPSIPHDHPLWKNQYRDLFTTQLECDNNISNQVLRNSLKRKIQFVKQEHSIPVVTP
                     AFLIDLFAHTSHLKTKKQTVFLNNISWCIICPRGAKESFTIELTSNDASVEYTMDKES
                     RNVRKRHSATPPNEAKKKIHLPNKELDRQADPPAFST"
     gene            <284869..>287706
                     /gene="TDEL0D01450"
                     /locus_tag="TDEL_0D01450"
                     /db_xref="GeneID:11502164"
     mRNA            <284869..>287706
                     /gene="TDEL0D01450"
                     /locus_tag="TDEL_0D01450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680892.1"
                     /db_xref="GeneID:11502164"
     CDS             284869..287706
                     /gene="TDEL0D01450"
                     /locus_tag="TDEL_0D01450"
                     /inference="similar to DNA sequence:INSDC:YJL089W"
                     /note="similar to Saccharomyces cerevisiae SIP4 (YJL089W);
                     ancestral locus Anc_1.277"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680940.1"
                     /db_xref="GeneID:11502164"
                     /db_xref="GOA:G8ZSY5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8ZSY5"
                     /translation="MTGSVSASEKESGGAGNSEEGSAAKQQVTKRKYGNLEAPVKEKT
                     LLVTKNERVRHSHACDRCRLKKVRCDGLKPSCSQCSRANFRCTTSDKLTRRGFPKGYT
                     EMLELEVVRLQKLVDEGAKSAGGTDNEVKLEEPKSRAPDSAKRNDPMVTEPQFPFIND
                     TFHYYENFVCEENYLGHRTWDVLRNVGAVEASASDSEVEVLKNQQLLSMTSLLQLQPS
                     TLWLPRFLAMKYDDNLRDHVQIAIARFSKTQNSLIPLLSPFDKWQVTFDQHFKCIADP
                     DPINLLALLYIVQMNWSCMNEFILFKVTKIVCSSATTSLRNLQCLLLACFYFMGSENH
                     TSFASELLHLAFSMVLDLGLFINSKKLAQLAKATIKHDQRIVTFWTFQFLDSWWSLIQ
                     GFPKSNFIVDEFHPRKIESLDKPCFKPFSLLLDFTTDSLDGCNLLHTLSTENSNGKSK
                     LIYLAESFRHLLVKWKLYHQLQDHEEHFNRADLNMSLALTKPDIIETQLTLFYLVITF
                     LTEQRLKNDNATRKKGTNLEDTAFEILSLYYLLLLDQSESEQPLQFTVLHILPCSNKE
                     LINSCLSVLNDWAIKPQEDNEFEGQSNWKYNKYQNFLMQWCQLYYDNESYDPMLIQLS
                     LSYKIHLAQDKEPSKWKKRDYLQEVEQYSTGNALSRGRSKLLSSNSQAIMNQFDMFSN
                     GNSRTNIFSNFQASALPNQSLSNATQLTQNDNNNIIDMSNFKSQILIEHEETDDGYAE
                     DDDEDDEEEEDSKPLEIPFTSKRTGSLFQTKQNLPPSHRGQKLEGTKERRTSILESQD
                     FPSHNQPPQKRARHNSERSANQGLLQNSPYSSTSSRVYHHYSTNTPTRNVHPTNNDIM
                     TSNSHGEILPPPPLPSHEGLFDHSVKISTNSSINTGSTNPARTPQIVETPRAFADILL
                     LHSPDQHEXXXXXXYIYIYIYIYIYIYIYSS"
     gap             287636..287652
                     /estimated_length=17
     gene            <287793..>288665
                     /gene="TDEL0D01460"
                     /locus_tag="TDEL_0D01460"
                     /db_xref="GeneID:11502165"
     mRNA            <287793..>288665
                     /gene="TDEL0D01460"
                     /locus_tag="TDEL_0D01460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680893.1"
                     /db_xref="GeneID:11502165"
     CDS             287793..288665
                     /gene="TDEL0D01460"
                     /locus_tag="TDEL_0D01460"
                     /inference="similar to DNA sequence:INSDC:YKR022C"
                     /note="similar to Saccharomyces cerevisiae NTR2 (YKR022C);
                     ancestral locus Anc_1.278"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680941.1"
                     /db_xref="GeneID:11502165"
                     /db_xref="GOA:G8ZSY6"
                     /db_xref="InterPro:IPR028211"
                     /db_xref="UniProtKB/TrEMBL:G8ZSY6"
                     /translation="MKIRKRVKIGLPPQQATDDGINAKKLSKASLSLLDDHQDDDEDN
                     VEVPLGTFKRKGKVVEAIESLQQESTSYGDIFSKKPVSRVMNLEDMAEEDDDDSLSFP
                     SKKEIEELKSNKLKAQATQKKKDAISEKVYVSLLDDDDKLEIMESIKKNGGTENTPSD
                     PDIDMLDEERLPLSSRESLLHKERLKQTIEEALKSQDDESSNAWESQLLSKGSGQSQQ
                     AIDIPKLPKLHPSESEDNVNDSDPLAQTIESVSFRKTQLMKQLTTLQAQKATLKTQQD
                     ALTHQFNRLQQEIH"
     gene            <288934..>289905
                     /gene="TDEL0D01470"
                     /locus_tag="TDEL_0D01470"
                     /db_xref="GeneID:11502166"
     mRNA            <288934..>289905
                     /gene="TDEL0D01470"
                     /locus_tag="TDEL_0D01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680894.1"
                     /db_xref="GeneID:11502166"
     CDS             288934..289905
                     /gene="TDEL0D01470"
                     /locus_tag="TDEL_0D01470"
                     /inference="similar to DNA sequence:INSDC:YJL088W"
                     /note="similar to Saccharomyces cerevisiae ARG3 (YJL088W);
                     ancestral locus Anc_1.279"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680942.1"
                     /db_xref="GeneID:11502166"
                     /db_xref="GOA:G8ZSY7"
                     /db_xref="InterPro:IPR002292"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /db_xref="UniProtKB/TrEMBL:G8ZSY7"
                     /translation="MSGIRHLVSIKDLTDKEFSILVDRAEYFKSIFKSNETNEFQKNH
                     LKLLGRTIALIFSKRSTRTRISTEGAATFFGAQPMFLGKDDIQLGVNESFYDTTKVVS
                     SMVSCIFARVNHHDEILQLCEHSSVPIINSLCDMFHPLQAICDMLTIKEHLDYSKNKL
                     KVAWIGDANNVINDMAIACLKLGMDVAVATPPGIELDQGIVNAGKEISERNNTKLTTT
                     HNSVEAAKGAHILVTDTFISMGEEYAKVAKLKQFKGFQIDAELAKHADPNYKFMHCLP
                     RHNEEVSDEIFYSKHSIVFEEAENRLYAAMAAIDVFVNNHGNFDDLK"
     gene            complement(<289982..>292450)
                     /gene="TDEL0D01480"
                     /locus_tag="TDEL_0D01480"
                     /db_xref="GeneID:11502167"
     mRNA            complement(<289982..>292450)
                     /gene="TDEL0D01480"
                     /locus_tag="TDEL_0D01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680895.1"
                     /db_xref="GeneID:11502167"
     CDS             complement(289982..292450)
                     /gene="TDEL0D01480"
                     /locus_tag="TDEL_0D01480"
                     /inference="similar to DNA sequence:INSDC:YJL087C"
                     /note="similar to Saccharomyces cerevisiae TRL1 (YJL087C);
                     ancestral locus Anc_1.280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680943.1"
                     /db_xref="GeneID:11502167"
                     /db_xref="GOA:G8ZSY8"
                     /db_xref="InterPro:IPR012387"
                     /db_xref="InterPro:IPR015965"
                     /db_xref="InterPro:IPR015966"
                     /db_xref="InterPro:IPR019039"
                     /db_xref="UniProtKB/TrEMBL:G8ZSY8"
                     /translation="MGLNGVEIRSESQEVRNLVRDLENATTLPSRGKATKRVCDLFDS
                     DKKVVSWKFQEWDYGKKNIKLPCNARGLFILEDDDKPEIVARGYDKFFNVDEVPFTKW
                     DYIEKNTVGPYDVTLKSNGCIIFISGLADGTLVVCSKHSTGARTDVDRNHAESGKSFL
                     LSQLAKLEIDSREFAKRLHELNVTAVAEYCDDSFEEHILAYEGEKVGLYLHGINLNQR
                     DFATWPMEDVARFASQYGFKPTEHFKLEDIKKLRTFVDECSQHGSYNGTEAEGFVIRS
                     HLKDSGDDFFFKYKFEEPYLMYRQWREVTKDYITTRSRVFKFKKHKFITNKYLDFVIP
                     LLENDKQMCDNYLRGFGIIKLRNAFLQDYGMSGMEILNYERVKELELRNAVDFDKVDE
                     NTKFLIFPVAVIGCGKTTTSLTLKNLFPKSWAVVQNDDITSKDKSMLMKKSLELLAQP
                     EIKCVVVDRNNHQYRERTQLFTWFEELKEDYLAYDTNVKIIGLSFFPYDELDKVGELT
                     IARVLARGDNHQSIKSSSYGEQKVLGIMRGFMNRFQPVNVERRPDSLFDLVISLRVYN
                     KNSSLHNAKTVLHELNKEYPVLVPEVPSSDRIEQAFNQSLNYKPKITKIVRGIGGSES
                     KKNLPTFFSAHINNRLEIIEEISNLVQNAKLDDAAKSGIKKLFQENKFQSEFHITLSH
                     ISQRKKGTELQRATWQNLIHRYQNLISTIKIQKEERHCLSTKDVVKFSIRKLCWDEKI
                     VGILVDLPEEHLFDVDGEAVPRINFRNEVSHITVGILETGTPPFYTNELCRKVLSSDK
                     KRDYHVLEFEYPKRFEANVRITFQ"
     gene            <292690..>294573
                     /gene="TDEL0D01490"
                     /locus_tag="TDEL_0D01490"
                     /db_xref="GeneID:11502168"
     mRNA            <292690..>294573
                     /gene="TDEL0D01490"
                     /locus_tag="TDEL_0D01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680896.1"
                     /db_xref="GeneID:11502168"
     CDS             292690..294573
                     /gene="TDEL0D01490"
                     /locus_tag="TDEL_0D01490"
                     /inference="similar to DNA sequence:INSDC:YJL085W"
                     /note="similar to Saccharomyces cerevisiae EXO70
                     (YJL085W); ancestral locus Anc_1.281"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680944.1"
                     /db_xref="GeneID:11502168"
                     /db_xref="GOA:G8ZSY9"
                     /db_xref="InterPro:IPR004140"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="UniProtKB/TrEMBL:G8ZSY9"
                     /translation="MATLRPAIDVDEADVLVFTQGLERASKVTVQINKSLRNIATTTG
                     HSSRLFAPIITRNNVLSTLQRNIESALNSVASVKDLANEASKHEMVLRKGFREVGLKQ
                     YIQAIHKLDDMLDDIKAGNFKRTDNSEFTGIQTHLKDLIRKSETNLRVYFVSVLRTIK
                     PFDPQININKKIPFPYYNDEQLAEMALIIDYFHNTFSDAAPIEDVFIQERSEMILKCM
                     AFLEPFAKKVASSDNTPYERDSGSLLSYTEALSGFVANEKSLVDDLYLQELELKPKVF
                     TGTIKPLLGAYVKLVETNLAYVRKNLENAGILSFELADSVHNVRRALKGGPLENYGPI
                     SECSKNVHTVTQSLFKDVIQRIGTKVNQMSAIPADNGVTESTVDTMSRLRKFSEYKAG
                     CLGAMENMRREMWLPTPHKEKEFTFNVSHTLREPSALLSCFLSDCIDLLIVSLERRAQ
                     RILMPNQEPDVANPNSSKNTHKPRIGFFIIMNMALIEQIVDKSNLGELLGSEGHVRME
                     KLKKRYINYLVSDWRDLASNLMDSVFVDSTGKISSKDKDQIKEKFKRFNEGFEELVSK
                     YKQYRLSDPGLKAMLKSEIVSLVMPMYERFYRRYKDSFKNPRKHIKYLPDELTSVLTQ
                     LGK"
     gene            complement(<294724..>297780)
                     /gene="TDEL0D01500"
                     /locus_tag="TDEL_0D01500"
                     /db_xref="GeneID:11502169"
     mRNA            complement(<294724..>297780)
                     /gene="TDEL0D01500"
                     /locus_tag="TDEL_0D01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680897.1"
                     /db_xref="GeneID:11502169"
     CDS             complement(294724..297780)
                     /gene="TDEL0D01500"
                     /locus_tag="TDEL_0D01500"
                     /inference="similar to DNA sequence:INSDC:YJL084C,YKR021W"
                     /note="similar to Saccharomyces cerevisiae YJL084C and
                     YKR021W; ancestral locus Anc_1.282"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680945.1"
                     /db_xref="GeneID:11502169"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:G8ZSZ0"
                     /translation="MSELHCVFSPVFPVDKDVDVAQDAEPLAHTSSIQVFVQLAEPVV
                     FIQGFHSSQQNDRPPSILRGSLVLRVLKPTKLKSVSLSFKGFSRTEWPEGIPPKRQDF
                     VEINDIVNHTWPFYQAHNRNSYDQSARKSSSDGNLDADHAHLLHESGASLYKTLSQTA
                     SRKNKRQSVSSTNGISSLSLASNGGGDNRSITDAASGSGRSLSPMFLLRRATSPGPKA
                     DDHRTHRSSTTTSLISDLLSGTFSTPADTTSSNSSNSDNHHGNDHGNASGSGSEQFIF
                     QPGEYIYTFEQAIPSSYPESVKADFGFVEYQLFVSIERFGAFKSNLTARLPVTLVRAQ
                     ADTSVEETEPIAISRDWESQLHYDIVIASKDIILDAFLPIAFHFSPMDKVTLHRIRVY
                     LTETMEYYCRNKKVHRMEPTKKFLLAEHDGPRLPGTSDSGALKAKNMGNLLLDEKSGD
                     LVNKNFEYQVFVPSVLSNNQRLHPDTAFDNIKANHWIKLCLRLSKMVDGKRKHYEISI
                     DSPIHVLHKLCSHANTLLPSYDSHITTNEQALSSCPKFGNTSDVNIYHDSNIFFPKEV
                     LQSPMLSPEVHPLDLNLEQRSMTASPRSRRVRRDTRTEDTSMLLSPSFKANIYQPDQI
                     QRELTSPQALPLSPMTSPPMRPLHPSEAPPAFESEVYSLPTLNNSGEMPRDPPSYGDV
                     LKADGVESTYRSPNSVNQSIPKITFGRSEEHWMETPAFHRRVCHFKQKKVVDIHPRSN
                     MKTAEDDDDDITSGFSFQGVSQASPNLPSAVLKSPAVKPLNLNVDVKRERAMSLTDNL
                     PSTVRNASSSFNDMSAVLAGGNENSEESGLSRVATNCSKSSSFGKSPRSSMDSNTSFT
                     NRTNMEPLLHHTETQRNVSVDDIVFQSRDSINNYANIPVDSSIDITALYDRNSNAWHP
                     LQAGVDNALSPAVSPRNSIAVANSNQVLDDFKNALRDDNDLGNDGREDSVSTLRQSGE
                     TSGESSSGRTADSIQEPPRRPESGDKQLINHTDRETTYQSIDGGLN"
     gene            complement(<298503..>298910)
                     /gene="TDEL0D01510"
                     /locus_tag="TDEL_0D01510"
                     /db_xref="GeneID:11502170"
     mRNA            complement(<298503..>298910)
                     /gene="TDEL0D01510"
                     /locus_tag="TDEL_0D01510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680898.1"
                     /db_xref="GeneID:11502170"
     CDS             complement(298503..298910)
                     /gene="TDEL0D01510"
                     /locus_tag="TDEL_0D01510"
                     /inference="similar to DNA sequence:INSDC:YKR020W"
                     /note="similar to Saccharomyces cerevisiae VPS51
                     (YKR020W); ancestral locus Anc_1.283"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680946.1"
                     /db_xref="GeneID:11502170"
                     /db_xref="UniProtKB/TrEMBL:G8ZSZ1"
                     /translation="MAEQISHKKSLRVSRLSKDRRLLLKEYYQLDEPQSAEVETAPPM
                     NGEAAEETGAGESNKSDMGDKPIDQCKFADLMRLHNSLLKKETETNNSIKNTIYENYY
                     DLIKVNDLLKEMSQSNEPLLDRLKDLTGLLQED"
     gene            <299155..>301146
                     /gene="TDEL0D01520"
                     /locus_tag="TDEL_0D01520"
                     /db_xref="GeneID:11502171"
     mRNA            <299155..>301146
                     /gene="TDEL0D01520"
                     /locus_tag="TDEL_0D01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680899.1"
                     /db_xref="GeneID:11502171"
     CDS             299155..301146
                     /gene="TDEL0D01520"
                     /locus_tag="TDEL_0D01520"
                     /inference="similar to DNA sequence:INSDC:YJL083W,YKR019C"
                     /note="similar to Saccharomyces cerevisiae TAX4 (YJL083W)
                     and IRS4 (YKR019C); ancestral locus Anc_1.284"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680947.1"
                     /db_xref="GeneID:11502171"
                     /db_xref="GOA:G8ZSZ2"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:G8ZSZ2"
                     /translation="MFGKKKRTHTSADLPEQAMSDSLRAAQVIFQRHADSQSSLVSNS
                     PGLSNQASPTMPRFRKSNSTMSTSRSTQPGRSSSVALKGSQQNVSRPKSPTPNDSAHA
                     AAAMAHMTLGRESDHQYDELLGLSALPHFNSSTSSTRNVDSKLEPVRRESMTRQSNNS
                     KSQLHMDVRPLPQPQRPPAIKTPASSPNIGQSNNAQRPKVHSSESRTLVGRVPPPNIY
                     LHPTNSPEVTEDGRSGNQLSSSSSIATSSSALSFVTGGSSYVGDEAQDSGNEDLDRDV
                     GDSQYDEYDLDDNSPLQDAHDQKTQFTSSTVDISPEPSELETPTSPVQTNATYGKLNR
                     IGNGNVTFQGTLPDLIPNHTRRTRMEKFKTKLFGSRNRTDTTNDPGSTSSVSADGEGR
                     PVVTTNNNLRFKTTMRGHDRHSSSETGGNSLKGQHEGAGAEEDLLDSDDDDSDTMEDQ
                     VDEKKRKKRAARLRRRLKHTAAVVPCTHHLHHHHDNRHSTKRKGFNEDKPWKSHKDVG
                     FVTAQERKRYEGMWVSNRCLYLELLPWWASVISGQNAPPVKLPEDGLMLNLVIKDIWA
                     RSNLPSDLLMQIYDKVDTRHDGTLDRKSFIVGMWLVDQCLYGRKLPIDIDQQVWDSVD
                     RYVVNVINSTTMKQMDKSKKRQMKQEIKNIKKDMKNVNV"
     gene            <301470..>303812
                     /gene="TDEL0D01530"
                     /locus_tag="TDEL_0D01530"
                     /db_xref="GeneID:11502172"
     mRNA            <301470..>303812
                     /gene="TDEL0D01530"
                     /locus_tag="TDEL_0D01530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680900.1"
                     /db_xref="GeneID:11502172"
     CDS             301470..303812
                     /gene="TDEL0D01530"
                     /locus_tag="TDEL_0D01530"
                     /inference="similar to DNA sequence:INSDC:YJL082W,YKR018C"
                     /note="similar to Saccharomyces cerevisiae IML2 (YJL082W)
                     and YKR018C; ancestral locus Anc_1.285"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680948.1"
                     /db_xref="GeneID:11502172"
                     /db_xref="InterPro:IPR019412"
                     /db_xref="UniProtKB/TrEMBL:G8ZSZ3"
                     /translation="MFRVFGALTGRGNSNAEMTQEEKTKYILKQAHDFEIALQAMDYV
                     LDDRAQEGLQLLRDNEPKDGSDQTINVLARGVIEFLEATLGFEAEEMKKASATLAKAE
                     QLSLKSRQNAQKLNVQSSSLYPPGTVYAVTYTESCLLHALLMLFSESMMEAAKALLKL
                     RKAYSMLQEIFEAIKKAEKTQRLTITEDPNESQTSFSSGESSFKSADIPYRLSPEEQD
                     NRDLLEYAEKVHQMRMKRLCGAHIGNSPAINRLRDELGLDAMRNLPQEEIKEFTHIFD
                     DLDVTQATIDEFIHSGVNLCFGILQVVLSLIPPAIGAVLSIVGFHGSRDEGLRLVWRA
                     TRQRNVHGCIGLLGLMFYYDGPFQFTDDDFDIPAVDTSSLEKVKTQGSQSTVVALQNT
                     RSSRSPSTSSLKKKATNDSTTSLRRKETNGSTYSLKQHSSMQDGDLDGPTLLHPGKIL
                     VDALLRSRALFPNSALWLLNEARMLSARGRLEEAVNLLDSIDVQSISMRQVKSLLVFD
                     RAITLSHLHRYDRAAEDLLSLTSISDWSHAFYTYFAGCCYLENWRMCQLGEMKSDQAD
                     FYKKKAEELIFNAPSLLGKKTFKSKNLPLDRFMLRKVQQFKTIQDELGLVDPLDAIAT
                     SPVHEISYFYNGYNRMTKEGLELSKRMLTEYHNPAIDAKDEDQEMIKNFLVALSLRRL
                     GEVQEGCDLMDEKLLPKIFWDDNGKIRYVKRTEDPWLYPAALYERALFSWKLHGMDGL
                     RESREWLVRAQNYADDYELSTRIGMKIKAALDRVEHSLNG"
     gene            <304228..>305886
                     /gene="TDEL0D01540"
                     /locus_tag="TDEL_0D01540"
                     /db_xref="GeneID:11502173"
     mRNA            <304228..>305886
                     /gene="TDEL0D01540"
                     /locus_tag="TDEL_0D01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680901.1"
                     /db_xref="GeneID:11502173"
     CDS             304228..305886
                     /gene="TDEL0D01540"
                     /locus_tag="TDEL_0D01540"
                     /inference="similar to DNA sequence:INSDC:YKR017C"
                     /note="similar to Saccharomyces cerevisiae YKR017C;
                     ancestral locus Anc_1.286"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680949.1"
                     /db_xref="GeneID:11502173"
                     /db_xref="GOA:G8ZSZ4"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002867"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018957"
                     /db_xref="UniProtKB/TrEMBL:G8ZSZ4"
                     /translation="MTSVQSEDNSSLIYGDDFDDDDESIDLYESQTTATCSMGDTACH
                     KLNSLVSQESEFDFDEDQFSGNESDDELLVDPMTLSKKALDDDKGGSSLKYECLTTQD
                     ILDRMLKRVHHLQPVFSIPSEDILVLMQRYDWNEERLLEEWTEKMDELLVEAGINTSN
                     PGDKLNITMRGIKHRSDFNCFICCEVRSTETFSLECGHEYCIECYRRYISDRLNEGNV
                     ITCMDCALALKNEDIDAIMGTPSSARLMDSSIKSFIQKHNRNYKWCPYADCKCIIHLN
                     DTSYLQEYTRLHCSRFVTCKFSHIFCFGCGYGMHAPADCNVTMAWVKKARKESENLNW
                     VLSHTKECPKCSVNIEKNGGCNHMVCSSCKYEFCWICSGEWGPHGRSFFQCTMYKNDD
                     EKQKASVENSKKALKRYTFYYRVFNEHEVSAKLDWKLGQTVGQKVKAMQEKMGVSWIE
                     GQFLAESLQILNEGRTVLKWSFAVAFYSDASHNLTKIFVDNQMLLSNAVEQLSELLQI
                     KNPETTMKRKSEFYNKAGYVRNRTRALIECGRDLLRKCICKPVD"
     gene            complement(<305973..>307415)
                     /gene="TDEL0D01550"
                     /locus_tag="TDEL_0D01550"
                     /db_xref="GeneID:11502174"
     mRNA            complement(<305973..>307415)
                     /gene="TDEL0D01550"
                     /locus_tag="TDEL_0D01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680902.1"
                     /db_xref="GeneID:11502174"
     CDS             complement(305973..307415)
                     /gene="TDEL0D01550"
                     /locus_tag="TDEL_0D01550"
                     /inference="similar to DNA sequence:INSDC:YJL081C"
                     /note="similar to Saccharomyces cerevisiae ARP4 (YJL081C);
                     ancestral locus Anc_1.287"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680950.1"
                     /db_xref="GeneID:11502174"
                     /db_xref="GOA:G8ZSZ5"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="InterPro:IPR027667"
                     /db_xref="UniProtKB/TrEMBL:G8ZSZ5"
                     /translation="MSNPALQVYGGDEITAVVIDPGSFSTNIGFSGTDCPQAILPSCY
                     GEQKAETEDNAPKKIFAEQSIGIPRPDYEIKPIVQNSMVVDWDAAEEQWSWALKDILY
                     LNSNSGIPALLTEPIWNTLENKTKSLEILLESLQFEACYLSSTPTCVSFASGRPNCLV
                     VDLGHDTTSVSPVVDGMTLSKSTMRNFLAGNCINELIKKPLKGKDLVPLFEIAQRKPE
                     FKKKTFDYQIHPSLYNYANSRGFLQECKETLCQVAPSPLDKMDSQLESMAKRSIEAPW
                     AEELVFDNKTRFGFAEQLFAPQKDELPENWPLSKDGIVETWHNDYVPLKRNKPNGGKP
                     EKQNNEEGESAAHEDDTATETPNENGKRPLEESVTGSDIAGAADLVNASILASDVDLR
                     ATLAHNIVLTGGTSSIPGFSDRLMSELNKKLPALKFRILTTGHLRERQYQAWLGGSIL
                     TSLGSFHQLWVGKQEYEEVGPDRLLSDRFR"
     gene            complement(<307600..>309231)
                     /gene="TDEL0D01560"
                     /locus_tag="TDEL_0D01560"
                     /db_xref="GeneID:11502175"
     mRNA            complement(<307600..>309231)
                     /gene="TDEL0D01560"
                     /locus_tag="TDEL_0D01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680903.1"
                     /db_xref="GeneID:11502175"
     CDS             complement(307600..309231)
                     /gene="TDEL0D01560"
                     /locus_tag="TDEL_0D01560"
                     /inference="similar to DNA sequence:INSDC:YKR016W"
                     /note="similar to Saccharomyces cerevisiae YKR016W;
                     ancestral locus Anc_1.288"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680951.1"
                     /db_xref="GeneID:11502175"
                     /db_xref="GOA:G8ZSZ6"
                     /db_xref="InterPro:IPR019133"
                     /db_xref="UniProtKB/TrEMBL:G8ZSZ6"
                     /translation="MLKSSSSSLLKHAVTRRSLASINTGAVVSSTPTSHPLRRFIVRT
                     TLAISLFYAGGLALAEYNDSFNDIFVENIPFAETLVDSFESYRDATMLSSPLTLEELR
                     AKFGGMLGGKVTSIPNQGVNAQDANKEDLKASIPTKIDARSPLTSTSTARNDAALVNL
                     SPINVVTGSHTPTKFAELVKGINDAIRAINEQKIEVAEEQLSVIIEAHQALTTSVVNF
                     NKDIESVVEQGISERTAQLVSDLTNKYETRLKEDEANLTSKFTEELQDYRKGLEERSA
                     KQLAEDLKANEQTLLAKHANEVALLSITQVEEFNKILKEKLDTERDGRLAHLKDLDSG
                     VGRLLESVDNLNHILMKKEAVTQLTLTIEELKTKLQSSNSHALNIESQLKKLKSLSDI
                     LPGKPKPCCKSKNKSPALIDVAISELDSLTSKQEILTNEQLYNRWNLLGDDFKTASLL
                     PPNAGILGHTFAKMFSFLLFTKEGSSPKNQDLDSVFARVNENLRLSKLDKAVEEVVAL
                     QGWPYVLCQEWINDARRKLEVESLVDVLDCELRTL"
     gene            <310454..>311107
                     /gene="TDEL0D01570"
                     /locus_tag="TDEL_0D01570"
                     /db_xref="GeneID:11502176"
     mRNA            <310454..>311107
                     /gene="TDEL0D01570"
                     /locus_tag="TDEL_0D01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680904.1"
                     /db_xref="GeneID:11502176"
     CDS             310454..311107
                     /gene="TDEL0D01570"
                     /locus_tag="TDEL_0D01570"
                     /inference="similar to DNA sequence:INSDC:YKR014C"
                     /note="similar to Saccharomyces cerevisiae YPT52
                     (YKR014C); ancestral locus Anc_1.289"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680952.1"
                     /db_xref="GeneID:11502176"
                     /db_xref="GOA:G8ZSZ7"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZSZ7"
                     /translation="MFQFKLVLLGDSSVGKSSIVYRFVKNSFDEFRESTIGAAFLSQT
                     IKVKESDDGEETVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQQDSLVKAQS
                     WVNELKNKVGDDDLVICLVGNKVDLCDEDAEDNKRAVGTEEARSYANEQNLLFYEVSA
                     KTGLNVQQIFQSIGEKLFETKSEEIAAAKNRQIGSSNDHVNVQLQRASTNDPTSCCF"
     gene            complement(<311223..>314846)
                     /gene="TDEL0D01580"
                     /locus_tag="TDEL_0D01580"
                     /db_xref="GeneID:11502177"
     mRNA            complement(<311223..>314846)
                     /gene="TDEL0D01580"
                     /locus_tag="TDEL_0D01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680905.1"
                     /db_xref="GeneID:11502177"
     CDS             complement(311223..314846)
                     /gene="TDEL0D01580"
                     /locus_tag="TDEL_0D01580"
                     /inference="similar to DNA sequence:INSDC:YJL080C"
                     /note="similar to Saccharomyces cerevisiae SCP160
                     (YJL080C); ancestral locus Anc_1.290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680953.1"
                     /db_xref="GeneID:11502177"
                     /db_xref="GOA:G8ZSZ8"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:G8ZSZ8"
                     /translation="MSLTLENEMNVEITPNVADSIPSVTEKVGDEAGSQQVEQEAPKP
                     KVLPSLKDLPSLGSNADLASTKVAWGPNVKPAAAPAISSSSSPSPSALNPGSRPMRSK
                     TIQEAFTLDLQSQLSISKPEFSRIVQSVKQNHKVSVESTLSKNSRTFLISGVPANVYA
                     GRRELVRKLTRPITDVIQVPSNSKAAIIGSGGKNIREIQDSCDVKINVAKENNPDSYD
                     EDLNDYTADVSIHGDIDSVKLAKEKILNIVKDENKHAVITFPVDDAKVLSFIDLSDLN
                     TKDDVKVQFNKDNNTVSIQGPREEAKIAKQDVKDYLAKLSNEIAIEQVAIPTKFQFLI
                     DAKEIKEKFNVIVEFSNKANADTVSFVGPRSKVNEAIDFARSSSKTYTVDTLDISKSH
                     GKNLAHAKNLALFFAKYNYLKGLQEAHPTIKVVLPTPEALALSDNVSIHISGKADQKE
                     EIKAVRKELIALVNDITPLDTTIVDDVDYELFHKESKHALLGQEENAAFVQFGDYYSG
                     NDAILLVALTSNDDFKPSAEEISETLSEVNASLDDIRKKQNALETKTLEMAPETQDSL
                     LGESSATLKLILEDVSQEEGHLQIKLHSPDESKVTFRGNERAVNIANKAVESILKSPS
                     KKFKDTVEVPANAVSRLIGTKGANTQQLRQKYDIQIDVPSESDGKKPVLVTLTGLQYN
                     VERAKAFIIAEAKKWADIITKELIAAPKYHRNLQGPQGAYRNRLQEKYNVKIFFPRNE
                     EVVTIRGPSRGVAKAYQELEALLDFEMENGHKSVVKVPAEHVPRIIGKNGDMINDIRA
                     EYGVEMDFLQKATDPKVQETGEVELEITGSRESIKSATKKVNDIVAEASDFVKKSLDI
                     DSKYHRTIVGSGGRKLREIIAAAGGDEYRNKSIDVPNANSESNVIKVEGPKKFVDIVV
                     KEINKIVEEGENSIEKELDIPTERQGALIGPAGMVRRQLESEFSITLNVPNKGETGKV
                     TIVGLPANVDKAEKKIISEIIRDNFDHEVLVPAKLHEFVSERGAFIQSLRNEHSINVR
                     HGNEAKRANKISRKALNIPVDRLRGSDEDKLKFTVEEITSDESSEEGQVPWRLAYDPV
                     DLSAILGEGEEEEGAKKSVEKDAASSKKAAIDAAVKAIEERIALAPQATSVGYIWSSD
                     PKKFNKIVGPGGSKIKVIRESSGAIINVPKRSDKVNDIVYIRGTADAVKKAGESILKT
                     LKN"
     gene            complement(<315171..>315977)
                     /gene="TDEL0D01590"
                     /locus_tag="TDEL_0D01590"
                     /db_xref="GeneID:11502178"
     mRNA            complement(<315171..>315977)
                     /gene="TDEL0D01590"
                     /locus_tag="TDEL_0D01590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680906.1"
                     /db_xref="GeneID:11502178"
     CDS             complement(315171..315977)
                     /gene="TDEL0D01590"
                     /locus_tag="TDEL_0D01590"
                     /inference="similar to DNA sequence:INSDC:YJL079C,YKR013W"
                     /note="similar to Saccharomyces cerevisiae PRY1 (YJL079C)
                     and PRY2 (YKR013W); ancestral locus Anc_1.291"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680954.1"
                     /db_xref="GeneID:11502178"
                     /db_xref="GOA:G8ZSZ9"
                     /db_xref="InterPro:IPR001283"
                     /db_xref="InterPro:IPR014044"
                     /db_xref="InterPro:IPR018244"
                     /db_xref="UniProtKB/TrEMBL:G8ZSZ9"
                     /translation="MKFSQVSLLAAAVATANGAAVTVTQHVHQESVVSVQGVVYVENG
                     QTHTTYSVIGGATNSAEAPVSTTLLASTSASTSLDPTSAVQTTSPTKDTTTLTPTTSS
                     SSSTKQTKSSTSSSTSAQQSSTSTASSGFASTILKAHNDKRALHKDTSSLTWSDELAS
                     YAQAYADKYDCSGTLTHSGGKYGENLAAGYDAAGSVNAWYDEIKDYDYSNPSYSSATG
                     HFTQVVWKGSTQLGCGIKNCNNAWGNYVICSYSPAGNVIGKFPDNVQPLN"
     gene            316763..316835
                     /gene="TDEL0Dtrna1A"
                     /locus_tag="TDEL_0Dtrna1A"
                     /db_xref="GeneID:11502179"
     tRNA            316763..316835
                     /gene="TDEL0Dtrna1A"
                     /locus_tag="TDEL_0Dtrna1A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:11502179"
     gene            <316952..>317851
                     /gene="TDEL0D01600"
                     /locus_tag="TDEL_0D01600"
                     /db_xref="GeneID:11503621"
     mRNA            <316952..>317851
                     /gene="TDEL0D01600"
                     /locus_tag="TDEL_0D01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680907.1"
                     /db_xref="GeneID:11503621"
     CDS             316952..317851
                     /gene="TDEL0D01600"
                     /locus_tag="TDEL_0D01600"
                     /inference="similar to DNA sequence:INSDC:YKR011C"
                     /note="similar to Saccharomyces cerevisiae YKR011C;
                     ancestral locus Anc_1.293"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680955.1"
                     /db_xref="GeneID:11503621"
                     /db_xref="UniProtKB/TrEMBL:G8ZT00"
                     /translation="MTKSDREIIYLYAGENHPKVKLTREREFTNVRGLLEYFHGIQDT
                     FYVEFETSETITENLKLRCTSYGGDEFDGSVPFFILEYDEILDSFYVWKSEGQWELNK
                     LIATLYTDHSNKGSHACGEILRESPEFAKHPRKKLIDLVIDKLNVDWSRIDIEEFWLQ
                     LDQVLALDQDAKLDEFSFKSLISVAVLKTKVKENKRMLQQAVVQYHRLMKSKEHTEIE
                     REDEKRAVSPTDPECPGPMYAFGKINSQGDQIVANFNRHFKLMAEDYETFDLKNWGQI
                     TRKSNRRKPRGSHTKNCISKVKS"
     gene            <318207..>321761
                     /gene="TDEL0D01610"
                     /locus_tag="TDEL_0D01610"
                     /db_xref="GeneID:11502180"
     mRNA            <318207..>321761
                     /gene="TDEL0D01610"
                     /locus_tag="TDEL_0D01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680908.1"
                     /db_xref="GeneID:11502180"
     CDS             318207..321761
                     /gene="TDEL0D01610"
                     /locus_tag="TDEL_0D01610"
                     /inference="similar to DNA sequence:INSDC:YJL076W,YKR010C"
                     /note="similar to Saccharomyces cerevisiae NET1 (YJL076W)
                     and TOF2 (YKR010C); ancestral locus Anc_1.294"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680956.1"
                     /db_xref="GeneID:11502180"
                     /db_xref="InterPro:IPR018844"
                     /db_xref="UniProtKB/TrEMBL:G8ZT01"
                     /translation="MLKLQVVLVPPSAQNGPVPYGFTSSTADSSRLIASGSVFGSGVP
                     RNADTSLPFPSNLSAANTTLYPNHFAQTKRKKFLHFTKSSNTLLDLSLEIVQKCEKMY
                     PTMSEEIDILSLQDNSGCDLDPDFYVKDVFNIDNTVRVILKNEIIIDDSSPVSGYRFT
                     KKKKLNSGFAQPQEVQNQSAQTLPPASSSTGNGGILKIAKKRPSTSVMRHPTTGTMRI
                     STPLAHQIYPPPNSNRMVSNNSDDEDASERSFLPPPAQPQSPPIRISSSMENNKRIRS
                     AVEEDAVSRSETVDPDKSKQQRLLSGTPVANTMTPNRVTLTGQRVVSERMSNGSSQNG
                     SIFTASSTSGNRLGSAANTRITSGMLSIPEPRIAEIEKELKEGPSSPTSILPAVPHRI
                     PMKEPYQKMAIDQSDDISSSDEQDSESQVKTSAQRQTSIADNNGSPVKESPLGENHLR
                     NVHLAELPRSKSGSVSAQRKTSLEARVENKTIGVVPQKGEEDEPVRKESFSDEEGEEE
                     QDVREEDQGLQRQLGLTNEKAEADTGEEEEENDGNDTVLITRNEPDNKSHSNTSIHKT
                     DFLKLMEGGSTDFPPWFGQHGSKGKPYTTVLHKDIDNSKPDPRNIIPRDTPRSAAKKA
                     AQLLSGKQGQKSEQHDDASESPSPSSSDIETDSSLDSDHDRIFINENNSVRSLNLRPL
                     KEKVISSQDLNSSDAVATDTTQKDTKVSQKSSADENIPSKDKVESGQSSATEPSKLPL
                     PVDEVRGNIIQGNEKPSPRKTIKEQPEAVAEKRVSEQLNSTKAESKPDVQPSAHKAQS
                     SSQKTDLSTNSHNGTDLKSTTAVAGKTGKAQDGQKLKLSTKASSDNSDESRSPSVPAA
                     RSQPTKKEEAEMKRREREAARAAKLEAAQKLKAEKEAQKVAKQKAKEEAKLAREAEAA
                     RKKHEREEKKRLRQEKLAEEKRKREEANAKKSEEPAVVKKADEKPEEKVKPQKAVLDG
                     GDKLKELKAKFTKSRAYVPAGLARQSIRRSDDSSESGSSDDESSSDDSSSSDEESSSI
                     SKKSRRLIVDTPKGALSSAQNKSAIKELPGVEDVPQSTQRSNPASQETPKKTPNKIPV
                     TRLMEMSSPSSSKGDGQARPSFLQGLPQKVRPSLSSLSDLVSKGVPDVREKSMTVSHP
                     AAKKVATSMSDDSNDEDDSLSESSDSDSDSDDSSYRRR"
     gene            complement(<321963..>325634)
                     /gene="TDEL0D01620"
                     /locus_tag="TDEL_0D01620"
                     /db_xref="GeneID:11502181"
     mRNA            complement(<321963..>325634)
                     /gene="TDEL0D01620"
                     /locus_tag="TDEL_0D01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680909.1"
                     /db_xref="GeneID:11502181"
     CDS             complement(321963..325634)
                     /gene="TDEL0D01620"
                     /locus_tag="TDEL_0D01620"
                     /inference="similar to DNA sequence:INSDC:YJL074C"
                     /note="similar to Saccharomyces cerevisiae SMC3 (YJL074C);
                     ancestral locus Anc_1.295"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680957.1"
                     /db_xref="GeneID:11502181"
                     /db_xref="GOA:G8ZT02"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029685"
                     /db_xref="UniProtKB/TrEMBL:G8ZT02"
                     /translation="MYIRRVIIKGFKTYRNETVIDDFSPHHNIVIGSNGSGKSNFFAA
                     IRFVLSGDYSNLKREERQGLIHQGSGSVMSASVEIVFHDPDHRIILPSGVAPRSNDEV
                     LVRRTVGLKKDDYQLNDRNVTKGDVVRMLESAGFSMNNPYNIVPQGRIIALTNAKDKE
                     RLQLLEDVVGAKSFEVKLRASLKKMEQTEQKRAQIVKEMEELNDKLSEMEEERKELEV
                     FNNLERNRKAFQFTLYDRELNDVINQIEKMDDVYNVTLHSSHDYITELDKREDMVEQI
                     NKNLQNLESSIKIKETAELSQARSKHNELSNAIANLNVKIRDLQRQVVSYDEQSDLNR
                     KNLAIINEAIEAKQAQLAKISPRFESLSKEEVSYKLELAGLQEKQRDLLLMKGKYSHF
                     QTVEERNEWIEGELRSLNETLANTTHLKSQIDNERNELHEKLNATEEQIQELEDSVRG
                     PGVVAEIEDIEKKVNDLKAEYVEKINERKELWRSEQKLQTISETLLDTVKNSERSVSE
                     TMAKSLANGIASVREITEKLRLPEGRVFGTLGELIKVNEKYKMCAEVVGGNSLFHIVV
                     DTDETASLMIQELYRMRGGRVTFMPLNRIYNDPNITYPPNAQSSCTPLIKKIKFDAQF
                     ESVVKNVFGKTIVVRDLAAGSKIAKHYKLDAITLDGDRADKSGLLTGGYHEHHKKTRL
                     ESLKDLKNARTQYKKTSDELEQIRQKIHTADAEIDSMNGQIRVASNKRETILTNVDGF
                     RTKLNNKLSEKLFLEESAKSLELKREKAETSIKVVQAKIDSYTLDLTSEFETQISAQK
                     QKELNDLEITLQKVQKNLNTTTEALQGITTKIDSLTAELNSKLLPQKSELQASKHQDG
                     DVLVADLKSDLELMISDKQGLEKQFESSGKEVDELQTELEGLKAEKGKNESLLEKANS
                     QQAQLLKKLETFQKDAEKSMVKKTTLASRREELQRKIREVGLLAEEALNSFSNLSSEE
                     LLRKLNAVNEDISGLKNVNKKAFENFKKFHEKKLELEDRSKELDESKTSIQNLIVKLK
                     QQKVAAVDSTFENVSRNFTEVFEQLVPRGKAKLVIHRSSDARDDDVDAENDTAMTGDD
                     DGTQTESMYTGVSISVSFNSKKTRQLHVEQLSGGQKTVCAVALILAIQMVDPAPFYLF
                     DEIDAALDKQYRTAVAGIIKALSANAQFICTTFRTDMLQVADKFFRVKYENKISTVVE
                     VDRQEAINFIKGTNKLAEV"
     gene            complement(325842..325972)
                     /gene="TDEL0Dtrna1L"
                     /locus_tag="TDEL_0Dtrna1L"
                     /db_xref="GeneID:11503654"
     tRNA            complement(join(325842..325886,325934..325972))
                     /gene="TDEL0Dtrna1L"
                     /locus_tag="TDEL_0Dtrna1L"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUG"
                     /db_xref="GeneID:11503654"
     gene            complement(<326217..>327482)
                     /gene="TDEL0D01630"
                     /locus_tag="TDEL_0D01630"
                     /db_xref="GeneID:11503628"
     mRNA            complement(<326217..>327482)
                     /gene="TDEL0D01630"
                     /locus_tag="TDEL_0D01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680910.1"
                     /db_xref="GeneID:11503628"
     CDS             complement(326217..327482)
                     /gene="TDEL0D01630"
                     /locus_tag="TDEL_0D01630"
                     /inference="similar to DNA sequence:INSDC:YBR287W"
                     /note="similar to Saccharomyces cerevisiae YBR287W;
                     ancestral locus Anc_1.296"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680958.1"
                     /db_xref="GeneID:11503628"
                     /db_xref="GOA:G8ZT03"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:G8ZT03"
                     /translation="MIATAETFSFGHIAYLVFESVLQVVIIALAGFWSSYAGLLPKNA
                     QKIISAINVDLFTPCLIFSKLARSLSMAKILEIAVIPFFFAITTGISWFSGRLMAKFF
                     RLDKDETNFVVANSIFGNSNSLPVSLTLSLAYTLPGLTWDQIPNDSRDNVASRGILYL
                     LIFQQIGQMLRWSWGYNVLLRWSGENPENMPPSQIAARLEESRASEATSESAVSYTGV
                     GNSLLSSNSWWSKVFDKAAAFVAGVRSYLNPPLYSMIISVIVASIPPVQHELFHKDGF
                     INNTFSEAIIQLGSVSIPLIIIVLGSNLFPSDETFRKTHKHNKLVIGSIVGRMILPSC
                     FLLPIIAVAVKYINVSILDDPIFLVVGFLLTVSPPAIQLTQITQINEFFEAEMASILF
                     WGYAILSLPVSIIVVSAAIYVLQWANPPN"
     gene            <328124..>329938
                     /gene="TDEL0D01640"
                     /locus_tag="TDEL_0D01640"
                     /db_xref="GeneID:11502183"
     mRNA            <328124..>329938
                     /gene="TDEL0D01640"
                     /locus_tag="TDEL_0D01640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680911.1"
                     /db_xref="GeneID:11502183"
     CDS             328124..329938
                     /gene="TDEL0D01640"
                     /locus_tag="TDEL_0D01640"
                     /inference="similar to DNA sequence:INSDC:YJL073W"
                     /note="similar to Saccharomyces cerevisiae JEM1 (YJL073W);
                     ancestral locus Anc_1.297"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680959.1"
                     /db_xref="GeneID:11502183"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:G8ZT04"
                     /translation="MKLRLLYICCGWLVKALAHDCDLERFESLSKSLKYDPASLNSCQ
                     QIIAQLEDCSDLNPKSRQRLLNQLSYRAGIIQLSLNQDLNAIASFERVNGTEDSFSHL
                     SQKRVGTLYAEFGMWDKVDTENEIRQEFQAINKSVHSKWDANHDVAQIEPELQHLLRL
                     SPYSLETRNFYLETLLVKLANSMDVSTAHETIKTNEIVLDKYSSRISLEKRIQMHYTS
                     AIIQTFILNTEPTHLRKCLALDMNFEPCRRLTLLHNRLKKVNPARPQILDPEVYVTGG
                     RNGADWQRIVQFYLRDKKPCAKLPLGYKFENNYKLVLRVAQMSLEELFTTQGSTSRFV
                     TDFHKFIDVMLCQAATESPSTKSMTQQFCKLSFEEIIPADTRKEIHRLSTTNQKGLEA
                     ILTNIWNSYPHLAVYVTQTILSESKNPPSAIQDELHKFFNENHLAKSANKLIQNQYNT
                     ISNMIRERQRKHQQQQQWNFQQQQKQQQYYRQPPPPNTPRTDRDYYKILGLPKTATSK
                     DIRRAYLDFTKKYHPDKQGQLSEKEESKIHEKMSQINEAYETLSDDTRRKEYDQARSS
                     GSRSGPMNPNMFRHANAREGQGSSHFGNNFKMNFGFGY"
     gene            complement(<329979..>331601)
                     /gene="TDEL0D01650"
                     /locus_tag="TDEL_0D01650"
                     /db_xref="GeneID:11502184"
     mRNA            complement(<329979..>331601)
                     /gene="TDEL0D01650"
                     /locus_tag="TDEL_0D01650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680912.1"
                     /db_xref="GeneID:11502184"
     CDS             complement(329979..331601)
                     /gene="TDEL0D01650"
                     /locus_tag="TDEL_0D01650"
                     /inference="similar to DNA sequence:INSDC:YBR286W"
                     /note="similar to Saccharomyces cerevisiae APE3 (YBR286W);
                     ancestral locus Anc_1.298"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680960.1"
                     /db_xref="GeneID:11502184"
                     /db_xref="GOA:G8ZT05"
                     /db_xref="InterPro:IPR003137"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="InterPro:IPR029514"
                     /db_xref="UniProtKB/TrEMBL:G8ZT05"
                     /translation="MKLSLSTAIAAVTVAGRVGSAFVLPEFFQEAFVPVETDEQQFWQ
                     FLQEDDESDFVSSLIPKPHVPYFLKPMVESEKLQDKIELDDLNETAHDILRIANASTR
                     QYGHPTRVIGSPGHWKTIRYILKQFDDMRDYYDVSVQAFSALSGKINSFNLSDAKTGE
                     TFPNTTAFSLSPPVKPFVGELVQIPNLGCDPADFESVTPKPPHERQKRKIALIERGSC
                     SFGNKSELAGKFGYHAVVIFDNDAKSNDGLRGTLGSVSKHSVSTIGVTHATGKELIKR
                     IFLNSHYSLQFDMDSFVKRIKTKNIIADTKHGDEDNIVALGAHSDSVEEGPGLNDDGS
                     GTISLLNVAKQLTHFKINNKVRFAWWSAEEEGLLGSTHYANNLTRDENLKIRLFMDYD
                     MMASPNYEYEIYDANDKDDPKGSEELKNLYIEYYKSKNLTYTLVPFDGRSDYVGFIEN
                     GIPAGGIATGAEKKNVKNGKVLDKCYHSLCDDIDNLAWDAFMVNTQLIAHSVATYGYS
                     LEGFPERNNATVETMDLNGEPRFKYRADYLIV"
     gene            complement(<332794..>333201)
                     /gene="TDEL0D01660"
                     /locus_tag="TDEL_0D01660"
                     /db_xref="GeneID:11502185"
     mRNA            complement(<332794..>333201)
                     /gene="TDEL0D01660"
                     /locus_tag="TDEL_0D01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680913.1"
                     /db_xref="GeneID:11502185"
     CDS             complement(332794..333201)
                     /gene="TDEL0D01660"
                     /locus_tag="TDEL_0D01660"
                     /inference="similar to DNA sequence:INSDC:YBR285W"
                     /note="similar to Saccharomyces cerevisiae YBR285W;
                     ancestral locus Anc_1.299"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680961.1"
                     /db_xref="GeneID:11502185"
                     /db_xref="UniProtKB/TrEMBL:G8ZT06"
                     /translation="MSFIARFFSWKQQKGLQTSGTRAVYTHEEDDFVHVSHVKTRESE
                     ADDEADVSKWEMARILGHLDVKVQPKVETLGDIKKYRTSRSSNTAAVKEHYVDDRYVI
                     DDPLELDMFDDKLNRVIKRSHRRKTNFPEKSRL"
     gene            complement(<333404..>334069)
                     /gene="TDEL0D01670"
                     /locus_tag="TDEL_0D01670"
                     /db_xref="GeneID:11502186"
     mRNA            complement(<333404..>334069)
                     /gene="TDEL0D01670"
                     /locus_tag="TDEL_0D01670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680914.1"
                     /db_xref="GeneID:11502186"
     CDS             complement(333404..334069)
                     /gene="TDEL0D01670"
                     /locus_tag="TDEL_0D01670"
                     /inference="similar to DNA sequence:INSDC:YJL072C"
                     /note="similar to Saccharomyces cerevisiae PSF2 (YJL072C);
                     ancestral locus Anc_1.300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680962.1"
                     /db_xref="GeneID:11502186"
                     /db_xref="GOA:G8ZT07"
                     /db_xref="InterPro:IPR007257"
                     /db_xref="InterPro:IPR016906"
                     /db_xref="InterPro:IPR021151"
                     /db_xref="UniProtKB/TrEMBL:G8ZT07"
                     /translation="MSLPEHLQATFSPDEIQFIVENEPIRIFPRITTRQSVRSRHRDQ
                     ITQAKCTLITSDDHNVNQMVAMQSTELPLWLALLLKQQNKCSIVAPRWLTLQSLDQSI
                     SFEKKNSDRFSSLPWNWLVLAQLLFGKAPDDFHDPVHELRSRIQDLREVRQLKVLRGL
                     RELNESHLQLDNLSLLEINELRPFIVGTMDKLRQIHTATNPESQPHAQAQLTQQDLDE
                     PPY"
     gene            <334181..>335902
                     /gene="TDEL0D01680"
                     /locus_tag="TDEL_0D01680"
                     /db_xref="GeneID:11502187"
     mRNA            <334181..>335902
                     /gene="TDEL0D01680"
                     /locus_tag="TDEL_0D01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680915.1"
                     /db_xref="GeneID:11502187"
     CDS             334181..335902
                     /gene="TDEL0D01680"
                     /locus_tag="TDEL_0D01680"
                     /inference="similar to DNA sequence:INSDC:YJL071W"
                     /note="similar to Saccharomyces cerevisiae ARG2 (YJL071W);
                     ancestral locus Anc_1.301"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680963.1"
                     /db_xref="GeneID:11502187"
                     /db_xref="GOA:G8ZT08"
                     /db_xref="InterPro:IPR006855"
                     /db_xref="InterPro:IPR011190"
                     /db_xref="UniProtKB/TrEMBL:G8ZT08"
                     /translation="MWKQALNRGFKYDQPNAAARKLILSVLSSTATRREARDYLVKYG
                     QNSSRANHCLLLIRHLQTMGRGTLWQLSGAIEKLRMLGIRPIFVIPPSGHVMQNAETL
                     DKVLTTANLRPLHLQDALFRGSDGTYSSILSSQASLFDSKSLDLIPVIQPYVFDEATA
                     SQRLTNDMVSFMENIVPRGGAPYIDKFFILNNIGGIPSDERRNNAHVFINLSQEYKTL
                     ASSLSEKAGSFSVREPQSQNLLDRLTLHLKEDELISLERQYKEHLEDLQLMNAVLSRL
                     SNSSTGLITTTKAAASTSDRKNPLLYNLLTDRSLISSSLPRFKARPEQWDEDHSWYEM
                     SNEVEANDYAFRDPEYSGAAKHQEDSILVTTVLKRGVHIKMLEYRTLSQYNSIGLPKS
                     FHSKEATKVSYNEDSKVNLTKLKRILDHSFGRDLDLDHYLNRINGRIASIIVIGDYEG
                     IAVLTYEGPSENPFVYLDKFAVLPHLKGSLGISDIIFNLMFKSFPRELLWRSRSDNVV
                     NKWYFQRSAGVLDLSIALSDDDRKNSQFKLFYHGDPDSNKDPFQDKARLKEYATYVRD
                     IEPSWAK"
     gene            complement(<335951..>338443)
                     /gene="TDEL0D01690"
                     /locus_tag="TDEL_0D01690"
                     /db_xref="GeneID:11502188"
     mRNA            complement(<335951..>338443)
                     /gene="TDEL0D01690"
                     /locus_tag="TDEL_0D01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680916.1"
                     /db_xref="GeneID:11502188"
     CDS             complement(335951..338443)
                     /gene="TDEL0D01690"
                     /locus_tag="TDEL_0D01690"
                     /inference="similar to DNA sequence:INSDC:YBR284W,YJL070C"
                     /note="similar to Saccharomyces cerevisiae YBR284W and
                     YJL070C; ancestral locus Anc_1.302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680964.1"
                     /db_xref="GeneID:11502188"
                     /db_xref="GOA:G8ZT09"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006329"
                     /db_xref="UniProtKB/TrEMBL:G8ZT09"
                     /translation="MAVPQRRQSLLFDVYQQAHFSFEDYKAKDEGKLNIPSNPEQLSI
                     DDLDMMPLSTSFDKQMLLGSPMYLDPEEQEEKQSMVMEEFSHHGTHSSRPVPSDASNL
                     HLDEYFEGDDPFENAGQLRAKYLLAASQDCASNIKYDMDRMFLYPKPLPKFWKFAKDE
                     RLNDESTASDYEYTESEIRPGCYFPTLSEDQYVEEEQLGVPKRLGKVHYTGEFFEMSH
                     FQEEFEAHKQQYGKRSETHGSCEVPTFEEFRKDFLSLVQTVQCSPLSEIAQRRIYYLL
                     EKFELFQHLNAKSEILENKRVPLRDFYNSRKVDRDVLLSGCATQRQLSEFIWEKLNVE
                     PHRIVHRTFDGKELTLSQIFEKENSSEDPMAIGLKVIDDEFLEWYKNDYLITLNLIPS
                     KDAEKTLAGKELYFYLLAKIFLDFDNYLDGEYLAEIFIKYCVHTLEKSKYQLAQISVD
                     FKFYENGEKSWWNRFSHWIAKWRLVSHNIRWNVRISRAYSKLFKRDRVKNFQDFLDLL
                     FGPLFIEENQKDVELQFFLMNVCCLDLVVSSTDDYLWQEFADPSTDPKNWMAKGDNPT
                     ISHYMYHIYAHLAKLNFLRQDSALNTICLRNYCSTLSNRTSQAGSEQNFTDQVEALIC
                     NFLLCDAGLLQAEYMWDSSPLIAYLYYLCQIPVVVAPLSSVSLFSSQYTHRENSGVFG
                     DTVMQASRDITEGEEHTYRTSPFMDMFKIGMKVSLSSKSVLFNSSYTMEPLIEEYSVA
                     ASIYLLNAADLCEFSRTSVLCSGFEGFYKAHWIGVGLKKTPFLKCNMGYVDEWYDREP
                     DTSARHNVPLIRRFYRKHTWDQEWDFIRDQFD"
     gene            338745..338816
                     /gene="TDEL0Dtrna1C"
                     /locus_tag="TDEL_0Dtrna1C"
                     /db_xref="GeneID:11502189"
     tRNA            338745..338816
                     /gene="TDEL0Dtrna1C"
                     /locus_tag="TDEL_0Dtrna1C"
                     /product="tRNA-Cys"
                     /note="codon recognized: UGC"
                     /db_xref="GeneID:11502189"
     gene            <339125..>340676
                     /gene="TDEL0D01700"
                     /locus_tag="TDEL_0D01700"
                     /db_xref="GeneID:11503622"
     mRNA            join(<339125..339134,339217..>340676)
                     /gene="TDEL0D01700"
                     /locus_tag="TDEL_0D01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680917.1"
                     /db_xref="GeneID:11503622"
     CDS             join(339125..339134,339217..340676)
                     /gene="TDEL0D01700"
                     /locus_tag="TDEL_0D01700"
                     /inference="similar to DNA sequence:INSDC:YBR283C"
                     /note="similar to Saccharomyces cerevisiae SSH1 (YBR283C);
                     ancestral locus Anc_1.303"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680965.1"
                     /db_xref="GeneID:11503622"
                     /db_xref="GOA:G8ZT10"
                     /db_xref="InterPro:IPR002208"
                     /db_xref="InterPro:IPR019561"
                     /db_xref="InterPro:IPR023201"
                     /db_xref="UniProtKB/TrEMBL:G8ZT10"
                     /translation="MAGYRLVDVAKPFLPILPEVEVSYEKVSFDDKVVYTIISGLIYL
                     FGQFPLAGISKDESNVKDPIFFLRGVFGAEPKSLLEFGIFPIISSGLILQLLAGLKVI
                     SVNFKLQQDRELFQTLTKLFALLQYFVLTNIFILSGYYGENLTVVQIGVLNLQLVGAG
                     FIAILLTEVVDKGFGFASGTMTINTMVIATSLVADTFGVSQITVDAEGHKEAQGAIIN
                     LVQGMRSKHRTFLGGIVSAFNRDYLPNLSTTLIVLAIGATVCYLQSFRLDLPIRSTKA
                     RGVNNVYPIRLLHVGALSVSFSYVLLTYIHIFAFALIHLVAKNNSQSIICKVLGHYET
                     VNNILYTPTFPLSLLTPPRSLLSGLFEQPLTFVVYTGFMLITGVWFANHWQAMSGSSA
                     RDIAVQFKEQGITLTGRREQSVAKELEKVIPVASTTGAALLALVTVIGEVLGLKGKAA
                     AIVVGVATGFSLLELISMDYQQTGGQSALAQVLGAPGRF"
     gene            complement(<340819..>341256)
                     /gene="TDEL0D01710"
                     /locus_tag="TDEL_0D01710"
                     /db_xref="GeneID:11502190"
     mRNA            complement(<340819..>341256)
                     /gene="TDEL0D01710"
                     /locus_tag="TDEL_0D01710"
                     /product="mitochondrial 54S ribosomal protein YmL27"
                     /transcript_id="XM_003680918.1"
                     /db_xref="GeneID:11502190"
     CDS             complement(340819..341256)
                     /gene="TDEL0D01710"
                     /locus_tag="TDEL_0D01710"
                     /inference="similar to DNA sequence:INSDC:YBR282W"
                     /note="similar to Saccharomyces cerevisiae MRPL27
                     (YBR282W); ancestral locus Anc_1.304"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL27"
                     /protein_id="XP_003680966.1"
                     /db_xref="GeneID:11502190"
                     /db_xref="InterPro:IPR019189"
                     /db_xref="UniProtKB/TrEMBL:G8ZT11"
                     /translation="MRSTAVNLFRESPVTLLTRPWKKFRDGTLFYGASKAGNKRSALT
                     TKQGNKTMYKGTRSSGIGKHTRYGGYTINWKRVRTFVTPKNYNTDLKPLVSHNVPELK
                     HQFKGYTKGSLDAKLYFGKLREYIQNGKLPSDASDPKCYIERG"
     gene            <342075..>343694
                     /gene="TDEL0D01720"
                     /locus_tag="TDEL_0D01720"
                     /db_xref="GeneID:11502191"
     mRNA            <342075..>343694
                     /gene="TDEL0D01720"
                     /locus_tag="TDEL_0D01720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680919.1"
                     /db_xref="GeneID:11502191"
     CDS             342075..343694
                     /gene="TDEL0D01720"
                     /locus_tag="TDEL_0D01720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680967.1"
                     /db_xref="GeneID:11502191"
                     /db_xref="UniProtKB/TrEMBL:G8ZT12"
                     /translation="MDTGKNTKASLTSKIIYDPPLTVEIDGVKELESILDLENCSSEL
                     CSVLDLPERSPNIYDTFESFEEVSIFGDLDKPPNNFDKEDRTSHYTATTMNSFDDAGM
                     VTSDFENSSTSPISQPGRRLSNSSPPQPSDLGFIFMDQDGIVPLAVWSADALETSARE
                     SEKTMRYKTQKVEHPRKIDRKPKFKVVKPTNHTSSFLQNVAKSCNMDLSYLFHCEDPQ
                     SAGSVLPSGTTLRPDTLSLYPNYSEKNHRSFHEPVSKKRSLEDSYNRTNTNSTKVTAG
                     RPRKEKRIKCLKRDSSVTLEKKVEFSQAIIEDAKPKRYQGIILRDQAAAELRLGKDEH
                     HALNLTLPNFDLVCQYLDGKAQEQHNSFRTIWKISRTQIDHHVSLEFHLSDETATVPD
                     AAMEISVFTLMAPGHSTKHLVTSCQYLEMVNFILGKDYNYLINDNLAETTVGSDGKMI
                     STQKHHASRVRSHVKKLLKRHVVKDFKRYTAEDRSDPIEFEYKMALHNLVLQCYVKKP
                     FESKVSIALMELGCVKKALTKQTEFFTFKKI"
     gene            complement(<343845..>345647)
                     /gene="TDEL0D01730"
                     /locus_tag="TDEL_0D01730"
                     /db_xref="GeneID:11502192"
     mRNA            complement(<343845..>345647)
                     /gene="TDEL0D01730"
                     /locus_tag="TDEL_0D01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680920.1"
                     /db_xref="GeneID:11502192"
     CDS             complement(343845..345647)
                     /gene="TDEL0D01730"
                     /locus_tag="TDEL_0D01730"
                     /inference="similar to DNA sequence:INSDC:YJL069C"
                     /note="similar to Saccharomyces cerevisiae UTP18
                     (YJL069C); ancestral locus Anc_1.305"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680968.1"
                     /db_xref="GeneID:11502192"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZT13"
                     /translation="MSNSVGGKLAGVIKATVPPPDEEEQLLAKVVFGDTSDFQSGLKD
                     FDLELLLNEQEDDLVDTYNGDELSGPEGEEDEENENMDNVQDDQLFFVDEGEDQANED
                     VDMDQDEPSEYSDEDEMEDGDDAWQDSDDEEVSVSVITSNKTKKLRTSYEESAINGKD
                     YIRRLRAQFEKIYPKPKWVDDISDEDLSGDESNDEGNEQALNGDISALSRILESTYEY
                     KDVSHSKLLPPKTLDIVRLKDANASHPSHSAIQSLSFHPHKPLLLTGGYDRTLRIYHI
                     DGKSNHSVTSVYLKGTPVQTCCFYVSPGQSSKKNTEEQRVFSGGRRRYMHSWDLSNAL
                     MNSSSHGSVAKIDKISRMYGHEETQRSFEKFKIAHFHNFETNQSHGIILLQGNNGWIN
                     VLNATTGVWMTGCKINGVLADFCIDYRPTSKNRAQTILIAANTYSEIWEFNLNDNGKV
                     VRKWKDEGGVGVTKIQVGGGTNSDNILTTEAGNMRTNRWLAIGSESGYVNVYDRKKLS
                     NNPKPVAALDQLTTTISTLKFSPDGQILCMASRAVKDSLRLVHLPTCTVFSNWPTSGT
                     PLGKVTAAAFSSHGEMLAVGNEQGKVRLWALNHY"
     gene            <346288..>348957
                     /gene="TDEL0D01740"
                     /locus_tag="TDEL_0D01740"
                     /db_xref="GeneID:11502193"
     mRNA            <346288..>348957
                     /gene="TDEL0D01740"
                     /locus_tag="TDEL_0D01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680921.1"
                     /db_xref="GeneID:11502193"
     CDS             346288..348957
                     /gene="TDEL0D01740"
                     /locus_tag="TDEL_0D01740"
                     /inference="similar to DNA sequence:INSDC:YBR281C"
                     /note="similar to Saccharomyces cerevisiae DUG2 (YBR281C);
                     ancestral locus Anc_1.306"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680969.1"
                     /db_xref="GeneID:11502193"
                     /db_xref="GOA:G8ZT14"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017149"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8ZT14"
                     /translation="MISSDLDLVHKWGHAYSIISIISFPKKNLLFAGTQDSKVLVFTL
                     YTYELIQTIKLGGDYETNTRSSVLCLERSIDENYLFSAGADSLVRIWSVYNTDETRGA
                     VQIEEVATVYSVTDIGDIFSLTYLDSLQTLVFGCQNASMMYLDNVFDRLLYDQTESPC
                     DINRLPHRRYDKFFDSSGPTGQPENRQLAQDEFHKSALQDGAMNRILEIPSENIINYA
                     HNGFIYSICKLCLKCSSFLSNNKTNELNHTHLHEYEPKSTCSEQSEISECIITGGGDG
                     ISKLWLFTKNGRGVVSIVSMGTNLSNEETVLAQATDFPFLYCGLSEGTVKIWDLTTKQ
                     LISTLHTPERSDIISVSVYQDHIFAINEGGITLFHEKEVIHWNQHQGKMLSSDVFERH
                     VDQSETQMSLLTGGNDGSLSLWDLSSVLHLSLNEIKTQNMEFQRRKSIATARGHSVKP
                     DTEEMLETLRVLIAIQSVSQTPDTVEQLASRRCATYLQKLLSKLGASRAHCFPLESGH
                     NPVVYASFKGTGENKKRILWYGHYDVIPAADINRWTSDPFTLTCENGYMKGRGVSDNK
                     GPLVAAMHSVATLLKNGELYNDVVFIIEGSEEIGSPGLDVVCEQNRNLIGDIDWIFLS
                     NSTWVDQDHPCLNYGLRGVINAKVTVWSDEPDRHSGVDGGMHKETTADLFSVISKLQD
                     DRGKVLIPNFNTPTKKISPEDYKRLEEIVELTEFGKNITVEELIKNWTKPSLSVTTMA
                     MSGPGNLTVIPKSATVGLSIRLVPEQGVEKVKSALIGHIEDCFQRLSSPNHLEISIEN
                     SAEAWLGDPTNQAYQILRKQMTATWGTEPLFVKEGGSVPCVRTLERIFNAPAVQIPCG
                     QSTDNGHLDNENLRIKNWSNMAEVICNVFRRLQ"
     gene            <349125..>350882
                     /gene="TDEL0D01750"
                     /locus_tag="TDEL_0D01750"
                     /db_xref="GeneID:11502194"
     mRNA            <349125..>350882
                     /gene="TDEL0D01750"
                     /locus_tag="TDEL_0D01750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680922.1"
                     /db_xref="GeneID:11502194"
     CDS             349125..350882
                     /gene="TDEL0D01750"
                     /locus_tag="TDEL_0D01750"
                     /inference="similar to DNA sequence:INSDC:YBR280C"
                     /note="similar to Saccharomyces cerevisiae SAF1 (YBR280C);
                     ancestral locus Anc_1.307"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680970.1"
                     /db_xref="GeneID:11502194"
                     /db_xref="GOA:G8ZT15"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="InterPro:IPR027046"
                     /db_xref="UniProtKB/TrEMBL:G8ZT15"
                     /translation="MSEAESNTTNAYDNVPPDIVQTALPFLSLEDIKNLSHTNKYFHK
                     LLNYESSETLWHDLFHKAYGRPYSNDEPFQTKDSGELRTCGEVIMLQDFSSLSWQERF
                     KVRTEQVKLYTWGCLKHGRLGYTANSNSHLSSNNLNSVGMRIKYGVNSPTMVPWFEES
                     NSTDESAIVQVSSGGFAFQILTRSGKLYTTGSSFSGGHNGPGPKEGEHDYNPFREAVH
                     DLETSFSRYRSIGITPGTFGVIPYGGTMHHGPTPTVGPHPNIYQDLEDMEKNAAQTIP
                     GNSYIRRVFTRNCFDIFISDSHSFKVDKEKLDSIKFVAVSSGRSHFLALDENNNLYSW
                     DSPDSDYGVRLSFKGLPSIDTNPIWKIGSGWDLNCIYVYKVGLIVWNKRDALKKGELA
                     SDVHYTIIPNTSDISGPGRVVDFACCQGDCVFFITNDRKILWVYSNGIVQQLRIPVEG
                     EYVKVTVCFTILALFTNEKCYTIKIKNSKLDMSSLTELQLEESEDRIISLATGDYHTV
                     ALTSKGQIYTWGLESQLCGCLGLGSPESVIEEEHHGRWDSIRNMRVEQPTKVKLNDEY
                     TCVAVCAGGWQSGALIMKR"
     gene            complement(<350943..>351839)
                     /gene="TDEL0D01760"
                     /locus_tag="TDEL_0D01760"
                     /db_xref="GeneID:11502195"
     mRNA            complement(<350943..>351839)
                     /gene="TDEL0D01760"
                     /locus_tag="TDEL_0D01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680923.1"
                     /db_xref="GeneID:11502195"
     CDS             complement(350943..351839)
                     /gene="TDEL0D01760"
                     /locus_tag="TDEL_0D01760"
                     /inference="similar to DNA sequence:INSDC:YJL068C"
                     /note="similar to Saccharomyces cerevisiae YJL068C;
                     ancestral locus Anc_1.308"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680971.1"
                     /db_xref="GeneID:11502195"
                     /db_xref="GOA:G8ZT16"
                     /db_xref="InterPro:IPR000801"
                     /db_xref="InterPro:IPR014186"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8ZT16"
                     /translation="MSFKVNQEIAVCGGKVLKLSHFSQIIGASMDVNVYLPKQYYSKT
                     VRKLIPVIYYLSGLTCSPQNASEKAFWQIQSDNYGFAMVFPDTSPRGDDVPDDPEKAW
                     DFGIGAGFYLNATQEPYKKHYQMYDYIHKELPTSLDEYFGKDSNLDFLDNVGITGHSM
                     GGYGSLTGFLKNYDANRYKSCSAFAPIVNPSKVPWGQKAFSGYLGSENAELWSQYDPS
                     ELVKKVINKGNDKILIHQGTKDPFLQTNLRPELLLEATKGTSWEGKIEVKMVDGFDHS
                     YYFISTFVPEHATFHAKNLGLI"
     gene            complement(<352013..>353311)
                     /gene="TDEL0D01770"
                     /locus_tag="TDEL_0D01770"
                     /db_xref="GeneID:11502196"
     mRNA            complement(<352013..>353311)
                     /gene="TDEL0D01770"
                     /locus_tag="TDEL_0D01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680924.1"
                     /db_xref="GeneID:11502196"
     CDS             complement(352013..353311)
                     /gene="TDEL0D01770"
                     /locus_tag="TDEL_0D01770"
                     /inference="similar to DNA sequence:INSDC:YBR279W"
                     /note="similar to Saccharomyces cerevisiae PAF1 (YBR279W);
                     ancestral locus Anc_1.309"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680972.1"
                     /db_xref="GeneID:11502196"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR007133"
                     /db_xref="UniProtKB/TrEMBL:G8ZT17"
                     /translation="MSKKQEYIAKIKYQNNLPPPLLPPKLLKFKVHTEEDADSAELIT
                     SLYSKTSVTPLVNINDDLGMPLDLMQLPGMLNNMDTKYLYELEGVKLAPEDRMLLRAP
                     GADRLPKTDMSKVTFLRRTEYVSTAITSHGQAEEDRKRTASKLEESEELLSASQIVEK
                     VESGFDAMTKDLSKLQHPVKKKVHAVKAWNLLPDTASMDQSYFTLRFAGSAALDATEK
                     KKYALSTSIFRPVELEEDEWISMYTTDPQNSDNLSKDVEKKIDENLQSGVEEGKVYKF
                     KRLRDFDMKQVPHQGRGGSFGELALVLNDEKGIAYYKPLRSRIELRRRRVNDVIKPLV
                     REHNVDQINVTLRNPTPQEANLRDRLRMKFDPIDFANADEDDEEPEVQEQENEVAQAE
                     LKDEEVKKPEEEEPQEEEPQEKEQADAKDAPTDDGEIAGN"
     gene            complement(<353592..>354539)
                     /gene="TDEL0D01780"
                     /locus_tag="TDEL_0D01780"
                     /db_xref="GeneID:11502197"
     mRNA            complement(<353592..>354539)
                     /gene="TDEL0D01780"
                     /locus_tag="TDEL_0D01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680925.1"
                     /db_xref="GeneID:11502197"
     CDS             complement(353592..354539)
                     /gene="TDEL0D01780"
                     /locus_tag="TDEL_0D01780"
                     /inference="similar to DNA sequence:INSDC:YJL066C"
                     /note="similar to Saccharomyces cerevisiae MPM1 (YJL066C);
                     ancestral locus Anc_1.310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680973.1"
                     /db_xref="GeneID:11502197"
                     /db_xref="UniProtKB/TrEMBL:G8ZT18"
                     /translation="MGLCSGNNDKQVEEVNERILKDETEDPVSDKLGSITDSMSSIWK
                     DSSSLWSHALDNPDKFLTQLTGSQNNHDRDLWDNFAMSASDAMGSLLDVMGLPGGYGN
                     PNRVKYLMDEPFTSDEVVRQGITGLYNYRTPTELQFTECNKVGGLSVWNTKGWWRCLF
                     PEKEVSERLADQKDKLQYVLTKEKVEGDSKHKFGLFFPEYTGFLTWKSHMNQLIRERA
                     DKEVAVIQTEPKLSTPEDLMVDTSKMNDDRDKKVIGTSEYVTYTYTPEGQKEVKKTKT
                     FYDNGTVLVRSENKLTPADRSEPQFDTSEKIISVKDDEK"
     gene            complement(<354675..>355265)
                     /gene="TDEL0D01790"
                     /locus_tag="TDEL_0D01790"
                     /db_xref="GeneID:11502198"
     mRNA            complement(<354675..>355265)
                     /gene="TDEL0D01790"
                     /locus_tag="TDEL_0D01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680926.1"
                     /db_xref="GeneID:11502198"
     CDS             complement(354675..355265)
                     /gene="TDEL0D01790"
                     /locus_tag="TDEL_0D01790"
                     /inference="similar to DNA sequence:INSDC:YBR278W,YJL065C"
                     /note="similar to Saccharomyces cerevisiae DPB3 (YBR278W)
                     and DLS1 (YJL065C); ancestral locus Anc_1.311"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680974.1"
                     /db_xref="GeneID:11502198"
                     /db_xref="GOA:G8ZT19"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G8ZT19"
                     /translation="MSEEQKEAMERLKKSQPRLPISKVRKIARSDPEYIVTAGNAFTA
                     AAFATELFVQSMTEEMIQLAYLSGKTATSKSIRLSYKNLSDCVARKENYSFLEDVVPQ
                     TKNLRTLVKENKVRYTTRIEGQQTLPFEEKHEEPDLDPEDEEDLEEDEEHQDPEVEEQ
                     LREIEELNRVPDLPDDDRRSESERSDQEDDNGGVEG"
     gene            <355798..>358281
                     /gene="TDEL0D01800"
                     /locus_tag="TDEL_0D01800"
                     /db_xref="GeneID:11502199"
     mRNA            <355798..>358281
                     /gene="TDEL0D01800"
                     /locus_tag="TDEL_0D01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680927.1"
                     /db_xref="GeneID:11502199"
     CDS             355798..358281
                     /gene="TDEL0D01800"
                     /locus_tag="TDEL_0D01800"
                     /inference="similar to DNA sequence:INSDC:YBR276C"
                     /note="similar to Saccharomyces cerevisiae PPS1 (YBR276C);
                     ancestral locus Anc_1.312"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680975.1"
                     /db_xref="GeneID:11502199"
                     /db_xref="GOA:G8ZT20"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G8ZT20"
                     /translation="MSQFSAVQRSSSKRQSTADDVSASSTPIKRHDSDRSSNIGGSLQ
                     FEFISVQELQGLLQMHLATPLPECDEMFPWLHSYSTTPPPSFPNAVSIIRSQPMSEGW
                     IQNSGILRCSLDPHDFLMTWGNDKNQQFRHCDRNESAIILREVMIRELAKVKEVVNED
                     DMNDAVQLCLQYNVLPFLTTDAYARETYGLKKGCTVSNSHQAAAVLTPKQPGSFRRFD
                     IQSAKMLEMSPAIVIYCFEIADCHNFSENPCRKCNQMAKVLRIALNLIQRSYSEKKSF
                     EVDIKILKYASIDEIPKSLIGTAPMSTTTLNKITPQQLVSQFDVESFNNWERGLLYRE
                     QLEMSKMSSASVVEQSRSVWCGNCTDYQVYKLLKKCGHLNEGQPSHPPCFSTENSIVK
                     LKNIKFSPDCQEAVDTKFFNITNPEKEWSMMIRCTESAAPPSLEKLWECLANALNDRI
                     SKPAEFNFPSSGTITLGSLNINSIKVILNTCFIIHQLTSMEGHGVLIYCSDGYTETTF
                     LLVSYLIFLWDLSLEDTLVRLHTEFQRPFFLFHMDLQVLGHLQTLLRNFSPKRTENAA
                     LFQSPLDGQLQPLEITPEMFSKIFLFRIPAGSDFSNLKGPLPSRILPHMYLGSLEHAQ
                     SPELLRKLGINYIVSVGENLSWVETSNQRNRASSSPIPTPASKVMSNFKSRNRGFSME
                     NNQKNNCIEENQSNSFIDFFEKEEFKILRVMNLGDNGKDALTHQLEHILKFIGECHDN
                     NGKVLVHCMVGVSRSATVCIAECMKRLQCDVLRAYIFVRVRRLNIIIQPNLMFMYELL
                     KWQEQQLQGREIDWHIICRSISELNTNYI"
     gene            complement(<358357..>359415)
                     /gene="TDEL0D01810"
                     /locus_tag="TDEL_0D01810"
                     /db_xref="GeneID:11502200"
     mRNA            complement(<358357..>359415)
                     /gene="TDEL0D01810"
                     /locus_tag="TDEL_0D01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680928.1"
                     /db_xref="GeneID:11502200"
     CDS             complement(358357..359415)
                     /gene="TDEL0D01810"
                     /locus_tag="TDEL_0D01810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680976.1"
                     /db_xref="GeneID:11502200"
                     /db_xref="GOA:G8ZT21"
                     /db_xref="InterPro:IPR001216"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="UniProtKB/TrEMBL:G8ZT21"
                     /translation="MSLQKFPVVATKGLTDAIGNTPLIKLTKLSQQVGRNIWGKAEFQ
                     NPGGSVKDRAALYLIQEAERLGQVDGKKADPTIVEGSAGNTAIGLAHIARARGYRSIF
                     YMPNTQSAAKINLLKFLGAEVYPVPVCPISDPLNFNNRARDHAARLPNAVWTDQFDNP
                     ANWKSHYYTTGPEIYNQLINNGFSCDAFTCSTGTGGTFTGVARYLEETTNGKCKLVAA
                     DPPGSVIYSYVKKGTMDREGSSFTEGIGQGRITKNLEASMDIIDDAVFIPDEESIVML
                     YRLLDEEGLYLGGTSALNVVAACKVAKELPEGANVATILCDSGHKYAERVFSKKWLKE
                     KNLYDVIPKQLLKYASLD"
     gene            complement(<359575..>360312)
                     /gene="TDEL0D01820"
                     /locus_tag="TDEL_0D01820"
                     /db_xref="GeneID:11502201"
     mRNA            complement(<359575..>360312)
                     /gene="TDEL0D01820"
                     /locus_tag="TDEL_0D01820"
                     /product="mitochondrial 54S ribosomal protein YmL8"
                     /transcript_id="XM_003680929.1"
                     /db_xref="GeneID:11502201"
     CDS             complement(359575..360312)
                     /gene="TDEL0D01820"
                     /locus_tag="TDEL_0D01820"
                     /inference="similar to DNA sequence:INSDC:YJL063C"
                     /note="similar to Saccharomyces cerevisiae MRPL8
                     (YJL063C); ancestral locus Anc_1.313"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL8"
                     /protein_id="XP_003680977.1"
                     /db_xref="GeneID:11502201"
                     /db_xref="GOA:G8ZT22"
                     /db_xref="InterPro:IPR000456"
                     /db_xref="UniProtKB/TrEMBL:G8ZT22"
                     /translation="MTVGLARKLSRTKPHRDALLKNMVSQLLQHGSITSTHEKCKEAS
                     RVAERVITWAKKVNANPASPLRSEIQSRLFLSGDNSKLMSRLLDDIAPNYVGRDGGYT
                     RVLHLEPRLGDKARQSILELVNTPVVDKEGNYNRGNMKLWLLVKNSVNDESSRRPYNA
                     FTLKSLKKMLVGKAPGQLATEILAIRKFLKQNQDSEWNESLEKESVSLLLDQVNELGS
                     TKPQSQTKRGGYAFVSQRPVRNLSSTA"
     gene            <360704..>360970
                     /gene="TDEL0D01830"
                     /locus_tag="TDEL_0D01830"
                     /db_xref="GeneID:11502202"
     mRNA            <360704..>360970
                     /gene="TDEL0D01830"
                     /locus_tag="TDEL_0D01830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680930.1"
                     /db_xref="GeneID:11502202"
     CDS             360704..360970
                     /gene="TDEL0D01830"
                     /locus_tag="TDEL_0D01830"
                     /inference="similar to DNA sequence:INSDC:YJL062W-A"
                     /note="similar to Saccharomyces cerevisiae YJL062W-A;
                     ancestral locus Anc_1.314"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680978.1"
                     /db_xref="GeneID:11502202"
                     /db_xref="UniProtKB/TrEMBL:G8ZT23"
                     /translation="MVLDPSRYQDTRTWKMTPAMIRARQPFFRRNMIGLGLLLGVTGG
                     VYFYTYNFLHRDNDFADVPVPPISEEELAQLKKEYEVLKANKEK"
     gene            <361149..>362099
                     /gene="TDEL0D01840"
                     /locus_tag="TDEL_0D01840"
                     /db_xref="GeneID:11502203"
     mRNA            <361149..>362099
                     /gene="TDEL0D01840"
                     /locus_tag="TDEL_0D01840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680931.1"
                     /db_xref="GeneID:11502203"
     CDS             361149..362099
                     /gene="TDEL0D01840"
                     /locus_tag="TDEL_0D01840"
                     /inference="similar to DNA sequence:INSDC:YBR265W"
                     /note="similar to Saccharomyces cerevisiae TSC10
                     (YBR265W); ancestral locus Anc_1.315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680979.1"
                     /db_xref="GeneID:11502203"
                     /db_xref="GOA:G8ZT24"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZT24"
                     /translation="MASIKYGLEDQVVLITGGSQGLGKQFAKKYYNESVRSKVVIVSR
                     GVEKLRNAIQEVTDGEVSPRPLTKTDIWSGKDRIAYVPCDLSDYSSVSQLFEILKAND
                     IVPTQFLACAGGSTPKLFKDLTGEQLEAGVKMNYFTALFLSHKVAQLYPYSHLILFSS
                     ETAFFPFIGYAQYAPSKEGIKALVSILRQELSHTRVSCVYPGNFESEGFALEELEKPA
                     ITKKIEGPSEPISCEECCNRIVRRLSQGYDDITVDLVGWFLMSTDMGLNKHDNYSFLW
                     FLQLILGTLSNLFIVPIFMLMCRYDINKWHRNQKNPFQRK"
     gene            <362311..>363471
                     /gene="TDEL0D01850"
                     /locus_tag="TDEL_0D01850"
                     /db_xref="GeneID:11502204"
     mRNA            <362311..>363471
                     /gene="TDEL0D01850"
                     /locus_tag="TDEL_0D01850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680932.1"
                     /db_xref="GeneID:11502204"
     CDS             362311..363471
                     /gene="TDEL0D01850"
                     /locus_tag="TDEL_0D01850"
                     /inference="similar to DNA sequence:INSDC:YBR267W"
                     /note="similar to Saccharomyces cerevisiae REI1 (YBR267W);
                     ancestral locus Anc_1.316"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680980.1"
                     /db_xref="GeneID:11502204"
                     /db_xref="GOA:G8ZT25"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8ZT25"
                     /translation="MSIYTCNTCELQFEGSQAQREHMKSEWHRYNLKRRVANLPPISE
                     EVFNSKVQALSAHEDAESTKSDKNKQLTKKELRRREKEALLEEKRQLLKIAEQNALNR
                     LAEQQAKPQEELREAPKEEPKEEPKEQDEEELTEEQLSEKLMQQKIDNRVDIPLTACF
                     FCNNKSFKTVELNLEHMFKNHGFYIPEQKYLVDRDGLLSYISEKIGLGNVCIVCNFEG
                     RSLEAVRAHMLAKRHCRIPYEEEDEKLEISQYYNFTSTYEQQSMEDGKEEDWEDVESG
                     EEDDASEDDIPEDYIYHDGVELHLPSGIKVGHRSLQRYYKQNLRPEVELTEGQGTLVA
                     AETRSFLTPFDKKKVQVQQRTWQTEVTDKKRHDKRAAKFINNQPHYRDQLLQ"
     gene            <363606..>366035
                     /gene="TDEL0D01860"
                     /locus_tag="TDEL_0D01860"
                     /db_xref="GeneID:11502205"
     mRNA            <363606..>366035
                     /gene="TDEL0D01860"
                     /locus_tag="TDEL_0D01860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680933.1"
                     /db_xref="GeneID:11502205"
     CDS             363606..366035
                     /gene="TDEL0D01860"
                     /locus_tag="TDEL_0D01860"
                     /inference="similar to DNA sequence:INSDC:YJL062W"
                     /note="similar to Saccharomyces cerevisiae LAS21
                     (YJL062W); ancestral locus Anc_1.317"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680981.1"
                     /db_xref="GeneID:11502205"
                     /db_xref="GOA:G8ZT26"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="UniProtKB/TrEMBL:G8ZT26"
                     /translation="MQKRLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQN
                     EAKPVFNKLVLVVIDALRSDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPR
                     LKGITTGSTPNFLDAILNVAEDDSSSNLNDQDSWVRQFFSHGKKLRFFGDDTWLKLFP
                     KEYFDEYDGTNSFFVSDFEQVDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGP
                     NSQFMPAKQEEMDEILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALI
                     SKKLRRYAPPAEQIGVQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVG
                     ILIQETLQLLDPKLAKIKLLENLKQLDSISNGHEVIQDEANIDQLYDLMKDIQSDLTR
                     SATNYNYDLMGMGLALLVITTIITVLVGSNRMEFGHPFFFTMIVSLLIGLSSFGSSFV
                     EEEHQIWWWISTGATLASSVYLVDEKYTHFVILVCLRIIRAWNNSGQKHFNENTVFDI
                     LKRNPTEQWYLNFFAIVICGLKGSSGDIVTFMCSFVLTALCLVYKVTWALVNRETVPH
                     WLYEVAYKSCSIMMGDTTDVFDKSLIPLAQLFFRCFAGCVAVAVVACKMGGNKNSHAI
                     STFITLLLIFQSQSPNIPLFFVFDVLKSSLNKIVSKRYNSDAYMISAVSLILQYFTFF
                     HFGGTNSIATVDLSNAYNGVSENYNIYAVGFMMCVSNFAPSIYWSTFTWNLLYKTNKK
                     WHNFFQSKLTFLMFNCISGCCLMFACVALRFHLFIWSVFSPKLCYYATWNIFMNLVIG
                     WILEIPLALTT"
     gene            <366206..>366508
                     /gene="TDEL0D01870"
                     /locus_tag="TDEL_0D01870"
                     /db_xref="GeneID:11502206"
     mRNA            <366206..>366508
                     /gene="TDEL0D01870"
                     /locus_tag="TDEL_0D01870"
                     /product="mitochondrial 54S ribosomal protein YmL37"
                     /transcript_id="XM_003680934.1"
                     /db_xref="GeneID:11502206"
     CDS             366206..366508
                     /gene="TDEL0D01870"
                     /locus_tag="TDEL_0D01870"
                     /inference="similar to DNA sequence:INSDC:YBR268W"
                     /note="similar to Saccharomyces cerevisiae MRPL37
                     (YBR268W); ancestral locus Anc_1.318"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL37"
                     /protein_id="XP_003680982.1"
                     /db_xref="GeneID:11502206"
                     /db_xref="InterPro:IPR013870"
                     /db_xref="UniProtKB/TrEMBL:G8ZT27"
                     /translation="MFRFVPKRLFSNCRVFLQETPSTIVKSSCPAGTVLSVNVKKSGK
                     DPVALEDSEYPAWLWEVLDPEARARKLAEDPMKLRKKQIRKANRMQIKQNNFLQQL"
     gene            <366715..>368790
                     /gene="TDEL0D01880"
                     /locus_tag="TDEL_0D01880"
                     /db_xref="GeneID:11502207"
     mRNA            <366715..>368790
                     /gene="TDEL0D01880"
                     /locus_tag="TDEL_0D01880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680935.1"
                     /db_xref="GeneID:11502207"
     CDS             366715..368790
                     /gene="TDEL0D01880"
                     /locus_tag="TDEL_0D01880"
                     /inference="similar to DNA sequence:INSDC:YJL061W"
                     /note="similar to Saccharomyces cerevisiae NUP82
                     (YJL061W); ancestral locus Anc_1.319"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680983.1"
                     /db_xref="GeneID:11502207"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:G8ZT28"
                     /translation="MTVETHPIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCN
                     VSEPGYHSMTLERAFKDVKHVVMSNSGEFLCLYNDDELRIIEVPWAYTEVSSMANAFQ
                     LFRFVSDEARIKQVLFHPLAYQQETVVILKDDDSITIMNWQDFGDSKPDVLNLSNGTY
                     SLDSSITDVECITFSQDGLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSL
                     IQYDVLNVGTDSEVKRNTIKQLKFVSGLHKQQNSQRILEIPEAQRQVRGQGPFTIAPF
                     PKQIYSSTGTGIASLPINDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFA
                     LVELITLGSQEIQQIVVGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLA
                     ETKLESEVTFTELKDSPKSVAWWNTTPQSVVKVSNREVKSKQVSEGVSKQDDDITGSR
                     QEPEKYNAHYSQPIAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLT
                     EASKDFVSKIAVGQTLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSR
                     SDAVHARHSTLMSRFNKFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDV
                     HNQKRLQDQLIHLKQEMNRIAQVTGDQNSQARDEWHELRHMLEEDTIILQDCNNQLKS
                     AARQVPAQP"
     gene            complement(<368841..>369218)
                     /gene="TDEL0D01890"
                     /locus_tag="TDEL_0D01890"
                     /db_xref="GeneID:11502208"
     mRNA            complement(<368841..>369218)
                     /gene="TDEL0D01890"
                     /locus_tag="TDEL_0D01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680936.1"
                     /db_xref="GeneID:11502208"
     CDS             complement(368841..369218)
                     /gene="TDEL0D01890"
                     /locus_tag="TDEL_0D01890"
                     /inference="similar to DNA sequence:INSDC:YBR269C"
                     /note="similar to Saccharomyces cerevisiae YBR269C;
                     ancestral locus Anc_1.320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680984.1"
                     /db_xref="GeneID:11502208"
                     /db_xref="InterPro:IPR012875"
                     /db_xref="UniProtKB/TrEMBL:G8ZT29"
                     /translation="MLLGVRRYVGSCRRAGVRWFKAEPVAGPPKLPKEDQEEFERLQK
                     IAQSQEAIDAYNREVEGDSTKESLNSPLLTKNDIGSFSPEFTKTLPEFEGDKNPETGE
                     IGGPKQDPLRHGDYSFNGRVTDF"
     gene            <369434..>370765
                     /gene="TDEL0D01900"
                     /locus_tag="TDEL_0D01900"
                     /db_xref="GeneID:11502209"
     mRNA            <369434..>370765
                     /gene="TDEL0D01900"
                     /locus_tag="TDEL_0D01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680937.1"
                     /db_xref="GeneID:11502209"
     CDS             369434..370765
                     /gene="TDEL0D01900"
                     /locus_tag="TDEL_0D01900"
                     /inference="similar to DNA sequence:INSDC:YJL060W"
                     /note="similar to Saccharomyces cerevisiae BNA3 (YJL060W);
                     ancestral locus Anc_1.321"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680985.1"
                     /db_xref="GeneID:11502209"
                     /db_xref="GOA:G8ZT30"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8ZT30"
                     /translation="MSKNAVRGLRSMTVARPHIVPNKYFTANVAKDVWSLTNEAAAAA
                     AGNAQNKGRELINLGQGFFSYSPPKFAITEAKKAVDIPLVNQYSPTRGRVSLLESLIK
                     LYSPLYNAELKAENVTVTTGANEGILSCLMGILNPGDEVIVFEPFFDQYIPNIELLGG
                     KVVYVPINPPKDMDQRVVKGTEWTVDYEQFANAITDKTKAVIINTPHNPIGKVFTREE
                     LTRIGEICVKKNVVIISDEVYEHLYFTDSFTRIATLSPEIGQLTLSVGSAGKSFAATG
                     WRVGWVVSLNPELLSYVSKAHTRICFASPSPLQEAVANSINDALEINYFENMRQEYKH
                     KYDIFTSVFKELGLPYTEPEGTYFILVDFSKVKIPEGYSYPEEIANKAKDFRIAYWLI
                     NELGVVAIPPTEFYIKEHEKAAENLLRFAVCKDDQYLEKAVDRLRLLKNYL"
     gene            <370917..>372143
                     /gene="TDEL0D01910"
                     /locus_tag="TDEL_0D01910"
                     /db_xref="GeneID:11502210"
     mRNA            <370917..>372143
                     /gene="TDEL0D01910"
                     /locus_tag="TDEL_0D01910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680938.1"
                     /db_xref="GeneID:11502210"
     CDS             370917..372143
                     /gene="TDEL0D01910"
                     /locus_tag="TDEL_0D01910"
                     /inference="similar to DNA sequence:INSDC:YJL059W"
                     /note="similar to Saccharomyces cerevisiae YHC3 (YJL059W);
                     ancestral locus Anc_1.322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680986.1"
                     /db_xref="GeneID:11502210"
                     /db_xref="GOA:G8ZT31"
                     /db_xref="InterPro:IPR003492"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR018460"
                     /db_xref="UniProtKB/TrEMBL:G8ZT31"
                     /translation="MGYPRSHVYLFFWIFGLINNVLYVVILSAAADIVGPKLPKSLVL
                     LADILPAFIVKLIAPFFMHRLSYSRRIVSLIVLSCVGMFLVSYGKLSVCLVGIVLASI
                     SSGFGEVTFLQLTHYYKEVALNGWSSGTGGAGLFGSGIYMLFTSILNIPVSISLLCFS
                     VLPLGFLLYYKLDQSSQEMDPSSAAPFLGDTQEEIDALVLAPPSSTSAVVKEDLLVDM
                     KGNFFETCSRLKELIVPYMLPLTTVYLFEYLINQAVAPTLLFPLDQKRMPFFFHRYRD
                     IYVTYGTLYQLGVFVSRSTAHLIRMKKLYLLSSLQGLNFILVCLQSLLYIVSSPWPIM
                     LLVFYEGFLGGAAYVNTFLNVLADEAPEKREFTLGTVSIADSFGVLIAALIGLKLEPT
                     LCSHQVADGRPWCTME"
     gene            complement(<372181..>373764)
                     /gene="TDEL0D01920"
                     /locus_tag="TDEL_0D01920"
                     /db_xref="GeneID:11502211"
     mRNA            complement(<372181..>373764)
                     /gene="TDEL0D01920"
                     /locus_tag="TDEL_0D01920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680939.1"
                     /db_xref="GeneID:11502211"
     CDS             complement(372181..373764)
                     /gene="TDEL0D01920"
                     /locus_tag="TDEL_0D01920"
                     /inference="similar to DNA sequence:INSDC:YBR270C,YJL058C"
                     /note="similar to Saccharomyces cerevisiae YBR270C and
                     BIT61 (YJL058C); ancestral locus Anc_1.323"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680987.1"
                     /db_xref="GeneID:11502211"
                     /db_xref="InterPro:IPR013745"
                     /db_xref="UniProtKB/TrEMBL:G8ZT32"
                     /translation="MSEPTSRKRSATTNLTINEPNADPTSPTKGRTRFYSISSDIIPQ
                     TLTHPDDEETLKSPKNTVIPPTWSHVGFQSIFQGGGGGQRRSKNSSKSTASPEDSSLT
                     TEKSGESLSSLAQRAEYHRSEEDLSNESVHTSGSSTKDKIRSAILGMSKDNHSFGDRS
                     SRIFRTNTNKSTSSLSGSLLKSPRPRNTSTLSNVARKLFKHRKHKGVHNDDPEAAVPT
                     PLSKFLHSSYARHKAPSQFMHNATVDGKSAYPFHPSSLSIHNDKGLLPVQDDNSFMAN
                     LLFLHEFLKNLPTLQANYRNFHAQELHVLEENIWSVHCSITLELFKSKRIWELPVKIE
                     DMNRLLSFYIILKTESKASSPHVKFIGEVEEFLTTSLYILENQIVFNYTNEDIMNTSL
                     KRLGVIWQIFYQQVYYEVMAMFIPLEKSFRASSKYWLDKTFTETSMQHVLSMDYILLR
                     CFRDSIVLPYYQNFINSHDGARKSFQLYIFNEEEEKGVTGQDKLTLLQCFGTLSSIQS
                     NDQNQKIIEELLEGIRMSI"
     gene            complement(<373906..>375753)
                     /gene="TDEL0D01930"
                     /locus_tag="TDEL_0D01930"
                     /db_xref="GeneID:11502212"
     mRNA            complement(<373906..>375753)
                     /gene="TDEL0D01930"
                     /locus_tag="TDEL_0D01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680940.1"
                     /db_xref="GeneID:11502212"
     CDS             complement(373906..375753)
                     /gene="TDEL0D01930"
                     /locus_tag="TDEL_0D01930"
                     /inference="similar to DNA sequence:INSDC:YJL057C"
                     /note="similar to Saccharomyces cerevisiae IKS1 (YJL057C);
                     ancestral locus Anc_1.324"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680988.1"
                     /db_xref="GeneID:11502212"
                     /db_xref="GOA:G8ZT33"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8ZT33"
                     /translation="MSLVPYKEGSVILDDPRSRSLVIVHPSNGSLEFFQQVFDLENAA
                     SGSSWDQKTTAAIASFVCPQCGTEFNPAVGVASPVDEESIQEDESMKELPVARSIGSR
                     SDLPRKYFKLLESSHRHYSLDQGRATLGPQHQYFIPDSLFIPGYYRKFFKTLSLLGNG
                     ARGSVYKVVHKIGDIDLGIFALKKIPIGNDMEWFQKCIREVKALSSLTHRSVNLITYN
                     HVWLEMNTACGLLRTLDGREPDAMEDIPCIFILQQYCSGGNLEDYILKDVFHKFQDLQ
                     SPEERKKRFLYKRKHPNESLGLSTGQILSITKDIAIGLQELHDIGLIHRDLKPSNCLL
                     LEENTKKSVIQEYNPTIVIGDLGECQIDGESRTATGATGTLEFTAPEVIIPGTGHHKP
                     TNYNEYTFASDMYSLGMICYFIVFGELPFKSQLEIGELKQNIMMFTLDKNALMEMHNE
                     RNLKPIDSRIFELMELLLSQNVNERLTAAEVVTMIESISESTAEEKSEKEACSNEIAI
                     LHKDEVVPSKDDLLEKHSIEYVDPSAERSSSIAKRSKLAHSKKILCVTINLALTAFTI
                     SSSNDMSLVCYISLVLFGMSVTSSLKDQKWFLAIFGCLALRHQWIRFHK"
     gene            <376261..>377478
                     /gene="TDEL0D01940"
                     /locus_tag="TDEL_0D01940"
                     /db_xref="GeneID:11502213"
     mRNA            <376261..>377478
                     /gene="TDEL0D01940"
                     /locus_tag="TDEL_0D01940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680941.1"
                     /db_xref="GeneID:11502213"
     CDS             376261..377478
                     /gene="TDEL0D01940"
                     /locus_tag="TDEL_0D01940"
                     /inference="similar to DNA sequence:INSDC:YBR271W"
                     /note="similar to Saccharomyces cerevisiae YBR271W;
                     ancestral locus Anc_1.325"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680989.1"
                     /db_xref="GeneID:11502213"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZT34"
                     /translation="MFDPLDLYTAEEEKPFKISRLVEERLGEASVNCQKYNDQTDENE
                     DEDYESILLDVLDLPSIQIATPKAILCVLLLLQPSNQVNFEVEALEQDISVDRICSEK
                     CIPSECLKRLVGYYNELWKNHRLNTASKVCSRIPILAQTQGPSMLKYYTSVLKHFENS
                     DCPLRDEILKQVSLRIAENCGRTAQPAMSRKFTFEGLPSPIEIYEPSLTADNLGWKTW
                     GASFILSQKLINVLAESTFNFKPRVLELGSGTGLAGISWLCKWVQKYGNGHTEIFLTD
                     LPVIVANLQKNVEVNKVESFATVSALDWTDPTDFINSYTDDEFDILIVSDPIYSPNHP
                     ELVVNMIKKFLSSQGQCYLEIPLRPRYAAERKRLRQLLSDNGFKIIKEEVDQGMEDWG
                     MVDYLFLEIVKKC"
     gene            complement(<377508..>379775)
                     /gene="TDEL0D01950"
                     /locus_tag="TDEL_0D01950"
                     /db_xref="GeneID:11502214"
     mRNA            complement(<377508..>379775)
                     /gene="TDEL0D01950"
                     /locus_tag="TDEL_0D01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680942.1"
                     /db_xref="GeneID:11502214"
     CDS             complement(377508..379775)
                     /gene="TDEL0D01950"
                     /locus_tag="TDEL_0D01950"
                     /inference="similar to DNA sequence:INSDC:YJL056C"
                     /note="similar to Saccharomyces cerevisiae ZAP1 (YJL056C);
                     ancestral locus Anc_1.326"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680990.1"
                     /db_xref="GeneID:11502214"
                     /db_xref="GOA:G8ZT35"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8ZT35"
                     /translation="MMINGPETMEKRGSEGIVHGHIHNYDNMTYIHGHVHHTSASGIA
                     EGYDTGPELAPSPNQTFTANQMSLSKSMDKSADCRYFQIINFHQNKMLSSEAGKEPGF
                     GMNKVDDLRSTPQTSRYNDDFLLLPRRKRKLSNNATDENCECPPKVLEICCDMQHSSS
                     KGEEKDKVAPEALPTVKNEETPRYRADNSQFFPSPMINDDNGSNFNFNQLLPIDCEMP
                     CQQAPKAYDSESEEDENKDEDIFEKFCKECLDLGHEPKHLSSSSNGHDDQDNATHVHH
                     SHHHNHSTVSGKHAFDTPLSTASTTSAEESLPSLPRKEQHNCAQPETTCDTPMKNSSG
                     HVANSQIDLKILNDLCNISSLYEFPFANHMNHHNHNHEHKENECINLLESSINDTGNS
                     LYELNENSSQNHHHHRVQLHGHMANCHSTTNTPKLGSQWNDKSFSGERSTIPDNAVKL
                     EDSNMVNPTVKSVDCFGISQESNTIAFNWAFKNEDNAIKCEWDQCPESYSNLIDLQKH
                     MLKDHVADEDASCNWVSCAFEGEDTCSLINHINTNHGINFGMNIADNSSLLEQRRQDR
                     IQNIPQPKSQSSDNIPYFACKWGDCTEVFDSAAALTTHLEALHLEKGKSEYHCHWHGC
                     DKRFAQRQKLVRHLKVHSGYKPYKCQDCGKCFSSEDTLTQHKRTHSGEKPFECRICGK
                     RFAVSSSLKIHIRTHTGEKPLQCKICGRRFSESSNLNKHMKSHQKKYSCVHCQRGFDD
                     AEKCKTHQSKCFKDR"
     gene            <380587..>381273
                     /gene="TDEL0D01960"
                     /locus_tag="TDEL_0D01960"
                     /db_xref="GeneID:11502215"
     mRNA            <380587..>381273
                     /gene="TDEL0D01960"
                     /locus_tag="TDEL_0D01960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680943.1"
                     /db_xref="GeneID:11502215"
     CDS             380587..381273
                     /gene="TDEL0D01960"
                     /locus_tag="TDEL_0D01960"
                     /inference="similar to DNA sequence:INSDC:YJL055W"
                     /note="similar to Saccharomyces cerevisiae YJL055W;
                     ancestral locus Anc_1.327"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680991.1"
                     /db_xref="GeneID:11502215"
                     /db_xref="InterPro:IPR005269"
                     /db_xref="UniProtKB/TrEMBL:G8ZT36"
                     /translation="MTAGINSVCVYCGSSFGNDSNYSDQAKKLGKLFHKLGWRLVYGG
                     GSTGLMGTIASSAMGPDCDGKVLGIIPNALVSKERDSGDDDDVNAKLKESVDNHRGAT
                     PISSKYGETCVVPDMHTRKRKMAEESDAYVAMPGGYGTLEEIMECITWSQLGIHGKPI
                     VLFNIDGFYDSLLNFIKHAIDEGFISKKNGLIIQVATTPEEVVEKIAHYVVPDGRFNL
                     AWDDEGKQQK"
     gene            <381478..>382809
                     /gene="TDEL0D01970"
                     /locus_tag="TDEL_0D01970"
                     /db_xref="GeneID:11502216"
     mRNA            <381478..>382809
                     /gene="TDEL0D01970"
                     /locus_tag="TDEL_0D01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680944.1"
                     /db_xref="GeneID:11502216"
     CDS             381478..382809
                     /gene="TDEL0D01970"
                     /locus_tag="TDEL_0D01970"
                     /inference="similar to DNA sequence:INSDC:YJL054W"
                     /note="similar to Saccharomyces cerevisiae TIM54
                     (YJL054W); ancestral locus Anc_1.328"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680992.1"
                     /db_xref="GeneID:11502216"
                     /db_xref="InterPro:IPR021056"
                     /db_xref="UniProtKB/TrEMBL:G8ZT37"
                     /translation="MSDSGSQAKKPKPGFTNPAFKAMGIPPLKLPSRNWMIFWSVLTV
                     SVSGIVYDKHRQKQIRNHYKDIVEPLASGNLEVNTKPRKITVFIAPPPSDYLDTSLKV
                     WKRYVKPILYYAGLDYEVIEEEKQGVIRTEVANRIREVRKQLRELASGKQDGENAQRL
                     ASQDQDEFDPELAKKYKSEFDFRDAIGIFYKTSKPQIIYEDSQNPDPSLAGGIICLGR
                     GAYKEYITGLHEGLLGPLDPPASVEPKVEETQVEEPKVENMQGTDLKVENAQGEDLKE
                     NVQDEKEGEKDDKEEETKDEKVLKPFITSDNYSEADIPQELQFQRGLFIKDPSTGIPI
                     LPHQAILMIPIPNLIGFLNIPERIYRFYQKRFYAEAVCSAVTDVVEQKNIRPYHSPQD
                     LALGAEEEDWPKSWVKEGLKRKSEWTAELKDDPRVTELLTVYNKGKEEPEK"
     gene            <383169..>384614
                     /gene="TDEL0D01980"
                     /locus_tag="TDEL_0D01980"
                     /db_xref="GeneID:11502217"
     mRNA            <383169..>384614
                     /gene="TDEL0D01980"
                     /locus_tag="TDEL_0D01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680945.1"
                     /db_xref="GeneID:11502217"
     CDS             383169..384614
                     /gene="TDEL0D01980"
                     /locus_tag="TDEL_0D01980"
                     /inference="similar to DNA sequence:INSDC:YBR272C"
                     /note="similar to Saccharomyces cerevisiae HSM3 (YBR272C);
                     ancestral locus Anc_1.333"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680993.1"
                     /db_xref="GeneID:11502217"
                     /db_xref="UniProtKB/TrEMBL:G8ZT38"
                     /translation="MSTNSDESPSAIKNMLDELNGMLECEELPSQINEQLERCILNLT
                     SINKLPVDPKRFLANIKRILVDPKANARLDYDLMLEMLSKIVATSSFEDVLTVFSVED
                     LVLSLKSGNPSLIKAANQVIARSYPKGLFANSEILDILLDLYFDSSYDISVINSIEHS
                     ISNLSSDELVRRRILINNLPPLMVVRKKFESTSMARLLEILNLLCRNMEHSEFIEKLF
                     VVRGDELIKSLDIDVVLFIHIVVYYTNLLNEVDVIEVGGHTHEWLLRYIQPIVPALGD
                     IYAQNDKYPDVKYFARSYLFKFFQKLSYLDDESLFRFLDENYIHISPETRYLTDFLSF
                     VNPSYLSRYYSTLLTRFGTVTPSKLGVIRNLVAHQQSFALIKSHITADAILAMPYMEQ
                     MVLLQRVSQYPHSAEYLLNDLPKVMSNLISNGNGEVIESETVALRRETIENLLKYDQS
                     VWHIPLMDEMIKITGGRPRSQVQTSLASSYI"
     gene            complement(<384739..>387966)
                     /gene="TDEL0D01990"
                     /locus_tag="TDEL_0D01990"
                     /db_xref="GeneID:11502218"
     mRNA            complement(<384739..>387966)
                     /gene="TDEL0D01990"
                     /locus_tag="TDEL_0D01990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680946.1"
                     /db_xref="GeneID:11502218"
     CDS             complement(384739..387966)
                     /gene="TDEL0D01990"
                     /locus_tag="TDEL_0D01990"
                     /inference="similar to DNA sequence:INSDC:YJL050W"
                     /note="similar to Saccharomyces cerevisiae MTR4 (YJL050W);
                     ancestral locus Anc_1.332"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680994.1"
                     /db_xref="GeneID:11502218"
                     /db_xref="GOA:G8ZT39"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011254"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012961"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016438"
                     /db_xref="InterPro:IPR025696"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZT39"
                     /translation="MDGEDLFDVFNEDTSNAPETPLEEVEKVDDTPVQDGSDKKRQLN
                     DEESSSDNKTAEETDNKRKKQERKLIDEKKKKSTLVPVVTDAFEQEASREVNASAGLM
                     NAATTQADEDGKVKLSHQVRHQVALPPNFDYKPIGEHKRQNEARTYPFTLDPFQDTAI
                     SCIDRGESVLVSAHTSAGKTVVAEYAIAQSLREKQRVIYTSPIKALSNQKYRELLAEF
                     GDVGLMTGDITINPDAGCLVMTTEILRSMLYRGSEVMREVAWVVFDEVHYMRDKERGV
                     VWEETIILLPDKVHYVFLSATIPNAMEFAEWICKIHVQPCHIVYTDFRPTPLQHYLFP
                     AHGEGIYLVVDEKSTFREENFQKAMASISNQSGDDPNSVDSRGKKGQSFKGGAAKGDA
                     KGDIYKIVKMIWKRKYNPVIVFSFSKRDCEELALKMSKLDFNSDDEKDALTKIFNNAI
                     ALLPEVDRELPQIKHILPLLRRGIGIHHSGLLPILKEVIEILFQEGFLKVLFATETFS
                     IGLNMPAKTVVFTSVRKWDGQQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMIDEKME
                     PQVAKGMVKGQADRLDSAFHLGYNMILNLMRVEGISPEFMLENSFFQFQNIVSVPAME
                     KKLIELQTEADKIEIEDEDNVKEFYEIRQTLDGYNEDVRHVITHPANILSFLQPGRMV
                     EVMVDNKDTYGWAVVVDFAKRMSKRDPSAEYTDHESYIVNVVVNTMYADSPLNLIKPF
                     NPRFPEGIRPALEGEKTVCAIIPITLESIRRVGNLRLFMPKDIKASGQKEVVGKSLQE
                     VARRFPDGIPLIDPVRNMKIEDDDFTKLLKKVEVLEKKLFSNPLAESVRLKELYENFS
                     RKRALIDETKQLKHKISESQAVIQLDDLRRRKRVLRRLGFCTQSDIIELKGRVACEIS
                     SGDELLLTELIFNGNFNDLTPQQAAALLSCFAFQERCKEAPRLKPELAEPLKAMREAA
                     AKIAKIMKDSKIEVVEKDYVESFRHELMEVVYEWCKGASFTQICKMTDVYEGSLIRMF
                     KRLEELVKELVDVANTIGNSALKEKMEAVLNLIHRDIVSAGSLYL"
     gene            complement(<388248..>390656)
                     /gene="TDEL0D02000"
                     /locus_tag="TDEL_0D02000"
                     /db_xref="GeneID:11502219"
     mRNA            complement(<388248..>390656)
                     /gene="TDEL0D02000"
                     /locus_tag="TDEL_0D02000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680947.1"
                     /db_xref="GeneID:11502219"
     CDS             complement(388248..390656)
                     /gene="TDEL0D02000"
                     /locus_tag="TDEL_0D02000"
                     /inference="similar to DNA sequence:INSDC:YJL051W"
                     /note="similar to Saccharomyces cerevisiae YJL051W;
                     ancestral locus Anc_1.331"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680995.1"
                     /db_xref="GeneID:11502219"
                     /db_xref="UniProtKB/TrEMBL:G8ZT40"
                     /translation="MVLEADAPMHRIGLYSMSQLPLAILGSLASLASGSVSTALVALF
                     HREEPELIVIACSTILSGLIFLALCLLPMGRSGNSSASLLGKFGIICIQLVILGASVY
                     YLNFGRKHGSLSNTQLHSNLLVALDSLILSTLFLNGLVIGSWISVRKDSIDESREQKS
                     KTMNDPEKYIPLKNSSQTLTPGMEFLHTFQSQSGPKTWNLTDTSGTHSSDEHSFPSVV
                     KHKLEYLSSREASPASTISRKASSISLKLRSASDSPKTKGSIISKLCRGRVKSLHNNR
                     ARDGSDSENKNINGRYVTRLSTIPDLSRSVLNFMLSSSDNQVSQENQIRPDRTASQIM
                     ESSHGQIAEGERTSSGQALDLERNAIERINSALLPPCLRIMETPPPAQQTTPKEPSGT
                     RMSPVICQHGSTAGVESNTDTLEGSGLGKVPRIPMTSHDNGSDLSTDYDMGTVFPQMA
                     TMEMWQENKDTGVQRPEKLHEQVLLPAFDLGRSNSSTGSIDLQTSAGFSFPSKIQPNE
                     ITIKNKLVEKDLDTISALEEYFRDVSIHEEDEEQIMQNGLKQDFSSSMLADRVSKELM
                     RTSTRHSPTKSMISVLSAASQQRSHTVRNSYLNMSNDAAHLQNSYYITSPSNAIINAT
                     KSSSPTRSQRLKRIGKKLSLSNISDTMTNHSFTSDATGEFLGTSKHDHMRGRSIDFSY
                     VHNLQSTHSPTKSTSGTSMNGSYKDRRNSLIPELAYRAASGPFYLQNGNSTINHEPDL
                     VVNSTFNEQSSNNRNSSSSASTNPSQESTTRYPEVVMSEYDRERWNSILNLKKVDSHG
                     QLKA"
     gene            complement(<391060..>392139)
                     /gene="TDEL0D02010"
                     /locus_tag="TDEL_0D02010"
                     /db_xref="GeneID:11502220"
     mRNA            complement(<391060..>392139)
                     /gene="TDEL0D02010"
                     /locus_tag="TDEL_0D02010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680948.1"
                     /db_xref="GeneID:11502220"
     CDS             complement(391060..392139)
                     /gene="TDEL0D02010"
                     /locus_tag="TDEL_0D02010"
                     /inference="similar to DNA sequence:INSDC:YJL053W"
                     /note="similar to Saccharomyces cerevisiae PEP8 (YJL053W);
                     ancestral locus Anc_1.329"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680996.1"
                     /db_xref="GeneID:11502220"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR028934"
                     /db_xref="UniProtKB/TrEMBL:G8ZT41"
                     /translation="MSLFHKSPVDIEILLDGEESRKHVEIPNAAGSGSKTLNDRLAVY
                     EDGETISGMVTLRVKEGKRVEHLGIKVAVIGSIDMIKTSGGNGSGNSSKRLSNTSSSV
                     SDARKTPVEQFICLSYDLCPPGELQHAQNFPFMFKDLAKRYESYRGKNVDVSYYVKVT
                     VARKSIDISKTKKFWVYLYKNVSLPPAPIVNNEESHPNAETTEENGADGASSSKALTG
                     GLRKEPKPVKLDIGIENCLHIEFEFSKSQYSLKEVIVGRIYFLLSRLKIKHMELSLIT
                     RESSGLQPSNCLVDSTAIRYEIMDGSPVKGETIPIRLFLGGYDLSPDVSCNYFNVKNY
                     LSLVIVDEDGRRYFKQSEIVLFRTR"
     gene            <392691..>394019
                     /gene="TDEL0D02020"
                     /locus_tag="TDEL_0D02020"
                     /db_xref="GeneID:11502221"
     mRNA            <392691..>394019
                     /gene="TDEL0D02020"
                     /locus_tag="TDEL_0D02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680949.1"
                     /db_xref="GeneID:11502221"
     CDS             392691..394019
                     /gene="TDEL0D02020"
                     /locus_tag="TDEL_0D02020"
                     /inference="similar to DNA sequence:INSDC:YJL049W"
                     /note="similar to Saccharomyces cerevisiae YJL049W;
                     ancestral locus Anc_1.334"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680997.1"
                     /db_xref="GeneID:11502221"
                     /db_xref="GOA:G8ZT42"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:G8ZT42"
                     /translation="MELPQSRLDSLYKDFRHLEELNPDGYKANIETWKAFLIKNYLIQ
                     AKSIYLRCGSGLLRTLSRESHGVPKSLDLVINSLIESDYLITPDDFYNGLMYPQESSW
                     FLKWIGFSGRNKRSFDVRKNNDTFYLKETDLIIRNIVEEKFESIKQRITNNIVSHATG
                     ITDLVFTKQEFYAKSGINELLIDSEPERKAMLFYLSHYRKIIVRDADIIKVVSPDVVH
                     ILADFPKIVTQDDHRVASLKATTINVNLQVKKLQAQVFDYSSMLQDAIKDSQPKEIQR
                     NYLQNKKMIEKNLSRLLIYQNNLLTVKSQLDMAATNQLLVSTLEGSNKLLTSINEYTG
                     SVEKVEDLLDEIKEQGERTEAINEILAGSESTEEDMELDRELEKIQEEENQKKAVSDD
                     KKENVKSQESNDELIEKLGNLKLEERRAPGELREKNMNSVPNQEGNAIAY"
     gene            complement(<394047..>395333)
                     /gene="TDEL0D02030"
                     /locus_tag="TDEL_0D02030"
                     /db_xref="GeneID:11502222"
     mRNA            complement(<394047..>395333)
                     /gene="TDEL0D02030"
                     /locus_tag="TDEL_0D02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680950.1"
                     /db_xref="GeneID:11502222"
     CDS             complement(394047..395333)
                     /gene="TDEL0D02030"
                     /locus_tag="TDEL_0D02030"
                     /inference="similar to DNA sequence:INSDC:YBR273C,YJL048C"
                     /note="similar to Saccharomyces cerevisiae UBX7 (YBR273C)
                     and UBX6 (YJL048C); ancestral locus Anc_1.335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680998.1"
                     /db_xref="GeneID:11502222"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8ZT43"
                     /translation="MKGELFMSSVEESVSKSMQEGKILVVYNSNGDDLWLNSWFQNSI
                     KDELRKHAVWLKLVRGTEQFTYFEQIFPSVEVPSFYLIQNGQILSTIQGEDRERSHWN
                     ELTNKLGLEKKLSVASTVPAAKTFKEQIIETTRQKYNEQLLREKKNADEERERILKLV
                     EADRAERRARRDRSATKSAAESNEIHDNIKNPQKLHAKTCTLLIKLTNGKSITREFGS
                     KSTLNDVRKWVDIARTDGDGPFAFHRSIPRVTFTDSDELRSLEALELLPRSVLIIKPL
                     DNGYGDLNVAEAKGPGLLGKVFSGISSWWAKDGGNLPNTTNVEDQKDSAEDGTFNPDM
                     SASGVPTANDEIMHGSPNSSRIDSPVYSAHEYHLRHNPSELSLPSRCVTPNVYHFVNA
                     EDEDKDRSTYNGNTVNLEKKKKIMSKCIAKLLLNND"
     gene            <395555..>397138
                     /gene="TDEL0D02040"
                     /locus_tag="TDEL_0D02040"
                     /db_xref="GeneID:11502223"
     mRNA            <395555..>397138
                     /gene="TDEL0D02040"
                     /locus_tag="TDEL_0D02040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680951.1"
                     /db_xref="GeneID:11502223"
     CDS             395555..397138
                     /gene="TDEL0D02040"
                     /locus_tag="TDEL_0D02040"
                     /inference="similar to DNA sequence:INSDC:YBR274W"
                     /note="similar to Saccharomyces cerevisiae CHK1 (YBR274W);
                     ancestral locus Anc_1.336"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003680999.1"
                     /db_xref="GeneID:11502223"
                     /db_xref="GOA:G8ZT44"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:G8ZT44"
                     /translation="MEELADLELPAIKDVVLGETIGQGAFACVKNAHLKVDPSVIIAV
                     KFVHIPSCKKNGLSEKDVVGEVILHSRCSKHPNVLRVIDCNIIKDYMWIAMEMADGGD
                     LFDKIEPDVGVDSEVAQFYFQQLIRAITYLHEECSVAHRDIKPENVLLDKNGNLKLAD
                     FGLASRFRRKDGSLRVSSDQRGSPQYMAPEILYSRAYYADATDLWSIGVLVFVLLTGE
                     IPWELPVMEDNNFEVFIQNQGNISAGPWAKIDFTHLNLLRKILQPEPDKRATLKDLHK
                     HPWFTNKLKFADLSGLCCDPALLANKLFSNLRVSLSDDDYMRFTQDPQPNDFMDVNYR
                     STQPMNSDLAGIEHDSMALGGFGSTQRAYTQYATEGFKNEVFMTQDSRWARFINNDVA
                     ALQFCDRNETTAGTSHVGFNPIKLTKFYSAQDMDVILPIFEEALKFARINVKQDLYSH
                     FIDLVNSLGYKGAFPLTISIRTHDRRGGNLTGSISIKTVRDNLKSINFERKAGDPLDW
                     RRLFKKIALFCREIILVPS"
     gene            complement(<397206..>402035)
                     /gene="TDEL0D02050"
                     /locus_tag="TDEL_0D02050"
                     /db_xref="GeneID:11502224"
     mRNA            complement(<397206..>402035)
                     /gene="TDEL0D02050"
                     /locus_tag="TDEL_0D02050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680952.1"
                     /db_xref="GeneID:11502224"
     CDS             complement(397206..402035)
                     /gene="TDEL0D02050"
                     /locus_tag="TDEL_0D02050"
                     /inference="similar to DNA sequence:INSDC:YBR275C"
                     /note="similar to Saccharomyces cerevisiae RIF1 (YBR275C);
                     ancestral locus Anc_1.337"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681000.1"
                     /db_xref="GeneID:11502224"
                     /db_xref="InterPro:IPR022031"
                     /db_xref="UniProtKB/TrEMBL:G8ZT45"
                     /translation="MSTKPDGDMHREKKMRAIDMLNHFINKRSQAKAKSVSPTARNWK
                     NSRLSPPNTEEPNEDANNVSPTPKRRKFAQSSPVRKPEEPVLSTDVQLKLPATESLND
                     KAEGSPGTKSVAFSDKLDSSPTQRTMNSSPRQTPASAPSKSILRNPIEFQKNVSLMAD
                     PAGKPKSKLAGRGGQVNDTSDDIDPTSLAFWEFGEVHKMLDSSNFKEFQKIIEGGLEI
                     LANNERSHVARRFEVYASFNNIIPPNNLKYHSELIEKKFDILIHNLKKIIEVCLPHLR
                     TEQEKLLGAGNKKNPFGSRLYIQIVRLFGSLLAHYRVMRALTKLPSLKEQLGEVLELS
                     KEALVHPNANKVIIGAQYTLLAYEKYGAYFLQKEDVMSIIRSVIRTKDIQSTNLICEK
                     LHLMRKFLSKYTSVMLEIIPEWLPSEVLAQILSDEEVHSLSILQAGIAVVLDLLKKSL
                     DSSAIHQTINRCIRNTLAKDVMPEGAQNRSVHGHSLEWGSTTLEEMLQKEITFLIISK
                     KEIKFAMDLWLAMMGLLYNTTEALLELSDTDERGWLRLNHICFLSGNSSAKFIALKAW
                     RIITYYSWAHVQGKSLHHDHALIRLLKMPFEFSSTSHLEPDVCEGLIYYLTGMVFVTC
                     GNSKAQEQKTFRFFWENLISPIYHDFLFTSDSIKLKSAAIKLLAVLIDGKSETGTSKT
                     KSSFPLKVIASVGVTMKEIEPVPADTVDDAYELVLTLVSNALSIDSSEWATRFELFDS
                     MLRLLPAEFIDDTHLTIFLDLVSRLFSQASLPKDPSTVLCPLVLSLTGPFANFVFESS
                     KNFQKLLKGVDHFYGQDSEIRLTLMKEFSKKLRRQISEFTIIERFLEVGDLSCQRYAS
                     NWIGSVLLPNTLTTSELHSFASIVKLLLSPQAIGALLNFCLNSKDKPDICELLNIDDW
                     GDEKVAILVKAVVSLSSNKLVPSLAVKLQKMLPSRVSLFNELFTTLQTLKYEELIRHV
                     IIANPEAANGIILLNGTQAPAVLPKGLPRDTLSYFVSQLPNFDENAQLGMIKWILDMN
                     EADLLFADRGEWKDCVFLRIGKDGEFSNEFKILIADAISQLYEKQSWKNLSKCILYCM
                     TCGQVPCVEQVYVRMRDKRRENNSPKSPKADECKSLNSILSESIKEIYQGDAIDTAFE
                     VTTSLIELKKVQNFSSCREEFLNFFIIRASNFVSVEQAIALELFERFIAVLMECFDEI
                     ILSFVESILSSILKVLTDHSLQVFGLLNHHLTLKGHLFHKLENYKTLLEKSGESKLVK
                     ENVEAQCSNGGPTLLEPIHTGTTSNASDMGQDKNQSDDINKAAVSYIIEVPATQGISK
                     SAESTEGRDSQRDMNIVTSTIIHDTVESTEISSFVKMDVASQKASEEVAREHESSDGF
                     SLTPVAQAIPVTYPVAQTSVEEITTNKHKDAQDPGQKKGANIDKKKEATVESNDDFAP
                     AETDQDDEFLLAMEQKLETTSNKLAPIIGQNPPEQNKLQSVSLDDVDAPASSKIRFPI
                     FNSSKFQGRSVKVLNNTTNLTQNAKNADEKEPDNNARSNGQTLEESRCSEDAVSRDAT
                     PSLRMHFPSKKARKLVNRVRAFTAEDLSHLPPEEKRNLRIELLDFLMSLEHEHGFYQ"
     gene            <403098..>403706
                     /gene="TDEL0D02060"
                     /locus_tag="TDEL_0D02060"
                     /db_xref="GeneID:11502225"
     mRNA            <403098..>403706
                     /gene="TDEL0D02060"
                     /locus_tag="TDEL_0D02060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680953.1"
                     /db_xref="GeneID:11502225"
     CDS             403098..403706
                     /gene="TDEL0D02060"
                     /locus_tag="TDEL_0D02060"
                     /inference="similar to DNA sequence:INSDC:YBR264C"
                     /note="similar to Saccharomyces cerevisiae YPT10
                     (YBR264C); ancestral locus Anc_1.338"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681001.1"
                     /db_xref="GeneID:11502225"
                     /db_xref="GOA:G8ZT46"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZT46"
                     /translation="MSSSIADVYVSDLKLVLLGESSVGKSSIVMRYVTGSFQKTNATI
                     GAAFTTRTFEVPQCDGSIKRINLEIWDTAGQERYRSLAPMYFRNTDIALVVFDVTKPE
                     SLRKAQSWIEELNSYVEEDRRDDLRIKVIGNKKDLEHDPVGTIEGLPLFTVSAKTGEG
                     IDELFESLVNDIPPGKFKKLDVSKHNAALELDKGPKARSGCC"
     gene            complement(<403746..>405245)
                     /gene="TDEL0D02070"
                     /locus_tag="TDEL_0D02070"
                     /db_xref="GeneID:11502226"
     mRNA            complement(<403746..>405245)
                     /gene="TDEL0D02070"
                     /locus_tag="TDEL_0D02070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680954.1"
                     /db_xref="GeneID:11502226"
     CDS             complement(403746..405245)
                     /gene="TDEL0D02070"
                     /locus_tag="TDEL_0D02070"
                     /inference="similar to DNA sequence:INSDC:YBR263W"
                     /note="similar to Saccharomyces cerevisiae SHM1 (YBR263W);
                     ancestral locus Anc_1.339"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681002.1"
                     /db_xref="GeneID:11502226"
                     /db_xref="GOA:G8ZT47"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019798"
                     /db_xref="UniProtKB/TrEMBL:G8ZT47"
                     /translation="MLTRFAARNNRSVVSAVRLFSSKSNVAAAMGTKGQTLLSQHVQE
                     VDPEMHKILEGERSRQKHSITLIPSENFTSKSVMDLLGSEMQNKYSEGYPSERYYGGN
                     QFIDQAESLCQKRALEVYGLNPEEWGVNVQALSGAPANLYTYSAVMEVGDRLMGLDLP
                     HGGHLSHGYQLSSGTKISYVSKYFQTMPYRVNPATGLIDYDTLSMTSKLFRPKVIVAG
                     TSAYSRVLDYKKFREIADGCGAYLMSDMAHISGLVAAGVTPSPFEYSDIVTTTTHKSL
                     RGPRGAMIFFRKGVRKVTKKGKTIMYDLEKKINFSVFPGHQGGPHNHTISALAVALKQ
                     ASTPEFKEYQQQVVDNARAFGEQLSKRGFKLVSGGTDNHLILIDLSTMGIDGARLETI
                     LEKLNIAANKNTIPGDKSALFPSGLRVGTPAMTTRGFKTQEFSKVAEFIDSATKMAIA
                     LKSQESPDTSDVRSKLANFKQLCEESKQVKNLANEVSQWAGQYPVPGDL"
     gene            <405789..>406082
                     /gene="TDEL0D02080"
                     /locus_tag="TDEL_0D02080"
                     /db_xref="GeneID:11502227"
     mRNA            <405789..>406082
                     /gene="TDEL0D02080"
                     /locus_tag="TDEL_0D02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680955.1"
                     /db_xref="GeneID:11502227"
     CDS             405789..406082
                     /gene="TDEL0D02080"
                     /locus_tag="TDEL_0D02080"
                     /inference="similar to DNA sequence:INSDC:YBR262C"
                     /note="similar to Saccharomyces cerevisiae YBR262C;
                     ancestral locus Anc_1.340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681003.1"
                     /db_xref="GeneID:11502227"
                     /db_xref="UniProtKB/TrEMBL:G8ZT48"
                     /translation="MSKILKLGSVALVSSALATSYYFYAVDRYGYHYNHSMWKKVSDT
                     TRGLLDRKQDIERSSPPTSEMREVVQRPISETFKDLWNEQIRETVKWVYSFGN"
     gene            <406238..>406933
                     /gene="TDEL0D02090"
                     /locus_tag="TDEL_0D02090"
                     /db_xref="GeneID:11502228"
     mRNA            <406238..>406933
                     /gene="TDEL0D02090"
                     /locus_tag="TDEL_0D02090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680956.1"
                     /db_xref="GeneID:11502228"
     CDS             406238..406933
                     /gene="TDEL0D02090"
                     /locus_tag="TDEL_0D02090"
                     /inference="similar to DNA sequence:INSDC:YBR261C"
                     /note="similar to Saccharomyces cerevisiae YBR261C;
                     ancestral locus Anc_1.341"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681004.1"
                     /db_xref="GeneID:11502228"
                     /db_xref="GOA:G8ZT49"
                     /db_xref="InterPro:IPR008576"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZT49"
                     /translation="MTTPDSQIDYEDAIDYWTGIPATVDGVLGGYGEGTVVPAMDVLG
                     SNHFLRKLKSRMIPEANCKKIGADIGAGIGRVTKNMLSKHCDVVDLLEPVKPFVEQMN
                     IELHELKEEGKIGKIYDMGMQDWQPEEGKYWLIWCQWCVGHLPDDELVKFLQRCKKAL
                     QPNGTIVVKENNTPTGNDDFDPEDSSVTRSDTKFKEIFERCGLKLIATDRQKGLPREL
                     YPVRMYALKPTTL"
     gene            <407647..>409707
                     /gene="TDEL0D02100"
                     /locus_tag="TDEL_0D02100"
                     /db_xref="GeneID:11502229"
     mRNA            <407647..>409707
                     /gene="TDEL0D02100"
                     /locus_tag="TDEL_0D02100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680957.1"
                     /db_xref="GeneID:11502229"
     CDS             407647..409707
                     /gene="TDEL0D02100"
                     /locus_tag="TDEL_0D02100"
                     /inference="similar to DNA sequence:INSDC:YBR260C"
                     /note="similar to Saccharomyces cerevisiae RGD1 (YBR260C);
                     ancestral locus Anc_1.342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681005.1"
                     /db_xref="GeneID:11502229"
                     /db_xref="GOA:G8ZT50"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:G8ZT50"
                     /translation="MSGSSSLQKSVDSPPTATPATPLSPPINNNGTAPIEIKSPDQML
                     SNPEIQKVMNSDVAINALLSRLKQSLLTCEEFTKFIRKKYVYEEEHVEELAKQFKHFF
                     VDASGSSLKRRIHDVLEFDGKLAQVKRSYVTALEKMYDEMSALLFTMTKMRKSVKENS
                     RRLEKEVADAIHSAEKAQARYNSLCQDWDKLRMTDPTKTKLTLRGSKTTKEQEEELLR
                     KIDNSDLDYKQKVDYSDSLRNTFITRERPKIVLELKDLILEIDTAMSIQLQKYTIWTE
                     NLILNSGVTVTPFDSTKSMKSIASSVTNEKDLYDFLNRYNNTGKNGLMVNKNLIPVGY
                     KRHPSMAKGFGDSSSKRSPPIFAVNPTKNSIPKRIISTHNETPFTSSPSTPSMAGSTN
                     TSFKSPNLPPKNSVNSAQREPKTSSEFSQLHVTNEASISSNNDTDPRSKTLDPGNSNA
                     RLPSLSTTVSMATAESDRPLSHIQTNNSMPPGTQKNFKTFGVPIENLVEFEQDMVPAI
                     VRQCIYVIDKYGLDLEGIYRKSANVLDVSKLKEEIDRDPSNVAMILPPKNYTDSDIYL
                     VGSLLKAFFAALPSSLLPEELGPEIKTCLSIPDQKTRKNYMHGLIYKLPDAQYWTLRA
                     LLFHLKRVADHESQNRMNLKSLNIIWGPTIISPNEDEPHDVNFQIGAMEVLLDVADQA
                     FEAD"
     gene            complement(<409766..>412105)
                     /gene="TDEL0D02110"
                     /locus_tag="TDEL_0D02110"
                     /db_xref="GeneID:11502230"
     mRNA            complement(<409766..>412105)
                     /gene="TDEL0D02110"
                     /locus_tag="TDEL_0D02110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680958.1"
                     /db_xref="GeneID:11502230"
     CDS             complement(409766..412105)
                     /gene="TDEL0D02110"
                     /locus_tag="TDEL_0D02110"
                     /inference="similar to DNA sequence:INSDC:YJL047C"
                     /note="similar to Saccharomyces cerevisiae RTT101
                     (YJL047C); ancestral locus Anc_1.343"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681006.1"
                     /db_xref="GeneID:11502230"
                     /db_xref="GOA:G8ZT51"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="UniProtKB/TrEMBL:G8ZT51"
                     /translation="MQQSESTLAIAESFTGTMPTADTINKRAQQFIYDRVNDIFNDVF
                     SFYDSRTMEKKDPAATEEYFCTIDRHVNGIGKLCKSGITVCKVRYKGNTCILIKDEAK
                     RLGMIWDALRIRVQAQVSIFVDHFLDPCRDSECFLSDLVNHWGTMHANYQLFIKEISP
                     LLEYIVINYPSVAKEVTRELKISDYFEMYLISLLRSKLSDHFMRFLEAFLSYLRQKPV
                     LARADLEMQTPLTLMYKYRIPLDNGLTLKDFYFESIGRYSQGNIDVVIDLFFCENLTK
                     YLIRNALITGTISAMLIKETNEIILRNTLMEENTAQKFFESMKDYVNLNSIIGVSQEI
                     SSQLAIILAVFESRSMMDELERIYAQVIKSTLMKAITEGLEESMKEACKLALLVKGSS
                     LLDIALKEIIKVLGGPINVMERYLRLCENCIRRNNHEIITGRSQESGKGIVLSLLVPN
                     TLQISPQFLDIYSRSLFRRFILHGPTVIETLQNTCFLECQLLEHFTDLYKLSPEFDRL
                     QTLKIEIFNSSQMAQKFASEQSQPALAMTPLILEKNKVPLVFQENATATNLPLTEEME
                     QSWDKLTDFYRMTDKRAQFKKLFLIDYLQHFEVETQIILSNSKPLVLDLSFHQTRVLC
                     LFNDSDSLTLDAISSRSRINRGVLTEVLKSFLNIGLLVSDSESYLLNEEFSPDESKIR
                     NGLLRVRMGVTDSKSSHLKRIESPLHMEGQVSYWKQELIRACIVRSLKGEERGLKPND
                     LFAKVRSQIYGTSVGEFKDALKKNVDDKMITKWRNCYKY"
     gene            complement(<412411..>414231)
                     /gene="TDEL0D02120"
                     /locus_tag="TDEL_0D02120"
                     /db_xref="GeneID:11502231"
     mRNA            complement(<412411..>414231)
                     /gene="TDEL0D02120"
                     /locus_tag="TDEL_0D02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680959.1"
                     /db_xref="GeneID:11502231"
     CDS             complement(412411..414231)
                     /gene="TDEL0D02120"
                     /locus_tag="TDEL_0D02120"
                     /inference="similar to DNA sequence:INSDC:YBR259W"
                     /note="similar to Saccharomyces cerevisiae YBR259W;
                     ancestral locus Anc_1.344"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681007.1"
                     /db_xref="GeneID:11502231"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="UniProtKB/TrEMBL:G8ZT52"
                     /translation="MMDHKDALTSYRAQVRKILQDNECNCRREAKKLHQLALIITERS
                     HKSHSTLSRKLRSILQQEFSTFAALLARPTFSNSKSWEDVAKRLLHYKTRLNCIKGHI
                     IYIDKTFQLQGTLTRSLEHLLVRLLLENGDSLTKSYKEACAYYICNSEDCGRNLEFIY
                     KSIYEYEASEMLNKVTPNHELLSKLTNMGLTCLKEWRLLHADANFFDIYEIWQKYHNL
                     SKLAGNTNSNLSAISTLFDDDPYKLLKSLHNVYLSYEDVNLLLSFSKKKGWKRSLEDA
                     FVVLRNVTLCNGDFERLLQSILLSEYPSNNNDTFKYVVSIRRNFQQSVKNIKQFQTDM
                     IRYLDFRLRKNYNEMRKNASASLSHSDHLWISAVTLLIVHYIPKRRDFLQRYLKEGLF
                     RQILMLNSKYPRFFNHRASLQRHLIENLRVHIPMDVHPYLTLNNDALTSLDKTYRMNH
                     NKTNFVGLYLSKHSYNEISDALMVTTDPIWPSIEFQREWTKQVDLFAAEDKILQGIFS
                     LHSITMSSPFRLAGGARLGLLVNLTMASIIYLFNDHDELHFREICKLLGSKEEAAIIR
                     ELSTLEKHKVLMRKNTNYFEINDSYIPTQLVAETGVIRCT"
     gene            <414351..>414737
                     /gene="TDEL0D02130"
                     /locus_tag="TDEL_0D02130"
                     /db_xref="GeneID:11502232"
     mRNA            <414351..>414737
                     /gene="TDEL0D02130"
                     /locus_tag="TDEL_0D02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680960.1"
                     /db_xref="GeneID:11502232"
     CDS             414351..414737
                     /gene="TDEL0D02130"
                     /locus_tag="TDEL_0D02130"
                     /inference="similar to DNA sequence:INSDC:YBR258C"
                     /note="similar to Saccharomyces cerevisiae SHG1 (YBR258C);
                     ancestral locus Anc_1.345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681008.1"
                     /db_xref="GeneID:11502232"
                     /db_xref="InterPro:IPR007870"
                     /db_xref="UniProtKB/TrEMBL:G8ZT53"
                     /translation="MASNSDEARRLADEFKKEGHFDKLKHDILSQELKQGESSTSVEQ
                     TIRAKVNALVRAMVAEDENLIFKNRGSTSALIESQIFKDGYKALSQGDGGLNVEEYIQ
                     EKLNEPALQDHVREKIEEMVQGTKNG"
     gene            complement(<414754..>415587)
                     /gene="TDEL0D02140"
                     /locus_tag="TDEL_0D02140"
                     /db_xref="GeneID:11502233"
     mRNA            complement(<414754..>415587)
                     /gene="TDEL0D02140"
                     /locus_tag="TDEL_0D02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680961.1"
                     /db_xref="GeneID:11502233"
     CDS             complement(414754..415587)
                     /gene="TDEL0D02140"
                     /locus_tag="TDEL_0D02140"
                     /inference="similar to DNA sequence:INSDC:YBR257W"
                     /note="similar to Saccharomyces cerevisiae POP4 (YBR257W);
                     ancestral locus Anc_1.346"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681009.1"
                     /db_xref="GeneID:11502233"
                     /db_xref="GOA:G8ZT54"
                     /db_xref="InterPro:IPR002730"
                     /db_xref="InterPro:IPR016848"
                     /db_xref="InterPro:IPR023534"
                     /db_xref="UniProtKB/TrEMBL:G8ZT54"
                     /translation="MDRSQLFIKNCLLTRNFADPEKLIKENRLQDTLLLLPTDGGVST
                     RLKRNRSKLKISLNTLEKAANTSRKHKDYKRVNKNSKAALKNYINNCKSSAGKALHIA
                     YDSKITDKNELSEHLQNNHTELWEALPRFDTFLPMHEQLWVGYIRELLNVPTTLSDAS
                     KLNINGSSALMKLSMADYNGAFLKVASSQNENQVGIEGIVLWDSQKNFIMVCRGNLVD
                     EVKIIPKKGTVFNFEVPLNADDALSYTILGDRFKYRSSDRAGRKFKSRRCDDMLHYLV
                     K"
     gene            <415993..>417246
                     /gene="TDEL0D02150"
                     /locus_tag="TDEL_0D02150"
                     /db_xref="GeneID:11502234"
     mRNA            <415993..>417246
                     /gene="TDEL0D02150"
                     /locus_tag="TDEL_0D02150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680962.1"
                     /db_xref="GeneID:11502234"
     CDS             415993..417246
                     /gene="TDEL0D02150"
                     /locus_tag="TDEL_0D02150"
                     /inference="similar to DNA sequence:INSDC:YJL046W"
                     /note="similar to Saccharomyces cerevisiae YJL046W;
                     ancestral locus Anc_1.347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681010.1"
                     /db_xref="GeneID:11502234"
                     /db_xref="GOA:G8ZT55"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR004562"
                     /db_xref="UniProtKB/TrEMBL:G8ZT55"
                     /translation="MEVLGKRLITPVIRFRVQAFSFSRYIYSRSYSQQSPFDLEDEDE
                     KFKDINQMYVEMFTDNDDTKLTSKNEGSKQPSSDLDELNDDMNDLLNVGYHKLTTTEL
                     EEKVKAPGRFILQSLSNNPYYNLAIESYVFSHTPVEQNVRTAFDSQRLLFYVNRDCVV
                     IGKNQNVWRELHVNAVQERGYELMRRFSGGGTVVHDQGNVNYSFITSREEFRREYFNQ
                     LIVASLKASHPNLDLKLNGRGDIALGDRKVSGSAYKISRGKSYHHGTMLIRSNLDQFH
                     GLLKPDSLKGITWKCNSVDSVRSAVENVPLDSTQQFIDVCADGFKQRFKTQEGDEIPI
                     YYCDEDMTMNDEIKNYMSTLCSDEWKYMSGPRFEVRLESSGHSIAVEKGVIVESSIPT
                     IIGTSFLDFTRNLSQFDDIDPELIL"
     gene            complement(<417281..>419167)
                     /gene="TDEL0D02160"
                     /locus_tag="TDEL_0D02160"
                     /db_xref="GeneID:11502235"
     mRNA            complement(<417281..>419167)
                     /gene="TDEL0D02160"
                     /locus_tag="TDEL_0D02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680963.1"
                     /db_xref="GeneID:11502235"
     CDS             complement(417281..419167)
                     /gene="TDEL0D02160"
                     /locus_tag="TDEL_0D02160"
                     /inference="similar to DNA sequence:INSDC:YFR029W"
                     /note="similar to Saccharomyces cerevisiae PTR3 (YFR029W);
                     ancestral locus Anc_1.348"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681011.1"
                     /db_xref="GeneID:11502235"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZT56"
                     /translation="MLAIDILEGIEQNLFLPKTLISCQLNNFTQEYIYKVQYGIIDDC
                     SILSCGCCLSESLHQDIVKHTKAERIRCPICDTKNVSLLCPVKQLRSLYKQIYYYREK
                     LRDNDEGNNEIPIKETTKEDSTKPIERFDRKDTTQMSLLALFHKVASKFNNQPDLPGK
                     KTNSITQVDQEPNYAESVDAEVLDTASNTRTIPISQDSINLSIKNTLQDMTRSVSIDE
                     EKEYFFAQCFPIYRKRSQFNTHPKFLRTKSKLYVNMAISPDCSKFALITEQRWEIHSI
                     RDGESPILLYCGKSTGEYGPDFDHLRYPDDKNVLTTKGSNPLRKDSWEHIFCKLSNDF
                     FVISGTKKRFRVFDLTQNGQPVHTYASAFPIRCIDIDSNSDMIACGITGLDRLTGAEQ
                     ALIVFHRIERNKVTSEPEISPPTTITLPYRDPINTLQFSDDGFYLSCSTTFESRFLII
                     SLRKFNEPRLIMKSLRSIDTSLESEGITDVKLFPGNPGLMCVTSAAFNAPPIVVNTKI
                     KNIDGLQSVAQPTMLIRLEELGSSIHKCEISPRNDSIAFLDRNGSVYIMFSPTMVDSD
                     KRRIVLVDMVSNAYRAHESAALRFSSDGHKLYILDRKGILHVEDFSYGLPQGHEVTKC
                     KEIN"
     gene            419929..420013
                     /gene="TDEL0Dtrna1Y"
                     /locus_tag="TDEL_0Dtrna1Y"
                     /db_xref="GeneID:11502182"
     tRNA            join(419929..419968,419977..420013)
                     /gene="TDEL0Dtrna1Y"
                     /locus_tag="TDEL_0Dtrna1Y"
                     /product="tRNA-Tyr"
                     /note="codon recognized: UAC"
                     /db_xref="GeneID:11502182"
     gene            <420339..>421901
                     /gene="TDEL0D02170"
                     /locus_tag="TDEL_0D02170"
                     /db_xref="GeneID:11503635"
     mRNA            <420339..>421901
                     /gene="TDEL0D02170"
                     /locus_tag="TDEL_0D02170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680964.1"
                     /db_xref="GeneID:11503635"
     CDS             420339..421901
                     /gene="TDEL0D02170"
                     /locus_tag="TDEL_0D02170"
                     /inference="similar to DNA sequence:INSDC:YFR028C"
                     /note="similar to Saccharomyces cerevisiae CDC14
                     (YFR028C); ancestral locus Anc_1.349"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681012.1"
                     /db_xref="GeneID:11503635"
                     /db_xref="GOA:G8ZT57"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR026070"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="InterPro:IPR029260"
                     /db_xref="UniProtKB/TrEMBL:G8ZT57"
                     /translation="MRKSVYLDNTIEFLKGRVYLGAYDYSPQDNDEIVFFTVEDSIYY
                     NSFHLDFGPMNIGHLYRFAVIFHEILNDPDNTNKAVIFYSSTSTRQRANSACMLCCYM
                     VLVQGWTPHQVLQPLAQVDPPFMPFRDAGYSNADFEITIQDVVYGVWRAKEKRLIDLH
                     SFNLESYERYEHVENGDLNLLTSDFIAFASPQEDSRSMGTTSSKSHLNQPFRSVLKYF
                     VNNNVQLVVRLNSHLYNKKHFEDVGIKHIDMIFEDGTCPDLSIVKNFVGAAETIINQG
                     GKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGMVVGPQQHWLYLHQN
                     DFREWRYTMRLSLVPDDIIGGLYPMVSLEKYRMQKKKLKDHKKNHESGQDDNDLAMTP
                     PSVNKISNNFRTSAVPQNSPGQPRKSQNGSNTIEDLNKKMTKTAVSSKGNLGMRSDAV
                     EDNNSDDEMQVEASETASSKMTSRLPKSSSNDGEDAILRQLLPKNRRVTSGRRTASAS
                     GGVRKISGTIKK"
     gene            complement(<421941..>422735)
                     /gene="TDEL0D02180"
                     /locus_tag="TDEL_0D02180"
                     /db_xref="GeneID:11502237"
     mRNA            complement(<421941..>422735)
                     /gene="TDEL0D02180"
                     /locus_tag="TDEL_0D02180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680965.1"
                     /db_xref="GeneID:11502237"
     CDS             complement(421941..422735)
                     /gene="TDEL0D02180"
                     /locus_tag="TDEL_0D02180"
                     /inference="similar to DNA sequence:INSDC:YFR027W"
                     /note="similar to Saccharomyces cerevisiae ECO1 (YFR027W);
                     ancestral locus Anc_1.350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681013.1"
                     /db_xref="GeneID:11502237"
                     /db_xref="InterPro:IPR028005"
                     /db_xref="InterPro:IPR028009"
                     /db_xref="UniProtKB/TrEMBL:G8ZT58"
                     /translation="MAVNSRSRSRSKYASKKSHKYVQSRLQIGPSEPALVKCTQCEMT
                     YSPSALDDDAAHRLYHDMHLRGRKWSVNWGVEVPRTVDSNDVMPTPPSSSKNGALSSR
                     PERIVMIRPECVPEVKATIEIMDRVNDELNAPHDENDFWSTAEGKGKAFLYIKNERAV
                     GVATMEILKPDRGRWMVYDTKSIIEHIRPAFVVGISRIWVCRTERHGKIATKILDAAR
                     ENTIYGRCIDKWEVAWSQPTDSGGKLASKYNGVRHKSGKLLIPCYI"
     gene            <423191..>424201
                     /gene="TDEL0D02190"
                     /locus_tag="TDEL_0D02190"
                     /db_xref="GeneID:11502238"
     mRNA            <423191..>424201
                     /gene="TDEL0D02190"
                     /locus_tag="TDEL_0D02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680966.1"
                     /db_xref="GeneID:11502238"
     CDS             423191..424201
                     /gene="TDEL0D02190"
                     /locus_tag="TDEL_0D02190"
                     /inference="similar to DNA sequence:INSDC:YFR025C"
                     /note="similar to Saccharomyces cerevisiae HIS2 (YFR025C);
                     ancestral locus Anc_1.351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681014.1"
                     /db_xref="GeneID:11502238"
                     /db_xref="GOA:G8ZT59"
                     /db_xref="InterPro:IPR004013"
                     /db_xref="InterPro:IPR010140"
                     /db_xref="InterPro:IPR016195"
                     /db_xref="UniProtKB/TrEMBL:G8ZT59"
                     /translation="MHSHHSHSGDYIAHGVDPLEDVTNRAIEMKFHTYCMTEHMPRIN
                     PKYLYPEEHLDRADDTAAVEKLHSDFAKFLDHAQKIKSRENSAGTTFLIGVEIEGCDQ
                     EHIEYARKLLEEKRGIVQFSVGSIHHVDGIPIDFDQDAWNRALATSQNNLKKLLLSYF
                     DLQYCMLMRLQPLVVGHFDLYKLYLPKDLKVDLETGYCVENGTSISNLSLIKQWKQVQ
                     DSVIRNLKYIESYGGAIEINTSALRKKLPEPYPGKDIGLLAKEYAGGRFVLSDDAHAV
                     SQVGVCYDEALKYIVEDLKLDKMYYITEGPIDRAVKLESIPIEQFKSHAFWSTNFSKK
                     AL"
     gene            complement(<424264..>426288)
                     /gene="TDEL0D02200"
                     /locus_tag="TDEL_0D02200"
                     /db_xref="GeneID:11502239"
     mRNA            complement(<424264..>426288)
                     /gene="TDEL0D02200"
                     /locus_tag="TDEL_0D02200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680967.1"
                     /db_xref="GeneID:11502239"
     CDS             complement(424264..426288)
                     /gene="TDEL0D02200"
                     /locus_tag="TDEL_0D02200"
                     /inference="similar to DNA sequence:INSDC:YHR020W"
                     /note="similar to Saccharomyces cerevisiae YHR020W;
                     ancestral locus Anc_1.352"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681015.1"
                     /db_xref="GeneID:11502239"
                     /db_xref="GOA:G8ZT60"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002316"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004499"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR007214"
                     /db_xref="InterPro:IPR016061"
                     /db_xref="InterPro:IPR017449"
                     /db_xref="UniProtKB/TrEMBL:G8ZT60"
                     /translation="MSVEEAFSKLCLSEKPAQDATAVKSLVFKPKTAKTATPIPIIVV
                     ALQSTSTPSPLLAQATSLKDPRLARDELFQSFFKCDSAKKFTLAYIGNAESEFRLLVD
                     NQLESLEDSTVLQLNESLFIKKSELTQFLSQFESNKQSVDFTQEVAKPAPKAKEATAV
                     SNAALEDAKLIGITVDKALDFSGWYQQVLTKGEMLDYYDVSGCYILRPPSYSIWEQIQ
                     RWFDDKIKGLGVQNAYFPMFVSSRVLEREKDHIEGFAPEVAWVTKAGKSELEEPIAIR
                     PTSETVMYPYYAKWIRSYRDLPLKLNQWNSVVRWEFKHPQPFLRTREFLWQEGHTAHL
                     TVEDAKEEVLNILDFYAGVYEELLAVPVVKGKKTEKEKFAGGEFTTTCEGYIPQTGRG
                     IQGATSHHLGQNFSKMFNVCVENPLGSEHPKLFVYQNSWGLSTRVIGVMVMIHSDNKG
                     LVIPPRVSQYQAVVIPVGITKKTTDAERSNIHASAKALEDRLKKAGVRAFGDYNDNYT
                     PGWKFSQYELKGVPVRIELGPKDIEKGQAIVVRRNDARKYTVQLDELETRIPEILEEL
                     QQDLYLRAKELFDTHRVIVEDWKDFVPNLNKKNVIISPWCGVMECEEDIKDSSAKKDD
                     GEELEQDDKAPSMGAKSLCIPFEQPELKAGQKCVRCDRAAIEYCMFGRSY"
     gene            <426546..>428213
                     /gene="TDEL0D02210"
                     /locus_tag="TDEL_0D02210"
                     /db_xref="GeneID:11502240"
     mRNA            <426546..>428213
                     /gene="TDEL0D02210"
                     /locus_tag="TDEL_0D02210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680968.1"
                     /db_xref="GeneID:11502240"
     CDS             426546..428213
                     /gene="TDEL0D02210"
                     /locus_tag="TDEL_0D02210"
                     /inference="similar to DNA sequence:INSDC:YHR019C"
                     /note="similar to Saccharomyces cerevisiae DED81
                     (YHR019C); ancestral locus Anc_1.353"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681016.1"
                     /db_xref="GeneID:11502240"
                     /db_xref="GOA:G8ZT61"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004522"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:G8ZT61"
                     /translation="MSLYVNESVGVDETTACGSQEKPYATPAFALFAYQGQQGQDAAE
                     PKLFVFKSEENEYQEISASALKKARKGCSGLIKKAVKQKEEQARKEQQDADNAAKQMA
                     ALNIKIEEDKSLPAAKKFKVGQSYEHVGERVKLSGWIHRLRSNKKVVFVVLRDGTGFI
                     QCVLAGDLAVAQQTVDLTLESSVVLYGTVTKVPEGKSAPGDVELVVDYYEIVGLAPSG
                     EEAFTNKIAEGADPSLLLDQRHLTLRGETISAVMKVRAALLKSIRRVYDEENITEVTP
                     PCMVQTQVEGGSTLFKLDYYGEEAFLTQSSQLYLETCLAALGDVYTIQESFRAEKSHT
                     RRHLSEYTHIEAELCFLSFDELLDHIERLVINSVQYVLEDPVSGPLVKQLNPKFQAPK
                     GPFLRLDYKDAIQWLNDHDVKNEDGEPFKFGDDIAEAAERKMTDTIGVPIFLIRFPVE
                     IKSFYMQRCKDDPRVTESVDVLMPNVGEITGGSMRIKDTEELMEGFKREGIDPKAYYW
                     FVDQRKYGTCPHGGYGIGTERILAWLCDRFTVRDCSLYPRFSGRCKP"
     gene            <428430..>429827
                     /gene="TDEL0D02220"
                     /locus_tag="TDEL_0D02220"
                     /db_xref="GeneID:11502241"
     mRNA            <428430..>429827
                     /gene="TDEL0D02220"
                     /locus_tag="TDEL_0D02220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680969.1"
                     /db_xref="GeneID:11502241"
     CDS             428430..429827
                     /gene="TDEL0D02220"
                     /locus_tag="TDEL_0D02220"
                     /inference="similar to DNA sequence:INSDC:YHR018C"
                     /note="similar to Saccharomyces cerevisiae ARG4 (YHR018C);
                     ancestral locus Anc_1.354"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681017.1"
                     /db_xref="GeneID:11502241"
                     /db_xref="GOA:G8ZT62"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR008948"
                     /db_xref="InterPro:IPR009049"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="InterPro:IPR022761"
                     /db_xref="InterPro:IPR024083"
                     /db_xref="InterPro:IPR029419"
                     /db_xref="UniProtKB/TrEMBL:G8ZT62"
                     /translation="MSDNTQKLWGGRFTGETDPLMHLYNASLPYDYKMYKADLEGTKV
                     YTSGLQKLGLLTEDELKKIHSGLEEIKKEWDEDKFVRHPNDEDIHTANERRLGEIIGR
                     NIAGKVHTGRSRNDQCVTDLRIYCRDLLNDKLFPDLQALVDVMIKRGKEEIDVLMPGY
                     THLQRAQPIRWSHWLSSYATYFTEDFKRLRQIMDRINQSPLGAGALAGHPYGIDREFL
                     AAGLGFDGVIGNSLVAVSDRDFIVELMFWGTLFMNHISRFAEDLIIYSTAEFGFIKLN
                     DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLAGFLMSLKGIPSTYDKDMQEDKEAL
                     FDCLVTVEHSILIATGVISTLFVQKENMENALTMDMLATDLADYLVRKGVPFRETHHI
                     SGECVALAENLKLSGIDKLTLEQYQKIDSRFGPDLFETFNFEQSVERRDATGGTAKSA
                     VLKQFENLASQIHTI"
     gene            complement(<429820..>430965)
                     /gene="TDEL0D02230"
                     /locus_tag="TDEL_0D02230"
                     /db_xref="GeneID:11502242"
     mRNA            complement(<429820..>430965)
                     /gene="TDEL0D02230"
                     /locus_tag="TDEL_0D02230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680970.1"
                     /db_xref="GeneID:11502242"
     CDS             complement(429820..430965)
                     /gene="TDEL0D02230"
                     /locus_tag="TDEL_0D02230"
                     /inference="similar to DNA sequence:INSDC:YHR017W"
                     /note="similar to Saccharomyces cerevisiae YSC83
                     (YHR017W); ancestral locus Anc_1.355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681018.1"
                     /db_xref="GeneID:11502242"
                     /db_xref="InterPro:IPR013952"
                     /db_xref="UniProtKB/TrEMBL:G8ZT63"
                     /translation="MSSGDRDIVDRLFSVGYNVISRGNEAVSDVAGKVVDKVRQVQGK
                     DVKKLESLQLDSKSPGVWESLGGVVSWTYGQRQRALVGASITAGAIVLFWQCKQLLKV
                     PERLPSSQSRCVLIFGDMRDPIVRTQVMDLYRRGFTVFICSTNAKAFRERQEDDDFLR
                     HIDPGSASDLASFVRFLAKSGEGEPCKLASILFMPNLAYYPPGDMSTSQLASEIRSNV
                     LVYYSTLVEILPHLESSTVQLILFNPSLSLNLAVPHHPAELFISGLMSSINQTMKRYH
                     RLKVSMVHVGALKLGAQPSNYKYLNLRGSNINDSLLKPVYNLIMSYNGNRMQRLWLWI
                     TTGGSLQRNLYCGRFSYLSKIPILTSIIKNDFWTSFKGLLKYKDLSK"
     gene            <431160..>432568
                     /gene="TDEL0D02240"
                     /locus_tag="TDEL_0D02240"
                     /db_xref="GeneID:11502243"
     mRNA            join(<431160..431206,431314..>432568)
                     /gene="TDEL0D02240"
                     /locus_tag="TDEL_0D02240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680971.1"
                     /db_xref="GeneID:11502243"
     CDS             join(431160..431206,431314..432568)
                     /gene="TDEL0D02240"
                     /locus_tag="TDEL_0D02240"
                     /inference="similar to DNA
                     sequence:INSDC:YFR024C-A,YHR016C"
                     /note="similar to Saccharomyces cerevisiae LSB3
                     (YFR024C-A) and YSC84 (YHR016C); ancestral locus
                     Anc_1.356"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681019.1"
                     /db_xref="GeneID:11502243"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007461"
                     /db_xref="UniProtKB/TrEMBL:G8ZT64"
                     /translation="MGINNPIPRSLKSETKKAAKVLASFVKPNQVFGADQVIPPNVLK
                     RAKGLAIITVLKAGFLFSGRAGSGVIVARLKDGTWSAPSAIAMAGAGAGGMVGVELTD
                     FVFILNSAEAVKSFSEFGTVTLGGNISVSAGPLGRNAEAAASASTGGVSAVFAYSKSK
                     GLFAGVSLEGSVIVERREANRKFYGDSCTAKMILSGRIRPPPAADPIFRVLESRAFNY
                     KSAMPADDYEDDFYDDIPSSFDSSEVSSTRPTTKSTRQRRSGSRSYFDDDDGFDDEHS
                     GYNGRRSGRDREDYNDSFNDPSGASEYYRSQRRQTQRDSRSPQHTNTRWEDDIYDRDR
                     DVDDLSNRFSKSRISSSSAGNGRASRPMSEKPDFGSPSSSNAPKAVALYSFAGEESGD
                     LPFRKGDVITILKKSESQDDWWTGRVNGREGIFPANYVELV"
     gene            complement(<432801..>434669)
                     /gene="TDEL0D02250"
                     /locus_tag="TDEL_0D02250"
                     /db_xref="GeneID:11502244"
     mRNA            complement(<432801..>434669)
                     /gene="TDEL0D02250"
                     /locus_tag="TDEL_0D02250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680972.1"
                     /db_xref="GeneID:11502244"
     CDS             complement(432801..434669)
                     /gene="TDEL0D02250"
                     /locus_tag="TDEL_0D02250"
                     /inference="similar to DNA sequence:INSDC:YFR023W,YHR015W"
                     /note="similar to Saccharomyces cerevisiae PES4 (YFR023W)
                     and MIP6 (YHR015W); ancestral locus Anc_1.357"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681020.1"
                     /db_xref="GeneID:11502244"
                     /db_xref="GOA:G8ZT65"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8ZT65"
                     /translation="MINPFIPRRVNILNNISPNVSRKHGEILKDETIKTTTIIETLDE
                     HPKGKDENSSVSSRSSQSETSDVVKLNYTNGDSAANVGIKSKLSSTLESKSVVALFIG
                     DLEPSVTENMLRDIFGKFRSLTSVKICLDSNSGKSLGYGYLNFANSEDAEKATEEFNY
                     RPIEGQEVRIMPSLRNSFYRKNVGTNVFFSNLPLEDSRLTTRVFYDTFKKYGKILSCK
                     LDKRKDIGFIYFNNDQSARKVIKDYNGKEFFGNKVLCGIHFDKDFRKYPEFEKRISNL
                     DSITVAMEELTTEDSNKVVLQRDSGSQVPHPNAVFVKNLPMDCTNEEILDFFSNIGPV
                     KSVFSSKAPKFNSLWAFVTYKRGSDTSKSIQFYNDKEFKNRRLIVSKAVPKEGKNQSP
                     SNYKNYKTIVQIDDVSPVLNEEFLSQLCIQERIKINKLHITSFNEKTLTYSGFIKCKT
                     KNDATRVFASLNNRLIGGSVIKCSWGKYEPTAAPTNVRIDGPRDFQQAQLLAFPLCHP
                     LYYSMKQSPNQNGFSQLPLPLGKNKCDRKDEEQKAEILHLLRRQVRKGIDFLKYPSAT
                     RDENLTCIADYIFDVYWRGDIDSLTKFMLLMNTNTQHEGILQRQIKEAANFLGFGR"
     gene            complement(<435173..>437278)
                     /gene="TDEL0D02260"
                     /locus_tag="TDEL_0D02260"
                     /db_xref="GeneID:11502245"
     mRNA            complement(<435173..>437278)
                     /gene="TDEL0D02260"
                     /locus_tag="TDEL_0D02260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680973.1"
                     /db_xref="GeneID:11502245"
     CDS             complement(435173..437278)
                     /gene="TDEL0D02260"
                     /locus_tag="TDEL_0D02260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681021.1"
                     /db_xref="GeneID:11502245"
                     /db_xref="GOA:G8ZT66"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:G8ZT66"
                     /translation="MLSKLLGSQLRATSFVQRPHVTKNMVRLSAQVSRVNPGRSFSVN
                     RILLESKEIVKKEVNTLPSATKITKIEKSGFFSHGFGKLLKWSVFSTGILATVCGSAL
                     IIFFIYDSTTYNECEVPENIEVPTLAISPERGGPENLPILRESLDTYDSEVKQTLSYK
                     PKLVVLGSGWASVGLLKSLHKGDYDVTVVSPQNYFLFTPLLPSAATGTLEVKSLMASI
                     RKIVGYIGGHYLEAKADRIEFKEKLVKVSQVLPQTGETRSFYLPYDKLVIGVGSTANT
                     HGVEGLQYCDRLKSAEDALDIKRKIKNNLELACLPTTTEEERKRLLSFVVCGGGPTGV
                     EFAAEVFDLLNEDLPKLYPRLLRQQVSVHIIQSRSNILNTYDEKISEYAMDRFKKESI
                     DLLTNARVDKILPDKVIFNQKNPTTGELERKELPFGLCLWSTGVAQNPLAKQVVKAFP
                     GDQKNKRAIETDSHLRVLGNEMKDVYAIGDCSTLRTDLADHAGEFVRNYIIQKNLRTA
                     NQASDIITNDEIKNLSLTYEEIYDLSRQLSKRHPQTRESFIALEEVLPKYDTGKKGSL
                     NFKEITRLLKDTESKLTSLPATAQRAHQQGTYLGKKFTRIARITDDHTRRGQLIEFDL
                     DESSCKPFRYIHLGSLAYIGNSAVFDLPGYSFVGGLIAMYLWRGVYFAQTVSLRTRVL
                     LFMDWLKRGLFGRDIMSTV"
     gene            complement(437575..437646)
                     /gene="TDEL0Dtrna1Q"
                     /locus_tag="TDEL_0Dtrna1Q"
                     /db_xref="GeneID:11502246"
     tRNA            complement(437575..437646)
                     /gene="TDEL0Dtrna1Q"
                     /locus_tag="TDEL_0Dtrna1Q"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAA"
                     /db_xref="GeneID:11502246"
     gene            complement(438226..438298)
                     /gene="TDEL0Dtrna2A"
                     /locus_tag="TDEL_0Dtrna2A"
                     /db_xref="GeneID:11503630"
     tRNA            complement(438226..438298)
                     /gene="TDEL0Dtrna2A"
                     /locus_tag="TDEL_0Dtrna2A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:11503630"
     gene            <438952..>439612
                     /gene="TDEL0D02270"
                     /locus_tag="TDEL_0D02270"
                     /db_xref="GeneID:11503636"
     mRNA            join(<438952..438968,439027..>439612)
                     /gene="TDEL0D02270"
                     /locus_tag="TDEL_0D02270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680974.1"
                     /db_xref="GeneID:11503636"
     CDS             join(438952..438968,439027..439612)
                     /gene="TDEL0D02270"
                     /locus_tag="TDEL_0D02270"
                     /inference="similar to DNA sequence:INSDC:YNL246W"
                     /note="similar to Saccharomyces cerevisiae VPS75
                     (YNL246W); ancestral locus Anc_1.116"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681022.1"
                     /db_xref="GeneID:11503636"
                     /db_xref="GOA:G8ZT67"
                     /db_xref="InterPro:IPR002164"
                     /db_xref="UniProtKB/TrEMBL:G8ZT67"
                     /translation="MSEKAIASALNELADCEVDVEKAEEDIELYRIRRLKPIYAKRDA
                     IISRIPSFWSIVLSQHSDFADYIRASDFKYVDAIESVIVDWKTPQDFEIEIKIKAIES
                     EFEVQVVKKHFIMKGETLTSQAVEIGISGTLEKRALSIGSAGQAILMQRNLLTVASLP
                     ISLARISIRTASNTIQKLNEMSKMKRAAIAIVKGNSFNSN"
     gene            complement(<439686..>441953)
                     /gene="TDEL0D02280"
                     /locus_tag="TDEL_0D02280"
                     /db_xref="GeneID:11502247"
     mRNA            complement(<439686..>441953)
                     /gene="TDEL0D02280"
                     /locus_tag="TDEL_0D02280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680975.1"
                     /db_xref="GeneID:11502247"
     CDS             complement(439686..441953)
                     /gene="TDEL0D02280"
                     /locus_tag="TDEL_0D02280"
                     /inference="similar to DNA sequence:INSDC:YFR022W,YOR018W"
                     /note="similar to Saccharomyces cerevisiae ROG3 (YFR022W)
                     and ROD1 (YOR018W); ancestral locus Anc_1.358"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681023.1"
                     /db_xref="GeneID:11502247"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="UniProtKB/TrEMBL:G8ZT68"
                     /translation="MFPGSKAKEPLLYDVRIKGADHGVILLKGSASEAPSVLLSGTIV
                     LSVQEPIQFKNMSLRLYGKIRLNIPTQYKTSKGMAERYVKYEKRVYEHTWDNFNVENY
                     FQNLYDNYGRKTSIASKSSGNLSSLPRKAKSSTASLISLAGQSSSSYHTLVKGNYEFP
                     FSAILPGSITESVEGLPNASVVYKLESAIERMKFHTDLICRKHLRVVRTLSPDALELS
                     ETVAVDNTWPNKVDYSISIPAKAIAIGSATPVHVLVVPLLKGLKLGPIKITMVEHSQY
                     CGSFGSVSTQERIVNKMRIKDPLDHMNEDNETNNENDDDFSFQDRWEVNTTFQIPPSL
                     SKCTQDCTLLNSIKVRHKLKFVISLVNPDGHVSELRASLPVQLFMSPFVALGVKKSDG
                     AYGSANNSMTDVSSLARNQNDIVDEEDDDDVIFAGPASEMDPSAVNNNGSSATPSMSQ
                     LMSPPNYGNHVYDRLWSDVSVPNTPPRSGSQTPLETFREGSVLDNAHDMSQLQLNLRR
                     LHVERENGETAESGSAETPPIQIESDQGVSINVPPGIPPASYHASMEAQPSFRDQESP
                     MITPPSIQMAKEDSFCQPRTGSPLKKDWEMGNLSRVPSYDKAMKSDMYGDDLPPLYPS
                     ESGRRNKGHQLERPQIVHHKSSSYLSLHANGGQAARTPLARSNNSSSSSLNILPTTSN
                     PDNSKNSPGSSSGGNNKGQSASRYYSFGMTPVGTENESSTSLHVQRTPSRGHLGEKSS
                     SFSSLIGLLSKKDKK"
     gene            complement(<442275..>443876)
                     /gene="TDEL0D02290"
                     /locus_tag="TDEL_0D02290"
                     /db_xref="GeneID:11502248"
     mRNA            complement(<442275..>443876)
                     /gene="TDEL0D02290"
                     /locus_tag="TDEL_0D02290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680976.1"
                     /db_xref="GeneID:11502248"
     CDS             complement(442275..443876)
                     /gene="TDEL0D02290"
                     /locus_tag="TDEL_0D02290"
                     /inference="similar to DNA sequence:INSDC:YFR021W"
                     /note="similar to Saccharomyces cerevisiae ATG18
                     (YFR021W); ancestral locus Anc_1.359"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681024.1"
                     /db_xref="GeneID:11502248"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZT69"
                     /translation="MPESLPVINFINFNQTGTCISMGTSLGFEIYNCDPFGKFYSEDS
                     GGYGIVEMLFSTSLLAVVGIGDQPAMSPRRLRIINTKKHSVICEVTFPTSILSVKMNK
                     SRLAVLLKEQIYIYDISNMRLLHTIETISNPHGIVALSPSTDNSYLVYPSPPKVINSE
                     IKQNVTTNNINVSTGGTRPTGDVGQTGTDPKEADAGTDNNSNAIPSGNNMYSPGKSGI
                     TTADKPQNVKNDNNIIKNGDVILFNMKTLQPTMVIEAHKGEIAALALSFDGTLLATAS
                     EKGTIIRVFNVETGVKMYQFRRGTYPTKIHSMCFNSDNQFLAVTCSSKTIHIFKLGKN
                     QVIGEGHESDNSNVDEEGSDVASAATRNADHSDEEIHGDPETEAALLEAESNDMVLLE
                     RSREPYVDASRRTVARMIRKSSQKFSRQAARTLEQIFPIKVSSLLEPSRHFASLKLPL
                     DSNSGVKSMTSIGELIEVDTSEYPELFDLSEESQSIRSNHSGSLVKMLPIRVITSEGY
                     LYNYVLDPERGGDCLLLSQYSLTLA"
     gene            444201..444300
                     /gene="TDEL0Dtrna1S"
                     /locus_tag="TDEL_0Dtrna1S"
                     /db_xref="GeneID:11502236"
     tRNA            join(444201..444238,444255..444300)
                     /gene="TDEL0Dtrna1S"
                     /locus_tag="TDEL_0Dtrna1S"
                     /product="tRNA-Ser"
                     /note="codon recognized: AGC"
                     /db_xref="GeneID:11502236"
     gene            complement(<444459..>450704)
                     /gene="TDEL0D02300"
                     /locus_tag="TDEL_0D02300"
                     /db_xref="GeneID:11503632"
     mRNA            complement(<444459..>450704)
                     /gene="TDEL0D02300"
                     /locus_tag="TDEL_0D02300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680977.1"
                     /db_xref="GeneID:11503632"
     CDS             complement(444459..450704)
                     /gene="TDEL0D02300"
                     /locus_tag="TDEL_0D02300"
                     /inference="similar to DNA sequence:INSDC:YFR019W"
                     /note="similar to Saccharomyces cerevisiae FAB1 (YFR019W);
                     ancestral locus Anc_1.360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681025.1"
                     /db_xref="GeneID:11503632"
                     /db_xref="GOA:G8ZT70"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027483"
                     /db_xref="InterPro:IPR027484"
                     /db_xref="UniProtKB/TrEMBL:G8ZT70"
                     /translation="MGVTTHTGEPTTLKSMKPATDKPDFLATEALIPRTTTNLDTNPV
                     LSNISIPTKMAAEPEDFSPQSNGTLEPDESEYLTDTGAVGESESPNSERPVQNTAEGK
                     KTALYKRTGPPGAHAKSLTFSLNNNAHMKRSSIYESKSTVTAIPIRNAMNSNRQHHWD
                     NEDAISMKSGSSSMTASLSRSFLFGFYHNKKKDKEHTKGVISKEYWMKDDSAKECFTC
                     GKTFNTFRRRHHCRICGQIFCNSCTLSIPGERFGYSGTMRVCNNCYEHANNFEDSSDE
                     ESAMDQVSHHQSNEDRLIYSAQESNPNQFQWEAESLNGDSDSASQQREVTLLNDDGDT
                     QSILTTAEDSKMFVSTPPPPPKMAIPATRQGESLEISFPAQNTPVESWHRESISGSAA
                     GSRDRYTIKDVDMLPSLDQAHVSPLQAHSKSGVKLGNSLRRTIFNRVGNKRPALEKAA
                     TTGNVDSIIGNVDSKNYKFQFNYIDGAQRGYLNNERRDNFPQRQQIQEKESGSNISMS
                     QVDDETSEDEGSMSIYSALNDPVHSSNPIRSMRTSTKSFQRAEASLQRMRFRRRSKSK
                     SNAARPDSIYSGLDLFNNSTPNLVSIVKEDEAFHPLSSSEASMQRPKGKIGPSGSWKR
                     LSSVNLSNSENKNELNEVSSLHMEALLDQVLSDQNFENPDEWKRILNGCLRKIQTIRL
                     NAKDSTTLDFRQNYVKIKRICGGNSESSEYINGVVFSKALPCKNMPRLVESPRILLVM
                     FPLEYQRNENHFLSIETVIAQEREYLDKLVSRLTSLTPSVVLVGANVSGYALELLNKA
                     GVVVQFNLKPQVIERIAKLTEADIAISIDKLAGNVRMGSCEKFEVNSYVYRNISKTYT
                     FIRGCNRELGGTILLRGDTEENLRKLKDVSEFMVYVVFSLKLESALFNDNFLQISTNY
                     YLKEKQEKKNEVVTGFFAEFLEKFNKRILTVSPTVEFPVPFLLRRARELELQLIEKRK
                     ESEYLEEHGEAARAFVTELLSLASTLTKNDFKYLIKFIHEKELENLELQFQKRSRHWE
                     VSCAQSHNMLGTGSHQCITVLYSMVSTKTATPCIGPQLVTIDYFWDSDISVGQFIENV
                     VATASYRCRQGCGGVLMDHYRSYVHGSGKVDVLLEKFQTRLPKLKDIIVTWSYCKKCG
                     TSTPILQMSEKTWNYSFGKYLEVMFWSKTESVAGIGKCTHDFAKDHVKYFGFNDLVAR
                     MEYSNLEVHELVTPPRKITWTPYKDIKMKVELYYQILDKIDAFYNSVLSRLSRVKLDS
                     MSGEKLLTGQSTLEALKSKVDEEKSVLINDLERYYRGDPGDQHIRLNIIIKALHDRAV
                     SWDSEFTEFGKKFLPSETDITRITSHQLKKLFTDFGSSDERTEEEGLDRVDDEEKEED
                     STHAKEIDENSQHVDAEIPFYSSQNEQESSQNEIENNLNDVGLSENQKTRSNTALANS
                     QLTADHPLGNRTSSSFNKSFDNGLVSDLQKSRGSESLSSSSSIAKEHRVSNKVGQLAN
                     FFDQMHFDALSKEFELQREKERVQLNKNKYQALRIHTSTPIVEIYKNVKDAVDEPLHD
                     LSKRDETKAKEPVDKTTIMPNKHKIHDKLESQLENSIYQWGEQVLQEDTKSTKLEPAN
                     LIVNADGKEVKLREPLPPVMTTTTANKEGSNTQPEKSLLMKALANFWADRSASLWKPL
                     SYPTLPSEHIFVDSDVIIREDEPTSLIAFCLSTPDYKQKMTKLDHQRQPSYAAPTEFS
                     AAASTNASEYFNFEKESQRSTDFSSKTHPSSENLSSSKMPSGQRPLPTQSTQTDPCEK
                     LESIMTKSTAVHLRYQFEDALTVMSCKIFFAGHFDAFRRTCGCQEKFIQSLSRCVKWD
                     SSGGKSGSGFLKTLDDRFIIKELSHSELEAFIKFTPSYFEYMAQAMFHDLPTALAKIF
                     GFYQIQVRSAISGTKSYKMDVIIMENLFYEKKTTRIFDLKGSMRNRHVEQTGKENEVL
                     LDENMIEYIYESPIHVREYDKKLLRASLWNDTLFLAKMNVMDYSLVVGIDNEGHTLTV
                     GIIDFIRTFTWDKKLENWVKEKGLVGGNSSKKPTVVTPKQYKNRFREAMERYILMVPD
                     PWYQEHF"
     gene            <451037..>451996
                     /gene="TDEL0D02310"
                     /locus_tag="TDEL_0D02310"
                     /db_xref="GeneID:11502250"
     mRNA            <451037..>451996
                     /gene="TDEL0D02310"
                     /locus_tag="TDEL_0D02310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680978.1"
                     /db_xref="GeneID:11502250"
     CDS             451037..451996
                     /gene="TDEL0D02310"
                     /locus_tag="TDEL_0D02310"
                     /inference="similar to DNA sequence:INSDC:YFR018C"
                     /note="similar to Saccharomyces cerevisiae YFR018C;
                     ancestral locus Anc_1.361"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681026.1"
                     /db_xref="GeneID:11502250"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="UniProtKB/TrEMBL:G8ZT71"
                     /translation="MMLGLVILLWISVVFAENLNFCAYHRDNLRRSLSLGSPGPDNLL
                     LPFNGTRIPGSQESIDIQIFIKEFFGEKLSNDWSLEVDSFEEKGYNFTNLVFTPFNGD
                     TFLVLAAHYDTKIEPKGFIGATDSGASCAILLYVAKFLDQILTSDRDLLNPWLLGSNV
                     GLKIVFFDGEEALEYWTAEDSIYGSKHLAEKWKNQGLLDRIDLFVLLDLLGSQEQLPV
                     HSYHRSSHAYYEVLSDIERVIAKGRDRSLNPSELQYLMKGPFLDDDHRPFYEAGVSVL
                     HLIPFPFPSVWHKLEDNFENLDETKIQRWAVMMSEFVVKFVNS"
     gene            <452093..>453874
                     /gene="TDEL0D02320"
                     /locus_tag="TDEL_0D02320"
                     /db_xref="GeneID:11502251"
     mRNA            <452093..>453874
                     /gene="TDEL0D02320"
                     /locus_tag="TDEL_0D02320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680979.1"
                     /db_xref="GeneID:11502251"
     CDS             452093..453874
                     /gene="TDEL0D02320"
                     /locus_tag="TDEL_0D02320"
                     /inference="similar to DNA sequence:INSDC:YOL025W"
                     /note="similar to Saccharomyces cerevisiae LAG2 (YOL025W);
                     ancestral locus Anc_1.362"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681027.1"
                     /db_xref="GeneID:11502251"
                     /db_xref="UniProtKB/TrEMBL:G8ZT72"
                     /translation="MLVSELVDQYLKTTDNDLKYMALRQELTVLEVGRDLDLLVNKVL
                     MPVLLEEKDPEIVELVSSQVYPQLTLKCIVVMKRGNHEPQWFNDLIVDPLMDHIADKR
                     KNFIVQTLRNVLKVAVQSRYRMQSAGDRHLGALVSQMKDYKGNNDVGQNTVLYWEALK
                     PVISTYYYGTVKIPFAILKEIFNLCEGKLDSLVRSVLISSVQATTRQNVEKIVQESVS
                     DSVLEAISTVWWQFGQLVPWLFEKRLLPDLHQQETLLTNLQMIYNLLPFFQIASAVSG
                     EKGNSKNGLKRRLESKLQGLLENAAANSSAATTKEVDAELDVEDAEVDDAQQAYLDEL
                     QSDDDLEFEDEELLETDEGYQLKKLCQTILETLNDNKEKSSDIQPHKIDLTKVEVSAL
                     DETEDVVYTIQSTLESETTLQPLLLSVEILNQLLLTGYTEIDYSPVCQSLVRHMKQNK
                     AFLQTIKVGNLTQTIDDGSTLRTMVHSTILQIITTRKLDYPTCCKLLTEAVSRGARDV
                     DPTIEQLSLRIIQNLLQSHYNTIRALDSSWYDQTLLPKAAETAGKLHKRLQTTIQNSE
                     QLEPQAQTATILQELTSLFNVQYPAIE"
     gene            <454067..>454663
                     /gene="TDEL0D02330"
                     /locus_tag="TDEL_0D02330"
                     /db_xref="GeneID:11502252"
     mRNA            <454067..>454663
                     /gene="TDEL0D02330"
                     /locus_tag="TDEL_0D02330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680980.1"
                     /db_xref="GeneID:11502252"
     CDS             454067..454663
                     /gene="TDEL0D02330"
                     /locus_tag="TDEL_0D02330"
                     /inference="similar to DNA sequence:INSDC:YFR017C,YOL024W"
                     /note="similar to Saccharomyces cerevisiae YFR017C and
                     YOL024W; ancestral locus Anc_1.363"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681028.1"
                     /db_xref="GeneID:11502252"
                     /db_xref="UniProtKB/TrEMBL:G8ZT73"
                     /translation="MPNKHLSIAEKDPALAQSRDFLDLEEPPAAKETPSGSQVCLIDY
                     DRARPANAQYNNNYTHQYQPGLMQAPLVEEGPTSRPNVGGMPRRRSTNYIDALHNKAK
                     SESTMNNDLQQSLRETTNTNSKSTPVFKPSYTTGTEAVPMTQDTAGPDDPARPDYYRS
                     SFSSRGGGRPELGRKKSSFEYEDFKKDVYDRLNMFDKT"
     gene            <455204..>456709
                     /gene="TDEL0D02340"
                     /locus_tag="TDEL_0D02340"
                     /db_xref="GeneID:11502253"
     mRNA            <455204..>456709
                     /gene="TDEL0D02340"
                     /locus_tag="TDEL_0D02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680981.1"
                     /db_xref="GeneID:11502253"
     CDS             455204..456709
                     /gene="TDEL0D02340"
                     /locus_tag="TDEL_0D02340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681029.1"
                     /db_xref="GeneID:11502253"
                     /db_xref="GOA:G8ZT74"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZT74"
                     /translation="MSDIEKEQVRDDVNEASSVIGSSDVDEAFNAALASKDLVVTEEI
                     NRKLLRKIDLYIQPVIWMLYALQYMDKVTNNYAGVMGIQQDLNLAPNEFAWLGTAFYL
                     AYLGGEFPIAQMLQRLPYVKTLSTCIVIWGVVLCAHAGVSNGAGIITARVFLGIFESS
                     ITPGFVILTSQWYRKEEHFARIAYWFSCNGLGQILGGSIAYGLAHHAESYSIESWKIL
                     FVITGLMSILFGVLFYFYIPDSPATAWFLTEEERLYQVQRIKSNQQGFGNKRFKRYQL
                     VEAFKDVRTWIYIVWGLTAQIPNGGLGSFGSILLYKTLGYSSEGALLMGLPQGAVQIA
                     SGIITGYIATKTGKRVIVGTVSCAITLIGTCLLAFTDAPHSRLAGYYIIPFFAIGIVT
                     ILASITSDAAGHTKKVTAAFLVSYCIGNIIGPQTFRVSDAPEYQPARVTMVACMVVAT
                     ADLFLLLIVNLRENSRRDRLQSEDPSYSVAPENVEFLDLTDFENKNFRYSS"
     gene            <456952..>458988
                     /gene="TDEL0D02350"
                     /locus_tag="TDEL_0D02350"
                     /db_xref="GeneID:11502254"
     mRNA            <456952..>458988
                     /gene="TDEL0D02350"
                     /locus_tag="TDEL_0D02350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680982.1"
                     /db_xref="GeneID:11502254"
     CDS             456952..458988
                     /gene="TDEL0D02350"
                     /locus_tag="TDEL_0D02350"
                     /inference="similar to DNA sequence:INSDC:YOL023W"
                     /note="similar to Saccharomyces cerevisiae IFM1 (YOL023W);
                     ancestral locus Anc_1.364"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681030.1"
                     /db_xref="GeneID:11502254"
                     /db_xref="GOA:G8ZT75"
                     /db_xref="InterPro:IPR000178"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006847"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR015760"
                     /db_xref="InterPro:IPR023115"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZT75"
                     /translation="MPYNLKFQPSKNSIYKGSENQGMWRSTLNRYVTRYPSTASCSAI
                     RYYAKKVKRIPKLRPVPFVIPNYVSVSKLANLLNCRMDNLIRDLTKLGFANISQGYIL
                     SKEYVELILQEYNYQLPEKSNEITPDNVYEELKSPVNPKSLQKRAPVVTIMGHVDHGK
                     TTIIDYLRKSSVVAQEHGGITQHIGSFQVITPVSKRKITFLDTPGHPVFLKMRERGAN
                     ITDIIVLVVSIEDSIMPQTIEAIKHAKNSGNELIVAITKIDRISQAKERERAMEKVTN
                     DLITQDIAVEKIGGDVQVIPISAKTGENMDLLEESIVILSDVMDIKAENSPKTVAEGW
                     ILESQVKKTVGNVATVLVKKGTVQKGKILVCGNTYCKVRSIHNEGGQQVPKALPSDAV
                     EVLGWKELPSAGDQVIEAKNEATAKKFISKRLALQEVEKEGLTVEKLNEQRALEAAKK
                     EKEAEEDEVDEEDNAVPVGPKKVNFIIKADVSGSAEAINESIADLGNDEVTCNIISSS
                     VGIPNENDLKIAQITNGIILCFNLGSLPNDVINNKLGVEVKQYNVVYKLIEDVTEILT
                     DNLTPIFEIKQIATVDIREIFEFQLKKKIIKIAGCRVVNGQINRNSMVQIQRGPSKEI
                     IYDGKLATLKQGKEDATEVTKGNECGVTFDKNFENYQAGDKIIVYENVKVPRFL"
     gene            complement(<459068..>460291)
                     /gene="TDEL0D02360"
                     /locus_tag="TDEL_0D02360"
                     /db_xref="GeneID:11502255"
     mRNA            complement(<459068..>460291)
                     /gene="TDEL0D02360"
                     /locus_tag="TDEL_0D02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680983.1"
                     /db_xref="GeneID:11502255"
     CDS             complement(459068..460291)
                     /gene="TDEL0D02360"
                     /locus_tag="TDEL_0D02360"
                     /inference="similar to DNA sequence:INSDC:YOL022C"
                     /note="similar to Saccharomyces cerevisiae YOL022C;
                     ancestral locus Anc_1.365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681031.1"
                     /db_xref="GeneID:11502255"
                     /db_xref="GOA:G8ZT76"
                     /db_xref="InterPro:IPR007320"
                     /db_xref="UniProtKB/TrEMBL:G8ZT76"
                     /translation="MSKIEEFAGSDFEEDLTSNNGPPVFLALVDAPVKENEEVTVEDS
                     FIGGKPVWLDENSVPNDELLKCGACKTKENMKLLVQAFSPLDTEQVEEVQGKNGVDNL
                     NYVSEDDERVLYVFLCTKCQRKANSVRCIRGVKKNSTKKTSASQQISQKMESLVVDKD
                     FKINPFDISSDKVNPFEANPFQKADNTPNPFAVAQIQNKPAQEKPKDTSLKVARKLHD
                     SQQDKPFDEAEAFKSYLLYVEEESFKNKKPDHLKLPENLKIDKSALDLSGETEADLDK
                     NPIKLDPRTEKLSKFLDDDVFQKFQEVVGYNPNQVLRYEFGGKPLLYAQSKVSFEKIV
                     SNPAYNPSSKRVFEMQLMPKMILDLEENVSLVDGMEWGTILVFTDIENYTPKFDENGV
                     GYVEEIVKVQWESRE"
     gene            460484..460554
                     /gene="TDEL0Dtrna1G"
                     /locus_tag="TDEL_0Dtrna1G"
                     /db_xref="GeneID:11502256"
     tRNA            460484..460554
                     /gene="TDEL0Dtrna1G"
                     /locus_tag="TDEL_0Dtrna1G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11502256"
     gene            <460691..>462952
                     /gene="TDEL0D02370"
                     /locus_tag="TDEL_0D02370"
                     /db_xref="GeneID:11503625"
     mRNA            <460691..>462952
                     /gene="TDEL0D02370"
                     /locus_tag="TDEL_0D02370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680984.1"
                     /db_xref="GeneID:11503625"
     CDS             460691..462952
                     /gene="TDEL0D02370"
                     /locus_tag="TDEL_0D02370"
                     /inference="similar to DNA sequence:INSDC:YFR009W"
                     /note="similar to Saccharomyces cerevisiae GCN20
                     (YFR009W); ancestral locus Anc_1.366"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681032.1"
                     /db_xref="GeneID:11503625"
                     /db_xref="GOA:G8ZT77"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZT77"
                     /translation="MSTSIGSQVRQAATSVDSIVTDYAVGYFNNLSTITFDAVQSKTV
                     DLSSEIDFVSSLLVDAGASKEKVDKLASDLLERLNVQLKENQAKLEITGDTSKRLLDI
                     NVLQTHNSKANINTSLNMLGVNNDIEHAGRNMDTRVDLKKLAKAEQKIAKKVAKRNNK
                     FVKYEASKLIDEKREEDYDSFFLKINPLDFGSAAGKSKDIHIDTFDLYVGDGQRILSD
                     AQLTLSFGRRYGLVGQNGIGKSTLLRALAGRELNVPKHISILHVEQELRGDDNTALQS
                     VLDADVWRKQLLSEEAKINERLQEIEELRTEFEEESLEVKKLDNEREDLDKHLEQISE
                     KLVDMESDKAEARAASILYGLGFSTDAQHKATKSFSGGWRMRLSLARALFCQPDLLLL
                     DEPSNMLDVPSIAYLSEYLKTYPATVLVVSHDRAFLNETATDIIYQHNERLDYYRGQD
                     FDTFYATKEERRKTAQREYDNQMAYRKHMQEFIDKYRYNAAKSQEAQSRIKKLEKLPI
                     LEPPEQEKSISFKFPDCEKLSPPIIQLQDVSFGYSEDDLLLKDVDLDLQMDSRIALVG
                     ANGCGKTTLLKVMMEQLRPLRGYVSRNPRLRIAYFTQHHVDSMDLNSSAVDWMSKRFP
                     GKTDEEYRRHLGSFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHVLILDEPSNHL
                     DTNGIDALVDALKNFTGGVLMVSHDISVIDSVCNEIWVSENGTSRRFDGSIHDYKKYI
                     LESADNSGVVKRH"
     gene            complement(<463000..>465993)
                     /gene="TDEL0D02380"
                     /locus_tag="TDEL_0D02380"
                     /db_xref="GeneID:11502257"
     mRNA            complement(<463000..>465993)
                     /gene="TDEL0D02380"
                     /locus_tag="TDEL_0D02380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680985.1"
                     /db_xref="GeneID:11502257"
     CDS             complement(463000..465993)
                     /gene="TDEL0D02380"
                     /locus_tag="TDEL_0D02380"
                     /inference="similar to DNA sequence:INSDC:YOL021C"
                     /note="similar to Saccharomyces cerevisiae DIS3 (YOL021C);
                     ancestral locus Anc_1.367"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681033.1"
                     /db_xref="GeneID:11502257"
                     /db_xref="GOA:G8ZT78"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022966"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:G8ZT78"
                     /translation="MSTAAVAHRRKRLSEGLTVTQKVFVRSRNGGASKIVREHYLRKD
                     IPCLSRACRICPNIIVPDAKNELPKFILSENPLALANGPHYVVLDTNVVLQAIDLLEN
                     PDCFCDVIIPQIVLDEVRNKSYPVYVRLRTLCRDSDDKKRFIVFHNEFSENTFVERLP
                     NETINDRNDRAIRKTCQWFAEHLKEQNINIVLVSNDRLNREAASKGDERFTTRSLYEY
                     VELLPNGEDIKDSIPNFESSADNIKDVDAKVEFSFPEYYSTARIMGGLKNGVLYQGNI
                     QISEYNFLEGSITLPRFSKPVLVVGQKNLNRAFNGDQVVVELLPQSEWKAPSSIALDS
                     EHFDVNDNADADADAEDAGVESSTGLISDKQRRLLTQDAILAQKSNKVQPTARVVAIP
                     RRSWRQYVGQIAPNSVDAKTGGSQNVFVILMDKCLPKVRIRTRRANDLLGKRIVISLD
                     SWPATHKYPLGHFVRDLGEVESAEAETEALLLEHDVEYRPFSKKVLECLPAEGHDWKA
                     PADLNDPEMIAKDSLLQKRRDLRDKLICSIDPPGCVDIDDALHAKRLSNGNWEVGVHI
                     ADVTHFVKPNTALDAEGASRGTSVYLVDKRIDMLPMLLGTDLCSLKPYVERFAFSVIW
                     ELDDNANIVNVDFMKSVIKSREAFSYEQAQLRIDDPNQKDELTEGMRALLQLSIKLKQ
                     KRLDAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIFD
                     AFPQTAMLRRHAAPPSTNFETLNEMLQTRKGLSISIESSKALADSLDRCIDPQDPYFN
                     TLVRIMSTRCMMAAQYFYSGAYSYADFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAG
                     AIGYEPLDLMHRDKNKMDMICRNINKKHRNAQFAGRASIEYYVGQVMRNNETVEAGYV
                     IKVLNNGIVVLVPRFGVEGLIRLENLTNDVNSSQFDEVNYKLSFTSKAGEKKEVYVFD
                     KVEVQLRSVLDPITSKRKAELLLEK"
     gene            complement(<466152..>466640)
                     /gene="TDEL0D02390"
                     /locus_tag="TDEL_0D02390"
                     /db_xref="GeneID:11502258"
     mRNA            complement(<466152..>466640)
                     /gene="TDEL0D02390"
                     /locus_tag="TDEL_0D02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680986.1"
                     /db_xref="GeneID:11502258"
     CDS             complement(466152..466640)
                     /gene="TDEL0D02390"
                     /locus_tag="TDEL_0D02390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681034.1"
                     /db_xref="GeneID:11502258"
                     /db_xref="UniProtKB/TrEMBL:G8ZT79"
                     /translation="MISGLLNIMLSFHLITKALCTPALISNSISEIYVERPEGLFFND
                     TDEIELQTAQDMSHLLEKHKNFLKNYMDTEDNLRTLIDPAYQSVQSEGFRHANGGSSK
                     DDLQFQMISVSRRDVNRVKSLLQDKYQDADFEALNFMHELDQNTQSVLLYYTNRDRDE
                     DH"
     gene            <467340..>468898
                     /gene="TDEL0D02400"
                     /locus_tag="TDEL_0D02400"
                     /db_xref="GeneID:11502259"
     mRNA            join(<467340..467361,467436..>468898)
                     /gene="TDEL0D02400"
                     /locus_tag="TDEL_0D02400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680987.1"
                     /db_xref="GeneID:11502259"
     CDS             join(467340..467361,467436..468898)
                     /gene="TDEL0D02400"
                     /locus_tag="TDEL_0D02400"
                     /inference="similar to DNA sequence:INSDC:YFR010W"
                     /note="similar to Saccharomyces cerevisiae UBP6 (YFR010W);
                     ancestral locus Anc_1.369"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681035.1"
                     /db_xref="GeneID:11502259"
                     /db_xref="GOA:G8ZT80"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8ZT80"
                     /translation="MSSATLEFNIKHAGKVYPVKIASDATAGDLKKEVEDLIKVPVAR
                     QKYMVKGGLSDDSATDLASLIKPGSNVMVLGTPDAGLISKPKEKSQFIEDLAPEQQFQ
                     HANDLPIGFQNMGNTCYLNATLQALYRIEPLRDMILDYNQNSTTTPVDETHKKIVVEM
                     KRCFENLKSKSYKSVMPMVLLTALRKCYPQFAERDPQSGFYKQQDAEELFTQLCQSMS
                     VVFGDKFTEAFSINFRTTIKDSANEDDVSVKEESDVKLQCHISGSTNFLKNGLIESLH
                     EKIEKRSEFTGMNSKYNVDKQITKLPKFLTVQYVRFFWKRSAGKKSKILRKVVFPFQL
                     DVADMLTPEYASEKIKVREEFRQVDKERIEKSRDIKKRKIEESTDSVVMTPRERHETE
                     LAMAKSEQEHWVEEFKKRTPKDLQQGENPSSLYELIGVITHQGANSESGHYQSFIRDD
                     MDEDKWYNFNDDKVSVVPKEKIEGLAGGGESDSALILIYKGFGL"
     gene            complement(<468952..>469422)
                     /gene="TDEL0D02410"
                     /locus_tag="TDEL_0D02410"
                     /db_xref="GeneID:11502260"
     mRNA            complement(<468952..>469422)
                     /gene="TDEL0D02410"
                     /locus_tag="TDEL_0D02410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680988.1"
                     /db_xref="GeneID:11502260"
     CDS             complement(468952..469422)
                     /gene="TDEL0D02410"
                     /locus_tag="TDEL_0D02410"
                     /inference="similar to DNA sequence:INSDC:YFR011C"
                     /note="similar to Saccharomyces cerevisiae YFR011C;
                     ancestral locus Anc_1.370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681036.1"
                     /db_xref="GeneID:11502260"
                     /db_xref="InterPro:IPR012471"
                     /db_xref="UniProtKB/TrEMBL:G8ZT81"
                     /translation="MGSQPSKPDEVKVFQPQTQIDFSEALLAQLESSKESNFSRKQLA
                     ERYVEQKVSDRLSELEEDTLKKFESKLENSLLKNEPSEGDDSSLSSNALNEKIESLNK
                     KLQVFNDNDNSKSEKYSKDKTRTALHKCLLENKGKPLNCYQEIEQFKKLVLDLD"
     gene            470814..470898
                     /gene="TDEL0Dtrna2Y"
                     /locus_tag="TDEL_0Dtrna2Y"
                     /db_xref="GeneID:11502249"
     tRNA            join(470814..470853,470862..470898)
                     /gene="TDEL0Dtrna2Y"
                     /locus_tag="TDEL_0Dtrna2Y"
                     /product="tRNA-Tyr"
                     /note="codon recognized: UAC"
                     /db_xref="GeneID:11502249"
     gene            <471383..>472822
                     /gene="TDEL0D02420"
                     /locus_tag="TDEL_0D02420"
                     /db_xref="GeneID:11503646"
     mRNA            <471383..>472822
                     /gene="TDEL0D02420"
                     /locus_tag="TDEL_0D02420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680989.1"
                     /db_xref="GeneID:11503646"
     CDS             471383..472822
                     /gene="TDEL0D02420"
                     /locus_tag="TDEL_0D02420"
                     /inference="similar to DNA sequence:INSDC:YFR012W,YOL019W"
                     /note="similar to Saccharomyces cerevisiae YFR012W and
                     YOL019W; ancestral locus Anc_1.371"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681037.1"
                     /db_xref="GeneID:11503646"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:G8ZT82"
                     /translation="MLPSARAVFSVVCAFQFASVALLIIACVTAPTFRQIGLSKHAGT
                     TYGVFGYCQDNDGCSKASAFYRPFEVGSSDEGDWTISHNGRGTLGKILIVTPIAAGLT
                     FLGFLSTVISFVGALVSGSTNAFLFALNLTMTVIGFLASALVCVIVFLLFYPNVTWCS
                     WNLIPAAALLLITIPLVFVAHSSARSSDEEDEELDDDLTGIIQHDEADEFVFESPKDA
                     GFYKEVSNPSGSLSEKPLMNDPYTNYESKKEESVVKISSGTTDQSTSHDLNDFEQESN
                     SHTAFSAINDNNNNPTLTRPGVSLSMASSEYSSNYAQNQFGKAPRGVLEDIIKDSISK
                     DDLPESHIQTVSDNGSDFTSISQRATRQQAMPPLHQQHQHQQQQRAYPTVRSAGPDPT
                     EMLLQNNPNFLHTNARRMQPQQPYYPQQYPPRAPNHYGGNQPPVQPMSQGGFSSTHYK
                     PAYKKKVGARNNMIPPASAITDGNPYQFR"
     gene            complement(<472851..>473951)
                     /gene="TDEL0D02430"
                     /locus_tag="TDEL_0D02430"
                     /db_xref="GeneID:11502262"
     mRNA            complement(<472851..>473951)
                     /gene="TDEL0D02430"
                     /locus_tag="TDEL_0D02430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680990.1"
                     /db_xref="GeneID:11502262"
     CDS             complement(472851..473951)
                     /gene="TDEL0D02430"
                     /locus_tag="TDEL_0D02430"
                     /inference="similar to DNA sequence:INSDC:YOL018C"
                     /note="similar to Saccharomyces cerevisiae TLG2 (YOL018C);
                     ancestral locus Anc_1.372"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681038.1"
                     /db_xref="GeneID:11502262"
                     /db_xref="GOA:G8ZT83"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006011"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:G8ZT83"
                     /translation="MFRDRTNLFLSYRRTFPHKANFSRLNRGKDDPFMDRHEDEEAYP
                     MVDMTQDRSRDYLPPAFVDLTQDVDDYLVEVQSLMKQLSKLYQKNSLPGFEDKSHDEK
                     EIEALSYEVIQLFQKSYNVIKKLQHIFESQTLEGKKLKRGDLIILDNLRKRYAQKIQL
                     ESNNFRVLQNNYLKFLNKDDSKPIFPKSEDSTQLLIEEEEEPLRNSQDIEAYSRQTLR
                     RQMDPGQQANQRFLQERDEEITQLAKGVLEVSTIFREMQNLIIDQGTIVDRIDYNLEN
                     TVIHLKEANRELTKATHYQKRTQKCKVILLLSLCVVALFFFVMLKPHNSGSSAPKVET
                     APKGSNGDSTAEGPIEVSNDNLQRRLIEILIK"
     gene            <474578..>477001
                     /gene="TDEL0D02440"
                     /locus_tag="TDEL_0D02440"
                     /db_xref="GeneID:11502263"
     mRNA            <474578..>477001
                     /gene="TDEL0D02440"
                     /locus_tag="TDEL_0D02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680991.1"
                     /db_xref="GeneID:11502263"
     CDS             474578..477001
                     /gene="TDEL0D02440"
                     /locus_tag="TDEL_0D02440"
                     /inference="similar to DNA sequence:INSDC:YOR129C"
                     /note="similar to Saccharomyces cerevisiae YOR129C;
                     ancestral locus Anc_5.457"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681039.1"
                     /db_xref="GeneID:11502263"
                     /db_xref="InterPro:IPR012860"
                     /db_xref="UniProtKB/TrEMBL:G8ZT84"
                     /translation="MDTGQGSEVLESNILYILTSKFDNKYGPTIVSQYPKHIAGFAQK
                     GAQKTIQLASLMIPNNIEHRAAAGADCNTFKLYFNKIDSSYQLLPPINEQIEENSKEP
                     SQISFINLVRAQSDKNDSRGSKIRSIALGTTLSNVEIMKPFLLMALEDMMLKDDDDND
                     KLVKNCFGTLNSIDLSAVRAILEDQPLQQMLQAVVNKNSLNNALDDNTESATRVRKML
                     KLTPIDRYGNRMLLDKGRIRIHFDQYAADSQFNHLTKDPLSIDLIACLPMHAKTCGHP
                     LLSFLQRLVPLLENIPSTNYSFKIIINSDKSSKEQLCQFVIALSSLFGCFPHVSSSRS
                     PCAISLPYIEVSMINTIKQYFEKHCKSLTFCVMGTANPIFKHHTELWDFYYNLDDETM
                     LLSNDRSDNQRNSLWDPQLLKKFLHMNINEMAPFQNQDHIRIGLLAKFLGIIKEENPN
                     SSEALSALKKVNVIQLMHLNNILNFGHGRDFNLLNSYLIGYKDFVIFDEFFRPASLQY
                     MRWFTTLDSIIDCLFRSDQNLSERQQDLGSLHDILTDILQNIGTSTSNLEAFLASGFN
                     YPFLRSSVGGNLLRKDFAGINVQKEIHENWKKGKSWLHIVDQESIGDGVIKYFVRDRS
                     LNLLSLPLLLNSNIRRPKNSKTKSLDRNSGTSALPVSTATASLNSDYEGRRPRSMSLK
                     WMLNLANPRSRDSILDTVSLRSGSDVSVYSFPSATSYPMTNGSGSSSSMSSASSSISS
                     SSSKVSFKFLRGETEKIKKLSFEILSKIEEHPIGEILIKSSLNPFLQLVYEGSKVEFA
                     KNLKDTTRT"
     gene            complement(<477063..>479090)
                     /gene="TDEL0D02450"
                     /locus_tag="TDEL_0D02450"
                     /db_xref="GeneID:11502264"
     mRNA            complement(<477063..>479090)
                     /gene="TDEL0D02450"
                     /locus_tag="TDEL_0D02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680992.1"
                     /db_xref="GeneID:11502264"
     CDS             complement(477063..479090)
                     /gene="TDEL0D02450"
                     /locus_tag="TDEL_0D02450"
                     /inference="similar to DNA sequence:INSDC:YDR380W"
                     /note="similar to Saccharomyces cerevisiae ARO10
                     (YDR380W); ancestral locus Anc_5.456"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681040.1"
                     /db_xref="GeneID:11502264"
                     /db_xref="GOA:G8ZT85"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G8ZT85"
                     /translation="MRETFHIKSRVCGILSCSVFRFITYHSEEQTIKFTDTMTPVTHD
                     LVHTAQHLYGANNLAAQIPFGLYVFKRLLSVGVKSIFGVPGDYNMRLLEHMYDESLVD
                     TAGDKLEWVGCCNELNAAYAADGYSRYSNEIGCVITTYGVGELGAISGLAGAFAESVK
                     VLHIVGIVDYEVNDLGPEMRSHNLHHLLPRLNDSNFVGPDYRVYAEMVKDKVACSVEY
                     LDDLETACDKVDKVIEDIYKYSKPGYLFVPRSFVDELVSTKNLIEKPTITLRECIEKS
                     PVDEAKIVTEKILRLLNQSASPAVIGDMFTDRYGLRVELNDFINKANIVGFSTVQGKS
                     IIDESSPLYMGAYNGMTSAPTVSEKLLACDLVLHFGIEKNEVNYGNYNFPHKSDAKIV
                     ELHPQYIRFYDNTTKKEEIYKGVSFVDILDLLNQSPELSELSFQYNSKFKAYTIEELN
                     LDERDFGNDETSDITQGTLQKSMPNYLNPGDVLISDTGTFQFAIRDFSLPSQVKYITQ
                     GFYLSIGMALPAALGVGIAMRDYPMHHVWDVEKIPFGYEPKVILFEGDGAAQMTVQEL
                     STMIRHQVPIEIFLWNNNGYTIERVIEGPTRPYNDIQPWKWTKLLEAFGDFDGKHSRA
                     TVLETRSQLENKLSELKYKDHRRGIDFMEVKLATMDVPSQLQKMIDAIVKN"
     gene            <479687..>481402
                     /gene="TDEL0D02460"
                     /locus_tag="TDEL_0D02460"
                     /db_xref="GeneID:11502265"
     mRNA            <479687..>481402
                     /gene="TDEL0D02460"
                     /locus_tag="TDEL_0D02460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680993.1"
                     /db_xref="GeneID:11502265"
     CDS             479687..481402
                     /gene="TDEL0D02460"
                     /locus_tag="TDEL_0D02460"
                     /inference="similar to DNA sequence:INSDC:YOR128C"
                     /note="similar to Saccharomyces cerevisiae ADE2 (YOR128C);
                     ancestral locus Anc_5.455"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681041.1"
                     /db_xref="GeneID:11502265"
                     /db_xref="GOA:G8ZT86"
                     /db_xref="InterPro:IPR000031"
                     /db_xref="InterPro:IPR003135"
                     /db_xref="InterPro:IPR005875"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR016301"
                     /db_xref="UniProtKB/TrEMBL:G8ZT86"
                     /translation="MDSRTIGILGGGQLGRMIVEAANRLNVKTVILDAPGSPAKQINS
                     VTEHVNGSFANPDDIEKIAAKCDVLTVEIEHVDVPTLKGLQEKFPNLKIYPSPETIEL
                     IQDKYLQKQHLIKNKIAVTESVSIDTASVSALKEVGEKLGYPYMLKSKTLAYDGRGNF
                     IIKNEGKIPEALEFLKDRPLYAEKWAPFKKELAVMIVRSIDGRVFSYPTVETVHKDNI
                     CFLCYAPARIPDSVQLKAKLLAENAVRAFPGCGIFGVEMFYLEDGELLINEIAPRPHN
                     SGHYTIDACVTSQFEAHVRAVLNLPMPKNFSALTTSETNAIMLNILGDEKRKNKELQI
                     CKRALETPGSSVYLYGKESRPKRKMGHVNVVTSSMEECERRMSYVIGKLKEPPKISAA
                     TKMINEAEKAPLVGVIMGSDSDLPVMSAACEILEQFEVPFEVTIVSAHRTPNRMSKYA
                     IEASQRGIKAIIAGAGGAAHLPGMVAAMTPLPVIGVPVKGSCLDGVDSLHSIVQMPRG
                     VPVATVAINNSTNAALLAIRLIGAFDASLHHKMQHFLLRQETDVLEKAAKLESEGYKN
                     YLKSK"
     gene            <481588..>481827
                     /gene="TDEL0D02470"
                     /locus_tag="TDEL_0D02470"
                     /db_xref="GeneID:11502266"
     mRNA            <481588..>481827
                     /gene="TDEL0D02470"
                     /locus_tag="TDEL_0D02470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680994.1"
                     /db_xref="GeneID:11502266"
     CDS             481588..481827
                     /gene="TDEL0D02470"
                     /locus_tag="TDEL_0D02470"
                     /inference="similar to DNA sequence:INSDC:YDR379C-A"
                     /note="similar to Saccharomyces cerevisiae YDR379C-A;
                     ancestral locus Anc_5.454"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681042.1"
                     /db_xref="GeneID:11502266"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:G8ZT87"
                     /translation="MAKRLSGLQKEVIHLYRGCIRVAHTKPRPNQPHFVSYIREEFGK
                     YKGLPKKDFTAIEHLLRVGHKRKDLYSQPELKDIH"
     gene            complement(<481927..>484860)
                     /gene="TDEL0D02480"
                     /locus_tag="TDEL_0D02480"
                     /db_xref="GeneID:11502267"
     mRNA            complement(<481927..>484860)
                     /gene="TDEL0D02480"
                     /locus_tag="TDEL_0D02480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680995.1"
                     /db_xref="GeneID:11502267"
     CDS             complement(481927..484860)
                     /gene="TDEL0D02480"
                     /locus_tag="TDEL_0D02480"
                     /inference="similar to DNA sequence:INSDC:YDR379W,YOR127W"
                     /note="similar to Saccharomyces cerevisiae RGA2 (YDR379W)
                     and RGA1 (YOR127W); ancestral locus Anc_5.453"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681043.1"
                     /db_xref="GeneID:11502267"
                     /db_xref="GOA:G8ZT88"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:G8ZT88"
                     /translation="METENGGTDLSVSYPSCVRCKDFITSGHAYELGDDRWHTHCFSC
                     YRCEKPLSCDSDFLVLGTGTLICFDCSDSCKNCGTKIDDLAIILSSSNEAYCSECFKC
                     CKCGDTIKDLRYAKTKRGLFCIHCHERLLAKRKQYEDRKRRLKKDLPEVPTVELPMPL
                     VIPEKSSKRPQSPVRGSERSLTPPPLSKSLIKSNSGSVISQYLAEDDDVKVGSGSIPA
                     KKDDEDTPKHSRNVSIDDMLNSTLENDREELKVSQEPKVLLNKTPLRNHRATNSLSKS
                     PLSHRQGMILEPEQSNQEKPLEQEEEQGLALNLPSQFSPINNDEDTLTLGFEDRPPTD
                     YAVTSPPRSPSPSKTNTIVTSPNRQEIVSNANESGKNRKIGRSLSLKSRNLVHNLKSK
                     TTGILDPRSSSPSTSRSKTISSPGRNDLDTHSGWGVPSSEESNTQPTPVTSSRHKMTP
                     RGKSDSTLHADHRNFTNPGRNYSVENVDHRRTHSNASNTSASNVSMFRTPPLDNPSIF
                     GRLSNSGSASHYKTSSWQANNEPVMEDPAESDAQKTVDDDITKAEDENESFLKKELGE
                     TELLLRKLKLEVRELESKRLHLTSEVDGLQSTKDVLVHEIERLRAEKGKFSSLESLAP
                     VPQNGDFQKPQDFNVDGIQSSKQAETASVARPGTKPRFWKIFSGARQPPQSQQQQHGQ
                     QLSLQNLAAPSGTTANTSISSSSSMYNGNNSTSGKLEISGPVLQNPNEFSDVKLLPIN
                     MNSQSELSMQGSPSRVDGNILYGSSLVARCSYEQSTIPLIVKSCKEHIESKEEFLRTE
                     GIYRKSGSQLLIEEIEKAFIACDTEQTTELLSLLDEDVHAVASVLKRYLRKLPNPVIT
                     FQVYEPLMNTVRENQMMTNLPFKAGGNHLKNNPQYVTALNTIVKILQNLPQEHRDLLL
                     FLAKHIHTVMSYSEANLMTLHNLSLVFAPGLIRDYTGEKDIADMKERNYIVGFIFGNF
                     EDIFS"
     gene            <485240..>485488
                     /gene="TDEL0D02490"
                     /locus_tag="TDEL_0D02490"
                     /db_xref="GeneID:11502268"
     mRNA            <485240..>485488
                     /gene="TDEL0D02490"
                     /locus_tag="TDEL_0D02490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680996.1"
                     /db_xref="GeneID:11502268"
     CDS             485240..485488
                     /gene="TDEL0D02490"
                     /locus_tag="TDEL_0D02490"
                     /inference="similar to DNA sequence:INSDC:YDR378C"
                     /note="similar to Saccharomyces cerevisiae LSM6 (YDR378C);
                     ancestral locus Anc_5.452"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681044.1"
                     /db_xref="GeneID:11502268"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:G8ZT89"
                     /translation="MSAKGTSSVSSQFLSEIIGKPVNVKLHSGMLYSGRLESIDGFMN
                     VALSKVTEHYENGHNGLLRNYNTDVFLRGTQVMYISEV"
     gene            complement(<485553..>485858)
                     /gene="TDEL0D02500"
                     /locus_tag="TDEL_0D02500"
                     /db_xref="GeneID:11502269"
     mRNA            complement(<485553..>485858)
                     /gene="TDEL0D02500"
                     /locus_tag="TDEL_0D02500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680997.1"
                     /db_xref="GeneID:11502269"
     CDS             complement(485553..485858)
                     /gene="TDEL0D02500"
                     /locus_tag="TDEL_0D02500"
                     /inference="similar to DNA sequence:INSDC:YDR377W"
                     /note="similar to Saccharomyces cerevisiae ATP17
                     (YDR377W); ancestral locus Anc_5.451"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681045.1"
                     /db_xref="GeneID:11502269"
                     /db_xref="InterPro:IPR019727"
                     /db_xref="UniProtKB/TrEMBL:G8ZT90"
                     /translation="MIAKRALSTLIPPKIVSAANIGSAPNARRIGNVVQFYKSLPQGE
                     AAAVKPSGVIGRYKAKYFDGDNASGKPLWHLALGILVMGYSMEYFFHLRHHKNGAEH"
     gene            complement(<486085..>487560)
                     /gene="TDEL0D02510"
                     /locus_tag="TDEL_0D02510"
                     /db_xref="GeneID:11502270"
     mRNA            complement(<486085..>487560)
                     /gene="TDEL0D02510"
                     /locus_tag="TDEL_0D02510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680998.1"
                     /db_xref="GeneID:11502270"
     CDS             complement(486085..487560)
                     /gene="TDEL0D02510"
                     /locus_tag="TDEL_0D02510"
                     /inference="similar to DNA sequence:INSDC:YDR376W"
                     /note="similar to Saccharomyces cerevisiae ARH1 (YDR376W);
                     ancestral locus Anc_5.450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681046.1"
                     /db_xref="GeneID:11502270"
                     /db_xref="GOA:G8ZT91"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR021163"
                     /db_xref="UniProtKB/TrEMBL:G8ZT91"
                     /translation="MVSGIAKLRFIRYASTYCGRKRISIVGSGPSGFYTAYRLLTKSE
                     VPLHITMWEKLPVPFGLSRYGVAPDHPEVKNCEDTFTKCAKEFSRPGQKHLFEFIGGV
                     TVGEEVKLTELLKKQDAVVLSYGCTGDKKLGIPGENSTKGVFSSREFVNWYNGHPDFA
                     TSPKFIDFDWSKVRNVGIIGNGNVALDLTRVLISNKISELWSGTDISPIAMKCLQRAP
                     IQNVKLIARRDFSHSKFTNKELREMWELEKYGIRGRIDPTYFREDMFNLNTIKDRAFK
                     RRVEMCSEYLKPYEQRTKRNYQKFLPPGANGQTWELDYLKTPIAINSDSSGNLSSLTV
                     CKNEITADNRVVSLKDQELTYELDLLITSLGYAGQPLPEFASLHIQFDKSHLAATAGR
                     VLTTQGSTYPGLYASGWIKTGSTGVIASTMMGAFEVADVLLQDLPKLPSRPTGPVDLT
                     HIAHTNWHHWEILNKRELQKGEEQNKTRSKFLTYQELQCSN"
     gene            <487817..>488530
                     /gene="TDEL0D02520"
                     /locus_tag="TDEL_0D02520"
                     /db_xref="GeneID:11502271"
     mRNA            <487817..>488530
                     /gene="TDEL0D02520"
                     /locus_tag="TDEL_0D02520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003680999.1"
                     /db_xref="GeneID:11502271"
     CDS             487817..488530
                     /gene="TDEL0D02520"
                     /locus_tag="TDEL_0D02520"
                     /inference="similar to DNA sequence:INSDC:YOR126C"
                     /note="similar to Saccharomyces cerevisiae IAH1 (YOR126C);
                     ancestral locus Anc_5.449"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681047.1"
                     /db_xref="GeneID:11502271"
                     /db_xref="GOA:G8ZT92"
                     /db_xref="InterPro:IPR013831"
                     /db_xref="UniProtKB/TrEMBL:G8ZT92"
                     /translation="MDYKKFLLFGDSITEFAFNSRAQEGESDQFALGAALCNDYTRKL
                     DIVQRGFSGYNSRWGLKILPRVLENEQNIVLSTIFFGSNDACLGGHQRVPMEEYASNT
                     RKMISMLREKNIKPILVGPGLIDQERFEAARKEEVERGYIRTNENFEAYSNKLQQIAT
                     EDKVPFVDLNTAFRREGGENWRDLFRDGLHFSGKGYEIFYNELLKSIRKYYPELAPEC
                     IPTRLPVWREVAEDGSNVL"
     gene            <488653..>490011
                     /gene="TDEL0D02530"
                     /locus_tag="TDEL_0D02530"
                     /db_xref="GeneID:11502272"
     mRNA            <488653..>490011
                     /gene="TDEL0D02530"
                     /locus_tag="TDEL_0D02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681000.1"
                     /db_xref="GeneID:11502272"
     CDS             488653..490011
                     /gene="TDEL0D02530"
                     /locus_tag="TDEL_0D02530"
                     /inference="similar to DNA sequence:INSDC:YDR375C"
                     /note="similar to Saccharomyces cerevisiae BCS1 (YDR375C);
                     ancestral locus Anc_5.448"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681048.1"
                     /db_xref="GeneID:11502272"
                     /db_xref="GOA:G8ZT93"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR014851"
                     /db_xref="InterPro:IPR027243"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZT93"
                     /translation="MVGSDSEPSTISLTESTPDAQLPVVAPDTLKGKFSSMIANAMEN
                     NPYFAAGGGLMVLGTGLAVARSGIIKASNLLYRQMIVDLEIQSKDKSYAWFLQWMSKH
                     PQRISKHLSVRTNYVQHDNGSVTTKFALVPGPGNHWIRYKGAFIRITRERSAKMIDLT
                     NGSPFEIVTLTTLYRDRYLFNEILNEAKDIALKSTEGKTVIYTSFGPEWRKFGQPKAK
                     RMLPSVILDQGIKEEILEDVHEFMRNGKWYSDRGIPYRRGYLLYGPPGSGKTSFIQAL
                     AGELDYNICILNLSEGNLTDDRLNHLMNNMPERSILLLEDIDAAFNQRLQSGETGFKS
                     SVTFSGLLNALDGVTSSEETITFMTTNHPEKLDPAIMRPGRIDYKVFVGNATSYQVEK
                     MFMKFYPGEETLCKLFVEAMNKLNITVSTAQLQGLFVMNKDKPQSALDMIETLRHSNH
                     VL"
     gene            complement(<490038..>490262)
                     /gene="TDEL0D02540"
                     /locus_tag="TDEL_0D02540"
                     /db_xref="GeneID:11502273"
     mRNA            complement(<490038..>490262)
                     /gene="TDEL0D02540"
                     /locus_tag="TDEL_0D02540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681001.1"
                     /db_xref="GeneID:11502273"
     CDS             complement(490038..490262)
                     /gene="TDEL0D02540"
                     /locus_tag="TDEL_0D02540"
                     /inference="similar to DNA sequence:INSDC:YDR374W-A"
                     /note="similar to Saccharomyces cerevisiae YDR374W-A;
                     ancestral locus Anc_5.447"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681049.1"
                     /db_xref="GeneID:11502273"
                     /db_xref="UniProtKB/TrEMBL:G8ZT94"
                     /translation="MGRHYVEEHVVNELRKCCAKEEEPNKAEGLLLSCLYQELLRKVL
                     KVAQLQAQLEGSREIQPYNVESAVETVMEG"
     gene            <490475..>491305
                     /gene="TDEL0D02550"
                     /locus_tag="TDEL_0D02550"
                     /db_xref="GeneID:11502274"
     mRNA            <490475..>491305
                     /gene="TDEL0D02550"
                     /locus_tag="TDEL_0D02550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681002.1"
                     /db_xref="GeneID:11502274"
     CDS             490475..491305
                     /gene="TDEL0D02550"
                     /locus_tag="TDEL_0D02550"
                     /inference="similar to DNA sequence:INSDC:YDR374C"
                     /note="similar to Saccharomyces cerevisiae YDR374C;
                     ancestral locus Anc_5.446"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681050.1"
                     /db_xref="GeneID:11502274"
                     /db_xref="InterPro:IPR007275"
                     /db_xref="UniProtKB/TrEMBL:G8ZT95"
                     /translation="MMEEAWERNVASGFVPVRTISDSLKELEGFITSIHSAAEGNAGL
                     PQRSPDEYSGGDNNYTTQVAPLRQADYQYFDEMSEYQHVSPNAINTYTGRVSMALKQK
                     GRKPLAKKTSAIIPPWIDVPEHSRFFVIKSSSLENVKKSFYNGIWSSTYFGNKRLSEA
                     YFNLPKGSKIFLFFSVNASGRFCGVAEMISGLESGLDTSIWGNNEKYDTAFKVRWIVV
                     RDVQNRLLKQFLIPSNDMKPVTNSRDTQEIPPAICKSILKLFKYDQTNVQSFLDHGYT
                     "
     gene            <491452..>492144
                     /gene="TDEL0D02560"
                     /locus_tag="TDEL_0D02560"
                     /db_xref="GeneID:11502275"
     mRNA            <491452..>492144
                     /gene="TDEL0D02560"
                     /locus_tag="TDEL_0D02560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681003.1"
                     /db_xref="GeneID:11502275"
     CDS             491452..492144
                     /gene="TDEL0D02560"
                     /locus_tag="TDEL_0D02560"
                     /inference="similar to DNA sequence:INSDC:YOR125C"
                     /note="similar to Saccharomyces cerevisiae CAT5 (YOR125C);
                     ancestral locus Anc_5.445"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681051.1"
                     /db_xref="GeneID:11502275"
                     /db_xref="GOA:G8ZT96"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR011566"
                     /db_xref="UniProtKB/TrEMBL:G8ZT96"
                     /translation="MLKNIIARTPIRRSFSALSSLKQIPSDGDKGSTQNLKYEPLSEA
                     QEAYLDRVVRVDQAGELGADYIYAGQYFVLANKYPHLKPVLQHMWDQEIHHHNTFNTL
                     QLKNRVRPSLITPLWKLGAFAMGAGTAIISPQAAMACTEAVETVIGGHYNEQLRCLTN
                     QYELEKPDSSFGIPAEIKDLTSTIRQFRDDELEHLNTAIEYDSKKAVPYMLLTEGIKG
                     ICKVAIWTAERV"
     gene            complement(<492200..>492772)
                     /gene="TDEL0D02570"
                     /locus_tag="TDEL_0D02570"
                     /db_xref="GeneID:11502276"
     mRNA            complement(<492200..>492772)
                     /gene="TDEL0D02570"
                     /locus_tag="TDEL_0D02570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681004.1"
                     /db_xref="GeneID:11502276"
     CDS             complement(492200..492772)
                     /gene="TDEL0D02570"
                     /locus_tag="TDEL_0D02570"
                     /inference="similar to DNA sequence:INSDC:YDR373W"
                     /note="similar to Saccharomyces cerevisiae FRQ1 (YDR373W);
                     ancestral locus Anc_5.444"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681052.1"
                     /db_xref="GeneID:11502276"
                     /db_xref="GOA:G8ZT97"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR028846"
                     /db_xref="UniProtKB/TrEMBL:G8ZT97"
                     /translation="MGAKASKLSKDDLTSLRQSTYFDRREIQQWHKGFLRDCPSGQLT
                     REDFVKIYKQFFPFGSPEEFANHVFSVFDKDNNGFVDFKEFITVLSTTSRGTLEEKLV
                     WTFQLYDLNHDGYITFDEMLTIVTSIYKMMGSMVKLSDDEATPELRVKKIFHTMDKNE
                     DGYITLEEFREGSKVDPSIINSLNLYDGLV"
     gene            <493355..>497173
                     /gene="TDEL0D02580"
                     /locus_tag="TDEL_0D02580"
                     /db_xref="GeneID:11502277"
     mRNA            <493355..>497173
                     /gene="TDEL0D02580"
                     /locus_tag="TDEL_0D02580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681005.1"
                     /db_xref="GeneID:11502277"
     CDS             493355..497173
                     /gene="TDEL0D02580"
                     /locus_tag="TDEL_0D02580"
                     /inference="similar to DNA sequence:INSDC:YOR124C"
                     /note="similar to Saccharomyces cerevisiae UBP2 (YOR124C);
                     ancestral locus Anc_5.443"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681053.1"
                     /db_xref="GeneID:11502277"
                     /db_xref="GOA:G8ZT98"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR025305"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G8ZT98"
                     /translation="MLQEDEKSGNVVQEIVSEDSLEAEKRLETPDLMDLGRETDHMVG
                     NTKQADHLDTLTHRDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYS
                     DLHNGILKAPVLAYSRRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGV
                     LIDVPHDYKITSSTLSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDR
                     QDLEFDPTDPRLVDHAIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEAC
                     QRFDTLDPSEIPTQADCINTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLT
                     SKYGFELHVEKDESTGESYFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAI
                     ELLGKDAKTTSKVYRTFNAIQIAFSKTTWFKMLGEHRSIFSFESASPLDANYNFINLS
                     ACFYYIDRDIIKNYEAQCALDPENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEA
                     LDQALKLFGIDSKDVDVATIDDSLLVSIYKSETMANPNENRHTDLKNALRLLAKYKKS
                     DKLKFFADYEPYKNVSRAYEILEVDESVDDDIIETAYSISINDSPGLKIDCDRALYTI
                     GVRKRSLRLLNYLLQQCPDFQLYYGPGTLLYSEALSMLQLNENAGDETVLEVFQRKWH
                     QETAFESDYLLKLKAALTKIGIERNSKLILHFIDTGTIDASCLPADNWPTGLNNIGNT
                     CYLNSLLQYYFSLAPLRRYVLEYQETMEHFRHHTGNELRRIGGREVSEAEVERSVQFV
                     YQLRDLFQAMIYSKERCVTPRKELAYLAFAPSNFEVEFEPTTVNAQHEVSKIAESTNN
                     DILMYGPTNRSDNDQTGPIELDSDSGNEDIDVSMTKEPSEEYKEDIPMSDAEKDNIIS
                     TSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPINLDEDNEQNDLVKQL
                     FYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDERLTMAEYG
                     DVKRTVAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFNEVLYMDRYSDSQDPKMV
                     EKKKESEQLKAQLSRLKIRQKELLSVNELGLSRKAAYMETINYLKSDLIKSQELKGLN
                     NDFLIEQLKQSIADIDQELTSLYHDIAKLENTIDKQFEEFKKIGYSLFAVFIHRGEAS
                     YGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPYFLVYVRQGHEHDI
                     EPLKRIIDRD"
     gene            <497351..>498343
                     /gene="TDEL0D02590"
                     /locus_tag="TDEL_0D02590"
                     /db_xref="GeneID:11502278"
     mRNA            <497351..>498343
                     /gene="TDEL0D02590"
                     /locus_tag="TDEL_0D02590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681006.1"
                     /db_xref="GeneID:11502278"
     CDS             497351..498343
                     /gene="TDEL0D02590"
                     /locus_tag="TDEL_0D02590"
                     /inference="similar to DNA sequence:INSDC:YDR372C"
                     /note="similar to Saccharomyces cerevisiae VPS74
                     (YDR372C); ancestral locus Anc_5.442"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681054.1"
                     /db_xref="GeneID:11502278"
                     /db_xref="InterPro:IPR008628"
                     /db_xref="UniProtKB/TrEMBL:G8ZT99"
                     /translation="MSNLQRRRVNRVDSGDESSLQASEFNETTTSKRVAYDPEEAKIT
                     ENVKNPKLTLMEEVLLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSA
                     RKRFDVSERLIEVVDASKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINY
                     QLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNM
                     ELSYNEYFPDTTSFKLIRTIALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQY
                     TQYPFDLDKATESGLSINLNKEVKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL"
     gene            complement(<498470..>500041)
                     /gene="TDEL0D02600"
                     /locus_tag="TDEL_0D02600"
                     /db_xref="GeneID:11502279"
     mRNA            complement(<498470..>500041)
                     /gene="TDEL0D02600"
                     /locus_tag="TDEL_0D02600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681007.1"
                     /db_xref="GeneID:11502279"
     CDS             complement(498470..500041)
                     /gene="TDEL0D02600"
                     /locus_tag="TDEL_0D02600"
                     /inference="similar to DNA sequence:INSDC:YDR371W"
                     /note="similar to Saccharomyces cerevisiae CTS2 (YDR371W);
                     ancestral locus Anc_5.441"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681055.1"
                     /db_xref="GeneID:11502279"
                     /db_xref="GOA:G8ZTA0"
                     /db_xref="InterPro:IPR001223"
                     /db_xref="InterPro:IPR001579"
                     /db_xref="InterPro:IPR011583"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR029070"
                     /db_xref="UniProtKB/TrEMBL:G8ZTA0"
                     /translation="MQRRPWLSHTVIIIVILASIAVEMCFYKKIFHRSAQRKVVDYVQ
                     SQPQQAQLVTNPGTVEPGQYLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVD
                     GATGALKLGDEWSDVGMDLYKPMAIKLNKLNPEVKNDLERQRRILPNGCLGELFYMRN
                     ANLFPNRNIRDFKVIMCVGGWSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDL
                     DWEFPEDDGFEPQMYLQLAKRLKERMNELEDAIFGPNMNHPKFQLSMATPAFSEKLDI
                     LPITEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLYNGSTKSFDETHQKHIYSTESVEG
                     LDAHSAIEHMLNVAGVNSHKICLGMAAYGRGFTNVVAQSTDKRFIDKPFHGVGGASDG
                     EPGMWLYNQLPIQGTHELFDPDYVSGFCYSSTSKTFVGYDSVESVRFKAQYVREKNLA
                     GGFWWESCGDDHANQSRSLLNAFTNEIKFVSKFDDLMYRQTPVLRYYVNKFGNDAFLS
                     PFILNLLAGQGEAPH"
     gene            <500294..>501616
                     /gene="TDEL0D02610"
                     /locus_tag="TDEL_0D02610"
                     /db_xref="GeneID:11502280"
     mRNA            <500294..>501616
                     /gene="TDEL0D02610"
                     /locus_tag="TDEL_0D02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681008.1"
                     /db_xref="GeneID:11502280"
     CDS             500294..501616
                     /gene="TDEL0D02610"
                     /locus_tag="TDEL_0D02610"
                     /inference="similar to DNA sequence:INSDC:YOR123C"
                     /note="similar to Saccharomyces cerevisiae LEO1 (YOR123C);
                     ancestral locus Anc_5.440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681056.1"
                     /db_xref="GeneID:11502280"
                     /db_xref="InterPro:IPR007149"
                     /db_xref="UniProtKB/TrEMBL:G8ZTA1"
                     /translation="MSEEVEDRVESGQNSTVEPVEEPINGNAGEIEDSGGDDEMDDLF
                     GDEGQASDRGSDEEEGGSSNSDEEESSRRGEMQMDDEEAQEHAMYTRKFYGEDADNMS
                     DQEESANHFTEENVELVRHIVPYKTVGEGADEKSTIYYAKVPEFLTIDPVPFDPPSFE
                     SKVKERLNSSSREDQLGDRLIDENTIRWRYSRDENQQVYKESNAQIVQWSDGGLSLKL
                     GTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKSLMFIPTSTNSKMHQKLTKAV
                     IRRDQRQTKGPGVYFVNKDPELEKNELEKKQQQVVRERRKRQLKEIESRNSPDISTGL
                     NGYRKTPVTASDEQDSYYGSSKRNEYEQDDFLVDDDEEEEAGYSEEDDVLDDNNDDQE
                     AEDEEDAKAERLRQLKRQGTERYTEPEPESDPSTKRRKVAIIDDEDDE"
     gene            <501856..>502304
                     /gene="TDEL0D02620"
                     /locus_tag="TDEL_0D02620"
                     /db_xref="GeneID:11502281"
     mRNA            join(<501856..501868,501937..>502304)
                     /gene="TDEL0D02620"
                     /locus_tag="TDEL_0D02620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681009.1"
                     /db_xref="GeneID:11502281"
     CDS             join(501856..501868,501937..502304)
                     /gene="TDEL0D02620"
                     /locus_tag="TDEL_0D02620"
                     /inference="similar to DNA sequence:INSDC:YOR122C"
                     /note="similar to Saccharomyces cerevisiae PFY1 (YOR122C);
                     ancestral locus Anc_5.439"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681057.1"
                     /db_xref="GeneID:11502281"
                     /db_xref="GOA:G8ZTA2"
                     /db_xref="InterPro:IPR005455"
                     /db_xref="InterPro:IPR027310"
                     /db_xref="UniProtKB/TrEMBL:G8ZTA2"
                     /translation="MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQ
                     EIAQGFDSPVGLQSNGLHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYP
                     PTVQAGEATKIVEQLADYLISVQY"
     gene            complement(<502356..>502664)
                     /gene="TDEL0D02630"
                     /locus_tag="TDEL_0D02630"
                     /db_xref="GeneID:11502282"
     mRNA            complement(<502356..>502664)
                     /gene="TDEL0D02630"
                     /locus_tag="TDEL_0D02630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681010.1"
                     /db_xref="GeneID:11502282"
     CDS             complement(502356..502664)
                     /gene="TDEL0D02630"
                     /locus_tag="TDEL_0D02630"
                     /note="ancestral locus Anc_5.438"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681058.1"
                     /db_xref="GeneID:11502282"
                     /db_xref="InterPro:IPR005545"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="UniProtKB/TrEMBL:G8ZTA3"
                     /translation="MVEWVVIVYDKGDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEP
                     TTPGGERTFAGSHLQIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEKK
                     "
     gene            complement(<502950..>505358)
                     /gene="TDEL0D02640"
                     /locus_tag="TDEL_0D02640"
                     /db_xref="GeneID:11502283"
     mRNA            complement(<502950..>505358)
                     /gene="TDEL0D02640"
                     /locus_tag="TDEL_0D02640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681011.1"
                     /db_xref="GeneID:11502283"
     CDS             complement(502950..505358)
                     /gene="TDEL0D02640"
                     /locus_tag="TDEL_0D02640"
                     /inference="similar to DNA sequence:INSDC:YLR352W"
                     /note="similar to Saccharomyces cerevisiae YLR352W;
                     ancestral locus Anc_4.185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681059.1"
                     /db_xref="GeneID:11502283"
                     /db_xref="UniProtKB/TrEMBL:G8ZTA4"
                     /translation="MPTPVTDDSTPRVIPPEIAYQILTFQFRDLMSNDHPGNAEKFTE
                     NFRTFVRSNLSVNKTFYHVCRVLIYRYCKLTTAKRFHSLLETLRNNEKVCNIVQVADF
                     QELTSIGLGRTGEMNKRIKNLTNETLSEFLELTQSNLREFLACEHIQDDLDENIVYNL
                     LRPGTVLSVLDFCGCSGDKFTESCIKALDRLYRFDEEKQQYITKEENYQITCLGLNDC
                     TDLPSPVLGRILLMLPELQKLDLGHTSIDDHTLMNGLPHLKSLTHLSLSMCLRLSPRG
                     VLEFFSHHPAVTDSNNSKTLEWLNLYSMPHSSSWTAVHAMFLLRKLCQFGHNKTLQYL
                     NLGGMPFHESDDRSAVRSGPYYQCHDTLQFIKYNFPKLKSLSIRGSNFPITRICDFLT
                     PVNEQNFEVKSGYELGKDELPEIQKLKFLNISNNFHVNKWTIQDPALFTCSPSLVALE
                     VSFDSWQQIEKANEKHEINALRYKNPHVLIKDPNDAEIVKWKCYIDSSYGRRYWLHKV
                     DKYLNRDDLETRGNISKYDCEGRKIIEITKQPDFLKFAQSKIMLGCGIVPLSGVRRKE
                     SYRDLKPPISQFFTRSGGTTLGHTATPIVTPRLPPGGWRLIHHDEEDSSLDNIIPEED
                     EEAGVMTDSFTSNVSANYSPAQFSNRMSRDGLYWDRSIPALNLRPAEEMTYIAPASRQ
                     SQQQIHQPPESIGEQVEENDDEYFNDVTLQRRRSQLSILGLSHPRNSVLPRQNSWNSS
                     ISLLFPFRKPKNYFMLNPKEFVFDVNSEETTERYRIHFELVNEYEVFGCIERGMYRYY
                     SLKT"
     gene            complement(<505536..>506636)
                     /gene="TDEL0D02650"
                     /locus_tag="TDEL_0D02650"
                     /db_xref="GeneID:11502284"
     mRNA            complement(<505536..>506636)
                     /gene="TDEL0D02650"
                     /locus_tag="TDEL_0D02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681012.1"
                     /db_xref="GeneID:11502284"
     CDS             complement(505536..506636)
                     /gene="TDEL0D02650"
                     /locus_tag="TDEL_0D02650"
                     /inference="similar to DNA sequence:INSDC:YGR040W"
                     /note="similar to Saccharomyces cerevisiae KSS1 (YGR040W);
                     ancestral locus Anc_4.184"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681060.1"
                     /db_xref="GeneID:11502284"
                     /db_xref="GOA:G8ZTA5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZTA5"
                     /translation="MPRTITFDIPSQYQLLALVGEGAYGTVCSAIHKPTGIHVAIKKI
                     QPFSKTMFVTRTLREIKLLRYFHDHENIISILDMIRPTTIDKMNAVYLVQELMETDLQ
                     RIINSHAANPLSDDHIQYFTYQILRALKSIHSAQVIHRDLKPSNLLLNSNCDLKVCDF
                     GLSRCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFREYTTAMDIWSCGCILAELV
                     SGKPLFPGRDYHHQLWLILEVTGSPSYEDVECIKSARAKSYIANLPMKPKMPWEIALG
                     KQNLNPQMLDLLDRMLTFNPNKRISAADALTHPYLSTYHDPEDEPEYPPLNLEDEFWR
                     IDNEIKKPNDDSEISMETLKQMLYDEIMKPLD"
     gene            <507166..>508284
                     /gene="TDEL0D02660"
                     /locus_tag="TDEL_0D02660"
                     /db_xref="GeneID:11502285"
     mRNA            <507166..>508284
                     /gene="TDEL0D02660"
                     /locus_tag="TDEL_0D02660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681013.1"
                     /db_xref="GeneID:11502285"
     CDS             507166..508284
                     /gene="TDEL0D02660"
                     /locus_tag="TDEL_0D02660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681061.1"
                     /db_xref="GeneID:11502285"
                     /db_xref="GOA:G8ZTA6"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR023209"
                     /db_xref="UniProtKB/TrEMBL:G8ZTA6"
                     /translation="MGKSYPEVTIVGAGIIGLYTAYVLTELEKIPGSQICVVAKYLPG
                     DQSAGGYTSPWAGGNWSCISPNDDATLFYDRFTYEHLAHLQKDLLDYFGEKDSEWLGL
                     GRRPSREFWDWIPDKRKIDSLRMYLEEFNILSKEELQQIQPTAPKFGISFKTWNFNCP
                     VFLQNFCGFLKGKHHIKFVKQELTHLSQATSYVNTEAIGGDKHLIFNCTGLGAHDLGA
                     VMDHKVYPTRGQVVVIKAPHINENCLRWGKDYATYIIPRPGKNKELVLGGFLQVDNYN
                     AQDTSQSETDDILRRTLTLLPKIGKNAEDLEIMRVAAGLRPSRYGGPRIEKETKSDDS
                     SLIVIHNYGASGYGYQGGMGMSYRAVMLGLSNEKKSKL"
     gene            <508421..>509281
                     /gene="TDEL0D02670"
                     /locus_tag="TDEL_0D02670"
                     /db_xref="GeneID:11502286"
     mRNA            <508421..>509281
                     /gene="TDEL0D02670"
                     /locus_tag="TDEL_0D02670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681014.1"
                     /db_xref="GeneID:11502286"
     CDS             508421..509281
                     /gene="TDEL0D02670"
                     /locus_tag="TDEL_0D02670"
                     /inference="similar to DNA sequence:INSDC:YLR351C"
                     /note="similar to Saccharomyces cerevisiae NIT3 (YLR351C);
                     ancestral locus Anc_4.183"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681062.1"
                     /db_xref="GeneID:11502286"
                     /db_xref="GOA:G8ZTA7"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="UniProtKB/TrEMBL:G8ZTA7"
                     /translation="MSKILSQKIKVALIQLAGSTADKNANLQRATHLIEKAVKDQPET
                     KLVVLPECFNSPYATDKFREYAEVIGPDSQSYKVLSAVAQKLKIILVGGSIPELEPKT
                     NKIYNTSMVFNENGELIGTHKKAHLFDIDIPNGITFKESDSLTGGDKATTLDTTYGKI
                     GLGICYDTRFPELAMISARKGAFAMIYPGAFNTVTGPMHWKLLARSRAIDNQIYTLFC
                     SPARNLESTYHAYGHSLVVNPRGDVIAEAGEGEEIIYADLDPADIQVFRQGVPITTQR
                     RFDIYKDVSK"
     gene            509381..509462
                     /gene="TDEL0Dtrna2S"
                     /locus_tag="TDEL_0Dtrna2S"
                     /db_xref="GeneID:11502287"
     tRNA            509381..509462
                     /gene="TDEL0Dtrna2S"
                     /locus_tag="TDEL_0Dtrna2S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCU"
                     /db_xref="GeneID:11502287"
     gene            complement(<509579..>510226)
                     /gene="TDEL0D02680"
                     /locus_tag="TDEL_0D02680"
                     /db_xref="GeneID:11503644"
     mRNA            complement(<509579..>510226)
                     /gene="TDEL0D02680"
                     /locus_tag="TDEL_0D02680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681015.1"
                     /db_xref="GeneID:11503644"
     CDS             complement(509579..510226)
                     /gene="TDEL0D02680"
                     /locus_tag="TDEL_0D02680"
                     /inference="similar to DNA sequence:INSDC:YGR038W,YLR350W"
                     /note="similar to Saccharomyces cerevisiae ORM1 (YGR038W)
                     and ORM2 (YLR350W); ancestral locus Anc_4.182"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681063.1"
                     /db_xref="GeneID:11503644"
                     /db_xref="GOA:G8ZTA8"
                     /db_xref="InterPro:IPR007203"
                     /db_xref="UniProtKB/TrEMBL:G8ZTA8"
                     /translation="MGIIGEPLSSQTSRDQSLKPFPSNGQNNKLSLSEPHKDHRRRRS
                     SSIISHVEPETFEDENDQQLLPNMNATWVDQRGAWIIHIVVIAILKIFYDLIPGVSTE
                     WSWTLTNMSYVIGSYVMFHLIKGTPFDFNGGAYDNLTMWEQINDETLYTPARKFLIMV
                     PIVLFLVSTHYSHYDLKLFSWNFSLTFLLAVVPKLPVTHRLRISIPGITGRAQIS"
     gene            <510572..>510832
                     /gene="TDEL0D02690"
                     /locus_tag="TDEL_0D02690"
                     /db_xref="GeneID:11502288"
     mRNA            <510572..>510832
                     /gene="TDEL0D02690"
                     /locus_tag="TDEL_0D02690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681016.1"
                     /db_xref="GeneID:11502288"
     CDS             510572..510832
                     /gene="TDEL0D02690"
                     /locus_tag="TDEL_0D02690"
                     /inference="similar to DNA sequence:INSDC:YGR037C"
                     /note="similar to Saccharomyces cerevisiae ACB1 (YGR037C);
                     ancestral locus Anc_4.181"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681064.1"
                     /db_xref="GeneID:11502288"
                     /db_xref="GOA:G8ZTA9"
                     /db_xref="InterPro:IPR000582"
                     /db_xref="InterPro:IPR014352"
                     /db_xref="UniProtKB/TrEMBL:G8ZTA9"
                     /translation="MVSQLFEEKAKAVNELPSTPDTDELLKLYALYKQATSGDNTKEK
                     PGIFNMKDRYKWDAWEEIKGTSQQDAENQYIEFVDSLIAKYK"
     gene            <511059..>513647
                     /gene="TDEL0D02700"
                     /locus_tag="TDEL_0D02700"
                     /db_xref="GeneID:11502289"
     mRNA            <511059..>513647
                     /gene="TDEL0D02700"
                     /locus_tag="TDEL_0D02700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681017.1"
                     /db_xref="GeneID:11502289"
     CDS             511059..513647
                     /gene="TDEL0D02700"
                     /locus_tag="TDEL_0D02700"
                     /inference="similar to DNA sequence:INSDC:YLR347C"
                     /note="similar to Saccharomyces cerevisiae KAP95
                     (YLR347C); ancestral locus Anc_4.180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681065.1"
                     /db_xref="GeneID:11502289"
                     /db_xref="GOA:G8ZTB0"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR027140"
                     /db_xref="UniProtKB/TrEMBL:G8ZTB0"
                     /translation="MSAAEVAHLLENTILSVDQGLRVASETQLKKLSNENFLQFAGLL
                     SSVVVDSGAKLEARILAALSLKNELVSKDSVKSQQYAQRWVATIDPASKEQIKVNAIN
                     GLMESSEPRVANASAQLIAAIANIELPRGEWLDLMKTMVDNTSPSQPENVKRASLLAL
                     GYICESADPQSQVLVSSSNNILIAIVQGAQSSEPSTDVRLAALNALADSLVFIKNNME
                     REGERNYLMQVVCEATQAQDSDIQTAAFGCLCKIMSLYYPYMKPYMEQALYALTIATM
                     KSTDDKVSSMAVEFWSTICEEEIDIAYELTQFPQSPLQSYNFALASLKEVVPELLNLL
                     TRQNEDLEDDDWNVSMSAGACLQLFAQNCGNHILEPVLQFVEQNITSENWRNREASVM
                     AFGSIMDGPDRTQRTYYIHQALPAILNLMNDSSVHVKETAAWCIGRVADLVVDSIDPQ
                     QHLPGVVQACLIGLQDHPKVATNCAWTIINLVEQLAEAKPSPIYTYYPPIVDVLIKAA
                     NRPDNEFNARASAFSALTTMVEYATDAVAEISASISTFVMDKLGQTMSIDETQLNMED
                     KQSLQELQANVLTVLAAVIRKSPTSVASVSDMLMDLFFKILDKKDSSYIEDDVFYAIS
                     ALASSLGKDFEKYLETFSPYLVKALNQVDSPVSITAVGFIADISNSLEEDFNKYATAF
                     MNVLGQMISTENSMRELKPAVLSVFGDIASNIGPNFTPYLNEVMALCVAAQNTKPENG
                     TLEALDYHIKVLESVLDAYVGAVAGLHANPEALFPYVGTIFQFISLISEDPQLYGEDS
                     TARSAVGLIGDISAMYPDGSIKQFYAQEWITELIKKTRSNMSFSQSTKDTARWAREQQ
                     KHQLAL"
     gene            <514008..>514706
                     /gene="TDEL0D02710"
                     /locus_tag="TDEL_0D02710"
                     /db_xref="GeneID:11502290"
     mRNA            <514008..>514706
                     /gene="TDEL0D02710"
                     /locus_tag="TDEL_0D02710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681018.1"
                     /db_xref="GeneID:11502290"
     CDS             514008..514706
                     /gene="TDEL0D02710"
                     /locus_tag="TDEL_0D02710"
                     /inference="similar to DNA sequence:INSDC:YGR036C"
                     /note="similar to Saccharomyces cerevisiae CAX4 (YGR036C);
                     ancestral locus Anc_4.179"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681066.1"
                     /db_xref="GeneID:11502290"
                     /db_xref="GOA:G8ZTB1"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:G8ZTB1"
                     /translation="MASSESSFNPNLIPFDDTYILYDSQDPLSFLSAYFSLIPIAVLI
                     FQLSWFITTREFEACIMAAGQVANEIFNNIVKAIVKQPRPMSFGESFQNATMRSGYGM
                     PSAHSQFMGFFCMYTSLRYCLRWKGLTRRKRLLGIMVVTTLATCVCFSRVYLQYHTPG
                     QVLVGFAVGLCTGSTYFLIVGLLRELKVIDWVLTWRIAQWLYVKDSCNLAPITIREEY
                     IQYQQRLEKKRRVY"
     gene            <515095..>515403
                     /gene="TDEL0D02720"
                     /locus_tag="TDEL_0D02720"
                     /db_xref="GeneID:11502291"
     mRNA            <515095..>515403
                     /gene="TDEL0D02720"
                     /locus_tag="TDEL_0D02720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681019.1"
                     /db_xref="GeneID:11502291"
     CDS             515095..515403
                     /gene="TDEL0D02720"
                     /locus_tag="TDEL_0D02720"
                     /inference="similar to DNA sequence:INSDC:YGR035C,YLR346C"
                     /note="similar to Saccharomyces cerevisiae YGR035C and
                     YLR346C; ancestral locus Anc_4.178"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681067.1"
                     /db_xref="GeneID:11502291"
                     /db_xref="UniProtKB/TrEMBL:G8ZTB2"
                     /translation="MSSTLQLGNGSSAMACTFSHTMASFVSNFMVTPVITVLYRGRGR
                     QVSTKPNVITRNDLLRTAEMNDIHASRRSSYSSDGSNARRESHRKHRRSKRPQATAQI
                     "
     gene            complement(<515473..>517104)
                     /gene="TDEL0D02730"
                     /locus_tag="TDEL_0D02730"
                     /db_xref="GeneID:11502292"
     mRNA            complement(<515473..>517104)
                     /gene="TDEL0D02730"
                     /locus_tag="TDEL_0D02730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681020.1"
                     /db_xref="GeneID:11502292"
     CDS             complement(515473..517104)
                     /gene="TDEL0D02730"
                     /locus_tag="TDEL_0D02730"
                     /inference="similar to DNA sequence:INSDC:YLR345W"
                     /note="similar to Saccharomyces cerevisiae YLR345W;
                     ancestral locus Anc_4.177"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681068.1"
                     /db_xref="GeneID:11502292"
                     /db_xref="GOA:G8ZTB3"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR016260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G8ZTB3"
                     /translation="MAAVLSDEEELINGLGSEMLMPPTGNHMARTGKRWSGSGSGRVN
                     DLKRPTSDGVHLSVEAEDYISPGQLYSTESGRLFHAGRILIVLVGLPATSKTLLSVAI
                     TRYTRWLGVRTKSFHVSEYRRKQGLEVPDDYFSALPATKEGMESRKKIFSTVFDEMLS
                     IFLETKGQLAVYDALNIRRDERKDLEAKFRALNIKVLFIESVMTDNDLVARNIGMAAQ
                     SADYKGLTKEKARSAFMRRLLVNKPLYEEISPEENLSYVKYINFGERLIVNNNRYGYL
                     INKIVFFLMNLRDKKGCVYFARCGTSDNDKYIDDEVLNSDGLRYSEILADLVLDRINS
                     RRLSRHGTPNSSANGSTPVPDEMGKKESSLIPTMATLHRTASRGNHKMRQVADWDGAD
                     EDSFVVWTAPRKRTYDTAKFFMDKGVVIRQRFQLQQLHPGLVADLTEEQIKEKYPEEY
                     GEYLKDKYHYRFPRAESYHDLAVRMEPLLLEMERMQGDILIIGHESTLKVLYGYLMAC
                     TCEELPSLSFPRDELIEISFSPFQNKAERIPIPQD"
     gene            complement(<517731..>518299)
                     /gene="TDEL0D02740"
                     /locus_tag="TDEL_0D02740"
                     /db_xref="GeneID:11502293"
     mRNA            complement(join(<517731..518095,518281..>518299))
                     /gene="TDEL0D02740"
                     /locus_tag="TDEL_0D02740"
                     /product="60S ribosomal protein L26"
                     /transcript_id="XM_003681021.1"
                     /db_xref="GeneID:11502293"
     CDS             complement(join(517731..518095,518281..518299))
                     /gene="TDEL0D02740"
                     /locus_tag="TDEL_0D02740"
                     /inference="similar to DNA sequence:INSDC:YGR034W,YLR344W"
                     /note="similar to Saccharomyces cerevisiae RPL26B
                     (YGR034W) and RPL26A (YLR344W); ancestral locus Anc_4.176"
                     /codon_start=1
                     /product="60S ribosomal protein L26"
                     /protein_id="XP_003681069.1"
                     /db_xref="GeneID:11502293"
                     /db_xref="GOA:G8ZTB4"
                     /db_xref="InterPro:IPR005756"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:G8ZTB4"
                     /translation="MAKQSLDVSSDRRKARKAYFTAPSSQRRFLLSAPLSKELRAQYG
                     VKSLPIRRDDEILVTRGSNKGQEGKISSVYRLKFAIQVDKVTKEKSNGASVQLNLHPS
                     KVVITKLHLDKDRKALIERKGGKLE"
     gene            complement(518847..518918)
                     /gene="TDEL0Dtrna3R"
                     /locus_tag="TDEL_0Dtrna3R"
                     /db_xref="GeneID:11502294"
     tRNA            complement(518847..518918)
                     /gene="TDEL0Dtrna3R"
                     /locus_tag="TDEL_0Dtrna3R"
                     /product="tRNA-Arg"
                     /note="codon recognized: CGG"
                     /db_xref="GeneID:11502294"
     gene            <521589..>522452
                     /gene="TDEL0D02750"
                     /locus_tag="TDEL_0D02750"
                     /db_xref="GeneID:11503649"
     mRNA            <521589..>522452
                     /gene="TDEL0D02750"
                     /locus_tag="TDEL_0D02750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681022.1"
                     /db_xref="GeneID:11503649"
     CDS             521589..522452
                     /gene="TDEL0D02750"
                     /locus_tag="TDEL_0D02750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681070.1"
                     /db_xref="GeneID:11503649"
                     /db_xref="UniProtKB/TrEMBL:G8ZTB5"
                     /translation="MNPITVLFHLALAYTSFTGIDLADASAVDVEVVTDQVSKVTIDL
                     NQLMDQAGTNSESSDASAKVLSYIVNSDSPVNSVVEAYDAAIDAGDISLATVYATKLM
                     GLIESVDDLISDIYAAPDYYSEIIPKQLITGAASQLAKRDQVDNDATRVLDALLNIMG
                     TNATAQSNQLDDGTTGLVRRDQCGNYNVDTSNVVALSVFNSMRGQIDGNMWYPNDPRN
                     FCRWYEDLRGCISWSTDVGGMPGNALQSWAADMSNCIPDAHPKSLKSLFAFGVSQGST
                     YVCGSGRPDGC"
     gene            <524246..>524950
                     /gene="TDEL0D02760"
                     /locus_tag="TDEL_0D02760"
                     /db_xref="GeneID:11502295"
     mRNA            <524246..>524950
                     /gene="TDEL0D02760"
                     /locus_tag="TDEL_0D02760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681023.1"
                     /db_xref="GeneID:11502295"
     CDS             524246..524950
                     /gene="TDEL0D02760"
                     /locus_tag="TDEL_0D02760"
                     /inference="similar to DNA sequence:INSDC:YGR033C"
                     /note="similar to Saccharomyces cerevisiae TIM21
                     (YGR033C); ancestral locus Anc_4.175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681071.1"
                     /db_xref="GeneID:11502295"
                     /db_xref="GOA:G8ZTB6"
                     /db_xref="InterPro:IPR013261"
                     /db_xref="UniProtKB/TrEMBL:G8ZTB6"
                     /translation="MKLGGMSTTARRPSQLGMASIGSSSRKPVCQLGLFKSYSTFNPQ
                     SAASPRDKPKNKVSLWTKLKSFTTFTASGTLVIGAAGLSAVVIYLILSELFSPSGDTQ
                     IFNRSVSMIEKDEVARSLLQCHDTADSKERLKAYGESFTSDKWTRNRPIVSTTKVDKT
                     GKAHHFMRFHVESKKKRGLVHIEAVDSDNSYQPAFTSVYLDVPGESRHYLIKPKVHKI
                     AKPSGFLGVNWGPKKA"
     gene            complement(<525103..>526752)
                     /gene="TDEL0D02770"
                     /locus_tag="TDEL_0D02770"
                     /db_xref="GeneID:11502296"
     mRNA            complement(<525103..>526752)
                     /gene="TDEL0D02770"
                     /locus_tag="TDEL_0D02770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681024.1"
                     /db_xref="GeneID:11502296"
     CDS             complement(525103..526752)
                     /gene="TDEL0D02770"
                     /locus_tag="TDEL_0D02770"
                     /inference="similar to DNA sequence:INSDC:YLR343W"
                     /note="similar to Saccharomyces cerevisiae GAS2 (YLR343W);
                     ancestral locus Anc_4.174"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681072.1"
                     /db_xref="GeneID:11502296"
                     /db_xref="GOA:G8ZTB7"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR012946"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G8ZTB7"
                     /translation="MMILNLKFSAAMIMSALSSINIAAAAPAQAAEIPTIEIMGNKFF
                     DSVSGDQFFMKGIAYQPSRSLDDLESATDTYETKYIDPLADPQICLRDIPYLKELSVN
                     TIRVYSIDPTKSHDECMQALADAGIYLLLDLAEPDVSICRNKPTWDVNIWNRYKDVVD
                     VMHNYPNVLGFFAGNEVTNDKTNTDASPFVKAAIRDVKNYIKFRGYRQIPVGYSSNDD
                     ADTREQLAQYFACGEICADFYGINMYEWCGYSSYGTSGYKERTIEFKDYPLPIFFSEF
                     GCNLVRPRPFTEVGALFGSKMSETWSGGLAYMYFEEENAYGVVKVNDEGEVEKLDDFE
                     FLKGEFTKAKPNKVTKSEFLRELPERKELKCPSSSKNWQSSNHTPPKPDVDKCNCLNK
                     ILPCQVLPYENPAEYNNLFDLVCGKVDCSDIAADGKKGVYGKFADCTAEQKLALQISK
                     LYVQSKDSSDTCPIGGKNVYFNSDYKKISKGDKCSKIELDYMSIHSNVTSKNSSAETS
                     GEKATTAVPNSTKVGAGSITQYKNSGCAILFVTIFIASFLL"
     gene            complement(<527127..>532742)
                     /gene="TDEL0D02780"
                     /locus_tag="TDEL_0D02780"
                     /db_xref="GeneID:11502297"
     mRNA            complement(<527127..>532742)
                     /gene="TDEL0D02780"
                     /locus_tag="TDEL_0D02780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681025.1"
                     /db_xref="GeneID:11502297"
     CDS             complement(527127..532742)
                     /gene="TDEL0D02780"
                     /locus_tag="TDEL_0D02780"
                     /inference="similar to DNA sequence:INSDC:YGR032W,YLR342W"
                     /note="similar to Saccharomyces cerevisiae GSC2 (YGR032W)
                     and FKS1 (YLR342W); ancestral locus Anc_4.173"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681073.1"
                     /db_xref="GeneID:11502297"
                     /db_xref="GOA:G8ZTB8"
                     /db_xref="InterPro:IPR003440"
                     /db_xref="InterPro:IPR026899"
                     /db_xref="UniProtKB/TrEMBL:G8ZTB8"
                     /translation="MSYNGHPSGNQPPYGEQPPYGEQPAYDEYGQPIYASNDAYYDPN
                     VSGDPYGNYDPDQMDYSAGPDGLYNQPRGPGQQPENFSDFSSYGPPGTPGYDSYAGNG
                     QYTPSQMSYGEPRSSGASTPIYGGEGYDPAAIAMALPNEPYPAWTADNQSPVAIEQIE
                     DIFIDLTNRFGFQRDSMRNMFDHFMTLLDSRASRMSPEQALLSVHADYVGGDTANYKK
                     WYFAAQLDMDDDVGFRNMSLGKLSRKARKAKKKNKKAIEESNPEDTEATLNQLEGDNS
                     LEAADFRWKAKMNQMSPLEKVRQIALYLLCWGEANQVRFTSECLCFIYKCALDYLDSP
                     LCQQRAEPMPEGDFLNRVISPLYRFLRDQVYQIVDGRFVKREKDHNRIIGYDDVNQLF
                     WYPEGIAKIVFEDGTRLIDLGVEERYLRLGDVVWDDVFFKTFKETRSWLHMVTNFNRI
                     WVIHASVYWMYAAYNAPTFYTHNYQQLVDNQPVPAYRWGSAALGGALASLIQMFATIC
                     EWTFVPRNWAGAQHLTRRFLLICVIFGINLGPIIFVFAYEKDTVYSTAGHAVAAVTFF
                     IAVGTIIFFAIMPLGGLFTPYMKKSTRRYVASQTFTASFAPLTGIDMWLSYLVWVTVF
                     AAKYAESYFFLILSLRDPVRILSTMTMRCTGETWWGAKLCRQQPKIVLGLMIATDFVL
                     FFLDTYLWYIIVNTVFSVGKSFWLGISILTPWRNIFTRLPKRIYSKILATTDMEIKYK
                     PKVLISQVWNAIVISMYREHLLAIDHVQKLLYHQVPSEIEGKRTLRAPTFFVSQDDNN
                     FETEFFPRNSEAERRISFFAQSLSTPIPEPLPVDNMPTFTVLTPHYAERILLSLREII
                     REDDQFSRVTLLEYLKQLHPVEWECFVKDTKILAEETAAYEGAEEGGDKEDALKSQID
                     DLPFYCIGFKSAAPEYTLRTRIWASLRSQTLYRTVSGFMNYARAIKLLYRVENPEIVQ
                     MFGGNAEGLERELEKMARRKFKFLVSMQRLAKFKPHELENAEFLLRAYPDLQIAYLDE
                     EPPLNEGEDPRIYSALIDGHCEILENGRRRPKFRIQLSGNPILGDGKSDNQNHALIFY
                     RGEYIQLIDANQDNYLEECLKIRSVLAEFEELNVEMVNPYAPDLKYEEQITNHPVAIV
                     GAREYIFSENSGVLGDVAAGKEQTFGTLFARTLAQIGGKLHYGHPDFINATYMTTRGG
                     VSKAQKGLHLNEDIYAGMNAVLRGGRIKHCEYYQCGKGRDLGFGTILNFTTKIGAGMG
                     EQMLSREYYYLGTQLPIDRFLSFYYAHPGFHLNNLFIQLSLQLFMLTLVNMNSLAHES
                     IICKYDKFKPIYDPLYPLGCYNLSPVIDWVRRYTLSIFIVFFIAFIPIVIQELIERGL
                     WKATQRFFRHILSLSPMFEVFAGQIYSAALLSDLSVGGARYISTGRGFATARIPFSIL
                     YSRFAGSAIYMGSRSMLMLLFSTIAHWQAPLLWFWASLSSLMFSPFLFNPHQFSWEDF
                     FLDYRDYIRWLSRGNNKYHRNSWIGYVRMSRSRITGFKRKMIGDESEKAAGDAHRAHR
                     TNLIFSEIIPCAVYAAGCFVAFTFINAQTGVKTTDADRVNSTLRVIICTLAPIVIDLG
                     VLFFCMGMSCCSGPLFGMCCKKTGSVMAGIAHGIAVVIHIAFFIVMWVLEGFNFARML
                     LGVVTCIQCQRLIFQCITVFMLTREFKNDHANTAFWTGKWYGSGMGYMAWTQPSREMA
                     AKVVELSEFAADFVLGHVLLFCQLPLLIIPGIDKFHSIMLFWLKPSRQIRPPIYSLKQ
                     TRLRKRMVKKYSALYYIILLLFAACIVGPAVASSKVDQNIGSSLTGTFANLVQPRNRT
                     NDDTGSTMTTQSGHYYSSTPSIASYSTIK"
     gene            complement(<533517..>534506)
                     /gene="TDEL0D02790"
                     /locus_tag="TDEL_0D02790"
                     /db_xref="GeneID:11502298"
     mRNA            complement(<533517..>534506)
                     /gene="TDEL0D02790"
                     /locus_tag="TDEL_0D02790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681026.1"
                     /db_xref="GeneID:11502298"
     CDS             complement(533517..534506)
                     /gene="TDEL0D02790"
                     /locus_tag="TDEL_0D02790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681074.1"
                     /db_xref="GeneID:11502298"
                     /db_xref="GOA:G8ZTB9"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:G8ZTB9"
                     /translation="MNKKKTLVRGGELSGDRNIMAFHQEFFTLNNGNKIPAVAVVGTG
                     TTWFKNEETESNFSKELVEQIKYALTLPGIVHLDAAECYNTYQELGQALRESPKPRDE
                     IFITDKFSPTPKNHGGVLERFESGIKKMGVDYVDLYLIHSPLIEKEKNGVTLEEVWKD
                     LEKLYEAGKAKNIGVSNFRVEDLQRILKVAKVKPQVNQIEFHVFLQNQTPGIVKFSQD
                     NNIQLEAYTPLGPLQRKQSDAGDFYNYVEELAKKYGKTEAQVLLRWVTRRHVLPITTS
                     SKPQRIQAAQDLFSFDLTDEEVKKITELGLKHKPLRLYWNDVWDQYNSEAQKP"
     gene            complement(<534568..>535719)
                     /gene="TDEL0D02800"
                     /locus_tag="TDEL_0D02800"
                     /db_xref="GeneID:11502299"
     mRNA            complement(<534568..>535719)
                     /gene="TDEL0D02800"
                     /locus_tag="TDEL_0D02800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681027.1"
                     /db_xref="GeneID:11502299"
     CDS             complement(534568..535719)
                     /gene="TDEL0D02800"
                     /locus_tag="TDEL_0D02800"
                     /inference="similar to DNA sequence:INSDC:YGR031W"
                     /note="similar to Saccharomyces cerevisiae YGR031W;
                     ancestral locus Anc_4.172"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681075.1"
                     /db_xref="GeneID:11502299"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8ZTC0"
                     /translation="MKREVTGATKAVQYHLKRTFSPLKAVASISSRRNYVRPVQVKLY
                     SSDTSSKKVPAGPLFDHHNNTFRTTTSQGKYGSTQVLNEDLLSDSIPSVKLAFDLIND
                     HTCQFIPEKASVIVLHGLFGNRMNNRTIGRELNELLERDVYLPDLRNHGASPHIGRHD
                     YTAMALDVERFIRENILTHPDAKRPIIIGHSMGAKVAMSVVLRKPELCSMLVSIDNAP
                     VATPPMNAFPRYTKKLLQIIEDPAMQTMQHADEALKAVEEKPVVRQFLLTVLQRVKDQ
                     ETGKWRFKSRIPLGILNDAIVKGNMSNWEFNPWVHRFTGPSLFIRGTKSHYVADEYLA
                     DIGNFFPNFEVRDIDAGHWVNSEKPKECVRDIVEFVERHEDELKSSKIV"
     gene            complement(<536084..>537757)
                     /gene="TDEL0D02810"
                     /locus_tag="TDEL_0D02810"
                     /db_xref="GeneID:11502300"
     mRNA            complement(<536084..>537757)
                     /gene="TDEL0D02810"
                     /locus_tag="TDEL_0D02810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681028.1"
                     /db_xref="GeneID:11502300"
     CDS             complement(536084..537757)
                     /gene="TDEL0D02810"
                     /locus_tag="TDEL_0D02810"
                     /inference="similar to DNA sequence:INSDC:YLR341W"
                     /note="similar to Saccharomyces cerevisiae SPO77
                     (YLR341W); ancestral locus Anc_4.171"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681076.1"
                     /db_xref="GeneID:11502300"
                     /db_xref="UniProtKB/TrEMBL:G8ZTC1"
                     /translation="MTLTLKDINSAATGSFSYNHFSKISILQETYKAESHGSPDLILR
                     QRFKRTHEKSCKRFTRSSGRDWCDARDLDENKMLAHLLSTDTDSVLEFSISSDRPHHD
                     SEFQLFTPPMLEGNTLLTLEELNAQIALLLAEYCPRRGTNFLSELTLTLITQAVQLNQ
                     AFARFKDVGSSDKNVTTFVQLCNKIMRDLWLRSLSDSIEHMHTMLLILERFEGQYNKV
                     EVRGITDPGIGTVLRKWSLLNYFPPVLINSLKFKVESSTICDDDCNMIANSELFKIAF
                     VTLAIESSKGFAKMINILIDLRAYESFTNHIVVNYLELLLACTIDTRVGEIMIGLEQV
                     IKRWITVKESTEPLTRTIFHQWAQRVMITYKIQQEQEIRLNGTQDEADVMFDKWEVAK
                     LFVSEILQFIQPEPTSQARSDTLGWLTVFDEYYDAASNPNDCIREPSQFELDSISIKS
                     IPQRRTTAKRDAIKRWASYSKDKVTQSCHRIKRRFQRVFHMHTNHALITSVRYYSALN
                     GRNYEYHYPDETPGFTSDQCAHVQRLTQKLYKSEQRGKRKRDALRVIFM"
     gene            complement(<537904..>538842)
                     /gene="TDEL0D02820"
                     /locus_tag="TDEL_0D02820"
                     /db_xref="GeneID:11502301"
     mRNA            complement(<537904..>538842)
                     /gene="TDEL0D02820"
                     /locus_tag="TDEL_0D02820"
                     /product="60S acidic ribosomal protein P0"
                     /transcript_id="XM_003681029.1"
                     /db_xref="GeneID:11502301"
     CDS             complement(537904..538842)
                     /gene="TDEL0D02820"
                     /locus_tag="TDEL_0D02820"
                     /inference="similar to DNA sequence:INSDC:YLR340W"
                     /note="similar to Saccharomyces cerevisiae RPP0 (YLR340W);
                     ancestral locus Anc_4.170"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P0"
                     /protein_id="XP_003681077.1"
                     /db_xref="GeneID:11502301"
                     /db_xref="GOA:G8ZTC2"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="UniProtKB/TrEMBL:G8ZTC2"
                     /translation="MGGVREKKAEYFAKLREYLEEYKSIFIVGVDNVASQQMHQVRKA
                     LRGRGVVLMGKNTMVRRAIRGFVSELPDYEKLLPFVKGNVGFVFTNESLKDIKEVIIE
                     NKVAAPARAGAVAPEDIWVTAMNTGMEPGKTSFFQALGVPTKIARGTIEIVSDVKVVE
                     AGNRVGQSEASLLNLLNISPFTYGLKIVQVYDAGQIFPSSILDITDEELVSHFVSAVS
                     TIASISLAIGYPTLPSVGHTLINNYKNLLAVAIASNYVYPEIEELVDRIENPDKYASA
                     APAAAAASAGEETKEEAAAEEDEESEDDDMGFGLFD"
     gene            <539203..>539679
                     /gene="TDEL0D02830"
                     /locus_tag="TDEL_0D02830"
                     /db_xref="GeneID:11502302"
     mRNA            <539203..>539679
                     /gene="TDEL0D02830"
                     /locus_tag="TDEL_0D02830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681030.1"
                     /db_xref="GeneID:11502302"
     CDS             539203..539679
                     /gene="TDEL0D02830"
                     /locus_tag="TDEL_0D02830"
                     /inference="similar to DNA sequence:INSDC:YGR030C"
                     /note="similar to Saccharomyces cerevisiae POP6 (YGR030C);
                     ancestral locus Anc_4.169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681078.1"
                     /db_xref="GeneID:11502302"
                     /db_xref="GOA:G8ZTC3"
                     /db_xref="InterPro:IPR002775"
                     /db_xref="InterPro:IPR020224"
                     /db_xref="UniProtKB/TrEMBL:G8ZTC3"
                     /translation="MEIPRIEFDGEDAHIDLDDQGQCMQFIRDKVIPGCVDDCQALEG
                     EIIMFRKITKNDSIQQTLEKLEAGKTRFVCVYAYGPHIHKLLSVVEIFKKIPSRKSES
                     KVTLKQWNKLSSFVSVQQGQNELLEKRTRVPILITVIAKPSDQEPLELPLKAFTKQ"
     gene            <540647..>542881
                     /gene="TDEL0D02840"
                     /locus_tag="TDEL_0D02840"
                     /db_xref="GeneID:11502303"
     mRNA            <540647..>542881
                     /gene="TDEL0D02840"
                     /locus_tag="TDEL_0D02840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681031.1"
                     /db_xref="GeneID:11502303"
     CDS             540647..542881
                     /gene="TDEL0D02840"
                     /locus_tag="TDEL_0D02840"
                     /inference="similar to DNA sequence:INSDC:YLR337C"
                     /note="similar to Saccharomyces cerevisiae VRP1 (YLR337C);
                     ancestral locus Anc_4.168"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681079.1"
                     /db_xref="GeneID:11502303"
                     /db_xref="GOA:G8ZTC4"
                     /db_xref="InterPro:IPR003124"
                     /db_xref="InterPro:IPR028293"
                     /db_xref="UniProtKB/TrEMBL:G8ZTC4"
                     /translation="MVPPPPPPPPPPPGGSSVPSPPKPAASVMQGRDALLGDIRKGAK
                     LKKAETNDRSAPALGGGPVVSSGPKLSSHGAPSIPESMSAPPIPGMGAPQLGDILAGG
                     IPKLKSVHKSAGAPSIPGQAPPFPSGGAPSIPKVPNSSAPPIPGSAPAIPSAPAPSVP
                     SARPKRRSHQKKSSISSVNVIEMRYLLFQQHLHQPLLLLRLRCQPFKLHQLHQLHQLH
                     QLHQPPPAPPAPSAPLAPPSSSSSSSSSSSDPPQKEDKSTQNIASVSQSSTGLPFLAE
                     INARRSDSGSVTGSVPSLPSQAPQLDAPPLPSQAPPLPSQAPPLPSQAPPLPSGAPPM
                     PTKRPSTSRPSAPPPPAPPAPPMSSAPPAPPAPPAPPAPPMSSAPPAPPAPPAPPAPP
                     FSAAPSTPIAPPAPPVAPPTPQISKAKPSSQRTPAPGGPLPFLSEIQKKRDDRFVVGG
                     DTGYTTKQEQSDAAASTSSSATAPAREDKPMGQMSFLGEIESRLKQPHSGAKPPSIPQ
                     PPPQPSSAPPLPKAAAPVPSAPPAVPSAAPAIPPQQGSSFLDEIQSTLQHSRSDYSTP
                     APSPPSMAPSAPPLPSAAPPLPSAAPPLPSAAPPLPSTNASSAPTPPPVAPSPKPAVT
                     IPNTTPSTHVPSTTKAPPPPPTMEASTNTKQRLFSSGTSSFRGTNEHTNAPDIEVGQL
                     TINGSSSTSGVKLNSGKVVIDDSRFRWTNASQIPKPRPYQNKTKLYPSGKGSSVPLDL
                     TLFA"
     gene            complement(<542944..>543548)
                     /gene="TDEL0D02850"
                     /locus_tag="TDEL_0D02850"
                     /db_xref="GeneID:11502304"
     mRNA            complement(join(<542944..543412,543481..>543548))
                     /gene="TDEL0D02850"
                     /locus_tag="TDEL_0D02850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681032.1"
                     /db_xref="GeneID:11502304"
     CDS             complement(join(542944..543412,543481..543548))
                     /gene="TDEL0D02850"
                     /locus_tag="TDEL_0D02850"
                     /inference="similar to DNA sequence:INSDC:YGR029W"
                     /note="similar to Saccharomyces cerevisiae ERV1 (YGR029W);
                     ancestral locus Anc_4.167"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681080.1"
                     /db_xref="GeneID:11502304"
                     /db_xref="GOA:G8ZTC5"
                     /db_xref="InterPro:IPR017905"
                     /db_xref="UniProtKB/TrEMBL:G8ZTC5"
                     /translation="MSNMAPTEGLDGRKIVYDEDGKPCRSCNTLLDFKFATGKITSKM
                     NSPIQTPTESKDNAMPMIPGHKTHAKVDPPDVEKLGRSSWDLLHSITARYPVKPTEQN
                     KSEMKQFLTLFSHVYPCSWCARDFEKFIAKHAPKVNSRDELGRWMCEAHNEVNAKLMK
                     EQFDCNLWDKRWKDGWDE"
     gene            complement(<543697..>544785)
                     /gene="TDEL0D02860"
                     /locus_tag="TDEL_0D02860"
                     /db_xref="GeneID:11502305"
     mRNA            complement(<543697..>544785)
                     /gene="TDEL0D02860"
                     /locus_tag="TDEL_0D02860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681033.1"
                     /db_xref="GeneID:11502305"
     CDS             complement(543697..544785)
                     /gene="TDEL0D02860"
                     /locus_tag="TDEL_0D02860"
                     /inference="similar to DNA sequence:INSDC:YGR028W"
                     /note="similar to Saccharomyces cerevisiae MSP1 (YGR028W);
                     ancestral locus Anc_4.166"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681081.1"
                     /db_xref="GeneID:11502305"
                     /db_xref="GOA:G8ZTC6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZTC6"
                     /translation="MSRKFDLKTVADLSVLIGTGISLYYLVSRLLNDVEAGPLSGRSK
                     ESKTRQLSQWQKLVDKNPKLADVELNTYEKSVLSSVVTADELAVTFKDIGGLDPIIAD
                     LHESVVYPLMMPEVYENNPLLQAPSGVLLYGPPGCGKTMLAKALANESGANFISIRMS
                     SIMDKWYGESNKIVDAMFSLAKKIQPCMIFIDEIDSFLRERASSDHEVTAMLKAEFMT
                     LWDGLLTSGRVMIVGATNRITDIDSAFLRRLPKRFLIPLPGKEERLKILKVLLQDTKT
                     DKDFFDIEAIATHTNGLSGSDLKELCREAALNAAKEYIKLKREYMAQKDVKNIEDFPL
                     KMRPLRTSDFAGNLKLDAGQSLQSMSLD"
     gene            <544975..>548166
                     /gene="TDEL0D02870"
                     /locus_tag="TDEL_0D02870"
                     /db_xref="GeneID:11502306"
     mRNA            <544975..>548166
                     /gene="TDEL0D02870"
                     /locus_tag="TDEL_0D02870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681034.1"
                     /db_xref="GeneID:11502306"
     CDS             544975..548166
                     /gene="TDEL0D02870"
                     /locus_tag="TDEL_0D02870"
                     /inference="similar to DNA sequence:INSDC:YLR336C"
                     /note="similar to Saccharomyces cerevisiae SGD1 (YLR336C);
                     ancestral locus Anc_4.165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681082.1"
                     /db_xref="GeneID:11502306"
                     /db_xref="GOA:G8ZTC7"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR003891"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZTC7"
                     /translation="MASKHGIRIPGLLLDELKSRDYSKDDRFNEPAKAKGKKRNPKGQ
                     LGRKERRKQQRLEKKSTKKGKTSGEDVRLKTKEIAKAKPSKVKYEESAPANKKSKEIK
                     TDLPFSSDDELSSGDFDEFDEDDLDEEEWEQLRELEGEVGGESDETSEVNEFEEEEDL
                     DDEELSEDGKDHDGMSVEETMAALKAMKQKKVKKMQDKEVVEEVEDEDMDEDEGEDED
                     HHENNLSEEDEESGDKEMSVEETMAALKAMKAKKNKMKDTKINKLEEEEVSDESEGKE
                     ISVEETMAALKAAKENKKKTERFPASEKKDKKRPKSKVIEVDYPMAPSDRAAAERDEM
                     DMQYYAKKLGLKGKSKKIHARDEFDAIGGLLDGLDYFDGYGAEDEDYGEYAYGDDRRK
                     ESSDEEQDGEEVPAFGSDDELSSGDFDEFDEDDLDEEEWEQLRELEERDDESGDDEKA
                     KIKGKRVKENPLVAPIEPGTEAYVPPSLRKKMLEGDGESAVEVEVKKSVKSSLNKLSD
                     SNLTVIISALNDLYAKHARQIVTKVIIDQVIDIIGQRNKLLDSFIINYSAILYSLWRL
                     RGTETGASFIQSVVESFLNHFEEQITRLDKKKTEDQDEIVLLSKEPANLLSLLAYCYN
                     FGLISSKLIYDLIRIFVEAPNELTTELLLRIISISGSLIRGDDPSALKDIISVLLTNI
                     KSIEKQPPRMKFLLDTVSDLKNNRLKPSMVATSHQNMKKSLNSFLNVGSTSSEALLVS
                     LDDIKNVDTKGKWWLIGASWKGNMDSAFEEAPGGGSKVSTNGGNHMTIDDDLLDDTPD
                     WSEIARRQRMNTDIRRAIFISIMSAQDYMDAFTKLEKLNLKKKQALEIPRVILHCLSQ
                     DGASNGYNPYYAALTNKLCENQHGLVKSFQFQFWEIVKAFEDDGLERDVEDNEDLDED
                     RRLKKIANQGKFFGSLIAEGTLKLDVLKHVSLISGLTSDGVQFMELLLFQMLLSAAKR
                     SEVKTKDANNKKSITYRDDILHNILANGIKSENRPIILKGLRFFLKKHFKYKNYIAMG
                     PGDKSYDRDTRRLKWAVSKFAELIDEELENADY"
     gene            complement(<548233..>549915)
                     /gene="TDEL0D02880"
                     /locus_tag="TDEL_0D02880"
                     /db_xref="GeneID:11502307"
     mRNA            complement(<548233..>549915)
                     /gene="TDEL0D02880"
                     /locus_tag="TDEL_0D02880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681035.1"
                     /db_xref="GeneID:11502307"
     CDS             complement(548233..549915)
                     /gene="TDEL0D02880"
                     /locus_tag="TDEL_0D02880"
                     /inference="similar to DNA sequence:INSDC:YLR335W"
                     /note="similar to Saccharomyces cerevisiae NUP2 (YLR335W);
                     ancestral locus Anc_4.164"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681083.1"
                     /db_xref="GeneID:11502307"
                     /db_xref="GOA:G8ZTC8"
                     /db_xref="InterPro:IPR000156"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR015007"
                     /db_xref="UniProtKB/TrEMBL:G8ZTC8"
                     /translation="MAKRFADSQITRETHRENDSDSDEESTGHGVASAAVMSKRKIAM
                     PKRKMAANFNRQPESTKENSSSAFGFLQGSASTGSDSDKNAKLKALNLQFKDKVISFV
                     DQDPCADLSPVFEKYKTYIQSIGAAKPAAKPAAQPAFTIAPKPVQQVDDKPESSSDEE
                     PEVKVEGPKFTINTKPPTSNSVFSFGATKVAKKDDSDSDCDEVEIKGPQFTFSGTVKS
                     DVFKLPKATEPTGEKPKDSEPKESEPEVKPAFSFGNSKQPSEKPAFSFGAPKETTNGK
                     PSFTFGKPQEGTKDKPKFDFSFSSAAKNDGTATDAQKPSLSFKFGADKENKDEKTEKS
                     AIPSFSFNNHNEKKDEKIAAKPAFTFGAPNSSTAPSFTFGKAATNEKTDDASKPSNGF
                     KFSLPFGQKAPENATTSNEAKDDKSTTVTADDEHKADEKPDESKPMDLQNGEEGENAL
                     FSQRSKLMIFNPETKAYDSRGVGEMKLLQSNEDKSKIRFLCRSDGMGNILLNTRVVKD
                     FSYTPLTAENENLVKIPTIEADNKLVTYVVKFKQKADGRQFVKAIEDVKKDM"
     gene            complement(550174..550245)
                     /gene="TDEL0Dtrna1E"
                     /locus_tag="TDEL_0Dtrna1E"
                     /db_xref="GeneID:11502308"
     tRNA            complement(550174..550245)
                     /gene="TDEL0Dtrna1E"
                     /locus_tag="TDEL_0Dtrna1E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:11502308"
     gene            <550794..>551120
                     /gene="TDEL0D02890"
                     /locus_tag="TDEL_0D02890"
                     /db_xref="GeneID:11503624"
     mRNA            <550794..>551120
                     /gene="TDEL0D02890"
                     /locus_tag="TDEL_0D02890"
                     /product="40S ribosomal protein S25"
                     /transcript_id="XM_003681036.1"
                     /db_xref="GeneID:11503624"
     CDS             550794..551120
                     /gene="TDEL0D02890"
                     /locus_tag="TDEL_0D02890"
                     /inference="similar to DNA sequence:INSDC:YGR027C,YLR333C"
                     /note="similar to Saccharomyces cerevisiae RPS25A
                     (YGR027C) and RPS25B (YLR333C); ancestral locus Anc_4.163"
                     /codon_start=1
                     /product="40S ribosomal protein S25"
                     /protein_id="XP_003681084.1"
                     /db_xref="GeneID:11503624"
                     /db_xref="InterPro:IPR004977"
                     /db_xref="UniProtKB/TrEMBL:G8ZTC9"
                     /translation="MPPKQQLSKAAKAAAALAGGKKSKKKWSKKSHKDKAQHAVILDQ
                     EKYDRILKEVPTYRYVSVSVLVDRLKIGGSMARIALRDLEGKGIIKPVSKHSKQAIYT
                     RAAASE"
     gene            complement(<551880..>552704)
                     /gene="TDEL0D02900"
                     /locus_tag="TDEL_0D02900"
                     /db_xref="GeneID:11502309"
     mRNA            complement(<551880..>552704)
                     /gene="TDEL0D02900"
                     /locus_tag="TDEL_0D02900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681037.1"
                     /db_xref="GeneID:11502309"
     CDS             complement(551880..552704)
                     /gene="TDEL0D02900"
                     /locus_tag="TDEL_0D02900"
                     /inference="similar to DNA sequence:INSDC:YGR026W"
                     /note="similar to Saccharomyces cerevisiae YGR026W;
                     ancestral locus Anc_4.162"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681085.1"
                     /db_xref="GeneID:11502309"
                     /db_xref="UniProtKB/TrEMBL:G8ZTD0"
                     /translation="MPQKIKIIQKKSTEKHLSPLQIQKYVWLAGHAMTLALGLLFSVT
                     YLLQCLIFFKYRSWKWLFLRMNRSYSFFSGHRWYHAILRWTPALLYRLALIGTFMSLG
                     VTSYQNSRGLHPQWFEMLSAENFQYLLISVFWFFTGASVFKIAPLMLLSYMHLTNWKQ
                     EIDGMKDEDEVTKKYAPVLNILAISEMLVAVSLALDAILLKSSSSGVVLVVYLGIYWL
                     RINFSPYVQITMLRLLSKLDKKVPPKYHDQWEIIKKFIYSKIQDHEKRKTAIKKTA"
     gene            <552892..>553602
                     /gene="TDEL0D02910"
                     /locus_tag="TDEL_0D02910"
                     /db_xref="GeneID:11502310"
     mRNA            <552892..>553602
                     /gene="TDEL0D02910"
                     /locus_tag="TDEL_0D02910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681038.1"
                     /db_xref="GeneID:11502310"
     CDS             552892..553602
                     /gene="TDEL0D02910"
                     /locus_tag="TDEL_0D02910"
                     /inference="similar to DNA sequence:INSDC:YGR024C"
                     /note="similar to Saccharomyces cerevisiae THG1 (YGR024C);
                     ancestral locus Anc_4.161"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681086.1"
                     /db_xref="GeneID:11502310"
                     /db_xref="GOA:G8ZTD1"
                     /db_xref="InterPro:IPR007537"
                     /db_xref="InterPro:IPR024956"
                     /db_xref="InterPro:IPR025845"
                     /db_xref="UniProtKB/TrEMBL:G8ZTD1"
                     /translation="MAKSRFEYVRQFEKSDILLPECYIVVRIDGKKFHEFSKHYEFEK
                     PNDMRALKLMNAAAKNVVLNYKNEIILAYGESDEYSFILKKETTLYNRRQEKIASLFV
                     SLFTSNYVALWPKFFDRDLDWKHLPFFDSRCVLYPNLQTVKDYLSWRFVDTHINNLYN
                     TVFWKLIQVCEMSPREAENFLSGTVSSEKQEILWQRCSINYNNEPEIFKKGTMVSRKG
                     EFLHVDIMKVIDEIFDGY"
     gene            complement(553712..553783)
                     /gene="TDEL0Dtrna2D"
                     /locus_tag="TDEL_0Dtrna2D"
                     /db_xref="GeneID:11502311"
     tRNA            complement(553712..553783)
                     /gene="TDEL0Dtrna2D"
                     /locus_tag="TDEL_0Dtrna2D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:11502311"
     gene            complement(<554151..>555101)
                     /gene="TDEL0D02920"
                     /locus_tag="TDEL_0D02920"
                     /db_xref="GeneID:11503637"
     mRNA            complement(<554151..>555101)
                     /gene="TDEL0D02920"
                     /locus_tag="TDEL_0D02920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681039.1"
                     /db_xref="GeneID:11503637"
     CDS             complement(554151..555101)
                     /gene="TDEL0D02920"
                     /locus_tag="TDEL_0D02920"
                     /inference="similar to DNA sequence:INSDC:YGR023W,YLR332W"
                     /note="similar to Saccharomyces cerevisiae MTL1 (YGR023W)
                     and MID2 (YLR332W); ancestral locus Anc_4.159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681087.1"
                     /db_xref="GeneID:11503637"
                     /db_xref="InterPro:IPR007567"
                     /db_xref="UniProtKB/TrEMBL:G8ZTD2"
                     /translation="MSVMFVVIAWLWCCGLVSAQNTTSLSTSSFSSSTSVASTSFTSI
                     SQPSSSLSSLSSSSSFIFSSSVSSSSSSSSSFSSSSSSSSSSSLSSSSSLSSSSSSSS
                     SSSSSLLPSSTTSSSSSSSSSSSSSSSSSSSTTSSPITSSSSEQHTITSLVSGKTIVS
                     NLYTTFTYTATAGQRNTSSHGLSKKNRNIVIGCVVGIGVPLIIAAALLIYFFCVQSKK
                     TDFIDSDGKVVTAYRANKFTRWWYALLGKDISDRYESTSPLGNSNSPIMEDEEMPDPS
                     EDTNVDTTGTSGGGAHSNELMLNEEKFYDENGNQLNARNY"
     gene            complement(<555333..>556139)
                     /gene="TDEL0D02930"
                     /locus_tag="TDEL_0D02930"
                     /db_xref="GeneID:11502312"
     mRNA            complement(<555333..>556139)
                     /gene="TDEL0D02930"
                     /locus_tag="TDEL_0D02930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681040.1"
                     /db_xref="GeneID:11502312"
     CDS             complement(555333..556139)
                     /gene="TDEL0D02930"
                     /locus_tag="TDEL_0D02930"
                     /inference="similar to DNA sequence:INSDC:YGR021W"
                     /note="similar to Saccharomyces cerevisiae YGR021W;
                     ancestral locus Anc_4.158"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681088.1"
                     /db_xref="GeneID:11502312"
                     /db_xref="InterPro:IPR002876"
                     /db_xref="InterPro:IPR017856"
                     /db_xref="InterPro:IPR026563"
                     /db_xref="InterPro:IPR026564"
                     /db_xref="InterPro:IPR029072"
                     /db_xref="UniProtKB/TrEMBL:G8ZTD3"
                     /translation="MSRSVVQFKAIARGFSTRSSVVWSGHNKWSTIKHDKAKNDAERN
                     KLFSKFAQRISLAVKAGGGIDPQLNIRLATAIEQASKNNVTKKVIENAIKKGSGQSTK
                     GQGTTETCMYEGMGPGGVAFVVEALTDNKNRTVGLVRSAFTKAQGSMTPTLYFFDRRG
                     YVVVRPPEELGEDQLFDQVLELEGVEDLETLPDGSVEVVTDPQSANSVAAALKDKQYT
                     LVEVGVEHVPKDDMCVTADPETQQRIDKFLAVLGEIEDITDVYHNLSEPL"
     gene            <556272..>556628
                     /gene="TDEL0D02940"
                     /locus_tag="TDEL_0D02940"
                     /db_xref="GeneID:11502313"
     mRNA            <556272..>556628
                     /gene="TDEL0D02940"
                     /locus_tag="TDEL_0D02940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681041.1"
                     /db_xref="GeneID:11502313"
     CDS             556272..556628
                     /gene="TDEL0D02940"
                     /locus_tag="TDEL_0D02940"
                     /inference="similar to DNA sequence:INSDC:YGR020C"
                     /note="similar to Saccharomyces cerevisiae VMA7 (YGR020C);
                     ancestral locus Anc_4.157"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681089.1"
                     /db_xref="GeneID:11502313"
                     /db_xref="GOA:G8ZTD4"
                     /db_xref="InterPro:IPR005772"
                     /db_xref="InterPro:IPR008218"
                     /db_xref="UniProtKB/TrEMBL:G8ZTD4"
                     /translation="MSDKRTLIAAIADEDTTTGLLLAGVGQITPETQDKNFYVYHEGK
                     STREQITQAFDNFTSKRDDIAILLINQHIAELIRSHVDNFTDAFPAILEIPSKDHPYD
                     PEKDSVLKRVRRLFGE"
     gene            complement(<556701..>558692)
                     /gene="TDEL0D02950"
                     /locus_tag="TDEL_0D02950"
                     /db_xref="GeneID:11502314"
     mRNA            complement(<556701..>558692)
                     /gene="TDEL0D02950"
                     /locus_tag="TDEL_0D02950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681042.1"
                     /db_xref="GeneID:11502314"
     CDS             complement(556701..558692)
                     /gene="TDEL0D02950"
                     /locus_tag="TDEL_0D02950"
                     /inference="similar to DNA sequence:INSDC:YLR330W"
                     /note="similar to Saccharomyces cerevisiae CHS5 (YLR330W);
                     ancestral locus Anc_4.156"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681090.1"
                     /db_xref="GeneID:11502314"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR003961"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="UniProtKB/TrEMBL:G8ZTD5"
                     /translation="MSQVDVLLTVGKLDASLALLTTEDHHVIEFPTVLLPDDVKAGSI
                     VKLSVSQTLEEERKQRDLFREIQAKILEKYGTHKPKPPVLKIVNVTQTSCVLAWDQLE
                     LGSSCLKSLVLYRQGVRSTVIPCPLKSNTTKISGLSVDTDYEFELKLTTTSGQLWSEK
                     VKMHTHKMTDMSGITVCLGPLDPLLNISGAQIAQSLSQMGARPLQRRVAIDTTHFVTN
                     DAENDDDPELMKAKNSNIPIVRPEWVRASEMERRIIGVRGFYLDADQGILKSYQFPPA
                     TDEFKAKFAKLKSGETTDSVNLEKKLPTIDGSQPAPKEDDVEDVGLTEEDLNVTSDQP
                     VNGAGEEEVYQKQEGEKSHSKELTDSEVQEGIENGEPSKLEQMESKTEEPVKSKQPVT
                     NEQAGANDELVAEESITKELPAEQKQANVELQDEGQKPVESEQITETTEPFIEAPVTT
                     EKAAEPPSVEPVKDFQEEVPAEPEQPVEQEQQTELQQAAEPVQPVEEEQQTKLEQATE
                     PEQQAERTEERQPIEEEQPTEKEQPLEKEQPVDSEQPAERESPFEAEQPTEKEQPAES
                     EPPLETEQPTEKEQPAESEPPLETEQPIKKEQPSDARQSDKKLDETDDQPAEAEQLAD
                     VNNPLEPAEPVSESTSEPTAEPSAPRSSKKNKKKKNKKK"
     gene            complement(<558937..>560352)
                     /gene="TDEL0D02960"
                     /locus_tag="TDEL_0D02960"
                     /db_xref="GeneID:11502315"
     mRNA            complement(<558937..>560352)
                     /gene="TDEL0D02960"
                     /locus_tag="TDEL_0D02960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681043.1"
                     /db_xref="GeneID:11502315"
     CDS             complement(558937..560352)
                     /gene="TDEL0D02960"
                     /locus_tag="TDEL_0D02960"
                     /inference="similar to DNA sequence:INSDC:YGR019W"
                     /note="similar to Saccharomyces cerevisiae UGA1 (YGR019W);
                     ancestral locus Anc_4.155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681091.1"
                     /db_xref="GeneID:11502315"
                     /db_xref="GOA:G8ZTD6"
                     /db_xref="InterPro:IPR004631"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8ZTD6"
                     /translation="MTAPEAYYPNEPTKPVVKTSKVPGPESQKQLADLDTVFDARPAY
                     FVADYEKSNGNYIVDVDGNAFLDLYAQIASIALGYNNPALIKAAKSPEMVRALVDRPA
                     PGNFPSADMPDILRKILQVAPKGQDHVWSGLSGADANELAFKAAFMYYRAKQRGYDTE
                     FSTEENKTVMENAAPGAPHLAVLSFKRAFHGRLFASGSTTVSKPIHKLDFPAFDWPHA
                     EYPSYQYPLEKYEDENHKEDERCLKIVEELIKTWKYPVAALIIEPIQSEGGDNHASKY
                     FLQKLRDITLKYNVVYIVDEVQTGVGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYF
                     FHDPKFIPNKPYRQFNTWCGEPARMIIAGAIGQEIIDRDLTSQVVRVGDYLFKKLEAL
                     QEKYPTKFHNLRGKNRGTFIAWDLPTPEERDTLLKKLKLNGCNVGGCSTNSVRLRPTL
                     TFEEKHADIFVEALAKSVTEL"
     gene            complement(<560723..>561601)
                     /gene="TDEL0D02970"
                     /locus_tag="TDEL_0D02970"
                     /db_xref="GeneID:11502316"
     mRNA            complement(<560723..>561601)
                     /gene="TDEL0D02970"
                     /locus_tag="TDEL_0D02970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681044.1"
                     /db_xref="GeneID:11502316"
     CDS             complement(560723..561601)
                     /gene="TDEL0D02970"
                     /locus_tag="TDEL_0D02970"
                     /inference="similar to DNA sequence:INSDC:YGR017W"
                     /note="similar to Saccharomyces cerevisiae YGR017W;
                     ancestral locus Anc_4.154"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681092.1"
                     /db_xref="GeneID:11502316"
                     /db_xref="GOA:G8ZTD7"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="InterPro:IPR024624"
                     /db_xref="UniProtKB/TrEMBL:G8ZTD7"
                     /translation="MIHQMAPWVPTFIQSTKNTTQPFLPFQLATIDKKTNTPRCRTVV
                     FRDFLFKDKRSNVLTFHTDIRSGKMEESFSGDLNSSAPVEACFYFPETMEQYRFSGEC
                     FIVCEKHLNVPPELSRKYGILSPSVCGHHKQELYEYEAELDEEKASREDGKQEDNGKP
                     QPNEPQPSVDTSADALLEPTDFQPPTIKEWNMEVRRQWYSNSRSSRSQYRKPEPGKPI
                     TSETSKQLDKIQRGVDGANENAGLDNFAVVCLCIQQVDYLNLKGAGGGERAIFSRVTD
                     NHNTSLECWDEEHVCP"
     gene            561970..562100
                     /gene="TDEL0Dtrna2L"
                     /locus_tag="TDEL_0Dtrna2L"
                     /db_xref="GeneID:11502261"
     tRNA            join(561970..562008,562056..562100)
                     /gene="TDEL0Dtrna2L"
                     /locus_tag="TDEL_0Dtrna2L"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUG"
                     /db_xref="GeneID:11502261"
     gene            <562389..>563063
                     /gene="TDEL0D02980"
                     /locus_tag="TDEL_0D02980"
                     /db_xref="GeneID:11503640"
     mRNA            <562389..>563063
                     /gene="TDEL0D02980"
                     /locus_tag="TDEL_0D02980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681045.1"
                     /db_xref="GeneID:11503640"
     CDS             562389..563063
                     /gene="TDEL0D02980"
                     /locus_tag="TDEL_0D02980"
                     /inference="similar to DNA sequence:INSDC:YLR329W"
                     /note="similar to Saccharomyces cerevisiae REC102
                     (YLR329W); ancestral locus Anc_4.153"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681093.1"
                     /db_xref="GeneID:11503640"
                     /db_xref="UniProtKB/TrEMBL:G8ZTD8"
                     /translation="MFLQQLASCLQEGISFWENQLLYETQISVSGKVIELRLNCKVWN
                     LDKVSTLLQKPVERRSHVKSLPKVQFLKELKVVSTLCTPCDTLPSTKSVVPQLNEFLG
                     SLFVSQLEFRYAFVFSVIARRKFLAQESSIGPISYALANSSALLPLLTKLIGDDSTAT
                     SAYQLVSVGKKRSKDLSFQIDKTNITPHAFLYLYFILRNWFSSCSISSDHFFKVRVIK
                     NSTTGI"
     gene            complement(<562949..>563512)
                     /gene="TDEL0D02990"
                     /locus_tag="TDEL_0D02990"
                     /db_xref="GeneID:11502318"
     mRNA            complement(<562949..>563512)
                     /gene="TDEL0D02990"
                     /locus_tag="TDEL_0D02990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681046.1"
                     /db_xref="GeneID:11502318"
     CDS             complement(562949..563512)
                     /gene="TDEL0D02990"
                     /locus_tag="TDEL_0D02990"
                     /inference="similar to DNA sequence:INSDC:YGR016W"
                     /note="similar to Saccharomyces cerevisiae YGR016W;
                     ancestral locus Anc_4.152"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681094.1"
                     /db_xref="GeneID:11502318"
                     /db_xref="UniProtKB/TrEMBL:G8ZTD9"
                     /translation="MSRLRRFNRSVLLDGSDFQADIDDSGIPDLPMDTDEQEELIERF
                     EISNTLRNKRYANTLSLTYLLFSGLCLMMASKAHGREMALLVLQSLSIICSMVLARYE
                     LMHSYPIFGGFSIYINNSRIQVLNVVLIVLIEWIGFASHDPWSSQLSRQIPVVLFLIT
                     RTLKKWSEDMEQELNQLRKMKYRYKNA"
     gene            <563628..>564599
                     /gene="TDEL0D03000"
                     /locus_tag="TDEL_0D03000"
                     /db_xref="GeneID:11502319"
     mRNA            <563628..>564599
                     /gene="TDEL0D03000"
                     /locus_tag="TDEL_0D03000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681047.1"
                     /db_xref="GeneID:11502319"
     CDS             563628..564599
                     /gene="TDEL0D03000"
                     /locus_tag="TDEL_0D03000"
                     /inference="similar to DNA sequence:INSDC:YGR015C"
                     /note="similar to Saccharomyces cerevisiae YGR015C;
                     ancestral locus Anc_4.151"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681095.1"
                     /db_xref="GeneID:11502319"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8ZTE0"
                     /translation="MIRRYISTKTIPTKPVVDLAFHHVMPSASAVKGHLGPRPVLINL
                     HGIFGSSAMFRSISKPLANELGVEVYSVDLRNHGDSPWAFPYDFMTHAKDVIHFIKTQ
                     VGAQTPVNLLGFSIGGKIGLLTTLCDQVNVTKCVSMDLPPYETPQLDDVVLQNYALIM
                     KIINREIKIKRGTQNWKRMLLDHFKALPANQVNNGDPSLYFANGFYRVKKNNVSYEEE
                     KAHRPIGDPYIDYYLPLKQFPDLLDSVKAWPDLSGKENSGGVFQTSTDRSVLFMRALK
                     SDFMKDDYSLLRKPFPNAKVHEFNTGHNMMVEEPESTLQCIIDYLKE"
     gene            complement(<564735..>568106)
                     /gene="TDEL0D03010"
                     /locus_tag="TDEL_0D03010"
                     /db_xref="GeneID:11502320"
     mRNA            complement(<564735..>568106)
                     /gene="TDEL0D03010"
                     /locus_tag="TDEL_0D03010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681048.1"
                     /db_xref="GeneID:11502320"
     CDS             complement(564735..568106)
                     /gene="TDEL0D03010"
                     /locus_tag="TDEL_0D03010"
                     /inference="similar to DNA sequence:INSDC:YGR014W"
                     /note="similar to Saccharomyces cerevisiae MSB2 (YGR014W);
                     ancestral locus Anc_4.150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681096.1"
                     /db_xref="GeneID:11502320"
                     /db_xref="UniProtKB/TrEMBL:G8ZTE1"
                     /translation="MNFLLQVAQVALLMNFADAAIIDFNRNNDTATTNRSSSQSNVYE
                     ITTGTSSSSSKTTKSSTNDIVSASSSSLNFGAESTKSSESDNLWTWLTKSSTSSSALE
                     VTQPSTTSASGNNYLTTSSKSSDYVVSSAGSSSERQHYNTDPTTTSSFYSVSAQSTKT
                     TSSTPIIDFSFTSISSSESSSTTQRAPTSSPKSETRTVSSPSDTSSQRWTSPSSSSLS
                     QFWTLSGAESYQWSSSASSDPETFTVSATTSSFSQPSWVASSESESTLSSTSVAQVSF
                     TSYPLSVRYSSASSLSSFATPSATSLFSSEPSSISSSAVSAAVSSYASTQTAWPSSFS
                     LSSSEPAAVSSSSAIPEYASTTSSQFVWSPSVSSSSQPVSVISSSEISQSSADSSSVS
                     SESTQYIWTPSSSSLESVSTFSAAPESISTPVSTASVTSTAQEGASSYIPSSSSSFSW
                     QPSSTSSSSEYVWTSSFTPESSSETPLTPSTSSILVPSSETSVSMTTESSNSSPSPIP
                     STSSFVEPSFVSSVPVPISQSTEIPDASSTYTPSAVSTQSTPISASSSATTQTTEMPA
                     VSSTYTSSSLSLTPSAPVSQSTESAFVSSIYSPSSVSTPSAISQSTESAITSSTYTPS
                     SMSNPPAPSTQSTESAAASSVYTPLSPSLSSSIQETSTTSTPLSSTAEPSTTEPSTVE
                     SLSSSTESSLYSQWASSEVTIPSSIPSISTPSTTSTPESSTITSSTSSDVYSPVAPSI
                     TSVSEVPSVTDQPSTTPSTPEPFVSSTPTSGVASVSSSSSSAAVSSSSSTTANNWWVP
                     TQIVTQTSQTTSSGTVGQATATLPQAIAAATQVARPDGYTLITLGFKRALNYNFVVSN
                     PISSAQIFAFLPEMLRTPFENSYENITVQQLVPLQSKAVSYLATVAEVYFPTSEISAL
                     SKLISNTSSNLYTDVEGPAKYLAYLIDASIPLTGLLGSDTSNPNMSSRNSSSSTGSSD
                     DNFNSGALGTSIKNINGSGSSLTSSKSKIAGLVVGVVAGGCTYIAAMILLIRFFVVRR
                     QQAKNAIKFPDDSSDSTSESGSDAHYHKQEKVTFDDQESITPSMRINNWMNESHYYDV
                     AGPDIRVAQIGKKATSIPKISRPIASQNSLGWNEI"
     gene            complement(<568719..>570467)
                     /gene="TDEL0D03020"
                     /locus_tag="TDEL_0D03020"
                     /db_xref="GeneID:11502321"
     mRNA            complement(<568719..>570467)
                     /gene="TDEL0D03020"
                     /locus_tag="TDEL_0D03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681049.1"
                     /db_xref="GeneID:11502321"
     CDS             complement(568719..570467)
                     /gene="TDEL0D03020"
                     /locus_tag="TDEL_0D03020"
                     /inference="similar to DNA sequence:INSDC:YGR013W"
                     /note="similar to Saccharomyces cerevisiae SNU71
                     (YGR013W); ancestral locus Anc_4.149"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681097.1"
                     /db_xref="GeneID:11502321"
                     /db_xref="GOA:G8ZTE2"
                     /db_xref="InterPro:IPR002483"
                     /db_xref="UniProtKB/TrEMBL:G8ZTE2"
                     /translation="MSDIVYVSPQVYLVSKDKWKSTHQKPGFIPILSADIPRFQESLQ
                     KVAKSRGGQQGIDGITNGSITKGGTNSSSFGSSKATEDHASNSSKHQSLKQFFPIGLQ
                     QQLHTFSLQGVPSTISDEQLESSLQTCIQRVIQCLGYDNGPHVECWTNIRFYDLSTQD
                     VFVRLDQSDNMLFAKICKSLEMVFPASGEQDEVKIEFHCDSNTTKLIEDQKVEVLEAA
                     CQSISNEMNEILRVPEGSKVSETTNDDFFGESSDYQIDFNTLSDLPRESLSQLCKDII
                     EFRTRVVSIEKEKRIREAYEESTRRKHQMMRIFDQLRKSKNNVTDEMESDESDDEQDE
                     YEGIGEDDFLAEKQRQDKEKEQSEQRYQELLKNLHKHIEPRLAALHRDIKRQQNYEKT
                     LADEQSLHLKQLLHQANDPYYDHHRSFKESEEQADETDRKEHGFETPSVEPEVPLTEE
                     QPQLQPEDSPAPGQIKIKFAFKKAIETSAQKFTESPELPIEKTQEPEGSAPSILALDD
                     ETLEKCLQKVKESRVVDELIKEYLGVYEDELVEYIFDNVREHKSKQVLLDDLKETFDE
                     DAITIVDKMWSNHYWS"
     gene            complement(<570612..>571775)
                     /gene="TDEL0D03030"
                     /locus_tag="TDEL_0D03030"
                     /db_xref="GeneID:11502322"
     mRNA            complement(<570612..>571775)
                     /gene="TDEL0D03030"
                     /locus_tag="TDEL_0D03030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681050.1"
                     /db_xref="GeneID:11502322"
     CDS             complement(570612..571775)
                     /gene="TDEL0D03030"
                     /locus_tag="TDEL_0D03030"
                     /inference="similar to DNA sequence:INSDC:YGR012W"
                     /note="similar to Saccharomyces cerevisiae YGR012W;
                     ancestral locus Anc_4.148"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681098.1"
                     /db_xref="GeneID:11502322"
                     /db_xref="GOA:G8ZTE3"
                     /db_xref="InterPro:IPR001216"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="UniProtKB/TrEMBL:G8ZTE3"
                     /translation="MGIDDKSISWRDALSALSLLIAGYSTYRYYRSLSESTIPPVKKG
                     VEELIGNTPLVLIKSLSNATGCRVYAKMELCNPAGSAKDRVAYNVIQTAEKTGQLVRG
                     EPGWVFEGTSGSTGISVAMLCNALGYKAHISLPDDTSSEKLALLESLGAVVNKVKPAS
                     IVDPDQYVNAAKKSAEAMVSKGIRGVFADQFENEANWRIHYEATGPEIYRQTGGELDL
                     FIAGCGTGGTITGVSKYLKENMKTQPHVVLADPQGSGFYNRINYGVMYDNAEKEGTRR
                     RHQVDTIVEGIGLNRITRNFKLGETYIDESIRVTDEQAIKMAKFLTVNDGLFVGSSTA
                     INAVAAVKMARRTSTGSKIVIIACDAGSRHLSKFWKEAKNVDCNITLDQVIGE"
     gene            complement(<572078..>572362)
                     /gene="TDEL0D03040"
                     /locus_tag="TDEL_0D03040"
                     /db_xref="GeneID:11502323"
     mRNA            complement(<572078..>572362)
                     /gene="TDEL0D03040"
                     /locus_tag="TDEL_0D03040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681051.1"
                     /db_xref="GeneID:11502323"
     CDS             complement(572078..572362)
                     /gene="TDEL0D03040"
                     /locus_tag="TDEL_0D03040"
                     /note="ancestral locus Anc_4.147a"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681099.1"
                     /db_xref="GeneID:11502323"
                     /db_xref="UniProtKB/TrEMBL:G8ZTE4"
                     /translation="MSFPCFSYLEYSRLPPAVQEQYLDWCQNQFENEREMILFERQGG
                     VQGLASRKAQEEVDWLQRITVWSYLHAYIPNNRGDHRFLSQEMFNKVKSN"
     gene            complement(<572635..>573939)
                     /gene="TDEL0D03050"
                     /locus_tag="TDEL_0D03050"
                     /db_xref="GeneID:11502324"
     mRNA            complement(<572635..>573939)
                     /gene="TDEL0D03050"
                     /locus_tag="TDEL_0D03050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681052.1"
                     /db_xref="GeneID:11502324"
     CDS             complement(572635..573939)
                     /gene="TDEL0D03050"
                     /locus_tag="TDEL_0D03050"
                     /inference="similar to DNA sequence:INSDC:YGR010W,YLR328W"
                     /note="similar to Saccharomyces cerevisiae NMA2 (YGR010W)
                     and NMA1 (YLR328W); ancestral locus Anc_4.147"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681100.1"
                     /db_xref="GeneID:11502324"
                     /db_xref="GOA:G8ZTE5"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR005248"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G8ZTE5"
                     /translation="MDPTRAPDFKPASADEEPQPPPDPTSTIPKSKPIVPYVLADYNS
                     SIDAPFNLVSLKKNLAYQRKTRRVLVVRFVILKDPNVAFTVSNNHRRSNHIPWSQSDF
                     QPLSENMSNTEDDDEDGDEDKAYFDEVDRNLDLGSKSTFDDIDEQMGGISIGVRKNQI
                     ADLEEVPHGIVRQARNIENYEFPTHRLAKRLQDHNKLPLVIVACGSFSPITYLHLRMF
                     EMALDAICEQTRFEVIGGYYSPVSDTYQKRGLAASHHRVRMCELACERTSSWLMVDAW
                     ESLQPTYTRTAKVLDHFNHEINVKRGGVRNVTGDKMGVKIMLLAGGDLIESMGEPNVW
                     ADADLHHILGNYGCLILERTGSDVRSFLLSHDIMYEHRRNVLVIKQLIYNDISSTKVR
                     LFIRRNMSVQYLLPNSVIRYIQEHGLYVNQTEPVKQVMGTKD"
     gene            complement(574249..574348)
                     /gene="TDEL0Dtrna3S"
                     /locus_tag="TDEL_0Dtrna3S"
                     /db_xref="GeneID:11502317"
     tRNA            complement(join(574249..574294,574311..574348))
                     /gene="TDEL0Dtrna3S"
                     /locus_tag="TDEL_0Dtrna3S"
                     /product="tRNA-Ser"
                     /note="codon recognized: AGC"
                     /db_xref="GeneID:11502317"
     gene            <575633..>575893
                     /gene="TDEL0D03060"
                     /locus_tag="TDEL_0D03060"
                     /db_xref="GeneID:11503650"
     mRNA            <575633..>575893
                     /gene="TDEL0D03060"
                     /locus_tag="TDEL_0D03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681053.1"
                     /db_xref="GeneID:11503650"
     CDS             575633..575893
                     /gene="TDEL0D03060"
                     /locus_tag="TDEL_0D03060"
                     /inference="similar to DNA sequence:INSDC:YGR008C,YLR327C"
                     /note="similar to Saccharomyces cerevisiae STF2 (YGR008C)
                     and TMA10 (YLR327C); ancestral locus Anc_4.146"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681101.1"
                     /db_xref="GeneID:11503650"
                     /db_xref="InterPro:IPR006861"
                     /db_xref="UniProtKB/TrEMBL:G8ZTE6"
                     /translation="MTRTQKWTQHEARPDPKYFTHAGNFGESPNNVKKQGSGKGNWGK
                     AGDEINDLIDSGEIQQVFNKQRRGSNNQTNEKKFEGIQHYQV"
     gene            complement(<576202..>577128)
                     /gene="TDEL0D03070"
                     /locus_tag="TDEL_0D03070"
                     /db_xref="GeneID:11502325"
     mRNA            complement(<576202..>577128)
                     /gene="TDEL0D03070"
                     /locus_tag="TDEL_0D03070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681054.1"
                     /db_xref="GeneID:11502325"
     CDS             complement(576202..577128)
                     /gene="TDEL0D03070"
                     /locus_tag="TDEL_0D03070"
                     /inference="similar to DNA sequence:INSDC:YGR007W"
                     /note="similar to Saccharomyces cerevisiae MUQ1 (YGR007W);
                     ancestral locus Anc_4.145"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681102.1"
                     /db_xref="GeneID:11502325"
                     /db_xref="GOA:G8ZTE7"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G8ZTE7"
                     /translation="MQLSDDRVWIDGCFDFTHHGHAGAILQARQTIEGDGGTLICGVH
                     NDREIEMNKGTLPVMTSRERYEHTRANRWCGEVVEDAPYVTQPAWLDRYGCRYVVHGD
                     DITLDANGEDCYQEMKDIGRFRVVKRTNGVSTTEIIHRILTGSKGSNDRASLEDLKRY
                     ASGPDGHSRHCYVFQGTLDHVLVEGNFKLCPEEFVLVRGTFDLFHMGQIDQLAQVKSL
                     EGKKIIAVIEDSNDCIMSPKERALSVLSCRHLDGVVIQPEIKQVDYEIDDDRLTQGSE
                     FQYLTCGVIVERIERQRDAYVRRNVRKGMPSA"
     gene            complement(<577180..>577905)
                     /gene="TDEL0D03080"
                     /locus_tag="TDEL_0D03080"
                     /db_xref="GeneID:11502326"
     mRNA            complement(<577180..>577905)
                     /gene="TDEL0D03080"
                     /locus_tag="TDEL_0D03080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681055.1"
                     /db_xref="GeneID:11502326"
     CDS             complement(577180..577905)
                     /gene="TDEL0D03080"
                     /locus_tag="TDEL_0D03080"
                     /inference="similar to DNA sequence:INSDC:YLR326W"
                     /note="similar to Saccharomyces cerevisiae YLR326W;
                     ancestral locus Anc_4.144"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681103.1"
                     /db_xref="GeneID:11502326"
                     /db_xref="InterPro:IPR025187"
                     /db_xref="UniProtKB/TrEMBL:G8ZTE8"
                     /translation="MSGIVNGVLASVGQSFLEGKANEFAEEHFQPTKDPFYETLPNGK
                     RVRRRLPDYCTKQESKVWKNLQNKAWSHDKSLCGCCCWTECIGWAPVLAIIPVIGPAL
                     MYWVHGKLVTYADKHYNLPAELLVKLHGNIGLDLAISLVPILGILFAWLHASSTRNCA
                     MIYNYVSQRAFEKAEMEKKVQMQAQRNAQVQQSYQQQAQAQAHAQAQAHNHRQQYQNQ
                     QMRPPPPVYPRQQQQSRAQRPYI"
     gene            complement(<578009..>578725)
                     /gene="TDEL0D03090"
                     /locus_tag="TDEL_0D03090"
                     /db_xref="GeneID:11502327"
     mRNA            complement(<578009..>578725)
                     /gene="TDEL0D03090"
                     /locus_tag="TDEL_0D03090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681056.1"
                     /db_xref="GeneID:11502327"
     CDS             complement(578009..578725)
                     /gene="TDEL0D03090"
                     /locus_tag="TDEL_0D03090"
                     /inference="similar to DNA sequence:INSDC:YGR006W"
                     /note="similar to Saccharomyces cerevisiae PRP18
                     (YGR006W); ancestral locus Anc_4.143"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681104.1"
                     /db_xref="GeneID:11502327"
                     /db_xref="GOA:G8ZTE9"
                     /db_xref="InterPro:IPR004098"
                     /db_xref="UniProtKB/TrEMBL:G8ZTE9"
                     /translation="MSFDLSSLLKNEIAKKQQNLNIPAREVEPVEAPQASDEEKVTEE
                     VVESNAEAIDENPLNEQLERLNNRPARVEQIISEDSKISIKIDPTSIGDEQKVQSLSR
                     QCNLYIHEILAQWDENQPEYHPELLTETKKSLFPLLVKLRRGTLAPDLVISLATVLYH
                     LQQPNENNLAIESYMKLSIGNVAWPIGVTSVGIHARSAHSKIQGENGPIANIMLDDQT
                     RLWITSIKRLITFQDWLAST"
     gene            <578864..>580063
                     /gene="TDEL0D03100"
                     /locus_tag="TDEL_0D03100"
                     /db_xref="GeneID:11502328"
     mRNA            <578864..>580063
                     /gene="TDEL0D03100"
                     /locus_tag="TDEL_0D03100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681057.1"
                     /db_xref="GeneID:11502328"
     CDS             578864..580063
                     /gene="TDEL0D03100"
                     /locus_tag="TDEL_0D03100"
                     /inference="similar to DNA sequence:INSDC:YGR005C"
                     /note="similar to Saccharomyces cerevisiae TFG2 (YGR005C);
                     ancestral locus Anc_4.142"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681105.1"
                     /db_xref="GeneID:11502328"
                     /db_xref="GOA:G8ZTF0"
                     /db_xref="InterPro:IPR003196"
                     /db_xref="InterPro:IPR011039"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:G8ZTF0"
                     /translation="MSQRDNDAPALKAAGAKESGEEYMSQEEEVFDGNDIENNENKVY
                     EESLDLDLSKSNRQVWLVRLPMFLAEKWRDRNNIHGQELGKIRINKDGSKIKLVLNEN
                     DNDSIPHQYDLELTKKVVENEYIFTEQNLKKYQQRVQELASDPEKQRQAYLKKQEREE
                     ELKKKQQQLRRRNNRRKFNHRVMTDRDGRDRYIPYVKTIPKKTSIVGTVCHECQVMPS
                     MDDPNYHKIVEQRRNIVKNYNKERITTLDQTVGVTMSHTGMSMRSDNSNFLKVAREKS
                     KSNTKYIRMPKKEILDYLFKLFDEYDYWSLKGLKERTRQPEAHLKDCLDKVATLVKKG
                     PYAFKYTLRPEYKRLKDEERKATLGELADEQPGDDDTSGFNANDEQNAHGEEGEGEED
                     IEMEDIV"
     gene            <580317..>580553
                     /gene="TDEL0D03110"
                     /locus_tag="TDEL_0D03110"
                     /db_xref="GeneID:11502329"
     mRNA            <580317..>580553
                     /gene="TDEL0D03110"
                     /locus_tag="TDEL_0D03110"
                     /product="60S ribosomal protein L38"
                     /transcript_id="XM_003681058.1"
                     /db_xref="GeneID:11502329"
     CDS             580317..580553
                     /gene="TDEL0D03110"
                     /locus_tag="TDEL_0D03110"
                     /inference="similar to DNA sequence:INSDC:YLR325C"
                     /note="similar to Saccharomyces cerevisiae RPL38
                     (YLR325C); ancestral locus Anc_4.141"
                     /codon_start=1
                     /product="60S ribosomal protein L38"
                     /protein_id="XP_003681106.1"
                     /db_xref="GeneID:11502329"
                     /db_xref="GOA:G8ZTF1"
                     /db_xref="InterPro:IPR002675"
                     /db_xref="UniProtKB/TrEMBL:G8ZTF1"
                     /translation="MAREITDIKQFLELTRRADVKTATVKVNKKVNKAGKSFRQTKFK
                     VRGSRNLYTLVVNDAGKAKKLIQSMPPTLKVNRL"
     gene            complement(<580694..>582241)
                     /gene="TDEL0D03120"
                     /locus_tag="TDEL_0D03120"
                     /db_xref="GeneID:11502330"
     mRNA            complement(<580694..>582241)
                     /gene="TDEL0D03120"
                     /locus_tag="TDEL_0D03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681059.1"
                     /db_xref="GeneID:11502330"
     CDS             complement(580694..582241)
                     /gene="TDEL0D03120"
                     /locus_tag="TDEL_0D03120"
                     /inference="similar to DNA sequence:INSDC:YGR004W,YLR324W"
                     /note="similar to Saccharomyces cerevisiae PEX31 (YGR004W)
                     and PEX30 (YLR324W); ancestral locus Anc_4.140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681107.1"
                     /db_xref="GeneID:11502330"
                     /db_xref="GOA:G8ZTF2"
                     /db_xref="InterPro:IPR006614"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="UniProtKB/TrEMBL:G8ZTF2"
                     /translation="MSEANSKERETRAQFVDQSPSRIGGDTTKVIRSALKKRNGSISE
                     RKYTATEGESRETTPIVSSPLLTSTPPTISKAMVNLYPNLIVADRFLTVVTWTGDDIW
                     PSILTVMVYTTVVLYFEKIAKYFGHLVVVAVLWGYSLLDKHVEESLNMQPTLDDIVHT
                     MNRVITKADMLLSPITILSAQDIKKLLFTTAFLSPIYVLITLFILPPRKVLLIGGVYL
                     LTYHSPWSTITRRLLWRFKLVRLFVFYVTGLDLGGIRKNQGIFAAMHKQVKKLSDVSK
                     GSTADDGKPIKFTYVLYENQRRWLGIGWTSSMLSYERAAWTDEFLNEAPSPDSFHLPE
                     ESSGMTWKWVDKTWRLDMTNDGAIQLSSSRPKTTASPNSDDGFIYYDNTWKKPSAEDS
                     FSKYTRRRRWIRTAELMKTEDFGLHETSITLGTGKTSDYSLHSNGGTQEISHNEKRKS
                     VSHLNGGGNSDENGVDNQRRVSFSNIDNVHIIPPDDDYEEPPSESTKENHNGLPSPTQ
                     SNEKKVK"
     gene            <582494..>583207
                     /gene="TDEL0D03130"
                     /locus_tag="TDEL_0D03130"
                     /db_xref="GeneID:11502331"
     mRNA            <582494..>583207
                     /gene="TDEL0D03130"
                     /locus_tag="TDEL_0D03130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681060.1"
                     /db_xref="GeneID:11502331"
     CDS             582494..583207
                     /gene="TDEL0D03130"
                     /locus_tag="TDEL_0D03130"
                     /inference="similar to DNA sequence:INSDC:YLR323C"
                     /note="similar to Saccharomyces cerevisiae CWC24
                     (YLR323C); ancestral locus Anc_4.139"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681108.1"
                     /db_xref="GeneID:11502331"
                     /db_xref="GOA:G8ZTF3"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G8ZTF3"
                     /translation="MFKKRSANRDDNKRKKIRVESEDSVNKEQQNTVTKPRASKLGHS
                     ITTVPKNSDSDDQKHQDEGSDDEHVAKFTLSVNDDATKEDRLNAEVKASKGVTKQIRQ
                     PSNVRTTLLTDYQPDVCKDYKQTGYCGYGDSCKFLHSRDDFKGGWKLNQEWKIDSDQE
                     TEQKRTINLDDVPSKCSICREEYKSPVVTTCGHYFCSSCFTKRVRKDSTCLICGKDTN
                     GVAKMANDLKRLLKKKQST"
     gene            complement(<583221..>585485)
                     /gene="TDEL0D03140"
                     /locus_tag="TDEL_0D03140"
                     /db_xref="GeneID:11502332"
     mRNA            complement(<583221..>585485)
                     /gene="TDEL0D03140"
                     /locus_tag="TDEL_0D03140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681061.1"
                     /db_xref="GeneID:11502332"
     CDS             complement(583221..585485)
                     /gene="TDEL0D03140"
                     /locus_tag="TDEL_0D03140"
                     /inference="similar to DNA sequence:INSDC:YGR003W"
                     /note="similar to Saccharomyces cerevisiae CUL3 (YGR003W);
                     ancestral locus Anc_4.138"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681109.1"
                     /db_xref="GeneID:11502332"
                     /db_xref="GOA:G8ZTF4"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:G8ZTF4"
                     /translation="MSSRRTKIRVPSRLGYSDETSESLLRTVGEAIDTICKGESEKLS
                     FEHHYRIVYTLVLRGKAPEVYECVQTHIATVLDIWVKEWGRVSDVKDKNIESYSIWMT
                     MWKRQCEYFKLLSDVMIYMDKVYCKPEKKLETYDLALHVFRDHVIKPLFDYIYQILIE
                     SVNESRHDQYANDNCVNIWRDSVDLMEKLDDEKDNYFATHFEPIFLFETKKYYESELN
                     GKNLPPVQLLEHMKKLKQFEYALDCRFLNADSTAKVTNVLDKVLLWNQNFLEAAPSLI
                     RLAIDEGNVDLMKELADLSSEERYAINILDCIKKCISDDANAIPIDTGSRKKAQVATQ
                     WTTSLIALYDKYHDFLKQLDFRHLTFQRDGSGEVQINTKLLNDVFSNYLNGQGKQAIE
                     LLTTYLDVFLKMTQARREVDRIKKDLEASVKLFKLFAEKDVFINTFKLQMSRRLLQHR
                     SSTDVERWMVKRLKEEMGTFFTSKLDGMLRDIGTSSELLRLFRNSLDEAQWPKDLDFR
                     PQILTMTSWPFQPPTNSDFELQLPTELEQLKLDFESFYTRKYTERTLQWAHNLGYIEI
                     GFQFDASYHELSMPIPIGIVFLMFEKYDELTIEMIEEQTNIPSQELHKHLLSLTIAPK
                     SRILKKKPMSRTISSTDKFSINYSFSAPARKVKVQTITGILPPSRSDSAVDLVQDTLK
                     RERLSEINAAVVRIMKAGQHLTHTELMNKVTLELESRFPLTGSTFKKSLNYLLEKEYI
                     QRDPEDISIYHYIS"
     gene            <585637..>587079
                     /gene="TDEL0D03150"
                     /locus_tag="TDEL_0D03150"
                     /db_xref="GeneID:11502333"
     mRNA            <585637..>587079
                     /gene="TDEL0D03150"
                     /locus_tag="TDEL_0D03150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681062.1"
                     /db_xref="GeneID:11502333"
     CDS             585637..587079
                     /gene="TDEL0D03150"
                     /locus_tag="TDEL_0D03150"
                     /inference="similar to DNA sequence:INSDC:YGR002C"
                     /note="similar to Saccharomyces cerevisiae SWC4 (YGR002C);
                     ancestral locus Anc_4.137"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681110.1"
                     /db_xref="GeneID:11502333"
                     /db_xref="GOA:G8ZTF5"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR027109"
                     /db_xref="UniProtKB/TrEMBL:G8ZTF5"
                     /translation="MSSSDIFDVLNIQQKSKSPGSTNSPTPVASSSGTASNRAPKTQV
                     TGMQRELYSLLGENQPPLVVQPSNKFKEKLASISKPSPWTYAPFKANLSVKLHHWVKG
                     SKELVGEEPQESPHSKYNVHLTIPSFSREEYESFMNNAPEEQEKENSAQNDEKNANTD
                     SKTDQDWTFEEADYLFRLCRKYDMRWFVIYDRYSSEKRRTLEDLKETFYKVCKRYFTA
                     KSPDDALLSSLDYPKQKELERKKYLQRLLSRSAAEIAEEEALIIESRKFEMAAKKTLN
                     ERESLLRLLDSPNSDQSVSQYLSSQGISQLYGSLLSDKSKKRKHNTNVPENPWMKQQQ
                     QFAQQRQQLQQLQDRKHDGQDLASPRKTKKQKQEIQTAIKRKAESVYAEHLLKNFNQE
                     ERAALGVVTHGEKLAPGVFLRSTKVSTFKPALQNKVATILQELDLPTRPAMPTSEVMK
                     EHEELLKGIATLVDLKKHLDKLEAEKSIVK"
     gene            complement(<587139..>591380)
                     /gene="TDEL0D03160"
                     /locus_tag="TDEL_0D03160"
                     /db_xref="GeneID:11502334"
     mRNA            complement(<587139..>591380)
                     /gene="TDEL0D03160"
                     /locus_tag="TDEL_0D03160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681063.1"
                     /db_xref="GeneID:11502334"
     CDS             complement(587139..591380)
                     /gene="TDEL0D03160"
                     /locus_tag="TDEL_0D03160"
                     /inference="similar to DNA sequence:INSDC:YLR320W"
                     /note="similar to Saccharomyces cerevisiae MMS22
                     (YLR320W); ancestral locus Anc_4.136"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681111.1"
                     /db_xref="GeneID:11502334"
                     /db_xref="InterPro:IPR019021"
                     /db_xref="UniProtKB/TrEMBL:G8ZTF6"
                     /translation="MNSNGSSSSVVGDSETEDEGLGFFCPHEVVRLASVTPAEPDPMT
                     QGSDLQVERLSGYVESSLATRRRNFRQRTAIQKLPYSLDRIRHKQLLQGIDVSSFDAV
                     SENITLPERKTSFIERKAGHELIERDKQAEELSGSNTNVYHRESGSPLEYKAHKLHES
                     DDEADSWTEDVVESENESEDTTERQHILFRGRKIDIERGYRGILPRIAWEKAMKKNGA
                     ISRVKKRSIPDDRKGLAKRKPVDVRRTNQDQDLLNDLIVADDDLGEKDFPTSNYQSAL
                     PDEHFRDLSELERMSAYYRNKYHDDSSSESSIEEYNFFDEAEEVNLARKYEKQTLDDL
                     ETKFVTQAEEIDLRYLSDDQDGAIETDEGAIKAMLMKQTIVANGKKPKASTQRSRTRC
                     RYRYGESAKRRPKTVAKPIRKYIRKTAEQNHESAVKPWSDKVRNHSQTVDPHYDIKER
                     QKKLVAKSVKNAHFGIFPERHSELNRAVNTFTTVVEGVSRNYALSALQKQESDEAEMV
                     EGLQADQKPKVHLCFRAIDALLLGKSFEPPDVVKLQISNKQFTLSRFHGGEICQSMSD
                     AFEHIIKTGITNTELVELSESLTAFLLHLNMKSVYGSISDFHRNFRNRVNLSRQNAKP
                     IHFFQIAVCQFMLLEITKYADLSKSFKLEIETEIIDHVVSFFKLLSVCYKSMLKLDLD
                     YLHQACDIIAIVVRILDGVETLWKRVEKEKLSCCVAKILVDIFPTGKSRWSLLEANGS
                     YDSMLQALSFVHYCMQKCQWQITNEVILLFDRVFKKRRFEDFAEEIEVSNANRVAYPR
                     TESSKCQTVFNSYLHLLRSNEVTNVLVERIVPMSEIASSDSISVLINRLNLLIALAER
                     SDLNSEKRLEELVRPVVQNNYLATKDTGSLKLVTESVLNGVLCLFDIHCQKKSPFRAS
                     ILVSIYKSLVLKHDELKGIWSRFLEHLVQSRDFSERFSSVFLKTMYPCFLSMCQHQKQ
                     AKERLLLLTIYLRNLKTVGAQWVQANLFQAVKGVVHESSKWIDHYCTIGKFLVDHNIM
                     TWWSFFVYNNVNNTPPARILFNYQVAQLCDRQSFDLIKRSLFETAVESFFQDKSALFV
                     MFVTTLIDREKGHKASFKITSIVDSCLNLLQPFVSTLINLSYGDLILRLVSDIRLLYH
                     DKQIGFALATRLTNVFNLHFVDQVKDCYDFLLMKRDLGISDKEADKSSFRDAFKQLDS
                     TLSQACYVERGLIQATFSAAEISEYLEKVKSLFTFSVLTNPFHFVVSLIDANLRGDAT
                     NRPIKIRIVALYLRLVNEILLASYGQVSPDAFLEQCRLFRIICERLPLAELASVSDER
                     SYAYESIRFQIIVLKIAQGFLEENLLLAHSKEFLRSFSIPNELEATQLSEKLDVIVRE
                     TAGQTLRVDSDCPQPDYEGLRSLIELKESRSSFVT"
     gene            <591528..>593747
                     /gene="TDEL0D03170"
                     /locus_tag="TDEL_0D03170"
                     /db_xref="GeneID:11502335"
     mRNA            <591528..>593747
                     /gene="TDEL0D03170"
                     /locus_tag="TDEL_0D03170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681064.1"
                     /db_xref="GeneID:11502335"
     CDS             591528..593747
                     /gene="TDEL0D03170"
                     /locus_tag="TDEL_0D03170"
                     /inference="similar to DNA sequence:INSDC:YLR319C"
                     /note="similar to Saccharomyces cerevisiae BUD6 (YLR319C);
                     ancestral locus Anc_4.135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681112.1"
                     /db_xref="GeneID:11502335"
                     /db_xref="InterPro:IPR005613"
                     /db_xref="InterPro:IPR022782"
                     /db_xref="UniProtKB/TrEMBL:G8ZTF7"
                     /translation="MSSDRRYKDGAGIQQDRPLSKRNSSVSSSSSRSTATSVETIVTK
                     LLMSTKHLLQTLTQWSRMAVTEKSVSNAYVQLGNDFKVVSKFFTHCGIDVRDLGDVPL
                     DLRRVLEVALREKPSDNNLNKYLPTIREIIVTLLDKLKVKQAMLKSMKHEQLVKETQH
                     QQRPSIVSSLALSSTSTPTRSSNPNITTTPSVAPEVPKRETSQKDSLKNETGRSAELL
                     TPTRQRTLSENEALSRLKHGSNLQRRASKRFSAYHMAKFTNQSTTEAAAAAVASVPSS
                     AQSNPLPCNLSADTSDKTPESSPRQSLPKSDTKLISRLDNGAVYTLFLTMDGKTKKCT
                     LPRPTSMNALKLLFVEKFAYSPGGEDFPNLYMKDPKYGVFYELDEQGLLELCDGCVIE
                     LRRQQHDDSVSNQISGMIEQLRNEISKSQENLLNQVRSLTIQSQQPNTSNTTIGKESH
                     QRSTTAYESLLQLKQEVSVMRQLQRENKTNVESTIATITEKLSKFRTLSLSPAASSNR
                     AYMDKSQSQLGEESDALLSRVDDLQDLIEILRKDVAARGAKPSKKKLESVQKDLKAAQ
                     EDLQKMKQYIVTEKPHWKKIWEAELDKVCEEQQFLTLQEDLAADLDEDLGKALETFDL
                     VSLCCAEQEKNPKRSKTAPILPIPKPGTLNVVRDQLLVEVQSLNPDHESRVEALERAE
                     KLWLKEREYRDNGEFEEELGHFVEKSSFKRSGGVEEVERLRRQKDEENLRANFGGLA"
     gene            complement(<593771..>596344)
                     /gene="TDEL0D03180"
                     /locus_tag="TDEL_0D03180"
                     /db_xref="GeneID:11502336"
     mRNA            complement(<593771..>596344)
                     /gene="TDEL0D03180"
                     /locus_tag="TDEL_0D03180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681065.1"
                     /db_xref="GeneID:11502336"
     CDS             complement(593771..596344)
                     /gene="TDEL0D03180"
                     /locus_tag="TDEL_0D03180"
                     /inference="similar to DNA sequence:INSDC:YLR318W"
                     /note="similar to Saccharomyces cerevisiae EST2 (YLR318W);
                     ancestral locus Anc_4.134"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681113.1"
                     /db_xref="GeneID:11502336"
                     /db_xref="GOA:G8ZTF8"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR003545"
                     /db_xref="InterPro:IPR021891"
                     /db_xref="UniProtKB/TrEMBL:G8ZTF8"
                     /translation="MKNLKSYLKEDLKIDLSTCQFQELYSCSHLNGLSELLSTHFVIL
                     NESSGLIPLIPGTDCHKSVVDQCVLFLLTRKMYSNVLTHGYKLGGTTSINSALHCVSV
                     NSNVAALKSKPWQLFHEIIGTQNFVNFIINCTVLGPDGDGYSQISGDRLTNSHHTPVS
                     SRQSKANHNDLISPVRARSFLYKNYSRFNYSEILPPANEYVAFRMSIFNPCLRRMNRK
                     MLSRIEYFLRKMLFNHHRKVKYVEILNGICPKSLDMGHLDAQTSTKQVIRFLIVILQK
                     LIPPELFGSKRNKAVIFKYVSSMLMLPVKGSLDIAEIGNSLRLKDFSWLIQPNTQFVK
                     HQYERTTFLMQSFISWLFKSLIPNIISTFFYCTEISSYVSISYFRHDVWNGMSLPYLN
                     AYLERHMIENNVCRNHYSYLHSRFNHNKARIVPKKADGEFRIIAVPNKGADEEEYFAF
                     RDNLRSVIYPIQCILDHLRNSRKNHFEKIYSANQIVSHIKKFKCHLLSKREYLPKLHY
                     LKFDIDSCYDSIPRERVFRVVKELLKKEQGFFVRSQSIYNSKTGAFSIQNVVNGSRQL
                     RDGEVYIDNVRTSFISNKDLLNVLEDEVNNSVLYFNGKCYLRKDGLFQGTSLSALLVD
                     LVYDDLLEHYSIFHPREEDDTLVLRLADDFLVISTNEARITNLKEAALQGFNEFNAKV
                     NTNKIISSACKDERKEFSFCALQISIDDLEVTKSPESLNIPEIGMSSAAKILKRLLGL
                     FEMRLSYGVTDLEINSKTTVLRQIRLIVTNIAEAYALACKGKRISTDHLSRFFHHLNL
                     SAIRSCSGGLRNDMFSAQLRLVIAECFLTVLSRNHARFNHAIDYLKSDSRMLSADLFL
                     Y"
     gene            <596671..>597763
                     /gene="TDEL0D03190"
                     /locus_tag="TDEL_0D03190"
                     /db_xref="GeneID:11502337"
     mRNA            join(<596671..596779,596843..596894,596956..>597763)
                     /gene="TDEL0D03190"
                     /locus_tag="TDEL_0D03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681066.1"
                     /db_xref="GeneID:11502337"
     CDS             join(596671..596779,596843..596894,596956..597763)
                     /gene="TDEL0D03190"
                     /locus_tag="TDEL_0D03190"
                     /inference="similar to DNA sequence:INSDC:YLR316C"
                     /note="similar to Saccharomyces cerevisiae TAD3 (YLR316C);
                     ancestral locus Anc_4.133"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681114.1"
                     /db_xref="GeneID:11502337"
                     /db_xref="GOA:G8ZTF9"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:G8ZTF9"
                     /translation="MVKKALNPLRIDYKKCIVEERLLQIRNKDNLHEPDLSRVWTIEI
                     NARDSKAIVDCIRRNFQPNDPITYTHVKRIRKKLDEPKKLIVIVCSCELFKDGSEVTS
                     LLKDSGVDFNQLNDCTVIPRQGAPTKELMMQWSEKFWPLTWCGNPNDQILNDYIFDMS
                     FIRKMLEKITQLSREAAEKDNEYPIVTAFVDPRNREAPIYAIDSRTKKGSTPIDHSIM
                     CGIRQVAERERKLGDTLGGGGYLCLDFDVYTTHEPCSMCSMALVHSRIKRCIFLEPME
                     VTGALKPSSGDGYCMHNNKLLNSKYEAFQWIGDEYPTMKLDPKMCC"
     gene            complement(<597766..>598251)
                     /gene="TDEL0D03200"
                     /locus_tag="TDEL_0D03200"
                     /db_xref="GeneID:11502338"
     mRNA            complement(<597766..>598251)
                     /gene="TDEL0D03200"
                     /locus_tag="TDEL_0D03200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681067.1"
                     /db_xref="GeneID:11502338"
     CDS             complement(597766..598251)
                     /gene="TDEL0D03200"
                     /locus_tag="TDEL_0D03200"
                     /inference="similar to DNA sequence:INSDC:YLR315W"
                     /note="similar to Saccharomyces cerevisiae NKP2 (YLR315W);
                     ancestral locus Anc_4.132"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681115.1"
                     /db_xref="GeneID:11502338"
                     /db_xref="UniProtKB/TrEMBL:G8ZTG0"
                     /translation="MSLREILVQFLLGNQLTSRLSLPEFQEVVDKNSGQGERIPDEKV
                     REWYAAYRARDQDETDATRLIVDKFLTITEQAEMRKLENAQLKESLSLEEVVDSMYNV
                     DQILDARLKTLNRAMETNVKVLAKLNDILAKVNRSKAEDDNIDLLNVLHGYKTMIEGD
                     E"
     gene            <598442..>600721
                     /gene="TDEL0D03210"
                     /locus_tag="TDEL_0D03210"
                     /db_xref="GeneID:11502339"
     mRNA            <598442..>600721
                     /gene="TDEL0D03210"
                     /locus_tag="TDEL_0D03210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681068.1"
                     /db_xref="GeneID:11502339"
     CDS             598442..600721
                     /gene="TDEL0D03210"
                     /locus_tag="TDEL_0D03210"
                     /inference="similar to DNA sequence:INSDC:YBR080C"
                     /note="similar to Saccharomyces cerevisiae SEC18
                     (YBR080C); ancestral locus Anc_3.304"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681116.1"
                     /db_xref="GeneID:11502339"
                     /db_xref="GOA:G8ZTG1"
                     /db_xref="InterPro:IPR003338"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR004201"
                     /db_xref="InterPro:IPR009010"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029067"
                     /db_xref="UniProtKB/TrEMBL:G8ZTG1"
                     /translation="MDKFKLPSFGKATHHSPPDMSNVDPQPRQLYVANCPNNSYALAN
                     VAAVSPQDFPDNIYILVDNLFVFTTRHSSELAAGTIGFNGNQRTWGGWSLNQEVQARA
                     FDLFKYSGKHSYLGSLDVDISFRSRGKAVNAPFDQDELALHFAKCFESQIFSPTQYLI
                     FEFKGHIFDLKVRNLQTIDLGDIEPVSPVSSSIEAKGILTKQTQINFFKGRDGLVNLK
                     SSNSLRPRSDAVIRSDFKFEDLGVGGLDKEFTKIFRRAFASRIFPPAVIEKLGISHVK
                     GLLLFGPPGTGKTLIARKIGTMLNAKEPKIVNGPEILSKYVGSSEENIRNLFKDAETE
                     YRAKGEESSLHIIIFDELDSVFKQRGSRGDGTGVGDNVVNQLLAKMDGVDQLNNILVI
                     GMTNRKDLIDSALLRPGRFEVQVEIHLPDEKGRLQIFDIQTKKMRENKMMDKDVDLAE
                     LAALSKNFSGAEIEGLVKSASSFAINKTVNIGKGATKLNQKDIAKLRVTREDFLNALQ
                     EVTPAFGISEEDLKTCVEGGMFRYSERVDAILKNGGRYVRQVRESEKSRLVSLLLHGP
                     SGSGKTALAAAIALKSEFPFIRLISPTELSGMSESAKIAYIDNTFRDAYKSPLNILVI
                     DSIETLVDWVPIGPRFSNNILQVLKVALKRKPPQDRRLLLMTTTSAYSVLQQMDILSC
                     FDSEIAVPNMTNLDEFNNVMIESNFLDDEGRVRVIKEMSEVCPKFNIGIKKVLTNIET
                     ARHDDDPVSEIVELMAQSA"
     gene            <600997..>603954
                     /gene="TDEL0D03220"
                     /locus_tag="TDEL_0D03220"
                     /db_xref="GeneID:11502340"
     mRNA            <600997..>603954
                     /gene="TDEL0D03220"
                     /locus_tag="TDEL_0D03220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681069.1"
                     /db_xref="GeneID:11502340"
     CDS             600997..603954
                     /gene="TDEL0D03220"
                     /locus_tag="TDEL_0D03220"
                     /inference="similar to DNA sequence:INSDC:YBR079C"
                     /note="similar to Saccharomyces cerevisiae RPG1 (YBR079C);
                     ancestral locus Anc_3.303"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681117.1"
                     /db_xref="GeneID:11502340"
                     /db_xref="GOA:G8ZTG2"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR027512"
                     /db_xref="UniProtKB/TrEMBL:G8ZTG2"
                     /translation="MAPPALRPENALKRADELISVGQHQAALQSLYDYMTARRIRWAQ
                     PSAIEPIVFRFLALGVELKRGRFIKDGLHQYKKLVQGSPEGLASVGAVARKYIDLVET
                     KMASEQAKAEELQKEEEDDDLEGGVTPENLLTSVYENDQSVGGFNDEAVTSWLKFTWE
                     SYRAVLDLLRNNSHLEITYSGVVSRSMQFCLKYNRKNEFKRLAEMLRQHLDAANYQQS
                     KSGNNIVDLSDDSTLQRYLEQRFHLVNVCVKLELWHEAYKSIEDVYHLSKMSEKQPKP
                     STLANYYENLAKVFLISGNQALHTAAWVKFFKLFRTNKNAKEEDLQRYASIVMLSALA
                     IQPDYLPTVGYDPQMRLNRLLGFDAKPSKKDSLDAALQEDIYSRVDADIKQLYELLEV
                     NYDSATIKEELAALLPKLTAKPYFDQYASSLRNLIVRKLFVSASQEHDSMGTDELYKF
                     ATLPAPLNMSYWDLEKSLLQAAIEDYVSFQIDHENNTVTFVKDPLEAFASSLTTEGEE
                     QPEEEDVEEKEAADEEEDEGEETAVGEDGENDDTAAEPEPVVTRNAYIRKALTSLSMV
                     LYETDSFKKASYLEKVRIARESLIQQTQEVIDNAKRLAEERAKKSQERKQEYMASAAV
                     NAEQDAELRQKRIMEERAAIEAKMEEEAQRRLVEKKKRELEALKLREVKNFIEEVNKN
                     GQVYIDPKEAKNMEIKDARKIIVEQLSKDQAELDERMSYALKKLDHTERALRKVELPL
                     LKKESEALTGADMDKYEAMKGKILKTARDEHEARLADHDRLVKAFDDYKQLRNRLRSQ
                     YEDKFGKERAEKQAQFEAAKKARIEEIRQKRYEELVAKRKEELALQERQESIRKQAEL
                     AKKQDEISRKQRELEEAAARKNASAPRADPFGRAQKTKEDMDRIAARQREMEEAAAKR
                     QAGAPRTDPFGRAQKSKEDLDRIAARQREMEEAAANKQAGSSTAKPASTEGRPMTFAE
                     KMRAKRAAKTNGN"
     gene            complement(<604102..>605445)
                     /gene="TDEL0D03230"
                     /locus_tag="TDEL_0D03230"
                     /db_xref="GeneID:11502341"
     mRNA            complement(join(<604102..605327,605391..>605445))
                     /gene="TDEL0D03230"
                     /locus_tag="TDEL_0D03230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681070.1"
                     /db_xref="GeneID:11502341"
     CDS             complement(join(604102..605327,605391..605445))
                     /gene="TDEL0D03230"
                     /locus_tag="TDEL_0D03230"
                     /inference="similar to DNA sequence:INSDC:YBR078W,YDR055W"
                     /note="similar to Saccharomyces cerevisiae ECM33 (YBR078W)
                     and PST1 (YDR055W); ancestral locus Anc_3.302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681118.1"
                     /db_xref="GeneID:11502341"
                     /db_xref="GOA:G8ZTG3"
                     /db_xref="InterPro:IPR000494"
                     /db_xref="UniProtKB/TrEMBL:G8ZTG3"
                     /translation="MQFKSTIFAAALAATALAANDTDVPSSCSISSGATATAQADLDQ
                     YSGCTTLVGDLEITGDSLTSASLANVEELQGSLIVNNASKLNDFHADSLKKVTDTLSL
                     QKLYILSAASFGALEEVDTIQFITLPAISTFTTNLKSANIIYVSDTALETVNAFTSLQ
                     KVASFNMNNNKGLGNLESDLETVSDSLEFSSNGNDANVTFDKLIWANNITIRDVESAS
                     FTNLESVNQSLGFINNSISTLNLSSLSSVGGSFSVVSNDELTEVDAKNLTSVGGGFVV
                     ANNTDFKSINGFSKLATVGGALVATGNFTELDLSSLKSVKGGAQVDTSSGNFSCDALK
                     SLQSKGAIQGDSFVCKNGATSTSIKLSSTSGSSSGSSSRTATSSGASSSGSVSDSSDS
                     SSTSTHTSRGAAAADFAPAGSILGVFAAVAAALL"
     gene            complement(<605872..>607584)
                     /gene="TDEL0D03240"
                     /locus_tag="TDEL_0D03240"
                     /db_xref="GeneID:11502342"
     mRNA            complement(<605872..>607584)
                     /gene="TDEL0D03240"
                     /locus_tag="TDEL_0D03240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681071.1"
                     /db_xref="GeneID:11502342"
     CDS             complement(605872..607584)
                     /gene="TDEL0D03240"
                     /locus_tag="TDEL_0D03240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681119.1"
                     /db_xref="GeneID:11502342"
                     /db_xref="GOA:G8ZTG4"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR015830"
                     /db_xref="InterPro:IPR020556"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="UniProtKB/TrEMBL:G8ZTG4"
                     /translation="MTLASESIAQPVDAAKFKQFEPLIAKYNEAKWAQMKEFDAKFLE
                     LCRSKIPSDAVLDAEPIDARKFVTSAGLLSESEAQIVNEFSIKELLDKQLAGELSAEQ
                     ITRAYIKSAIIAQLATNCVMQFLIPSALERAKELDLYLKENGKLFGPMHGVPISLKEQ
                     MGYKGQVTCASYVSLIDNVVKKSSVSIQIFDKLGAVFHARTSQPQAIMHLDTWNNIIG
                     RTRNPCSTRLSPGGSSGGESAMVAMHGSAIGIGSDIGGSIRCPAAFTNVFGLKPTTKR
                     LSSMNGISGGRGQESIPSTEGPIARSIQDLEYFMDVYLNQGKPWEYDPTSLVIPWRPA
                     EVEEKIRIGVLFDDNLVTPHPAVKRALQQVVSQLGEQFEIVDLADSWFSQEEMLAIHN
                     TTLSLYTIDGNRSQLELISPSGEPILPLTKHFLNFGQGKELSIYDNRKLNIFRDSTKL
                     ALLERFFSQSPTSKKLHFILSPTYPAPSEIPGNSLYWGYTSFWNLTDYPNVVFPTSYT
                     HDPKLDSLPPTQLKQNEFEESVWSNYNPDAYVGGPVGLQLTGKRFDDERIVQAVKKIT
                     SVLK"
     gene            <608173..>609543
                     /gene="TDEL0D03250"
                     /locus_tag="TDEL_0D03250"
                     /db_xref="GeneID:11502343"
     mRNA            <608173..>609543
                     /gene="TDEL0D03250"
                     /locus_tag="TDEL_0D03250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681072.1"
                     /db_xref="GeneID:11502343"
     CDS             608173..609543
                     /gene="TDEL0D03250"
                     /locus_tag="TDEL_0D03250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681120.1"
                     /db_xref="GeneID:11502343"
                     /db_xref="GOA:G8ZTG5"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G8ZTG5"
                     /translation="MSTDIEDSKEILQEPDEIEVPDGGYGWVVLVAFFLFNFCTWGAN
                     AGYAIYLTEYLDHNVFPGGTKLDYSAVGGIAFGAGLLFAPFITWFSHKFTLHLTIALG
                     IVFQGAALLLAAFSKKLWQIYLTQGLLISFGLAFLFIPAMTLIPQWFRKKGTVASGIG
                     TGGSGLGGIVFNLGMQRIVEARGVKWALIAQCIICSSLSTIALILTRTRRSAVFKDEK
                     PKTLIVARQVFSKAGTWLLCGWISFTMLGYVILLYSLSAFTTSLGYSAKQGSVVSCMV
                     SVGFLFGRPTVGHLADLFGPITVGIIVHLIVAIFAWAMWIPCSNLATAIIFALIVGSL
                     MGTIWPTVASIAARVVGLKKLDVTLGSMWVFLAIFGMPAPVIGFKLRSNANDGKAYVN
                     TAIFAGFGYLGASLCLLLLRGYIIARDRSSAKSDSMDQDELDVDVSFKEFVRGLTTWN
                     VPKGKV"
     gene            <610053..>610922
                     /gene="TDEL0D03260"
                     /locus_tag="TDEL_0D03260"
                     /db_xref="GeneID:11502344"
     mRNA            <610053..>610922
                     /gene="TDEL0D03260"
                     /locus_tag="TDEL_0D03260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681073.1"
                     /db_xref="GeneID:11502344"
     CDS             610053..610922
                     /gene="TDEL0D03260"
                     /locus_tag="TDEL_0D03260"
                     /inference="similar to DNA sequence:INSDC:YDR054C"
                     /note="similar to Saccharomyces cerevisiae CDC34
                     (YDR054C); ancestral locus Anc_3.301"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681121.1"
                     /db_xref="GeneID:11502344"
                     /db_xref="GOA:G8ZTG6"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:G8ZTG6"
                     /translation="MSNRKSTAASLLLRQYRELTDPKKAIPSFHIELEDDSNIFVWNI
                     GVMVLNEESIYHGGYFKAQMRFPEDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQS
                     GDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPDQYKQRV
                     KMEVERSKQDIPQGFIMPTSDSAYLSKLGKREEPEETKDMADNFWYDSDLDDDDNVGG
                     DVNDDCFSYDDDDVYNYQGGYSNNDDEDGDGIEFEDDNDSMDNDSVMDRKKPHKAEDE
                     SEDLEEVERVGKR"
     gene            <611266..>611742
                     /gene="TDEL0D03270"
                     /locus_tag="TDEL_0D03270"
                     /db_xref="GeneID:11502345"
     mRNA            <611266..>611742
                     /gene="TDEL0D03270"
                     /locus_tag="TDEL_0D03270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681074.1"
                     /db_xref="GeneID:11502345"
     CDS             611266..611742
                     /gene="TDEL0D03270"
                     /locus_tag="TDEL_0D03270"
                     /inference="similar to DNA sequence:INSDC:YBR077C"
                     /note="similar to Saccharomyces cerevisiae SLM4 (YBR077C);
                     ancestral locus Anc_3.300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681122.1"
                     /db_xref="GeneID:11502345"
                     /db_xref="InterPro:IPR020233"
                     /db_xref="UniProtKB/TrEMBL:G8ZTG7"
                     /translation="MIIQSRNVKTLLDTLLKPVEIEPISFTTNPLQSSVLLASTNGSV
                     ISFSNSSSVNGDSHSVNNLKMMSLLIRDKWSEDQAQTDDRPASNRYKYELDNTGLNTN
                     IYTYEIEDLHACVAQIPQSDLLLLFIADASYPYGLLVLKMKKSLLAFQDMYGYKLD"
     gene            <611996..>613681
                     /gene="TDEL0D03280"
                     /locus_tag="TDEL_0D03280"
                     /db_xref="GeneID:11502346"
     mRNA            <611996..>613681
                     /gene="TDEL0D03280"
                     /locus_tag="TDEL_0D03280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681075.1"
                     /db_xref="GeneID:11502346"
     CDS             611996..613681
                     /gene="TDEL0D03280"
                     /locus_tag="TDEL_0D03280"
                     /inference="similar to DNA sequence:INSDC:YDR052C"
                     /note="similar to Saccharomyces cerevisiae DBF4 (YDR052C);
                     ancestral locus Anc_3.299"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681123.1"
                     /db_xref="GeneID:11502346"
                     /db_xref="GOA:G8ZTG8"
                     /db_xref="InterPro:IPR006572"
                     /db_xref="InterPro:IPR013939"
                     /db_xref="UniProtKB/TrEMBL:G8ZTG8"
                     /translation="MVARSPLRETDANLQQRPVDVGEDGIVRGGLVTKKRTLERIELQ
                     ERKKCKAERARSIEGAVKVNKTTAMKNIEPKVTPSELLDWQNNWKRIMRRESRIYFDT
                     ADETESSKLVKSKMDKRKDLLKSGFVSLGAQITQFFDCNVTIVITRRPIDNIHLLPES
                     DILSRAKKGYMKVWGYEKAFRFLKNLDVELHDLEKTRQTWMHLACQIYCKMKSCMVRP
                     IETPGLDAMIFNYFKFPHVYMFDLWQTWAPIITLEWKPQELKDLKKLPYPVLKMGTFG
                     RCPFIGDGNCDETSYRRVIKRYARDKSNKNYALKLRRMYQFSAQPNLHQQELIIIPHT
                     CLDSKRCYETWKSTVSEESGEEEQTSSASCKESSKTLKIRQEPSVEVGELVLEPKKPA
                     TMGLARQETEEFPDDLCDKKKSRVTQEIKASGAHQSNDVATSFGNGLGPTTASVMNKN
                     LKTLSRLVVDRRLGAKATNVPHGPAPQCNESVQKPAEINDEQTTKKRKVEAKVTQPTK
                     NEVVKNAGYCENCRVKYESLDGHIVTEKHQLFAQNDFNFEMIDSLIEKLRFQF"
     gene            complement(<613799..>614782)
                     /gene="TDEL0D03290"
                     /locus_tag="TDEL_0D03290"
                     /db_xref="GeneID:11502347"
     mRNA            complement(<613799..>614782)
                     /gene="TDEL0D03290"
                     /locus_tag="TDEL_0D03290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681076.1"
                     /db_xref="GeneID:11502347"
     CDS             complement(613799..614782)
                     /gene="TDEL0D03290"
                     /locus_tag="TDEL_0D03290"
                     /inference="similar to DNA sequence:INSDC:YBR076W"
                     /note="similar to Saccharomyces cerevisiae ECM8 (YBR076W);
                     ancestral locus Anc_3.297"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681124.1"
                     /db_xref="GeneID:11502347"
                     /db_xref="InterPro:IPR028012"
                     /db_xref="UniProtKB/TrEMBL:G8ZTG9"
                     /translation="MHDYSDLLPIASDLEYWIDSSSTYVDDDSHLETDRDSGLDTLDC
                     FSKRKLPANREASLSQDVFLELVPRDSLCKHSLLPRQHRVLVLPRSFQHHRIQKWLKS
                     QILEQGFDLKKNFQCPPSRCSNDQSNANACSDLNWISYRYMRVSSAGKQVMCRLCHGR
                     NWISSCSFFKHLFLAHGIMTQVKSNYASNFQVETFKITDYFTVKVQTIQSVEFTRNLL
                     PYLEVSLVPLPEKKFSKVLNNGFRRTHVVCPHCSKWIRLGWCEYDEIIRQDFEDFDSF
                     RNLNIENYSKISYVQKRDRDSIEGLYENYFIHYIECDFTRFQSKYLYVQIV"
     gene            <615663..>617975
                     /gene="TDEL0D03300"
                     /locus_tag="TDEL_0D03300"
                     /db_xref="GeneID:11502348"
     mRNA            <615663..>617975
                     /gene="TDEL0D03300"
                     /locus_tag="TDEL_0D03300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681077.1"
                     /db_xref="GeneID:11502348"
     CDS             615663..617975
                     /gene="TDEL0D03300"
                     /locus_tag="TDEL_0D03300"
                     /note="ancestral locus Anc_3.296"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681125.1"
                     /db_xref="GeneID:11502348"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G8ZTH0"
                     /translation="MDHIASLSNEITLACGSLALRMNKMSLTLELVSRVLEKNPSDKA
                     ALMLLAKTHLLKNEYSDVIGLLQAVDKDRKLWEVFSLACYKLIRFDLAVEAIGHCEEE
                     DDKHDEDINLGVRHLECRILLLADAKKYPLEATVQKFERTLKLTQRSKRPSIHLEALF
                     TRAQLFEKNNQWGKCCNDLQDSIDILQSPDAVNHFHVKDFIFKATFAYIYKVFLSWKM
                     HANTQLIDQLFRDSMKFAHTTRTLQSVNLAQFIYKMLSHQEIDLQGFMNEVASYTDDL
                     RPFACYIVARALIESDLQGNDAKAFEYLQLSLTLNKNKPHVWISMGSMFLRSKRIPDA
                     LSAYSKALELVHSTKETHNFLSKHLLPGLNENVKSFAYFGTAQAYMMSNDIDNASVAL
                     RQCLNSLSGDDKDAMEKSGLEDLINVLNISMSVDLEKLKESLTIPEIPLSLFLNPMFY
                     LQESQVFQIKETVLETSRTTLKSMPLAIPPTTTESTPKNNPNFKKKIMKKPHETVKPS
                     KLRRRKRNDIFRRANLSISKNKHITNHPKKKQSHHPENDNHTPNTPASNNHTHSYDHP
                     ILHNRDSSNRVNETNSNSNHQDSQINNNTTGIEHINIQSFPSIPSSTIYDSNFIPQYG
                     SLYVNNEQSHLTRAAPFNHTNITASNTPSIYPHPAQVIHYFQPVDFPASPSFYYPQPS
                     LEEAYRNNSNGMDSHSPPQTYGRPVMMPQYSNSFYPSDQPRFSASLPTRTAPFMTQQP
                     LQQQRPFLPADNSNCDSTSGDSSQIASFIN"
     gene            complement(<618078..>620933)
                     /gene="TDEL0D03310"
                     /locus_tag="TDEL_0D03310"
                     /db_xref="GeneID:11502349"
     mRNA            complement(<618078..>620933)
                     /gene="TDEL0D03310"
                     /locus_tag="TDEL_0D03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681078.1"
                     /db_xref="GeneID:11502349"
     CDS             complement(618078..620933)
                     /gene="TDEL0D03310"
                     /locus_tag="TDEL_0D03310"
                     /inference="similar to DNA sequence:INSDC:YBR074W"
                     /note="similar to Saccharomyces cerevisiae YBR074W;
                     ancestral locus Anc_3.295"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681126.1"
                     /db_xref="GeneID:11502349"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="UniProtKB/TrEMBL:G8ZTH1"
                     /translation="MLAEVFRSIFRFRKTTVSLLCVLTYAIIGILYVYDHTHYKYVLP
                     SSSDFHRSSTLLENAWLDLQNITETFHPYTSRANVEVHDYLLDRVTNITQSVPYAKVS
                     DDVAERRSTIVKRVNKVNSTTSFGQISYFESGNILVKLEGKISELPALLLSAHYDSVP
                     TGHGATDDGKGIVSLLGILDYYAAEQPKRTMLFNFNNNEEFGLLGAEAFFSHPWSNLT
                     LYFINLEGTGTGGKSVLFRTSDASTAKMYQKAVVKSPFGNSIYQQGFNDRLVRSETDF
                     VVYARKELRGFDIAFYKPRDLYHTIKDSIQYTSREALWHMFHTAWQLSDYMVMNSNID
                     DEDFTAAVYFDILGLRFVTISAKTLFRSGSTLLVLMPVLTFLVDFIGRKKNKETKGFW
                     NIWLRLPLSLAISIGLVRGTQSFIQAVNPFIISRDYLSPLFALSSEFVLINYLVLSLF
                     EYLSRTADFKTIALRELAVLLWINLFVQTVKLYTSGYKETGTYPFTIFYMTTSLGCIM
                     GYICRSFGKKRAEPVASKRPQAETSYGSQIVDEERGGEPDQQSIGSGRSSGINENGSQ
                     HEHSEEVPLDERAPLLQTSKSKDDHKSKPIVKGLITKALNYDWSLQFLITLPIATFFL
                     FNSVDLILDALNQTIQEGSKSTINTWNILFLGSILIVLPLLPFTYKLNYLVGLLFAIS
                     FGISLALSLLQSPFTEQSPLKLRFEQTVDMNNSTDAIVSVLGRKGGFVSSVLDDLPSV
                     KEQRKQVWCESLGDGNEQCSYVGYPPNLFDSSSPLKPQDIFAIEILKDDRNSADRSSY
                     APINAVLRINARENRACKVRFNSNFNTNSPVRQITIDKEGMGKNTTLEVIKLSSGINE
                     VQLHKLDFDKPYYNIGVQWLPNIINTNSKREDRDADALEVTVTCFWGEYDSESQLGHS
                     HKRKLPAFDELLEYSPVNVIYTNREKGLFKFMDSVTL"
     gene            <621131..>622246
                     /gene="TDEL0D03320"
                     /locus_tag="TDEL_0D03320"
                     /db_xref="GeneID:11502350"
     mRNA            <621131..>622246
                     /gene="TDEL0D03320"
                     /locus_tag="TDEL_0D03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681079.1"
                     /db_xref="GeneID:11502350"
     CDS             621131..622246
                     /gene="TDEL0D03320"
                     /locus_tag="TDEL_0D03320"
                     /inference="similar to DNA sequence:INSDC:YDR047W"
                     /note="similar to Saccharomyces cerevisiae HEM12
                     (YDR047W); ancestral locus Anc_3.294"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681127.1"
                     /db_xref="GeneID:11502350"
                     /db_xref="GOA:G8ZTH2"
                     /db_xref="InterPro:IPR000257"
                     /db_xref="InterPro:IPR006361"
                     /db_xref="UniProtKB/TrEMBL:G8ZTH2"
                     /translation="MGSSQSVASQDFAQLKNDLLLRAARGERVERPPCWIMRQAGRYL
                     PEYHEVKNGRDFFETCRDAEIASEITIQPVRRYAGLLDAAIIFSDILVIPQAMGMKVE
                     MVEGHGPSFPEPLRTVDDLVKVLDYEVDVLKELDWAFKAITLTRKKLDGQVPLFGFCG
                     GPWTLLVYMTEGGGSRLFRFAKTWINEHPDWSHKLLQKITDVAIEFLAQQVVAGAQIL
                     QVFESWGGELSSDDFDEFSLPYLKEIAAKVPKRLAELGVTENIPMIVFAKGSWYALDK
                     LCGAGYNAVSLDWLWNPKEATKINDGRVTLQGNFDPGAIYGTNENITKKVEKMIKGFG
                     GGKQHYIVNFGHGTHPFMDTEKIRFFLEECHRIGSQK"
     gene            <622416..>624179
                     /gene="TDEL0D03330"
                     /locus_tag="TDEL_0D03330"
                     /db_xref="GeneID:11502351"
     mRNA            <622416..>624179
                     /gene="TDEL0D03330"
                     /locus_tag="TDEL_0D03330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681080.1"
                     /db_xref="GeneID:11502351"
     CDS             622416..624179
                     /gene="TDEL0D03330"
                     /locus_tag="TDEL_0D03330"
                     /inference="similar to DNA sequence:INSDC:YDR049W"
                     /note="similar to Saccharomyces cerevisiae YDR049W;
                     ancestral locus Anc_3.293"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681128.1"
                     /db_xref="GeneID:11502351"
                     /db_xref="GOA:G8ZTH3"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8ZTH3"
                     /translation="MVEVTQFKKNDLYIYELSANVLDSLKLITFDSTLHEVDPVPTAT
                     AAANGASAQTTKPTSDSLECNVCGMTFETLQRNREHRRTDLHTYNVKRNMKDLSPIGE
                     DKFQDLISSKEGTPHATDIHNPSADDDQEDRDNDESESDEFYREQSNFLDDLLEDEVT
                     NMSIDDNSGGVVSHLNTRSPQIYFNSTLLQNSDAFGIYKALFTEDQTIKPLQSVKEWN
                     FNKDQSSTVSALFMVGGGHFAGAIVSHQRANVNGNARKQDQSLQEQAVVFLEHKTFHR
                     YTTRRKQGGSQSAMDQAKGKANSAGSDLRRYNEAALKLDIKNLLAEWEPYLRNCENVF
                     LRATNIHERKVFTDNREIKKIENKVKSFPFTTGRPTVAELKRSWCELSYLKKVAKPQP
                     LALKEPNVSSDITKTSKNEDKEPSKEISPEELHTKELLQFLKKAKAPLLVAYLRKRGL
                     DVNFRLAPKSQYSVTPTMLHFAAQQGLRQMVTILISNLKSDPCIENEYGKTAWDLAKS
                     SDVRYAFQLARHKLGENYTDWSKSHIDKPLSREDIDILNKEKLDNEKKETDEAIKREL
                     ENVRERQKAELEDKKRFWENS"
     gene            complement(<624367..>627105)
                     /gene="TDEL0D03340"
                     /locus_tag="TDEL_0D03340"
                     /db_xref="GeneID:11502352"
     mRNA            complement(<624367..>627105)
                     /gene="TDEL0D03340"
                     /locus_tag="TDEL_0D03340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681081.1"
                     /db_xref="GeneID:11502352"
     CDS             complement(624367..627105)
                     /gene="TDEL0D03340"
                     /locus_tag="TDEL_0D03340"
                     /inference="similar to DNA sequence:INSDC:YBR073W"
                     /note="similar to Saccharomyces cerevisiae RDH54
                     (YBR073W); ancestral locus Anc_3.292"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681129.1"
                     /db_xref="GeneID:11502352"
                     /db_xref="GOA:G8ZTH4"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZTH4"
                     /translation="MHLPKYENKPFKPPRRIGATEAVIKSSPAKAVGFKRTPSSQAPR
                     SEPKRPKTPYAAGPVEGTSVACQKIYTLMHRKPTNKKHKTWNGDGYAISKSPDRFTFY
                     DDSGKFIGGSSYAGENELTETIFRAGGLEIQLDYEIVSADERREAKVVLQQSNNTSKI
                     NGRNSAKSEVSGQKGLSPSPPIPIPEQFEKKSMPKFKSAFKPSKILTPLSGPLKSVKQ
                     KYLPVFDISKIESPVLMNKFAEADVDVVVDPLVGKNLRPHQREGVKFMYDCVSGLAKP
                     TGKPPTIDQTTTSLILERDSDISGCLLADEMGLGKTLMTIALIWTLLKQTPMASQVPC
                     SQSGVPLQGLCSKVLIVCPVTLIANWKREFGKWLNLSRIGVLTLSPSNTAEKDKYDVR
                     NFLKVQRTYQVLIIGYEKLLTVSNELKSGKDALDLLVCDEGHRLKNGASKILNILKSL
                     DIGKKVLLSGTPIQNDLNEFYTVVDFINPGILGSFSHFKKRFMNPILRARDPANRYNE
                     LAVEKGEERSKEMIEITQRFTLRRTNSILAEFLPPRTDMILFCKPTEAQVSAFKDILQ
                     GAQIDLKGLNANSSLSLITLLKKVCNSPSLISSDSFYHSTLENSKISAKYQRALNSGK
                     LKVLMALLERIRNGTDGEKVVVVSNYTQTLDIIENLMRSADMKTCRLDGSTQSKRRDS
                     IVTSFNRDPTMFAFLLSAKSGGVGLNLIGASRLILFDNDWNPSVDLQAMSRIHRDGQK
                     RPCYIYRLITAGCIDEKILQRQLAKHSLSQKFLCDNKAENGHADDDLFNKEDLKNLFT
                     VMTDVSSNTHDLICSCEGEGEEITIEDQETRDVTPSPVTANKLDSWQTALDAQQTIED
                     YNAKIEKVQTNLIKKCLVGYKHINPRKVDDLLDTVATEAVRRLSSDVVFVFVKPGE"
     gene            complement(<627442..>628068)
                     /gene="TDEL0D03350"
                     /locus_tag="TDEL_0D03350"
                     /db_xref="GeneID:11502353"
     mRNA            complement(<627442..>628068)
                     /gene="TDEL0D03350"
                     /locus_tag="TDEL_0D03350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681082.1"
                     /db_xref="GeneID:11502353"
     CDS             complement(627442..628068)
                     /gene="TDEL0D03350"
                     /locus_tag="TDEL_0D03350"
                     /inference="similar to DNA sequence:INSDC:YBR072W"
                     /note="similar to Saccharomyces cerevisiae HSP26
                     (YBR072W); ancestral locus Anc_3.291"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681130.1"
                     /db_xref="GeneID:11502353"
                     /db_xref="InterPro:IPR002068"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:G8ZTH5"
                     /translation="MSFNSPFFSFFDAINNEVDAFNRALDNHGYGSYQPRRQIASGGQ
                     DEKQVAKKDNASREVQAPRHLTDWFDNDWSILPRDFGSSNLTPPVDILDHDKNYDIKV
                     TVPGVKDKKSIHLEYHKEKNQIVITGEIPSGSSAEDKDKVKVQERAYGKFKRVISLPE
                     YPRIDADNIKADYNSGILTLTVPKLEPSKNGEDAVKKIEISSEESWGN"
     gene            complement(<628544..>629080)
                     /gene="TDEL0D03360"
                     /locus_tag="TDEL_0D03360"
                     /db_xref="GeneID:11502354"
     mRNA            complement(<628544..>629080)
                     /gene="TDEL0D03360"
                     /locus_tag="TDEL_0D03360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681083.1"
                     /db_xref="GeneID:11502354"
     CDS             complement(628544..629080)
                     /gene="TDEL0D03360"
                     /locus_tag="TDEL_0D03360"
                     /inference="similar to DNA sequence:INSDC:YBR071W"
                     /note="similar to Saccharomyces cerevisiae YBR071W;
                     ancestral locus Anc_3.290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681131.1"
                     /db_xref="GeneID:11502354"
                     /db_xref="UniProtKB/TrEMBL:G8ZTH6"
                     /translation="MLRRTKANSKKRHSMFLDIRSSITAQGALDEEDKFDAYQGKNKS
                     ADTLPLDDFASTSSTMNSTKKPQRKGKLKRSSVILDNTLVRDYNLAIRHFEKLDTRTM
                     QASHSNKSIASTGSTVSSLFSSTSTTSIRDLLYDAMEKEYEEDCQIIDKSHNMNFDCR
                     LRADGTSSRYIRTNLDFE"
     gene            <629476..>630192
                     /gene="TDEL0D03370"
                     /locus_tag="TDEL_0D03370"
                     /db_xref="GeneID:11502355"
     mRNA            <629476..>630192
                     /gene="TDEL0D03370"
                     /locus_tag="TDEL_0D03370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681084.1"
                     /db_xref="GeneID:11502355"
     CDS             629476..630192
                     /gene="TDEL0D03370"
                     /locus_tag="TDEL_0D03370"
                     /inference="similar to DNA sequence:INSDC:YBR070C"
                     /note="similar to Saccharomyces cerevisiae ALG14
                     (YBR070C); ancestral locus Anc_3.289"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681132.1"
                     /db_xref="GeneID:11502355"
                     /db_xref="InterPro:IPR013969"
                     /db_xref="UniProtKB/TrEMBL:G8ZTH7"
                     /translation="MKVEFVFVGLLLAYAALVVRLISILPFFKGYSNGFDNQDGSLKV
                     SLFEHKAKRPLRLFLFLGSGGHTGEMLRLIENYKRVLLAKGNTICVGYSDQKSKECFV
                     RSIASEYPDCRFEYYQFKKAREVNASLLQSLISVLQTLLTSLKNVIKISSDFRQGPHL
                     VLLNGPGTCCIIATWFKMLEFLNFAQPCSNLVYVESLARINTLSLTGKILYYIADVFI
                     VQWQELTSQNPRAKCFGILV"
     gene            complement(<630256..>631002)
                     /gene="TDEL0D03380"
                     /locus_tag="TDEL_0D03380"
                     /db_xref="GeneID:11502356"
     mRNA            complement(<630256..>631002)
                     /gene="TDEL0D03380"
                     /locus_tag="TDEL_0D03380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681085.1"
                     /db_xref="GeneID:11502356"
     CDS             complement(630256..631002)
                     /gene="TDEL0D03380"
                     /locus_tag="TDEL_0D03380"
                     /inference="similar to DNA sequence:INSDC:YDR050C"
                     /note="similar to Saccharomyces cerevisiae TPI1 (YDR050C);
                     ancestral locus Anc_3.288"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681133.1"
                     /db_xref="GeneID:11502356"
                     /db_xref="GOA:G8ZTH8"
                     /db_xref="InterPro:IPR000652"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR020861"
                     /db_xref="InterPro:IPR022896"
                     /db_xref="UniProtKB/TrEMBL:G8ZTH8"
                     /translation="MARTFFVGGNFKLNGSKKSIKEIVERLNQASLSENVEVVLCPPA
                     PYLEYTASLVQKKQITVGAQNTWTKASGAFTGENSVDQVLDVGAKWVILGHSERRTIF
                     HEDDKLIAEKTKFALDQGAGVIFCIGETLEEKKAGVTLDVCERQLNAAIAEVKDWTNV
                     VVAYEPVWAIGTGLAATAEDAQDIHASLRKLLAAKLGDKVAQQTRILYGGSANGSNVA
                     SFKDKADVDGFLVGGASLKPEFVDIVNSRK"
     gene            complement(<631409..>632380)
                     /gene="TDEL0D03390"
                     /locus_tag="TDEL_0D03390"
                     /db_xref="GeneID:11502357"
     mRNA            complement(<631409..>632380)
                     /gene="TDEL0D03390"
                     /locus_tag="TDEL_0D03390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681086.1"
                     /db_xref="GeneID:11502357"
     CDS             complement(631409..632380)
                     /gene="TDEL0D03390"
                     /locus_tag="TDEL_0D03390"
                     /inference="similar to DNA sequence:INSDC:YDR051C"
                     /note="similar to Saccharomyces cerevisiae YDR051C;
                     ancestral locus Anc_3.287"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681134.1"
                     /db_xref="GeneID:11502357"
                     /db_xref="GOA:G8ZTH9"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G8ZTH9"
                     /translation="MPTEQTSQMSEPVFEAATCHKPRLIILIRHGESESNKDKTINQH
                     TPNHQIPLTENGWKQARQAGIDLLRVLNLDDYSIVDKLEEQCKEENGTKKELPLRNYS
                     PLSKKKDTNVVFYTSPYKRARQTLKGILNVFDEYNELNCGVKVSEDEKYHTTGKSKFA
                     LWYPPTFPSGFYENRRRSPVEELSDGKNFLQYRVKDDPRIREQDFGNFQQVNSMQDVM
                     KKRSTYGHFFYRFPEGESAADVYDRVASFQETLYRYFERTNKRPRDAVVLVTHGIYCR
                     VFLMKWFRWTYEEFESFTNVPNGSMIVMEFDNSTDRYVLRTELPKWC"
     gene            <632541..>633026
                     /gene="TDEL0D03400"
                     /locus_tag="TDEL_0D03400"
                     /db_xref="GeneID:11502358"
     mRNA            <632541..>633026
                     /gene="TDEL0D03400"
                     /locus_tag="TDEL_0D03400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681087.1"
                     /db_xref="GeneID:11502358"
     CDS             632541..633026
                     /gene="TDEL0D03400"
                     /locus_tag="TDEL_0D03400"
                     /note="ancestral locus Anc_3.286"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681135.1"
                     /db_xref="GeneID:11502358"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:G8ZTI0"
                     /translation="MFRVELTRIAGNNAKLKNPTRRLFWNWFSSGLGKGPETREPNQM
                     FLSIRNENEMTDTLIASSKTPLIMNFTMRNNAPCDKLTGALNRIVTLETDKKVNVVDV
                     ETDWSGTKECTLRFGVNNIPMLVAVRKTFPVDYYTPKDLTNQDVDWYGLKAWIEKNAD
                     P"
     gene            <633162..>633494
                     /gene="TDEL0D03410"
                     /locus_tag="TDEL_0D03410"
                     /db_xref="GeneID:11502359"
     mRNA            <633162..>633494
                     /gene="TDEL0D03410"
                     /locus_tag="TDEL_0D03410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681088.1"
                     /db_xref="GeneID:11502359"
     CDS             633162..633494
                     /gene="TDEL0D03410"
                     /locus_tag="TDEL_0D03410"
                     /inference="similar to DNA sequence:INSDC:YDR045C"
                     /note="similar to Saccharomyces cerevisiae RPC11
                     (YDR045C); ancestral locus Anc_3.283"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681136.1"
                     /db_xref="GeneID:11502359"
                     /db_xref="GOA:G8ZTI1"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR001529"
                     /db_xref="InterPro:IPR012164"
                     /db_xref="UniProtKB/TrEMBL:G8ZTI1"
                     /translation="MLSFCPLCNNMLLIASADSGVYSLSCRSCPYEFPIEGIEIYDRK
                     KLPRKEVDDVLGGGWDNVDQTKVQCPNYDICAGESAYFFQLQIRSADEPMTTFYKCVN
                     CGNRWKEN"
     gene            complement(<633587..>634570)
                     /gene="TDEL0D03420"
                     /locus_tag="TDEL_0D03420"
                     /db_xref="GeneID:11502360"
     mRNA            complement(<633587..>634570)
                     /gene="TDEL0D03420"
                     /locus_tag="TDEL_0D03420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681089.1"
                     /db_xref="GeneID:11502360"
     CDS             complement(633587..634570)
                     /gene="TDEL0D03420"
                     /locus_tag="TDEL_0D03420"
                     /inference="similar to DNA sequence:INSDC:YDR044W"
                     /note="similar to Saccharomyces cerevisiae HEM13
                     (YDR044W); ancestral locus Anc_3.282"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681137.1"
                     /db_xref="GeneID:11502360"
                     /db_xref="GOA:G8ZTI2"
                     /db_xref="InterPro:IPR001260"
                     /db_xref="InterPro:IPR018375"
                     /db_xref="UniProtKB/TrEMBL:G8ZTI2"
                     /translation="MPAPQDPQHLPIRQQMEALIRRKQQEITQGLESLDTVKFTADSW
                     TRGNDGGGGTSMVIQNGETYEKGGVNVSVVYGQLSPQAVTAMKHDHKNLNLVSDPATG
                     APHADGVKFFACGLSMVIHPHNPHAPTTHLNYRYFETWNPDGTPQAWWFGGGADLTPS
                     YLYEEDAKLFHQTHKDALDKHDKELYPRFKKWCDEYFYITHRGETRGIGGIFFDDYDE
                     RDPQEILKMVEDCFDAFLPSYLPIIAKRKDTPYTPEQKKWQAIRRGRYVEFNLIYDRG
                     TQFGLRTPGSRVESILMSLPEYASWLYNHHPEPGSEEEKLIKVTTKAREWV"
     gene            <635293..>635820
                     /gene="TDEL0D03430"
                     /locus_tag="TDEL_0D03430"
                     /db_xref="GeneID:11502361"
     mRNA            <635293..>635820
                     /gene="TDEL0D03430"
                     /locus_tag="TDEL_0D03430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681090.1"
                     /db_xref="GeneID:11502361"
     CDS             635293..635820
                     /gene="TDEL0D03430"
                     /locus_tag="TDEL_0D03430"
                     /inference="similar to DNA sequence:INSDC:YBR066C,YDR043C"
                     /note="similar to Saccharomyces cerevisiae NRG2 (YBR066C)
                     and NRG1 (YDR043C); ancestral locus Anc_3.281"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681138.1"
                     /db_xref="GeneID:11502361"
                     /db_xref="GOA:G8ZTI3"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8ZTI3"
                     /translation="MISQPVSVLPLPLASDAGIERKYFTLLPSIADTHVIEDDLKYRL
                     NKCAFDSPRRVSVNLPTPSTSPISSLSDFRTLPISPASSVYNSGSESSTSTDSSRRNR
                     VSKQEAGVSKVEQRRRHVCKVCSKGFTTSGHLARHNRIHTGEKNHFCPLEGCNQRFSR
                     HDNCIQHYRTHLRKK"
     gene            <636183..>637205
                     /gene="TDEL0D03440"
                     /locus_tag="TDEL_0D03440"
                     /db_xref="GeneID:11502362"
     mRNA            <636183..>637205
                     /gene="TDEL0D03440"
                     /locus_tag="TDEL_0D03440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681091.1"
                     /db_xref="GeneID:11502362"
     CDS             636183..637205
                     /gene="TDEL0D03440"
                     /locus_tag="TDEL_0D03440"
                     /inference="similar to DNA sequence:INSDC:YBR065C"
                     /note="similar to Saccharomyces cerevisiae ECM2 (YBR065C);
                     ancestral locus Anc_3.280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681139.1"
                     /db_xref="GeneID:11502362"
                     /db_xref="UniProtKB/TrEMBL:G8ZTI4"
                     /translation="MDDPPVVCDPCLGDSSNIRMTKATNGAQCKICTLPYTLFHFKPH
                     IRDANLTKTVICRRCALQRNICQCCMLDMVWHISVQLRDQMLAMIQKDRNVVTEEAQN
                     DMMRRFLALKGGKLGGAQITSDPNEIHSVLNKLQEVLHSNPVSVVKKIESAPLEKFKQ
                     YDISSLLRKLPLKDSFGTTEPCKSFFLYNVDASIPEWKISKAIAETVNNEQWQDRATT
                     ALVVNHKAKCGGIRFKSEELGQKFVETLQSSGSAFKTAENLERGVLKIDHFRLFVIPW
                     TSGFSASSFGATTGENIKLSLSLDKLIKLENSANLTAAAAPEKTKKNKVTKKRQTPKR
                     VSNLEL"
     gene            <637245..>637832
                     /gene="TDEL0D03450"
                     /locus_tag="TDEL_0D03450"
                     /db_xref="GeneID:11502363"
     mRNA            <637245..>637832
                     /gene="TDEL0D03450"
                     /locus_tag="TDEL_0D03450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681092.1"
                     /db_xref="GeneID:11502363"
     CDS             637245..637832
                     /gene="TDEL0D03450"
                     /locus_tag="TDEL_0D03450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681140.1"
                     /db_xref="GeneID:11502363"
                     /db_xref="UniProtKB/TrEMBL:G8ZTI5"
                     /translation="MNSCLNRLPNFHKKITELRIIKLISMLWFILVELPLRLIKTLIF
                     ARPAQLETSSIQGRYHYQTASLSDVMTEAYLSKDFSPLETSGKYTRLYYSPTLGLVVS
                     LLVFGTVLRLNFLRKTQLGLKSSFPVRAPRKRLLDVRNIPVEYDEELNTWCTLNCSTA
                     KGRKSAMGIPRLGLPQQTVQSGTIARSLIFQPTRN"
     gene            <637921..>638355
                     /gene="TDEL0D03460"
                     /locus_tag="TDEL_0D03460"
                     /db_xref="GeneID:11502364"
     mRNA            <637921..>638355
                     /gene="TDEL0D03460"
                     /locus_tag="TDEL_0D03460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681093.1"
                     /db_xref="GeneID:11502364"
     CDS             637921..638355
                     /gene="TDEL0D03460"
                     /locus_tag="TDEL_0D03460"
                     /inference="similar to DNA sequence:INSDC:YBR062C"
                     /note="similar to Saccharomyces cerevisiae YBR062C;
                     ancestral locus Anc_3.279"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681141.1"
                     /db_xref="GeneID:11502364"
                     /db_xref="GOA:G8ZTI6"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G8ZTI6"
                     /translation="MSDTEVRAQLREIFRREGLGDSTTVLQLLSQLIPESLQEEWLDQ
                     MAEADKKGCPESFVDSLPRVPKSEISPSSSCSICYVNYLNDGYPLVVRLPHCGHDFDL
                     ECLSVWFSKSTSCPLCRDDVLSHRAEVDTSQVELEEDWGMYG"
     gene            complement(<638384..>638944)
                     /gene="TDEL0D03470"
                     /locus_tag="TDEL_0D03470"
                     /db_xref="GeneID:11502365"
     mRNA            complement(<638384..>638944)
                     /gene="TDEL0D03470"
                     /locus_tag="TDEL_0D03470"
                     /product="mitochondrial 37S ribosomal protein RSM10"
                     /transcript_id="XM_003681094.1"
                     /db_xref="GeneID:11502365"
     CDS             complement(638384..638944)
                     /gene="TDEL0D03470"
                     /locus_tag="TDEL_0D03470"
                     /inference="similar to DNA sequence:INSDC:YDR041W"
                     /note="similar to Saccharomyces cerevisiae RSM10
                     (YDR041W); ancestral locus Anc_3.278"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM10"
                     /protein_id="XP_003681142.1"
                     /db_xref="GeneID:11502365"
                     /db_xref="GOA:G8ZTI7"
                     /db_xref="InterPro:IPR001848"
                     /db_xref="InterPro:IPR027486"
                     /db_xref="UniProtKB/TrEMBL:G8ZTI7"
                     /translation="MLRRLGVRLQSSVAKALPVNVEAVYHAPLKLPVEHGDLVADLQL
                     RSYDNENLDFYSDFILRAGYYLGMPLTGPKPLPTRRERWTVIRSPFAHAKSKENFERH
                     THKRLIRVWDSNPDVVQIWLSYISKHAITGVGMKCNVYQKSPIALELDSDAALPQNNT
                     PANSMDEAVGDKVLELLNSPDFKRHL"
     gene            <639066..>639965
                     /gene="TDEL0D03480"
                     /locus_tag="TDEL_0D03480"
                     /db_xref="GeneID:11502366"
     mRNA            <639066..>639965
                     /gene="TDEL0D03480"
                     /locus_tag="TDEL_0D03480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681095.1"
                     /db_xref="GeneID:11502366"
     CDS             639066..639965
                     /gene="TDEL0D03480"
                     /locus_tag="TDEL_0D03480"
                     /inference="similar to DNA sequence:INSDC:YBR061C"
                     /note="similar to Saccharomyces cerevisiae TRM7 (YBR061C);
                     ancestral locus Anc_3.277"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681143.1"
                     /db_xref="GeneID:11502366"
                     /db_xref="GOA:G8ZTI8"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR028590"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZTI8"
                     /translation="MGKSSKDKRDLYYRKAKEEGYRARSAYKLLQLNDNFHFLDDPSL
                     KRVVDLCAAPGSWSQVLSRKLFEGSDQQDRRIVAVDLQTMSPIDHVTTLQADITHPRT
                     LQRILQLFGDEPADLVISDGAPDVTGLHDLDEYVQQQLVMSALQLACCVLKPKGSFIA
                     KVFRGRDIDLLYSQLACLFTHVTCAKPRSSRSTSLEAFVVCQGYQPPADWTPKLDPSQ
                     SVQQFFQHCLPNGKHIAPFMACGSLESFDSDATYTSTCSTDPIATGDKHKPSLNPVQQ
                     PTNPPYKQALLLKRQGRLSRHVR"
     gene            <640308..>643535
                     /gene="TDEL0D03490"
                     /locus_tag="TDEL_0D03490"
                     /db_xref="GeneID:11502367"
     mRNA            <640308..>643535
                     /gene="TDEL0D03490"
                     /locus_tag="TDEL_0D03490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681096.1"
                     /db_xref="GeneID:11502367"
     CDS             640308..643535
                     /gene="TDEL0D03490"
                     /locus_tag="TDEL_0D03490"
                     /inference="similar to DNA sequence:INSDC:YDR040C"
                     /note="similar to Saccharomyces cerevisiae ENA1 (YDR040C);
                     ancestral locus Anc_3.276"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681144.1"
                     /db_xref="GeneID:11502367"
                     /db_xref="GOA:G8ZTI9"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR006414"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:G8ZTI9"
                     /translation="MSEVDFEFRDFHTLTADQAASKLQTDVQSGLTGEEFRRRCKIVG
                     ENSLGDDQGIDYKGLVIHQICNAMILVLLISMVISFAVRDWITGGVIAFVVGINVVIG
                     VYQEYKASKTMNSLKLLSSPSAHTLREGHSEDVPSKEIVPGDVCLVKVGDTIPADLRL
                     IEASNFETDEALLTGESLPIAKQPEAVYEEDTPIGDRLNLAFSSSTVVKGRARGIVIS
                     TGLNTEIGKIAQSLRGNNGLISRDPAKNWWQNLWITLKQTCGAFLGTTVGTPLHRKLS
                     KLAILLFGVAVVCAIIVMASQKFRVDRGVAIYAICVALSMIPSSLVVVLTITLSVGAA
                     VMVSRNVIVRKLDSLEALGAVTDICSDKTGTLTQGKMLARQVWVPRFGTVTISNSNEP
                     FNPTAGDINAVPVLSPHEHAHNETEDVGILQDFKQKYYANELPELMRTDLFTEWLETA
                     TLANIATVFQDPNTQEWKAHGDPTEIAIQVFAKKMDMPRSALTGENSRNDSDSTCDEK
                     KQEAKYVQVAEFPFDSTIKRMSAVYENTQDNSQTVFAKGAFESVLKCCKYWHGETGIV
                     DLKDDDINNIKEEVNTLSSQGLRVLAFAKKVYYQDALNQDIKGKLSEKRDFAESELCF
                     LGLIGIYDPPRNETAGAVKRFHNAGINVRMLTGDFPGTAKAIAQEVGILPINLYHYPQ
                     EVVDVMVMTGTQFDQLSEQEIDDLPVLPLVIARCSPQTKVRMIEALHRRDKFCAMTGD
                     GVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILSAVEEGRRMTDNIQKF
                     VLQLLAENVAQALYLLVGLVFIDQDGKSVFPLSAVEVLWIIVFTSCFPAMGLGIEKAA
                     PDLMDRPPNDAKSGVFTWEVIIDMFAYGIIIAASCMGTFTSILYGKENGELGYNCNAD
                     DNPTCHGVFRARSATFATMTWCALILAWEVIDLRRSFFRMQPETDTPYTQFFKDIWSN
                     KFLFWSVILGFITAFPVVYIPVINTKVFLHQAISYEWGIAFAFTIVFWFGAELYKIFK
                     RLYFKNGKRAENPENDLEKKTRYDPFEAYSTTTTMQTEAHLPGKF"
     gene            complement(<643677..>645467)
                     /gene="TDEL0D03500"
                     /locus_tag="TDEL_0D03500"
                     /db_xref="GeneID:11502368"
     mRNA            complement(<643677..>645467)
                     /gene="TDEL0D03500"
                     /locus_tag="TDEL_0D03500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681097.1"
                     /db_xref="GeneID:11502368"
     CDS             complement(643677..645467)
                     /gene="TDEL0D03500"
                     /locus_tag="TDEL_0D03500"
                     /inference="similar to DNA sequence:INSDC:YDR037W"
                     /note="similar to Saccharomyces cerevisiae KRS1 (YDR037W);
                     ancestral locus Anc_3.275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681145.1"
                     /db_xref="GeneID:11502368"
                     /db_xref="GOA:G8ZTJ0"
                     /db_xref="InterPro:IPR002313"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018149"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:G8ZTJ0"
                     /translation="MSQEEATKAATDGVANLHLDDVTGEMVSKSELKKRIKQRQVEAK
                     KAAKKAAGTPQPESKKKKSDLMADLSPAQYFEARSRQVKELRNTHSPNPYPHKFHVSI
                     TNPAFLEKYAYLERGQTLPDEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQ
                     DYYDEKAYEADHDLLKRGDIVGVEGYVGRTQPKKGGEGEISVFVSRVELLTPCLHMLP
                     ADHFGFKDQETRYRKRYLDLIMNKDSRKRFITRSKIITYIRKFLDSREFIEVETPMMN
                     VIAGGATAKPFVTHHNDLNMDMFMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMT
                     HNPEFTTCEFYQAFADVYDLMDMTEVMFSEMVKEITGSYVIKYHPDPSNPEKELELNF
                     ARPWKRINMIEELEKRFNVTFPAGDQLHTAETGEFLKKILSDNKMECPPPLTNARMLD
                     KLVGELEDTCINPTFIFGHPQMMSPLAKYSRDKPGLCERFEVFVATKEICNAYTELND
                     PFDQRDRFEEQARQKDQGDDEVQLIDEVFCNALEYGLPPTGGWGCGIDRLAMFLTDSN
                     TIREVLLFPTLKPDVLRDEVKKEEAQAKTV"
     gene            <645756..>647522
                     /gene="TDEL0D03510"
                     /locus_tag="TDEL_0D03510"
                     /db_xref="GeneID:11502369"
     mRNA            <645756..>647522
                     /gene="TDEL0D03510"
                     /locus_tag="TDEL_0D03510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681098.1"
                     /db_xref="GeneID:11502369"
     CDS             645756..647522
                     /gene="TDEL0D03510"
                     /locus_tag="TDEL_0D03510"
                     /inference="similar to DNA sequence:INSDC:YBR060C"
                     /note="similar to Saccharomyces cerevisiae ORC2 (YBR060C);
                     ancestral locus Anc_3.274"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681146.1"
                     /db_xref="GeneID:11502369"
                     /db_xref="GOA:G8ZTJ1"
                     /db_xref="InterPro:IPR007220"
                     /db_xref="UniProtKB/TrEMBL:G8ZTJ1"
                     /translation="MFYGIVREIYEVVMNNDEDIVEHGDILSSPSKKLGQKILRSPGK
                     GRRRESARKHLLEKIRIVETEEVPEEVADEVADEVADEVRGELQEEETEGGLETPRKK
                     RRTKIEVKLEPVEPLEQEVKVKLDEVPSTPSKKPIKSTSVEHDFTSPLKSVILSNLQE
                     YKENASSQSLKLSRNFNKTPLPPNNDRFKFQPEKAVSSFYDTFEGYFDQKKNTRGLKK
                     SKNTMSMATELTREEFALISDIFHKKLHRTARDDLYKIQSKMFPQYWLELLQGFSLLF
                     YGIGSKREFMEKYAFEYLVPNLAYSQMHKDQVAYPKKQLDINDYNIPCIVINGYNPTC
                     NYRDVFKDISAALLPEELTRNETKYWGNHVLLQIQKMVEIYKDESSDIKLVVVVHNLD
                     GPSLRKDAFQTMLCHLALIRQVAIIASTDHIYAPILWDNFKAQNYNFVFHDVTNYEPF
                     TVESSFRDVMKMSKSDSASGAEGAKYVLESLTVNSKKMYKLLVETQIRNMEKSTNSKG
                     KVAPTKRGLPTMGVEFKQLLHLCAAEFIASNELSLRSMLTEFVEHKMANLSKNPAGTE
                     HVWVPYNYSEMTKLYSTVLKEL"
     gene            <647828..>650977
                     /gene="TDEL0D03520"
                     /locus_tag="TDEL_0D03520"
                     /db_xref="GeneID:11502370"
     mRNA            <647828..>650977
                     /gene="TDEL0D03520"
                     /locus_tag="TDEL_0D03520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681099.1"
                     /db_xref="GeneID:11502370"
     CDS             647828..650977
                     /gene="TDEL0D03520"
                     /locus_tag="TDEL_0D03520"
                     /inference="similar to DNA sequence:INSDC:YBR059C"
                     /note="similar to Saccharomyces cerevisiae AKL1 (YBR059C);
                     ancestral locus Anc_3.273"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681147.1"
                     /db_xref="GeneID:11502370"
                     /db_xref="GOA:G8ZTJ2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8ZTJ2"
                     /translation="MSTTNLSSRTSNSVGNPTMERFLPGAVVAVGTHRVEVVNYLAEG
                     GFAQIYVVKFLEYLNEFENKSKVPMKVGDVACLKRVLVQDENGLSEMRNEVEVMKQLM
                     GAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIM
                     YDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFKLCDFGSTSQCFPVVTTHQEIAI
                     LTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGIFLYKLLFFITPFEMTGQFAI
                     LHSKYEFPPNHYSSQLINLIIIMLAENPFVRPNIYQVLNHICTMIGVEVPIEDKYGCG
                     AYNFDKYAEFQTKLQNAQYQMYMLQQKKLENRGILDPSDESLLNNLMITAFEVSGKIP
                     MEANSRESTKSPEVQDLKLAKGASEATEDKPDQHPASSSDEMLVKRTSSSKTQEKSHV
                     DVAESAYEIGSEKHDGTSEVINQVPSETDALSNKGEPEKQSSIIETAVPPADDLHMAA
                     PNLEQRQKSSSSISSESKSYMSGPQGLSSEELTEHAIKAEIAPGTKQHKSNNPFPRMA
                     TDYPDAAHQENIFMDDSPRNALNNQQRLHFPPKDLQYKAERERIQLQQGPQFVSPPSQ
                     RQQIQQQYPYRNDLPQGIQQQQQYPTPFNQEIPNYVGPNMRYAYQGIPPNANVPYYPA
                     QQVKQQQQPQPQPQKVMYPTPQQSVAVPLQVQAQAGSRIPQQASHPVSNRTQEDIPPP
                     MPPRHEQLLKEGEKQKREEELLIAFSPPKQHGDQNVGDRPNPEILTSPSRRGNLDLSY
                     NEMDFSQEDLMKDRQDPLDTGGMDSSIASSESIEMNLEDTKRGNRSLRINRSEFPRGY
                     DSPIPRRHEAGNEKNSTDEREAESVKETSGRRSLDLKFHEVRFSSPDLNNQNVPVHSG
                     HLKESSANKHKPTHSHKQRNTESTDAVSHVARRNHSTGSSSSASRKHSSNNINVVKTG
                     SHARNDLERTKTSNGSSNTSVNNSSTNLSGMRRSFAKARQSLDLERVRREALNNSDSA
                     ISGKRRSLFSVFRGNSDKK"
     gene            <651209..>651559
                     /gene="TDEL0D03530"
                     /locus_tag="TDEL_0D03530"
                     /db_xref="GeneID:11502371"
     mRNA            <651209..>651559
                     /gene="TDEL0D03530"
                     /locus_tag="TDEL_0D03530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681100.1"
                     /db_xref="GeneID:11502371"
     CDS             651209..651559
                     /gene="TDEL0D03530"
                     /locus_tag="TDEL_0D03530"
                     /inference="similar to DNA sequence:INSDC:YBR058C-A"
                     /note="similar to Saccharomyces cerevisiae TSC3
                     (YBR058C-A); ancestral locus Anc_3.272"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681148.1"
                     /db_xref="GeneID:11502371"
                     /db_xref="UniProtKB/TrEMBL:G8ZTJ3"
                     /translation="MLKDDKESIFSTVTARDAVNIDDLGKVSDEHLVAKVRPSMKYVE
                     TVREHKIRESPGMSTIDKLGDMIGDFVESLYWMYYIHLPYYLMTSFDSFCLHAFFLTI
                     FSLGFFGIIKYLLL"
     gene            <652067..>653566
                     /gene="TDEL0D03540"
                     /locus_tag="TDEL_0D03540"
                     /db_xref="GeneID:11502372"
     mRNA            <652067..>653566
                     /gene="TDEL0D03540"
                     /locus_tag="TDEL_0D03540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681101.1"
                     /db_xref="GeneID:11502372"
     CDS             652067..653566
                     /gene="TDEL0D03540"
                     /locus_tag="TDEL_0D03540"
                     /inference="similar to DNA sequence:INSDC:YDR036C"
                     /note="similar to Saccharomyces cerevisiae EHD3 (YDR036C);
                     ancestral locus Anc_3.271"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681149.1"
                     /db_xref="GeneID:11502372"
                     /db_xref="GOA:G8ZTJ4"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR018376"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:G8ZTJ4"
                     /translation="MLRNLGKNTLTIKRTLMASSVSLSKPVLYNVQDTARVITLNRSK
                     KLNALNGEMCESMFATLNEYAKSDCANLIMVKSANQPRSFCAGGDVSFVAESNSNGRA
                     EESAQLFTAEYSLNFQMATYQKPIVTFMDGITMGGGVGLSIHTPFRIATENTKWAMPE
                     MDIGLFPDVGTTFAMPRVITLANANGQMALYLALTGDVISGEDAYILGLASHYVKHDS
                     LADLETRLAEIKTLKDGSASDESFFTMVDNAIEEFASQLPKDHSFKFSNEKLNVIESC
                     FDISKITSVKQVLQKLDEIIINNSDASQESKQFASEIKGKLSTKSPTSMQVALRLLQD
                     NSKDNIESALRRDLYTATNFCMAVKNPESGVEFSEATIHKLIEKQKAPYAWKTKLDDL
                     SPSQITSLVSPKPSMPVSLWRNYANVTWKQYPHHLKYQLPTETAIMKYITGQDGRNNS
                     LSISKDEVISHFTNFNQTTRGKIGVDKLCRMVIQRKCTVDDANALKWKN"
     gene            <653772..>656114
                     /gene="TDEL0D03550"
                     /locus_tag="TDEL_0D03550"
                     /db_xref="GeneID:11502373"
     mRNA            <653772..>656114
                     /gene="TDEL0D03550"
                     /locus_tag="TDEL_0D03550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681102.1"
                     /db_xref="GeneID:11502373"
     CDS             653772..656114
                     /gene="TDEL0D03550"
                     /locus_tag="TDEL_0D03550"
                     /inference="similar to DNA sequence:INSDC:YBR058C"
                     /note="similar to Saccharomyces cerevisiae UBP14
                     (YBR058C); ancestral locus Anc_3.270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681150.1"
                     /db_xref="GeneID:11502373"
                     /db_xref="GOA:G8ZTJ5"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR016652"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G8ZTJ5"
                     /translation="MTDVSWNEMNVPSVISKDECLYCFETVYNEALKEASALHSLNLC
                     LSCFQPVCHRHLPLHVQVSEKNCDTAHWQYLNIHKVKRTKVDEDQDMNKSNKKIRLNV
                     VEKSEDEMFETNWSLLKYNSSTASSEESVSNKDPEINPVVQEKIKQILGSKSQDMVDK
                     TSSWELSVKSCPHTQNFQVPAVEAKSKDERCNDCGLDQNLWLCLHCGNIGCGREQVGI
                     EGHSHALNHYDKHSTHPLAVKLGSLSQSSIDLYCYSCNDEVKFENPEAFAQALSKYGI
                     DLKSKLASEKSLVELQVEQNMNWDFQMTDAQGKELKHLSANKEYGCGLINLGNSCYIN
                     SVLQCLLNGGVKTYSLSALGESFPLDVLYPSTNMKCQLIKLNNAIKLEPELYPSGIRP
                     RSFKKCIGQAHEEFSSERQQDALEFLSFFNDTLDKKIFSRSENNPSDLMRYIIENRLQ
                     CTKCGKVKYTTDINESMLVPLEENSDSQHSQSLLDRLVEYFHGEELDFKCPQCKDMVQ
                     AIRKPGFKTFPDTLVVNPVRIKLQNWTPVKTADDLIIPGLEDPLDTLDLSKFQSSGFN
                     SETESPFPEEEDSHDAEFVPNQACVSQLAEMGFSPNAITRSLHATGNLETEPAMNWLF
                     AHMEDPDINEPFTPPKAKEADVQIDQEAISSMTAMGLDAKLCKKALILNNGDVTSSVD
                     WVFNNMDDDGELPQKDTQPAKSHTANLGHSSASPYKLVAVVCHKGNSAHSGHYVAFIR
                     KSVEQEEKWVLYNDEKIVVAVEDNFEEIRKNGYLYFYSRV"
     gene            <656347..>657429
                     /gene="TDEL0D03560"
                     /locus_tag="TDEL_0D03560"
                     /db_xref="GeneID:11502374"
     mRNA            <656347..>657429
                     /gene="TDEL0D03560"
                     /locus_tag="TDEL_0D03560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681103.1"
                     /db_xref="GeneID:11502374"
     CDS             656347..657429
                     /gene="TDEL0D03560"
                     /locus_tag="TDEL_0D03560"
                     /inference="similar to DNA sequence:INSDC:YBR057C"
                     /note="similar to Saccharomyces cerevisiae MUM2 (YBR057C);
                     ancestral locus Anc_3.269"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681151.1"
                     /db_xref="GeneID:11502374"
                     /db_xref="UniProtKB/TrEMBL:G8ZTJ6"
                     /translation="MNYMDCGYDTQRSFDASMNNPSNNQQSYASGDAKDGETCISESR
                     ISMMDSSSINMHFTHSTVGSHSGSNFLLPSNPNSCYLQAGLDIMGGNNHSDSFSMPRT
                     VNWSETTPRRQMVSDLVRNGQDDASNVGPGVTASPSVLMSARGVSNRTKNSSFDTSFE
                     TFASRNGNNGNNALCYGEAIVNSGTNDSNSEVIKSLNLRLQVKETQNESLESEIQKLK
                     KTFNEALNFKQSEHKFEKQNSHAGSTPIEVPTSVEQVFKKLSSSLEKKDKELEETKQT
                     LESVLTALALNPTNSVTKYGRYDAEALAHKMVVRLETLTKENQEMAKMLAYGRAKEVQ
                     IELQLARMENRELKDTVSKLKQSNET"
     gene            complement(<657584..>658702)
                     /gene="TDEL0D03570"
                     /locus_tag="TDEL_0D03570"
                     /db_xref="GeneID:11502375"
     mRNA            complement(<657584..>658702)
                     /gene="TDEL0D03570"
                     /locus_tag="TDEL_0D03570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681104.1"
                     /db_xref="GeneID:11502375"
     CDS             complement(657584..658702)
                     /gene="TDEL0D03570"
                     /locus_tag="TDEL_0D03570"
                     /inference="similar to DNA sequence:INSDC:YDR035W"
                     /note="similar to Saccharomyces cerevisiae ARO3 (YDR035W);
                     ancestral locus Anc_3.268"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681152.1"
                     /db_xref="GeneID:11502375"
                     /db_xref="GOA:G8ZTJ7"
                     /db_xref="InterPro:IPR006218"
                     /db_xref="InterPro:IPR006219"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G8ZTJ7"
                     /translation="MFIKNDHVGDRNRLEDWRIKGYDPLTPPDLLQHELPISEKGHKT
                     IVDAREAVCDVLNGKDDRLVIVIGPCSIHDPKAAYEYADKLAEASKKHSKDLLIIMRA
                     YLEKPRTTVGWKGLINDPDIDNSFQINKGLRISRELFTNLVEKLPIAGEMLDTISPQF
                     LSDCFSLGAIGARTTESQLHRELASGLSFPIGFKNGTDGGLQVAVDAVRSAAHAHYFL
                     SVTKPGVTAIVGTEGNKDTFIILRGGKNGTNYDAAGVKDAKAQLLKSKLIDEKDVQRR
                     IMIDCSHGNSNKDYRNQPKVAQSIHDQLKDGENGICGVMIESNLVEGRQDVPAEGGRA
                     GLKYGCSITDACIGWESTEQVLDLLADGVRQRRAALGK"
     gene            complement(<659039..>659209)
                     /gene="TDEL0D03580"
                     /locus_tag="TDEL_0D03580"
                     /db_xref="GeneID:11502376"
     mRNA            complement(<659039..>659209)
                     /gene="TDEL0D03580"
                     /locus_tag="TDEL_0D03580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681105.1"
                     /db_xref="GeneID:11502376"
     CDS             complement(659039..659209)
                     /gene="TDEL0D03580"
                     /locus_tag="TDEL_0D03580"
                     /inference="similar to DNA
                     sequence:INSDC:YDR034W-B,YBR056W-A"
                     /note="similar to Saccharomyces cerevisiae YDR034W-B and
                     YBR056W-A; ancestral locus Anc_3.267"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681153.1"
                     /db_xref="GeneID:11502376"
                     /db_xref="InterPro:IPR028144"
                     /db_xref="UniProtKB/TrEMBL:G8ZTJ8"
                     /translation="MRHQQPAYHPQPVYVQQAPVRRERGCCGCHPTGCCGTLCNILFC
                     CCLVDLCCNIIG"
     gene            complement(659467..659538)
                     /gene="TDEL0Dtrna2Q"
                     /locus_tag="TDEL_0Dtrna2Q"
                     /db_xref="GeneID:11502377"
     tRNA            complement(659467..659538)
                     /gene="TDEL0Dtrna2Q"
                     /locus_tag="TDEL_0Dtrna2Q"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAA"
                     /db_xref="GeneID:11502377"
     gene            complement(<659777..>661330)
                     /gene="TDEL0D03590"
                     /locus_tag="TDEL_0D03590"
                     /db_xref="GeneID:11503642"
     mRNA            complement(<659777..>661330)
                     /gene="TDEL0D03590"
                     /locus_tag="TDEL_0D03590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681106.1"
                     /db_xref="GeneID:11503642"
     CDS             complement(659777..661330)
                     /gene="TDEL0D03590"
                     /locus_tag="TDEL_0D03590"
                     /inference="similar to DNA sequence:INSDC:YBR056W"
                     /note="similar to Saccharomyces cerevisiae YBR056W;
                     ancestral locus Anc_3.266"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681154.1"
                     /db_xref="GeneID:11503642"
                     /db_xref="GOA:G8ZTJ9"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G8ZTJ9"
                     /translation="MKTYSRIIDNPIGRRYNMLDKIKQKFEKVKDKVDPTTSSSGSGH
                     KGTDWSSSGGIGKKEVYRNRYNYGVNLGGLFVLENWIYDGGLDKGGDSEFDAVSAQAK
                     ESSVDEAAKKLQDHYKDYIGKIDWNWLKNEAGVTAFRVPVGYWHVGNGQFVDDLPFGP
                     LKEVYSKAQPWDFLKQLIKKAGEYDIGILVDIHGLPGGANTDSHSGSTGGSAAFFNTS
                     KYVDKMVKEVIPFIVKDACTEAENVIGLQIVNEAAFDNNAKGQKNYYSQAISAIRDID
                     SGLPVVISDGWWPQQWADWLKDEGLDANVVIDSHVYRCFSDEDKSKDAGKIIDDLSKS
                     VNFPKDQADFTCGEFSCVLDGQTWEKTSGARDELIKQYGCREIDVFSKTASWGWFFWT
                     LQFKHGDGGEWGLSPWSTKVPFHVARRTSGAKADENRVQDLVNDHVNYWSDKGGDKME
                     HWRFEDALRAVINDVKAFAQFDNSRLGRWRAWGLQRRSQYINEKGDGEFMWEWDQGWQ
                     RGIEEFVLR"
     gene            complement(661575..661658)
                     /gene="TDEL0Dtrna3L"
                     /locus_tag="TDEL_0Dtrna3L"
                     /db_xref="GeneID:11502378"
     tRNA            complement(661575..661658)
                     /gene="TDEL0Dtrna3L"
                     /locus_tag="TDEL_0Dtrna3L"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUA"
                     /db_xref="GeneID:11502378"
     gene            <661898..>664537
                     /gene="TDEL0D03600"
                     /locus_tag="TDEL_0D03600"
                     /db_xref="GeneID:11503648"
     mRNA            <661898..>664537
                     /gene="TDEL0D03600"
                     /locus_tag="TDEL_0D03600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681107.1"
                     /db_xref="GeneID:11503648"
     CDS             661898..664537
                     /gene="TDEL0D03600"
                     /locus_tag="TDEL_0D03600"
                     /inference="similar to DNA sequence:INSDC:YBR055C"
                     /note="similar to Saccharomyces cerevisiae PRP6 (YBR055C);
                     ancestral locus Anc_3.265"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681155.1"
                     /db_xref="GeneID:11503648"
                     /db_xref="GOA:G8ZTK0"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR010491"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR027108"
                     /db_xref="UniProtKB/TrEMBL:G8ZTK0"
                     /translation="MERPSFLDQAPPPGYIAGVGRGATGFSTRGDPTTKGKVPKRFQL
                     NDKGLDTRTGHNTNLEPEDKEDKEAEEIFAAIETKLSTKRRAPNKTESDTTDNIPKQF
                     ADLKRSLATVTDEEWLNLPDAGDITKKHKRERLQDQLNRKEYAAPDTLMNSNVNLSKL
                     TEEREKLLARQLDANVLSTQGRDETATNVTTYLSELDRSTVTNLETSGQLEDVKKMRT
                     ILASYRKADPTRPEGWIASAKLEEKANKFKTAKNILEEACQQCPRSDEVWLERIRLNV
                     SDIPLCKTLAADGIAFNPHSLQLWLKATDLESEPFNKRRVVMRALQELPKNEELWKLV
                     LKFEDDQSERQKILSKAVELIPQSMYLWEKLVETQDYTSAKESLNGARKQLPGECRVW
                     ILAAKIEERFNENVTVDRLTKLLNNGMNQLSKNESNPELLVWLRHAQSLATRPESQKV
                     AVAIVRAALSREDIQSGESSVLDTIKEMNDSIVKIVAYRTLLHELPVKYSIWKALRIA
                     CENTKKMHELYETYEELLFKQDTDFRILKDNPTLSLMYSKEVWKYGQDTSKALEILNK
                     SIQVIPTYMDFWIAKLKVLCLSSQFDIAQDTFLQAIDTHSQSESSNLHRLYLKYVNFL
                     RFRNENQRAIDFLEQECIGRFPNYYKFYIQLGQIYQYIGQPKKMRETYSIGSKTLPHC
                     AILWILKAKADEIDFQQPTRARSELDKALLKNPNEISLYLAKIQMEVRLGFQDQARLI
                     VQQALQKFPNSPDLWSANISLLPAKRASMKKTMFQDALKKTNNSCQVLLEIGLSFYRD
                     SQFVTALKWFDRASKSDPKYADAFVWSARSTKRLKKDTTPIYDHVEQCEPVYGPLWIS
                     IAKNVRYQYLKPSQILDILIKDC"
     gene            <664819..>666993
                     /gene="TDEL0D03610"
                     /locus_tag="TDEL_0D03610"
                     /db_xref="GeneID:11502379"
     mRNA            <664819..>666993
                     /gene="TDEL0D03610"
                     /locus_tag="TDEL_0D03610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681108.1"
                     /db_xref="GeneID:11502379"
     CDS             664819..666993
                     /gene="TDEL0D03610"
                     /locus_tag="TDEL_0D03610"
                     /inference="similar to DNA sequence:INSDC:YDR034C"
                     /note="similar to Saccharomyces cerevisiae LYS14
                     (YDR034C); ancestral locus Anc_3.264"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681156.1"
                     /db_xref="GeneID:11502379"
                     /db_xref="GOA:G8ZTK1"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:G8ZTK1"
                     /translation="MFSKTSSKGQVNGVQKGFATTSPASSHTLSPIPLDSDTGASFLG
                     VERLFAGKVETADYQSLSYVDATPAVGSYGSMTSPTTSNERVADEEIMDGSAAMPPTP
                     VTSTVKDSNGNVKRKYSRNGCTECKRRRIKCDETKPTCWQCARLNRECIYVLNLKNKK
                     RKNKEAPASRQKQKQTEKVAAIKQRINTPTEKDQLDDMHLLELPNVIPVGNMDGYDAN
                     LLIQNLNDIVSMKLNDSLLDNQDLKDLELPVMDLPELMPHTATPTSTVPISFLMNSAI
                     TFNIELSSFKLGGVHDDYLKVFFVDCLGTIAPFFQDQENPLRDIILSFARNESYLLSA
                     ALAVGASLAHRKSDSFDDERNYCAYLSHCLSLLGEQFQNESNVLNKIEPITFTVIMLA
                     WNCINTMNSQWRSHLKGVTDLFKKINSGNSSKAMNVAKCWFKVMETFASISTVLGGSV
                     TEDQDLDLIFDPYDYQYVDSLKFLNIMTPLNKFNLLRGHKEDFDLVIKEVIKALTLIR
                     KSEKFHLKKEGDVFSKLDYLLWSPETDAEKSTSTICYFKTQKILVEIDQQLDYQFIDK
                     SGIIPRESQSHPHNSNIVDNAIDLVTLRSGESIAISWYDISHQTQVLSFLLIVLLKFL
                     SIPKESITVQQVVKKILSFFKFLDSDSPPRNSRMCYSNFAVLIAGLNAMDEETRKIVR
                     SYYKLNGGKFQRLTEHNLNRLEKVWYGKDSEYKMADQDVLTW"
     gene            complement(<667287..>668237)
                     /gene="TDEL0D03620"
                     /locus_tag="TDEL_0D03620"
                     /db_xref="GeneID:11502380"
     mRNA            complement(<667287..>668237)
                     /gene="TDEL0D03620"
                     /locus_tag="TDEL_0D03620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681109.1"
                     /db_xref="GeneID:11502380"
     CDS             complement(667287..668237)
                     /gene="TDEL0D03620"
                     /locus_tag="TDEL_0D03620"
                     /inference="similar to DNA sequence:INSDC:YBR054W,YDR033W"
                     /note="similar to Saccharomyces cerevisiae YRO2 (YBR054W)
                     and MRH1 (YDR033W); ancestral locus Anc_3.263"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681157.1"
                     /db_xref="GeneID:11502380"
                     /db_xref="GOA:G8ZTK2"
                     /db_xref="InterPro:IPR017452"
                     /db_xref="InterPro:IPR029730"
                     /db_xref="UniProtKB/TrEMBL:G8ZTK2"
                     /translation="MSDFVELMKRGGNQAITINKPDGVDFHLTARGSDWLWTAFCVFL
                     VMAMILIGLMFRKAPNERLFYYTAIAPVFFMAINYFTLASNLGWTPIKAKYNHVTTTT
                     QQEHPGYRQVFYSRYIGWFLAFPWPVIQASLLGGTPIWQIAFNVGLTETWVVALLIAA
                     LVKTTYKWGYYSFAIAAGVVASISVMTTTRNLVKNMGKDVFQIFTCFYGVVMFLWGIY
                     PISFGLSEGGNVIQPNSEAVFYGILDVLLLGVVPCLFVALASSVGLERLGYGPQAAFS
                     PMPHEKTMNSIASARNSGETAVSTPKATPKPAKKAKKSKK"
     gene            <669584..>670645
                     /gene="TDEL0D03630"
                     /locus_tag="TDEL_0D03630"
                     /db_xref="GeneID:11502381"
     mRNA            <669584..>670645
                     /gene="TDEL0D03630"
                     /locus_tag="TDEL_0D03630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681110.1"
                     /db_xref="GeneID:11502381"
     CDS             669584..670645
                     /gene="TDEL0D03630"
                     /locus_tag="TDEL_0D03630"
                     /inference="similar to DNA sequence:INSDC:YBR053C"
                     /note="similar to Saccharomyces cerevisiae YBR053C;
                     ancestral locus Anc_3.262"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681158.1"
                     /db_xref="GeneID:11502381"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="InterPro:IPR013658"
                     /db_xref="UniProtKB/TrEMBL:G8ZTK3"
                     /translation="MPAAEVVDFTKLKPYYHAPGARLSEGITYMNETKTLVWVDIYKG
                     EVHKVEHIQKPETSHDYINIGLDNYKSNAHIKYPHPEAAKETIGVVFPLVEKEQTDHI
                     ERVLFASKYGIARASFVTKEWEYIVLYTDCPNIAQDRALRLRSNDGNVSPCGHYLYVG
                     LMNDFDYPLKDEGCIVRVHLRNKTVEMIWDRIKIPNAIHWNEKGDTSYITESLKYTIW
                     AFNEKTGEKKPLIDIKSSNNESFESPEPDGSAMDHLNNRLYVCIFSTGKIQEYSLHDG
                     KLLKEYLLPPQTPNITCCTIAGNDLYVTTGNQHVDKGPEASSDKRGGSLYKLPNVVPF
                     ATESTLIEFVSSKRLPIFD"
     gene            <670867..>671466
                     /gene="TDEL0D03640"
                     /locus_tag="TDEL_0D03640"
                     /db_xref="GeneID:11502382"
     mRNA            <670867..>671466
                     /gene="TDEL0D03640"
                     /locus_tag="TDEL_0D03640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681111.1"
                     /db_xref="GeneID:11502382"
     CDS             670867..671466
                     /gene="TDEL0D03640"
                     /locus_tag="TDEL_0D03640"
                     /inference="similar to DNA sequence:INSDC:YBR052C,YDR032C"
                     /note="similar to Saccharomyces cerevisiae RFS1 (YBR052C)
                     and PST2 (YDR032C); ancestral locus Anc_3.261"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681159.1"
                     /db_xref="GeneID:11502382"
                     /db_xref="GOA:G8ZTK4"
                     /db_xref="InterPro:IPR005025"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR010089"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:G8ZTK4"
                     /translation="MAPKVAIIIYTLYGHTAILAEAEKRGVEAAGGTAEIFQVPETLS
                     ADVVKALGGPAKPDYPLATKDTLTEYDFFLFGIPTRFGNMPAQWKAFWDATGGLWVKG
                     ALHGKVAGIFVSTGTGGGNEATAMNSLSTLAHHGIIFVPLGYKNAFAELSNITEPHGG
                     SPWGAGTLAAADGSRSPSELELKVHEIQGRTFAETVAKF"
     gene            complement(<671492..>671851)
                     /gene="TDEL0D03650"
                     /locus_tag="TDEL_0D03650"
                     /db_xref="GeneID:11502383"
     mRNA            complement(<671492..>671851)
                     /gene="TDEL0D03650"
                     /locus_tag="TDEL_0D03650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681112.1"
                     /db_xref="GeneID:11502383"
     CDS             complement(671492..671851)
                     /gene="TDEL0D03650"
                     /locus_tag="TDEL_0D03650"
                     /inference="similar to DNA sequence:INSDC:YDR031W"
                     /note="similar to Saccharomyces cerevisiae MIC14
                     (YDR031W); ancestral locus Anc_3.260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681160.1"
                     /db_xref="GeneID:11502383"
                     /db_xref="InterPro:IPR016611"
                     /db_xref="UniProtKB/TrEMBL:G8ZTK5"
                     /translation="MSNFLDQLIMEDVAAHCPKQFMEYHKCVSKNHDDPSQCVYRRND
                     LSKCINANVPTVQRVMSQCADIMKKYELCIKENMASRTINENCLGILAELRSCAEAQM
                     QKDGTRPINEMFVYEKK"
     gene            <671946..>673298
                     /gene="TDEL0D03660"
                     /locus_tag="TDEL_0D03660"
                     /db_xref="GeneID:11502384"
     mRNA            <671946..>673298
                     /gene="TDEL0D03660"
                     /locus_tag="TDEL_0D03660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681113.1"
                     /db_xref="GeneID:11502384"
     CDS             671946..673298
                     /gene="TDEL0D03660"
                     /locus_tag="TDEL_0D03660"
                     /inference="similar to DNA sequence:INSDC:YDR030C"
                     /note="similar to Saccharomyces cerevisiae RAD28
                     (YDR030C); ancestral locus Anc_3.259"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681161.1"
                     /db_xref="GeneID:11502384"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZTK6"
                     /translation="MNNAILRYKLGEIDGDHLTRLGRQLEFARILECDSPRCYRHSRN
                     KKVATGVTCLDLDNTTGGFILSSGDDGSLSLWSLDDRLDRSTNVLYNKRINYVARSQA
                     DDDVNSQPFKKRISDSSEGPRIVHSFETKQNKFRMYRQSSSQAASKIGPTEDSNVGQG
                     HRFAITCMKWYSIDNGMFFTGSNDCKLKFWDTNAFECVQEIDIGYRLNQIDIDTDGKY
                     VVAASEDYYPRLIDLRTVVSSGITNLSHGKMDSEILCCKTNPTKPHIIATGDAQGNVK
                     LWDLRYANRQLLSLEQQPSGKAHLRGCNDICWDSAGSQLASTATDGKCCIWSPFSPRI
                     PPPTQIGPSDPMRNRYRKRTSQRLLWIDTFLAHNTDYGDLQIFETHRGKLWNKIDLPT
                     TFVSIKNATHKKLTSFFTGIALQRSTTNSTGIRLFLGTNAPSMDAGNGSIYEYVANYL
                     "
     gene            <673725..>676541
                     /gene="TDEL0D03670"
                     /locus_tag="TDEL_0D03670"
                     /db_xref="GeneID:11502385"
     mRNA            <673725..>676541
                     /gene="TDEL0D03670"
                     /locus_tag="TDEL_0D03670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681114.1"
                     /db_xref="GeneID:11502385"
     CDS             673725..676541
                     /gene="TDEL0D03670"
                     /locus_tag="TDEL_0D03670"
                     /inference="similar to DNA sequence:INSDC:YDR028C,YBR050C"
                     /note="similar to Saccharomyces cerevisiae REG1 (YDR028C)
                     and REG2 (YBR050C); ancestral locus Anc_3.258"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681162.1"
                     /db_xref="GeneID:11502385"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="UniProtKB/TrEMBL:G8ZTK7"
                     /translation="MGSNLAAYFADHNESNGSGMRPGLVRSTSSNVPGNDDDDMGPSV
                     SMAVQADDEDGFQRSTFNLKRTRSMGYFDDYIDPTKKMPGKSVAQGSDDEYDDDDYNT
                     DSDSESDSYSDDEDNDGYEEEEAAQTRGISPSVSPPPADADNYLMPQDDNDLVREPER
                     HVDYLSHEWNEWDISQSWKYIILKKKKRAEDLVNAARLENASWRTWAKARNHLKTVSP
                     EIVNWSKDSDVTWLYGPIVRDRDDDDVSDVERGYGSDDENSKRVAATKKIVMTKTPAS
                     PTPKPILKKRTVSEILAENSEWKLNEARKHISEMKHASVVMDPYGGESHDVYDDYDAL
                     AAKVNAQYYRHGNQYSDKGMADSQIIDPNTMQKVPQSVPEISHLDDGAQEYPESAQHI
                     EKTNSMSSAQISSALANLKSNLKSASSNKTRHIHFNDRVEQCMALARNASDSEFSDEE
                     DEYNTLRQGDLRSKSNDGSDSSDNNPSSSSSDESDEDDDNAGLFINPTTSRKADTYHL
                     TDSSSQTSSVHSRTPINPIIKLLPATTLNYGSDDEASDNEEYNGYGNAVSHNVNTYRG
                     YDYMYDYNSVYTGDTSSFLPGEGCDVVDVPDGLDLRAAMAADNASTYEMGHAVASSHG
                     DSKETGDPSSPSNFMYDLPRDSDFDSDEQFIENSNYRSSDDDDDALSMKRTVSLGKGG
                     QSNSLRDLRKPPSSTSVGPAKTRSFITGKSADNKNKDSTITKTPARGANPAGRPRCLK
                     RNSSSSSFIFNSDSDEDDEGSDGDEHDGFMHNEQDGLDFDDTRVDENVSTGKEDKLPS
                     FKPVKPVPPQSTVISPDPRTFSSPGASQAGDKSKSIRLKNTSSSAEVGASDVAISGSF
                     SPRSDSVKSVVSNQGIVDKETTSDLREMNEHLKAYHLDDNKQEQSEENNESIHKMMQN
                     ARGIAHKYLHSWKNQDPKEDHSKD"
     gene            <677149..>679815
                     /gene="TDEL0D03680"
                     /locus_tag="TDEL_0D03680"
                     /db_xref="GeneID:11502386"
     mRNA            <677149..>679815
                     /gene="TDEL0D03680"
                     /locus_tag="TDEL_0D03680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681115.1"
                     /db_xref="GeneID:11502386"
     CDS             677149..679815
                     /gene="TDEL0D03680"
                     /locus_tag="TDEL_0D03680"
                     /inference="similar to DNA sequence:INSDC:YDR027C"
                     /note="similar to Saccharomyces cerevisiae VPS54
                     (YDR027C); ancestral locus Anc_3.257"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681163.1"
                     /db_xref="GeneID:11502386"
                     /db_xref="UniProtKB/TrEMBL:G8ZTK8"
                     /translation="MSNHDDGGEDSKKSIGEKDLDVPLEASPRIIVPESPAKGTRSPS
                     EDGTTSLNDDLASVSGINTRPVASSRMSLDSYSVRRSFDSSVMGRHSRSFGFDNESHS
                     GSMEFSPLGNNSIYEIVMNTRRKDWLAYPTVIDIPPVALSKNVIEDSYKKAARQYVKE
                     IRHESSVFESTNNLRSMTRMEQLRQLEKYDNPTQDFANEDEKEFVNRENLKELEDVPS
                     FYFEKDFQLDNPRTFHRVLKDIDLQLNKLNEEDQVQRDEAQMELKERLNYYLDAVEGL
                     LVAEISKSSHKFFHALADVDLIQQKAEGTVMELDRLAEATEFIDKEKIQKRIGDLEKI
                     FKRKNVQKIEQALLQVKLVTSRTQECQQLYGNGGFEKCLDLIGSIDFLIKGDDSQDTV
                     VQGWVSDWPYKLVNLKSVPALAGTRELLTNLKIEIGGKFSLQLCDLLLRDVREYCEPI
                     SAIETLSRFQNITREKPFLETNPLFTSSITELIHQLRRCEELASSFSLYQDKCVAEIK
                     NIIKMFLPQEQQANDEPPRSQQSISSGSKLSRLIKEQTPVEFQDMLVSIFTRSSEALR
                     RFCMHQKLLLDLALSEITYSTTTAEFNENHQAMITQLDIRFGINEAIRILQLRMGKII
                     AVRRETTATLRYDHFLKLYSICVLFIQECEAMSGEFLTKYLSDVLAAQIKNYISAQGS
                     KNLRTIQSKIDAEKWTPSIVNRNVQKDVNDIVASMDLDPLDWVQLSDLVQPSSAPEED
                     QLATPNQAGHRKSVVVGDKTFVASDALLSCIYLVKVILILSTNLPAAYLSSFEKMCYD
                     LLKHFNVCAINSVTQPDKTLSKTGKNLSIMGESLDCLAELLQIVQQFFQRMQSFSRDF
                     TPADQPNYAQLLQQYRGSTDKIYQSNVPPPPV"
     gene            <680058..>681923
                     /gene="TDEL0D03690"
                     /locus_tag="TDEL_0D03690"
                     /db_xref="GeneID:11502387"
     mRNA            <680058..>681923
                     /gene="TDEL0D03690"
                     /locus_tag="TDEL_0D03690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681116.1"
                     /db_xref="GeneID:11502387"
     CDS             680058..681923
                     /gene="TDEL0D03690"
                     /locus_tag="TDEL_0D03690"
                     /inference="similar to DNA sequence:INSDC:YBR049C,YDR026C"
                     /note="similar to Saccharomyces cerevisiae REB1 (YBR049C)
                     and YDR026C; ancestral locus Anc_3.256"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681164.1"
                     /db_xref="GeneID:11502387"
                     /db_xref="GOA:G8ZTK9"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:G8ZTK9"
                     /translation="MAGEQEKRSRDHSPFVVHHQDVGNGNHESVEEAVFKYVGVGLQH
                     DDDHKGKKSGEVHDGGSKGPADMEWLFRHAQGVDDETGQDSSSARERQSVALAAVAAA
                     YASGGGGLGKRGLEKVDDDDENIARGALKRARKAKEEKAKLQLAVDPELATLDDSGVS
                     EHDQLVRKAIIDTDSIAQHPDFQQYLNTEVHGHKLKGSQKLRDKSDDSDGEGKGLEDV
                     DPSVVAASAANHDDELGDVTKQYSELQKESAIDGPVTKSLQKKDYREVLPKVMSSSQI
                     SVDTDVSHLISSAASKASAIIGTTTQSSGKSFDSAEEAALEQFITEYQTIKNLDRQQI
                     CERIWSNERRKDDFWSNMCKVLPYRSRSSIYKHVRRKYHIFEQRGKWTPQEDQELARL
                     CVEKEGQWSEVGKAMGRMPEDCRDRWRNYVKCGSSRASNKWAPDEEELLKRVIAEMLE
                     EAERNYLARNSNELVHDSDGENESGEDNKSDVLHGGKDRKLQNKPSFKDAINWTIVSE
                     RMGGTRSRIQCRYKWNKLVKKEAIAKIQSIGEGDKRWILEKLRDLGFTEDSQVDWEEL
                     AALKPGVKWTGTELKLCYERMRSGIRYYKQKSINEISKELLGLLDGSIPLDSKGN"
     gene            complement(<682047..>682669)
                     /gene="TDEL0D03700"
                     /locus_tag="TDEL_0D03700"
                     /db_xref="GeneID:11502388"
     mRNA            complement(join(<682047..682469,682625..>682669))
                     /gene="TDEL0D03700"
                     /locus_tag="TDEL_0D03700"
                     /product="40S ribosomal protein S11"
                     /transcript_id="XM_003681117.1"
                     /db_xref="GeneID:11502388"
     CDS             complement(join(682047..682469,682625..682669))
                     /gene="TDEL0D03700"
                     /locus_tag="TDEL_0D03700"
                     /inference="similar to DNA sequence:INSDC:YBR048W,YDR025W"
                     /note="similar to Saccharomyces cerevisiae RPS11B
                     (YBR048W) and RPS11A (YDR025W); ancestral locus Anc_3.255"
                     /codon_start=1
                     /product="40S ribosomal protein S11"
                     /protein_id="XP_003681165.1"
                     /db_xref="GeneID:11502388"
                     /db_xref="GOA:G8ZTL0"
                     /db_xref="InterPro:IPR000266"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR019979"
                     /db_xref="InterPro:IPR028333"
                     /db_xref="UniProtKB/TrEMBL:G8ZTL0"
                     /translation="MSTELTVQSERAFQKQPHIFNNPKLKTNKRAKRWYKNAGLGFKT
                     PKTAIEGSYIDKKCPFTGLVSIRGKILTGVVVSTKMHRTIVIRRDYLHYVPKYNRYEK
                     RHKNVPVHVSPAFRVEVGDIVTVGQCRPISKTVRFNVLKVASNSKSKKQFTKF"
     gene            complement(<683127..>683651)
                     /gene="TDEL0D03710"
                     /locus_tag="TDEL_0D03710"
                     /db_xref="GeneID:11502389"
     mRNA            complement(<683127..>683651)
                     /gene="TDEL0D03710"
                     /locus_tag="TDEL_0D03710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681118.1"
                     /db_xref="GeneID:11502389"
     CDS             complement(683127..683651)
                     /gene="TDEL0D03710"
                     /locus_tag="TDEL_0D03710"
                     /inference="similar to DNA sequence:INSDC:YBR047W"
                     /note="similar to Saccharomyces cerevisiae YBR047W;
                     ancestral locus Anc_3.254"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681166.1"
                     /db_xref="GeneID:11502389"
                     /db_xref="UniProtKB/TrEMBL:G8ZTL1"
                     /translation="MLRPSLRRFTTTRLYLSKTVSNRIIIPPASHFPTVKSPATSIPR
                     HEYRQLPEDSNYIEKFYDELETFSNEILIKQLKKTYADFDDEPEELLFQLEKYIELQI
                     IPKHSDTQQAANDGPIRSIQCRTLSDKIIIERFLDLARGMKLTLLLNGGHTFIFDVLL
                     QAKQVFDKMQQTNN"
     gene            <683833..>684840
                     /gene="TDEL0D03720"
                     /locus_tag="TDEL_0D03720"
                     /db_xref="GeneID:11502390"
     mRNA            <683833..>684840
                     /gene="TDEL0D03720"
                     /locus_tag="TDEL_0D03720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681119.1"
                     /db_xref="GeneID:11502390"
     CDS             683833..684840
                     /gene="TDEL0D03720"
                     /locus_tag="TDEL_0D03720"
                     /inference="similar to DNA sequence:INSDC:YBR046C"
                     /note="similar to Saccharomyces cerevisiae ZTA1 (YBR046C);
                     ancestral locus Anc_3.253"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681167.1"
                     /db_xref="GeneID:11502390"
                     /db_xref="GOA:G8ZTL2"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002364"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZTL2"
                     /translation="MTADSIPKTQKVVLIDGVGDYDVIKYQDSAVPSIGDNELLIKNK
                     YAGINFIEAYFRKGIYPVQLPQILGREATGVVVAKGQSVKNFDIGDKVAYMSSSTFAQ
                     YTKYSSSGLISKLPSETTDDQLKVYAAALIQGLTALTFLDEAYKVKEGDYILLYAAAG
                     GVGLLMDQLLKERGAHAIAVVSTEEKEELAKKFGAEYVINSSKEDILKRALEITNDKG
                     VDAVFDSVGKDTFDISLNALKLKGSFVSFGNASGPVPPFALSRLSSKNIRLMRPTLFG
                     YLAEPEDWDHYSKKLFELIDSGKLKIAITKTYPLSEYKIATQELESRKTTGKLVLEIP
                     Q"
     gene            <685041..>686843
                     /gene="TDEL0D03730"
                     /locus_tag="TDEL_0D03730"
                     /db_xref="GeneID:11502391"
     mRNA            <685041..>686843
                     /gene="TDEL0D03730"
                     /locus_tag="TDEL_0D03730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681120.1"
                     /db_xref="GeneID:11502391"
     CDS             685041..686843
                     /gene="TDEL0D03730"
                     /locus_tag="TDEL_0D03730"
                     /inference="similar to DNA sequence:INSDC:YBR045C"
                     /note="similar to Saccharomyces cerevisiae GIP1 (YBR045C);
                     ancestral locus Anc_3.252"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681168.1"
                     /db_xref="GeneID:11502391"
                     /db_xref="UniProtKB/TrEMBL:G8ZTL3"
                     /translation="MTTVVLQKETLHETSIANAEGSGRRLTWRKWFHTARKDKIEDDF
                     QEDECISLEEAESLVFVPSFHLNSSYTLPETSPEIQVRTHRNRQKIRELKKQLTLKLH
                     RLKHKYDKVESQRFEKPAKKTIDRHITEEPISVKDLFNNTEEYHSVDVIEETKIKKQE
                     DLQKSELPKDNANNDEVNETFNEVEATSATSCRMKRPFNNELSANSSFKRSCSTKDLS
                     SASSVESLRNDYNGDEDEQNSIQNTPPDYLTKSPTLIDDTATLGEQDSIRAPPCPKSR
                     TESDDDGSLNMKSAHADVSSDDSSLPDDISTTMDDTVSEALSCAASVTCEKVYTIPTF
                     RKRKDSLNVANIVKSFRDGTLNEEQLIEFVDKGKKRNEDLTFKNKEFYDDPASKAPTD
                     TLTDKVDKDKCLKDSKINVKNSVRFTGKKGEGAVKFDRFSCLIVYKPSTKSSSLVNDG
                     VMSLRDCDHPQGSIRRLPSQTRSVRQKPEGCEAKSILKIKANTREKEEIRRAIRCDEV
                     DIESFMNLFEHFENKKQMEEIKLGEVREDQLNHYYSEQFFPEILEDVTVTTAHNSEFS
                     RSRKATELNIGRNLGAIKCGLVHYVCPTCDTKIL"
     gene            complement(<686950..>688332)
                     /gene="TDEL0D03740"
                     /locus_tag="TDEL_0D03740"
                     /db_xref="GeneID:11502392"
     mRNA            complement(<686950..>688332)
                     /gene="TDEL0D03740"
                     /locus_tag="TDEL_0D03740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681121.1"
                     /db_xref="GeneID:11502392"
     CDS             complement(686950..688332)
                     /gene="TDEL0D03740"
                     /locus_tag="TDEL_0D03740"
                     /inference="similar to DNA sequence:INSDC:YDR023W"
                     /note="similar to Saccharomyces cerevisiae SES1 (YDR023W);
                     ancestral locus Anc_3.251"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681169.1"
                     /db_xref="GeneID:11502392"
                     /db_xref="GOA:G8ZTL4"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002317"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR010978"
                     /db_xref="InterPro:IPR015866"
                     /db_xref="UniProtKB/TrEMBL:G8ZTL4"
                     /translation="MLDINQFIEDKGGNPELIRKSQKARGASVELVDEIISDYKEWVK
                     TRFDLDELNKKLNKLQKEIGLKFKSKEDASELLAEKEKLTQEKKNLTEREQAEDKDLR
                     SKVFQIGNIVHPSVVVSNDEENNELVRTWKPEGLETVGEQGSASGQPARLSHHEVLLR
                     LDGYDPERGVKISGHRGYFFRNYGVFLNQALINYGLSFLASKGYIPLQAPVMMNKEVM
                     AKTAQLSQFDEELYKVIDGEDEKYLIATSEQPISAYHSNEWFEKPQEQLPIRYAGYSS
                     CFRREAGSHGKDAWGVFRVHAFEKIEQFVLTEPEKSWEEFENMINNSEEFYQSLKLPY
                     RVVGIVSGELNNAAAKKYDLEAWFPYQKEYKELVSCSNCTDYQSRNLEIRCGIKKMGD
                     REKKYVHCLNSTLAATQRALCCVLENYQTDEGLIVPEVLRKYIPGEPEFLPFTKELPK
                     NSTSSKEKKK"
     gene            688797..688870
                     /gene="TDEL0Dtrna1V"
                     /locus_tag="TDEL_0Dtrna1V"
                     /db_xref="GeneID:11502393"
     tRNA            688797..688870
                     /gene="TDEL0Dtrna1V"
                     /locus_tag="TDEL_0Dtrna1V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUA"
                     /db_xref="GeneID:11502393"
     gene            <689004..>689450
                     /gene="TDEL0D03750"
                     /locus_tag="TDEL_0D03750"
                     /db_xref="GeneID:11503634"
     mRNA            <689004..>689450
                     /gene="TDEL0D03750"
                     /locus_tag="TDEL_0D03750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681122.1"
                     /db_xref="GeneID:11503634"
     CDS             689004..689450
                     /gene="TDEL0D03750"
                     /locus_tag="TDEL_0D03750"
                     /inference="similar to DNA sequence:INSDC:YDR022C"
                     /note="similar to Saccharomyces cerevisiae CIS1 (YDR022C);
                     ancestral locus Anc_3.250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681170.1"
                     /db_xref="GeneID:11503634"
                     /db_xref="InterPro:IPR018621"
                     /db_xref="UniProtKB/TrEMBL:G8ZTL5"
                     /translation="MQPLTLTLYDKNVRHMLNDGNQSSSYRTPDGESNAIFPTNFHYI
                     FEDDEDDQEELDTDESIENIVILHLEENGALVHAELISDHLELLSYNKTISSSGNDDN
                     QNQDFELEIVSQFSDLSPLVHDLPLAELIRLYTIQNEQLQIISDSM"
     gene            complement(<689455..>690651)
                     /gene="TDEL0D03760"
                     /locus_tag="TDEL_0D03760"
                     /db_xref="GeneID:11502394"
     mRNA            complement(<689455..>690651)
                     /gene="TDEL0D03760"
                     /locus_tag="TDEL_0D03760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681123.1"
                     /db_xref="GeneID:11502394"
     CDS             complement(689455..690651)
                     /gene="TDEL0D03760"
                     /locus_tag="TDEL_0D03760"
                     /inference="similar to DNA sequence:INSDC:YDR021W"
                     /note="similar to Saccharomyces cerevisiae FAL1 (YDR021W);
                     ancestral locus Anc_3.249"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681171.1"
                     /db_xref="GeneID:11502394"
                     /db_xref="GOA:G8ZTL6"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZTL6"
                     /translation="MSFNKDEDSKLKFRTSRKLPIAPTFEAMKLKDDLLRGIYSYGFE
                     APSAIQSRAITQIISGKDVIAQAQSGTGKTATFTIGILQAIELKRKDLQALVLSPTRE
                     LATQISQVVSNLGDYMNVKTYAITGGKTLKDDIKKIQGSGCHIVSGTPGRVLDMIKRQ
                     ILKTRSVQMLILDEADELLSERLGFKNQIYDIFTKLPPACQVVVVSATMNKDILEITK
                     KFMSDPVKILVKKDEISLEGIKQYMVNVDKEDWKFDTLCDLYDSLTITQCVIFCNTKK
                     KVDWLAQKMSQSNFAVSSMHGDMKQEDRDRVMNDFRTGHSRVLISTDVWARGIDVQQI
                     SLVINYDIPEILENYIHRIGRSGRFGRKGVAINFVTRDDVSKLKEIEKFYSIKIKAMP
                     ANLADI"
     gene            <690840..>691538
                     /gene="TDEL0D03770"
                     /locus_tag="TDEL_0D03770"
                     /db_xref="GeneID:11502395"
     mRNA            <690840..>691538
                     /gene="TDEL0D03770"
                     /locus_tag="TDEL_0D03770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681124.1"
                     /db_xref="GeneID:11502395"
     CDS             690840..691538
                     /gene="TDEL0D03770"
                     /locus_tag="TDEL_0D03770"
                     /inference="similar to DNA sequence:INSDC:YDR020C"
                     /note="similar to Saccharomyces cerevisiae YDR020C;
                     ancestral locus Anc_3.248"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681172.1"
                     /db_xref="GeneID:11502395"
                     /db_xref="GOA:G8ZTL7"
                     /db_xref="InterPro:IPR006083"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZTL7"
                     /translation="MTGQIQLVIISIGGGHATGVMEAGTQIKQSLVKIFPHTNIRIID
                     LDALSDRKPKYYSHKDYDFDAVHRQLTEGGHFTKTVAIKNANDANSSDPIELVLLCGC
                     YALFDERINNLAQLKVFLDSDGDKRLINLINLRKIATGEELSELLTEYMDHLRVEMHK
                     FIGPTRANADLIIPCTNDNTGCAIITDGIVRVVQDIRGSGHHTHSFAKQSPLLLDFEA
                     ERMNVEKERYYDLA"
     gene            <691980..>693683
                     /gene="TDEL0D03780"
                     /locus_tag="TDEL_0D03780"
                     /db_xref="GeneID:11502396"
     mRNA            <691980..>693683
                     /gene="TDEL0D03780"
                     /locus_tag="TDEL_0D03780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681125.1"
                     /db_xref="GeneID:11502396"
     CDS             691980..693683
                     /gene="TDEL0D03780"
                     /locus_tag="TDEL_0D03780"
                     /inference="similar to DNA sequence:INSDC:YBR044C"
                     /note="similar to Saccharomyces cerevisiae TCM62
                     (YBR044C); ancestral locus Anc_3.247"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681173.1"
                     /db_xref="GeneID:11502396"
                     /db_xref="GOA:G8ZTL8"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:G8ZTL8"
                     /translation="MLRKAVGRGGSIRSIKTLHTPVFKTNDLATKQALLDDIKLLDKI
                     VNSTSHNKSLLSTGKYRTKPQIITSQDTVKLQNVVREFLDRIQMEQSMADPKQVDLKQ
                     KLSKIGLQLFVDCHDRNIIPMSTTLSHILMQQYNQSPTRETLNGIQQSLSKVRKFLEE
                     NKVIIKSKDDIDALVNEVYSSRLELDIIKRVLEAVDYKLHSPDTVRVVKSSRTTDDLE
                     ISKGWRFPAGIMDTNEAYLRSLRLPEKKLVSIEKEMLVLVYDGTLKDADKILPTLNYA
                     AKIQKSLLLVVTGDCIGDALTCITINNNKNMRQANDSRAIIMKYNTKANGDLALQENY
                     DFINFLRLPKGFASVYSPEFSPCVPSKFCEDQFYGKLASLKATTGEAFLYNSTDWSDN
                     DSHNQFLQMTVTVKVGGHSELEIDQRRTSLDNLINNVLCHGLSSGFIPSYGIALAKAV
                     LPVSTLIKPNTPLETKLGIEAVTMALTAPMATALENMYSYNKFQVAGLVADAIQGPDF
                     TKASLEPNSKEQDLLERGILEPWNKIDQCLANVATFIRLLSSCNTVVAQVNEKPKRAN
                     T"
     gene            <693953..>695143
                     /gene="TDEL0D03790"
                     /locus_tag="TDEL_0D03790"
                     /db_xref="GeneID:11502397"
     mRNA            <693953..>695143
                     /gene="TDEL0D03790"
                     /locus_tag="TDEL_0D03790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681126.1"
                     /db_xref="GeneID:11502397"
     CDS             693953..695143
                     /gene="TDEL0D03790"
                     /locus_tag="TDEL_0D03790"
                     /inference="similar to DNA sequence:INSDC:YDR019C"
                     /note="similar to Saccharomyces cerevisiae GCV1 (YDR019C);
                     ancestral locus Anc_3.246"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681174.1"
                     /db_xref="GeneID:11502397"
                     /db_xref="GOA:G8ZTL9"
                     /db_xref="InterPro:IPR006222"
                     /db_xref="InterPro:IPR006223"
                     /db_xref="InterPro:IPR013977"
                     /db_xref="InterPro:IPR027266"
                     /db_xref="InterPro:IPR028896"
                     /db_xref="InterPro:IPR029043"
                     /db_xref="UniProtKB/TrEMBL:G8ZTL9"
                     /translation="MLSRVIQRRFNSSQTASNLKKTALYDLHVALGGTMVPFAGYSMP
                     VLYQGQTHIESHNWTRTNAGLFDVSHMLQSRLTGAGATEFLHKVTPTDFQALEQGNGT
                     LSVLLNEHGGIVDDTLITKQRENDFYVVTNAGCIERDSEFIRSEIKNFTGDCQWDVVQ
                     GRSLLALQGPKAHEVFEPLLREGQTVKDLFFGQRRSYELFNGIPVDVARSGYTGEDGF
                     EISLPNDKAVEFAQLLLDNQHTKPIGLAARDSLRLEAGMCLYGHELNEDTTPVEAALR
                     WVISKSRRAGEGTKFNGYEKIMDQINSNSYSDVRIGFKYLKKGPAARTDAKIFLPDNK
                     TQVGVVTSGSASPSLGNINIGQGYVSKANRKTGTQLSVQVRNKFFPIELAKLPLVPTH
                     YYKP"
     gene            <695403..>697325
                     /gene="TDEL0D03800"
                     /locus_tag="TDEL_0D03800"
                     /db_xref="GeneID:11502398"
     mRNA            <695403..>697325
                     /gene="TDEL0D03800"
                     /locus_tag="TDEL_0D03800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681127.1"
                     /db_xref="GeneID:11502398"
     CDS             695403..697325
                     /gene="TDEL0D03800"
                     /locus_tag="TDEL_0D03800"
                     /inference="similar to DNA sequence:INSDC:YBR043C"
                     /note="similar to Saccharomyces cerevisiae QDR3 (YBR043C);
                     ancestral locus Anc_3.245"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681175.1"
                     /db_xref="GeneID:11502398"
                     /db_xref="GOA:G8ZTM0"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZTM0"
                     /translation="MTTESLHSESTRATETHSTAHTEPQPYTGYEKSTGVQVDNVPDT
                     ETTGIHILKDERYVVPRKERRGLLAHLSIIPEFKDPRDYPASIKKLIVLIIAFSSLMG
                     PMATSIVFPAINPITESLDTTTFMVNISVGVYSLSLGIFPLWWSSFSEMHGRRSVYVV
                     SFIMLFGFCIGAALSPNISSFIILRVLCGAASASVQSVGAGTVSDLYIPEDRGRNLGI
                     YYMGPLMAPLIAPIIASGLVTRWSWRSTQWFMVILAGFDVLLLVFFLPETLRKQDSKA
                     AIAAILLERRNHNANKNPGIEATVDLVADHSNDNESKESSNDGDGEEDLRRMLTDASS
                     RHNYPTADHNIDVGAPQISRIQSQDPRWESRMRDYDLARMRTNLENELAKTETQKSRL
                     TDSVGRSKKRIIMNQCYIHFIRPMKSVYFLKYPPVLMAIIFSAISFSVLYFVNMTIEY
                     DYSRSPYNFKPLFVGLLYIPNSVTYIIAAIYGGKWVDSLLKRYKVKYGILAPEARISW
                     NLVTAVAIFPVSLLIFGWCLDKKCHWVTPLIGTALFGFASMMTIGATVSYLVDSLPGR
                     GATGVALNNLVRQILAAVAVFVTEPMLKGMGTGWAFTMLAFIIIGSSSVLLILKRYGD
                     HWRENYDLQKLYDQVE"
     gene            <697491..>698690
                     /gene="TDEL0D03810"
                     /locus_tag="TDEL_0D03810"
                     /db_xref="GeneID:11502399"
     mRNA            <697491..>698690
                     /gene="TDEL0D03810"
                     /locus_tag="TDEL_0D03810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681128.1"
                     /db_xref="GeneID:11502399"
     CDS             697491..698690
                     /gene="TDEL0D03810"
                     /locus_tag="TDEL_0D03810"
                     /inference="similar to DNA sequence:INSDC:YBR042C,YDR018C"
                     /note="similar to Saccharomyces cerevisiae CST26 (YBR042C)
                     and YDR018C; ancestral locus Anc_3.244"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681176.1"
                     /db_xref="GeneID:11502399"
                     /db_xref="GOA:G8ZTM1"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:G8ZTM1"
                     /translation="MSVKQGFIRARKLVVAVLSIIMMIFGSTSLVASQAVFQLCYPKG
                     SPQLQQKYNYTKKAFISLLISILNFVSPSAIRISTDNATIAKGTFYKSNGKLMSHLKH
                     RSIIIANHQIYTDWVFLWWLLSTSNLASNIFIILKKSLESIPILGYGMRNFRFIFISR
                     RWVQDKITLQNSLGTIDANSRGVGPLSGNQPLRVEEDGEMFWNTNKVDESKSWPYSLL
                     LFPEGTNLSPTTRRRSASFAEKVGQQAFRHVLLPHATGLRTSLKLLGPSVEVVYDITI
                     GYSGVGRDTYGEMIYRLPNIFLRGETPKLVDMHIRAFNVAEIPVDDEEEFNQWLYKVW
                     KEKDDLMETYYTKGSFDLDPELDQTVVGKFNVDLKPCIVTSIVPTAFVLSLLLVTYLM
                     YLLYSKL"
     gene            complement(<698728..>700740)
                     /gene="TDEL0D03820"
                     /locus_tag="TDEL_0D03820"
                     /db_xref="GeneID:11502400"
     mRNA            complement(<698728..>700740)
                     /gene="TDEL0D03820"
                     /locus_tag="TDEL_0D03820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681129.1"
                     /db_xref="GeneID:11502400"
     CDS             complement(698728..700740)
                     /gene="TDEL0D03820"
                     /locus_tag="TDEL_0D03820"
                     /inference="similar to DNA sequence:INSDC:YBR041W"
                     /note="similar to Saccharomyces cerevisiae FAT1 (YBR041W);
                     ancestral locus Anc_3.243"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681177.1"
                     /db_xref="GeneID:11502400"
                     /db_xref="GOA:G8ZTM2"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:G8ZTM2"
                     /translation="MADNVILHLIKRVLTLCYRIVKLVLSILLLGLAFIFKKPLDILD
                     RKYRIREDFYIIPFFLKALVRYIISVRRNRFQYWYTFSRQVRKNAERTAICYPRPSTV
                     KGEYEVEKYTYQEFYDIVLRLSHVMHYQYGVEAGEHIGLDSTNKPLFLFLLFAIWNIG
                     AIPALLNYNIMGKPLVHSLKTASVSKVFIDPQASKPMLESEDLIRETLPDTQLNYIHE
                     ADLMRVLTNPSSPEFLQLDEVRSPKGLTDYKPAMFIFTSGTTGLPKSAIMSWRKAVFA
                     CNLFSHVFHMDKRSVAFTAMPLFHSTAAMLGLCAIISQGGCLAMANKFSATNFWKQAY
                     LTNATHVQYVGEICRYLLHAPPSKYDHMHSVKVAYGNGLRPDIWQRFRKRFNIESIGE
                     FYAATEAPFATTCLQKGDFGVGACKSYGSVINWFLSFQQVLVRMDPEDDSVVYRNAKG
                     LCERPAVGEPGELLMKILFPKKPETSFQGYLGNKKETESKVLRNVFKKGDAYYRCGDL
                     FREDENGLLYFLDRLGDTFRWKSENVSTSEVEDEIMSSNDTDFAQTVVVGVKIPGYEG
                     RAGFAVIKTVDNSLSDERKLNLLEDLLADLNKELPKYALPIFIKLVDEIEMTDTNKIS
                     KKTYKNQVLPHGPGGDETIYWLKDYSEYKVLTEKDWEAIKTQNVKL"
     gene            complement(<701405..>702301)
                     /gene="TDEL0D03830"
                     /locus_tag="TDEL_0D03830"
                     /db_xref="GeneID:11502401"
     mRNA            complement(<701405..>702301)
                     /gene="TDEL0D03830"
                     /locus_tag="TDEL_0D03830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681130.1"
                     /db_xref="GeneID:11502401"
     CDS             complement(701405..702301)
                     /gene="TDEL0D03830"
                     /locus_tag="TDEL_0D03830"
                     /inference="similar to DNA sequence:INSDC:YBR040W"
                     /note="similar to Saccharomyces cerevisiae FIG1 (YBR040W);
                     ancestral locus Anc_3.242"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681178.1"
                     /db_xref="GeneID:11502401"
                     /db_xref="InterPro:IPR016509"
                     /db_xref="UniProtKB/TrEMBL:G8ZTM3"
                     /translation="MLAFKAVCFCIKRMPRIFALSFNVIAVFLTAFLLIGCYNETSLS
                     TFLVSYKFEKSSPFYSVIKSSFNSTTVRSNVSLSGLENVEIKSGYMGVCLLNLPKDYD
                     SDSQRICYPRKNLFNTTVYSDLSIEMFNLPSTNNSGSNSQNNVPIKLNILQLGQLTSV
                     EIIHPYILMATVVLSCAMFLLIIYVTLPKLPKKQFMTRVLLAWSPVLTLLWGFGTMWT
                     HVGINATSELAPAASMGIIKAKRGKKAATMSWCAFAFLLLDCLIIWALYFRDRKKLSD
                     EIDKIKASNSYDKYHSDSSTLA"
     gene            complement(<702497..>703369)
                     /gene="TDEL0D03840"
                     /locus_tag="TDEL_0D03840"
                     /db_xref="GeneID:11502402"
     mRNA            complement(<702497..>703369)
                     /gene="TDEL0D03840"
                     /locus_tag="TDEL_0D03840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681131.1"
                     /db_xref="GeneID:11502402"
     CDS             complement(702497..703369)
                     /gene="TDEL0D03840"
                     /locus_tag="TDEL_0D03840"
                     /inference="similar to DNA sequence:INSDC:YBR039W"
                     /note="similar to Saccharomyces cerevisiae ATP3 (YBR039W);
                     ancestral locus Anc_3.241"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681179.1"
                     /db_xref="GeneID:11502402"
                     /db_xref="GOA:G8ZTM4"
                     /db_xref="InterPro:IPR000131"
                     /db_xref="InterPro:IPR023632"
                     /db_xref="InterPro:IPR023633"
                     /db_xref="UniProtKB/TrEMBL:G8ZTM4"
                     /translation="MFSRVGAQVARQNVRQYATLKEVEMRLKSIKNIEKITKTMKIVA
                     STRLSKAEKAKNTAKVFDSADNQFYRNAETKALEQPEEKKELVIAITSDKGLCGSIHS
                     QLAKAVRRHMQEAPSADIVAIGDKIKAQLLRTHADNVKFAVNGIGKEAPTFLEAASIA
                     DKLLALGAGTYPKISIFYNDPVSSISFEPKVKPVFTPETIKESPGYSKYEIDLDAKVP
                     TDLFEYTLANKILTAMAEGYAAEISARRNAMDNASKNAGDMINRYSILYNRTRQAVIT
                     NELVDIITGASSLD"
     gene            <704134..>706500
                     /gene="TDEL0D03850"
                     /locus_tag="TDEL_0D03850"
                     /db_xref="GeneID:11502403"
     mRNA            <704134..>706500
                     /gene="TDEL0D03850"
                     /locus_tag="TDEL_0D03850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681132.1"
                     /db_xref="GeneID:11502403"
     CDS             704134..706500
                     /gene="TDEL0D03850"
                     /locus_tag="TDEL_0D03850"
                     /inference="similar to DNA sequence:INSDC:YDR017C"
                     /note="similar to Saccharomyces cerevisiae KCS1 (YDR017C);
                     ancestral locus Anc_3.240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681180.1"
                     /db_xref="GeneID:11502403"
                     /db_xref="GOA:G8ZTM5"
                     /db_xref="InterPro:IPR005522"
                     /db_xref="UniProtKB/TrEMBL:G8ZTM5"
                     /translation="MDHEIVEQPDESVASLKDLNVSDRKRLSNVIHGRKASTYLRIFR
                     DDDSITEPETVERPTEPKRRKSLSLYDTHYNSSTLPRRKFSRSKDNLSQVRPKKQDDS
                     PNLKPVSSATYYPHKAKENNDDDVLDEEIVPKLSPSRSMERDDYSEAIESDDEDDQDT
                     DFPLAVELQPFTNNVGGHTAIFRFSKRAVCKALVNRENEWYENIEINHKELLQFMPRY
                     IGVLNVRQHFHSRDEPLNQVPSEKSKKKSIDEPTTNNVGEPLKQIQSLPCDSVYLDYP
                     QQALPEVVLNDNRHIIPESLLYFYPQSSPNSAPSDSYLLSLNNRHSVPCDGENNITGS
                     TTVNTKLKELVLQEVFAPAHNCSRPRRSSKKNRASSHGNSRRNSNQSLKNLSTRTANS
                     PLLKKSTKESISNAITSPSSVMDLKQLKRKEMARENIRNSAQLSPSCSNKSSPLIHTN
                     EAISPLTLPVDRMNSEDIFNMDDEDDTDLRRNQLPEPALSPAQDKKNDDSVSYEEHSD
                     SIVSKFILLEDLTRKLNKPCALDLKMGTRQYGVDATRKKQLSQREKCLKTTSRKLGVR
                     VCGLKTWNGSYYITRDKYFGRRVKIGWQFTRVLARFIYDGQIISSIIRQIPRLVKQLD
                     TLATEISALKGYRLYGSSLLLMYDGSNPGNKRCRVKVNLIDFARCVTKDGYDQAYQSF
                     RIPPKNPDKEDRGFLRGIRSLKFYLNSIWNYLTGDVPLCNDDEELEQLIERHREKFDK
                     NWDWLDQFDKEKEEDFNNPNSELRTKWRKYELIFDLEPVYNDDVEVSD"
     gene            <707946..>708230
                     /gene="TDEL0D03860"
                     /locus_tag="TDEL_0D03860"
                     /db_xref="GeneID:11502404"
     mRNA            <707946..>708230
                     /gene="TDEL0D03860"
                     /locus_tag="TDEL_0D03860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681133.1"
                     /db_xref="GeneID:11502404"
     CDS             707946..708230
                     /gene="TDEL0D03860"
                     /locus_tag="TDEL_0D03860"
                     /inference="similar to DNA sequence:INSDC:YDR016C"
                     /note="similar to Saccharomyces cerevisiae DAD1 (YDR016C);
                     ancestral locus Anc_3.239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681181.1"
                     /db_xref="GeneID:11502404"
                     /db_xref="GOA:G8ZTM6"
                     /db_xref="InterPro:IPR013958"
                     /db_xref="UniProtKB/TrEMBL:G8ZTM6"
                     /translation="MDVAADDQREKTQLTSSDKYFIEQRDLIVQDINNTMDSILNNLN
                     TLNISLENSIAVGKEFESVSDLWKTFYNGLESSNDALMSSQDNDPEGSQK"
     gene            complement(<708235..>708741)
                     /gene="TDEL0D03870"
                     /locus_tag="TDEL_0D03870"
                     /db_xref="GeneID:11502405"
     mRNA            complement(<708235..>708741)
                     /gene="TDEL0D03870"
                     /locus_tag="TDEL_0D03870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681134.1"
                     /db_xref="GeneID:11502405"
     CDS             complement(708235..708741)
                     /gene="TDEL0D03870"
                     /locus_tag="TDEL_0D03870"
                     /inference="similar to DNA sequence:INSDC:YDR014W-A"
                     /note="similar to Saccharomyces cerevisiae HED1
                     (YDR014W-A); ancestral locus Anc_3.238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681182.1"
                     /db_xref="GeneID:11502405"
                     /db_xref="UniProtKB/TrEMBL:G8ZTM7"
                     /translation="MRRSLTTYVTDEEERRPLVRRAATASAICAVGVVEVGLGMIKLE
                     EVGEVSQFSQLEYQTEAHPETRPNPQRESSPEVEVVPDTSVEEIHDHQSGGEESIWVP
                     ETPETSLDEVSLPEGVHKSLKDLIYKTNKNLYDVDSNKVKYKAGLSRKGLAVPSLHRR
                     KGHDSSPA"
     gene            <710881..>711567
                     /gene="TDEL0D03880"
                     /locus_tag="TDEL_0D03880"
                     /db_xref="GeneID:11502406"
     mRNA            <710881..>711567
                     /gene="TDEL0D03880"
                     /locus_tag="TDEL_0D03880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681135.1"
                     /db_xref="GeneID:11502406"
     CDS             710881..711567
                     /gene="TDEL0D03880"
                     /locus_tag="TDEL_0D03880"
                     /inference="similar to DNA sequence:INSDC:YBR035C"
                     /note="similar to Saccharomyces cerevisiae PDX3 (YBR035C);
                     ancestral locus Anc_3.236"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681183.1"
                     /db_xref="GeneID:11502406"
                     /db_xref="GOA:G8ZTM8"
                     /db_xref="InterPro:IPR000659"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="InterPro:IPR019576"
                     /db_xref="InterPro:IPR019740"
                     /db_xref="UniProtKB/TrEMBL:G8ZTM8"
                     /translation="MADDAERTQTPIIFAPETYQYDKFSLNDSQLTKDPIEQFTKWFE
                     EAKADKSETLPEAINFSSAELPSGRVSSRVLLFKELDHRGFTIYSNWGTSKKANDINS
                     NPHAAITFFWKDLQRQVRIEGFTEHVNRTTSERYFKTRPRGSKIGAWSSPQSHVIQSR
                     EELDELTKQNEKRFQDIQDIPCPDYWGGLRVVPLEIEFWQGRPSRLHDRFSYRRKTEH
                     DSWELVRLAP"
     gene            complement(<711602..>713380)
                     /gene="TDEL0D03890"
                     /locus_tag="TDEL_0D03890"
                     /db_xref="GeneID:11502407"
     mRNA            complement(<711602..>713380)
                     /gene="TDEL0D03890"
                     /locus_tag="TDEL_0D03890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681136.1"
                     /db_xref="GeneID:11502407"
     CDS             complement(711602..713380)
                     /gene="TDEL0D03890"
                     /locus_tag="TDEL_0D03890"
                     /inference="similar to DNA sequence:INSDC:YDR014W"
                     /note="similar to Saccharomyces cerevisiae RAD61
                     (YDR014W); ancestral locus Anc_3.235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681184.1"
                     /db_xref="GeneID:11502407"
                     /db_xref="UniProtKB/TrEMBL:G8ZTM9"
                     /translation="MVKVYGKRSSSLVCQFSQPNDSEVELSDTEDGKQEDDQRDCATE
                     VTDSTSGGQDELALSNDTTVETSKLSCDSEDQFSISSVPSSVQGTHNEDKFKAFDFLD
                     SNTNTKKRRTNYRRNNSEVCDIPATGFPSIPIDRTVSDLNAFLSSLQPANGEDDLQET
                     LERELRKSVQESKSKVRGRVMYDRSRTMLYNKEEEENAIEEGEEKEDTTEISEEDPSS
                     ADGSTHHYNELKNMGESLKYQDDLGFLTEKSPSKLDTDSFTSRLLNLALTLKQDEDFL
                     LYVDKHCAIDVCSWSLAKKALDHPVTTMLQAFLLAKIDLPQESLPFLSEKLIVALLSA
                     DKVPPKSALHSKMTRLNFIDFLKRTDHTTGQVYALELCLKYRNILKSEDISRRVIRLI
                     EENKNPQLRVLLHPLADCILTQDTTILQDFTQGSSLLSNLVAALPQECNDEFLIKSLI
                     LLSNEHKIITQASKDDKTKIMNCSLDFVLDNVRAEKSDNLDMVILHLGLILNLVDACD
                     WQIDASRLELARDMLYKNMNTGNTEFMVFMLSLALTHLLHRSGVLLPRDEKNLLTKIL
                     KPFDSEAKNCNESIRIKVTTALNYLL"
     gene            <713519..>714145
                     /gene="TDEL0D03900"
                     /locus_tag="TDEL_0D03900"
                     /db_xref="GeneID:11502408"
     mRNA            <713519..>714145
                     /gene="TDEL0D03900"
                     /locus_tag="TDEL_0D03900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681137.1"
                     /db_xref="GeneID:11502408"
     CDS             713519..714145
                     /gene="TDEL0D03900"
                     /locus_tag="TDEL_0D03900"
                     /inference="similar to DNA sequence:INSDC:YDR013W"
                     /note="similar to Saccharomyces cerevisiae PSF1 (YDR013W);
                     ancestral locus Anc_3.234"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681185.1"
                     /db_xref="GeneID:11502408"
                     /db_xref="GOA:G8ZTN0"
                     /db_xref="InterPro:IPR005339"
                     /db_xref="InterPro:IPR021151"
                     /db_xref="UniProtKB/TrEMBL:G8ZTN0"
                     /translation="MYGDLADKLVLEAKRTKHLHSRSSNGYKLPMYHEELIQGILKEV
                     GQLKKNTEFLKEQQSIGSLDDRVSKCQYFVTLLCMERNKRCLLAYQKMRADILDRFAW
                     ENNGLDLLNELKGSEQVASDLSHDEQEYLKDYLDLLTDLKSSELADIDLSGSLTPPSD
                     VFIDVRVLKDAGEIQTEYGVFNLIKDSQFFVRHSDVERLIQQGYLQKI"
     gene            <714493..>715539
                     /gene="TDEL0D03910"
                     /locus_tag="TDEL_0D03910"
                     /db_xref="GeneID:11502409"
     mRNA            <714493..>715539
                     /gene="TDEL0D03910"
                     /locus_tag="TDEL_0D03910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681138.1"
                     /db_xref="GeneID:11502409"
     CDS             714493..715539
                     /gene="TDEL0D03910"
                     /locus_tag="TDEL_0D03910"
                     /inference="similar to DNA sequence:INSDC:YBR034C"
                     /note="similar to Saccharomyces cerevisiae HMT1 (YBR034C);
                     ancestral locus Anc_3.233"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681186.1"
                     /db_xref="GeneID:11502409"
                     /db_xref="GOA:G8ZTN1"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="InterPro:IPR025799"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZTN1"
                     /translation="MSKTNTEESATAKADLTHSEQHYFDSYDHYGIHEEMLQDSVRTL
                     SYRNAIVQNKHLFKDKIVLDVGCGTGILSMFAAKNGAKHVIGVDMSSIIEMARKIVDI
                     NGFSDKITLLRGKLEDVELPFPKVDIIVSEWMGYFLLYESMLDTVLYARDRYLVEGGL
                     IFPDKCSIHIAGLEDAHYKDEKLNYWHDVYGFDYSPFIPLVMEEPIVDTVQSNVVNTT
                     RCQLIEFDLNTVKLSDLSFKAKFQVQAKRQDWINGLIAWFDCVFPAPEGRTPVGFSTG
                     AHSPYTHWKQTVFYLKDNLECETGDILEGEITCAPNKNHNRDLDVKINYSFRAKGVDA
                     NRRRRIGENRYVMH"
     gene            complement(<715675..>716763)
                     /gene="TDEL0D03920"
                     /locus_tag="TDEL_0D03920"
                     /db_xref="GeneID:11502410"
     mRNA            complement(<715675..>716763)
                     /gene="TDEL0D03920"
                     /locus_tag="TDEL_0D03920"
                     /product="60S ribosomal protein L4"
                     /transcript_id="XM_003681139.1"
                     /db_xref="GeneID:11502410"
     CDS             complement(715675..716763)
                     /gene="TDEL0D03920"
                     /locus_tag="TDEL_0D03920"
                     /inference="similar to DNA sequence:INSDC:YBR031W,YDR012W"
                     /note="similar to Saccharomyces cerevisiae RPL4A (YBR031W)
                     and RPL4B (YDR012W); ancestral locus Anc_3.232"
                     /codon_start=1
                     /product="60S ribosomal protein L4"
                     /protein_id="XP_003681187.1"
                     /db_xref="GeneID:11502410"
                     /db_xref="GOA:G8ZTN2"
                     /db_xref="InterPro:IPR002136"
                     /db_xref="InterPro:IPR013000"
                     /db_xref="InterPro:IPR023574"
                     /db_xref="InterPro:IPR025755"
                     /db_xref="UniProtKB/TrEMBL:G8ZTN2"
                     /translation="MSRPQVTVQSLTGEATSSSVPLPAVFHAPIRADIVHSVFTSVNK
                     NKRQAYAVSEKAGHQTSAESWGTGRAVARIPRVGGGGTHRSGQAAFGNMCRGGRMFAP
                     TKTWRKWNVKVNHNEKRYATASAIAASAVASLVLARGHRVEKIPEIPLVVSNDLESVK
                     KTKEAVAALKAVGAQAELVKVLKSKKLRAGKGKYRNRRFTQRRGPLVVYSEDNGIVKA
                     FRNVPGVETANVASLNLLQLAPGAHLGRFVIWTESAFASLDKVWGSETVASSKSNYSL
                     PQSIITNPDVTRIINSSDIQSIVRPAGQATVKRTHVLKKNPLKNKQVLLRLNPYAKVF
                     AAEKLGSKKAEKASNKPSQVFSETLKHD"
     gene            complement(<716963..>718417)
                     /gene="TDEL0D03930"
                     /locus_tag="TDEL_0D03930"
                     /db_xref="GeneID:11502411"
     mRNA            complement(<716963..>718417)
                     /gene="TDEL0D03930"
                     /locus_tag="TDEL_0D03930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681140.1"
                     /db_xref="GeneID:11502411"
     CDS             complement(716963..718417)
                     /gene="TDEL0D03930"
                     /locus_tag="TDEL_0D03930"
                     /inference="similar to DNA sequence:INSDC:YBR030W"
                     /note="similar to Saccharomyces cerevisiae YBR030W;
                     ancestral locus Anc_3.231"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681188.1"
                     /db_xref="GeneID:11502411"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR011383"
                     /db_xref="UniProtKB/TrEMBL:G8ZTN3"
                     /translation="MSNTQPDDLSDVLRFVGDSDDSFWSIECEVRTSPNGGLGVFAKQ
                     DLEEGTVLLKLPKSCLFSASNSSIANLLVDDEIDGVLALNIAFLYETTVFKEKSHWFP
                     YLKSIRIYNDDGLLVLPPSHWSETEKLLLKGSTLDTLHGGLAKDEDVQEGFEIAIDLA
                     HKWNGEFGLPIPQGFLDVDLSDKQEVLLKFHRFVATAYALSSRIFEIDAFHESALVPI
                     ADLFNHHVTTPDVHFSSLYDVCQLCGEPGMCKHLVAEAALEAAQQDLSEQEMDESSDE
                     DEDNDDDESKQDELVDMTLVHAVKKGQEVFNSYGDLSNALLLARYGFTVAHNPNDVLH
                     LGKEIRQLARHQRHAQRIAWWRKIGYPLWFRSTHKQETEPDEELEQELPPWLSEMCID
                     SEGSPAEALVAFLNLLSMSELQWKRLYDTSKIQALNKMGDAGVRTFLLRLLAYKGLSL
                     QLPKPDTPDTIKSLLNSERRILQKAKYLQTQPHN"
     gene            <718798..>720072
                     /gene="TDEL0D03940"
                     /locus_tag="TDEL_0D03940"
                     /db_xref="GeneID:11502412"
     mRNA            <718798..>720072
                     /gene="TDEL0D03940"
                     /locus_tag="TDEL_0D03940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681141.1"
                     /db_xref="GeneID:11502412"
     CDS             718798..720072
                     /gene="TDEL0D03940"
                     /locus_tag="TDEL_0D03940"
                     /inference="similar to DNA sequence:INSDC:YBR029C"
                     /note="similar to Saccharomyces cerevisiae CDS1 (YBR029C);
                     ancestral locus Anc_3.230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681189.1"
                     /db_xref="GeneID:11502412"
                     /db_xref="GOA:G8ZTN4"
                     /db_xref="InterPro:IPR000374"
                     /db_xref="InterPro:IPR016720"
                     /db_xref="UniProtKB/TrEMBL:G8ZTN4"
                     /translation="MKDKQKPKSAGTGAKTVGKTPQEKKESKKSNFLVRTIWTWIMIA
                     GFFITLASGHFWCIMLILACQIATFKECIGVTSESGRAKNLPLTKTLNWYFLFTTIYY
                     LDGKSLFQFFQDYFIEYKGLTLLAANHRFICYCLYLLGFVLFVCSLRKGFLKFQFASL
                     CATHMVLMLVVGQAHLIIKNVINGLIWFLLPCGLVIVNDIFAYLCGITFGRTKLIEIS
                     PKKTLEGFLGAWFFTALASIILTKIFSSFMYMTCPVKDIHTNFFSNLTCELNPVFVPQ
                     DYRLPPIIFDKLGVSVLTVKPIYFHALNLATFASLFAPFGGFFASGLKRTFQVKDFGH
                     SIPGHGGITDRVDCQFIMGSFANLYYETFISENRITVETVLSTILMNLDEKQIVRLIS
                     TLNAILFKKGIFTEQKYKQLASIYNAATDKLD"
     gene            <720229..>721710
                     /gene="TDEL0D03950"
                     /locus_tag="TDEL_0D03950"
                     /db_xref="GeneID:11502413"
     mRNA            <720229..>721710
                     /gene="TDEL0D03950"
                     /locus_tag="TDEL_0D03950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681142.1"
                     /db_xref="GeneID:11502413"
     CDS             720229..721710
                     /gene="TDEL0D03950"
                     /locus_tag="TDEL_0D03950"
                     /inference="similar to DNA sequence:INSDC:YBR028C"
                     /note="similar to Saccharomyces cerevisiae YBR028C;
                     ancestral locus Anc_3.229"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681190.1"
                     /db_xref="GeneID:11502413"
                     /db_xref="GOA:G8ZTN5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:G8ZTN5"
                     /translation="MIFHLDEDLGRLKLSDSEDSSLRQGPIAIFDERDDVDHLTVRTE
                     PIPFKDGRTRRRSSVLEKFPVSTPPCTRRVSITAASNPFTSGSLDLGISPNDGGTGLT
                     RSLRDFRPVRVLGKGAYGKVVLVEDEQTSKLYAMKQLQKADIIITKDSEELNGDKNVS
                     KLIERTFAERTILSELEHPNIVKLFYSFHDNSKLYLILQYIPGGELFFHLKEQGTLDE
                     DTVAFYAAEISCALKFLHSKGIVYRDLKPENCLLDQHGHLVLTDFGLSKKSVVQRDNP
                     LSSSTEGDLLGEEVTSLHSIIGTPEYCAPEILQGIPYTKNCDWYSLGCLMYDMMTGKP
                     PHTGANHKVILNKIQKDKQGPKIPYYLSDGMKDMLSALLKKEHTKRWDVDQYWKNTTD
                     NKNKQKKKRKAGQERTSAFTSHFIFRKINWQRLESGALQSSELGPIVPLITDWALAEN
                     FDSEFTSMSYDDPKDNINIPKSASDVFKGFSYKASGSYLDKYF"
     gene            <721950..>723077
                     /gene="TDEL0D03960"
                     /locus_tag="TDEL_0D03960"
                     /db_xref="GeneID:11502414"
     mRNA            <721950..>723077
                     /gene="TDEL0D03960"
                     /locus_tag="TDEL_0D03960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681143.1"
                     /db_xref="GeneID:11502414"
     CDS             721950..723077
                     /gene="TDEL0D03960"
                     /locus_tag="TDEL_0D03960"
                     /inference="similar to DNA sequence:INSDC:YBR026C"
                     /note="similar to Saccharomyces cerevisiae ETR1 (YBR026C);
                     ancestral locus Anc_3.228"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681191.1"
                     /db_xref="GeneID:11502414"
                     /db_xref="GOA:G8ZTN6"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZTN6"
                     /translation="MLHSFKRLMSTKVPRQFKSVVYSSHNLEDCTSVLSIQNYTPKED
                     LAKSIVLRSLAFPINPSDINQLQGVYPSKPEKTLNYSTKEPAAIAGNEGVFEVISVPE
                     GESSLTEGDWVIPVQANQGTWSNYRVFTKASDLIKVNGLDLHSAATVSVNGCTAYQLV
                     NNYVDWNHNANEWLVQNAGTSGVSKVVTQIAKAKGIKTLSVIRDREGFEDVARNLENK
                     YGATKVISETENGDKQFGKEQLPQILGPDAKVRLALNSVGGKSSSAIARKLGKDALML
                     TYGGMSKQPVTLPTSLHIFKGLTSKGFWITENYKRNPEEKPANVADFIKLYKEGKIVS
                     PKDDISSVEWDVNSATDEQLLDLIKSSINAKGKKQLVVLKW"
     gene            complement(<723101..>724270)
                     /gene="TDEL0D03970"
                     /locus_tag="TDEL_0D03970"
                     /db_xref="GeneID:11502415"
     mRNA            complement(<723101..>724270)
                     /gene="TDEL0D03970"
                     /locus_tag="TDEL_0D03970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681144.1"
                     /db_xref="GeneID:11502415"
     CDS             complement(723101..724270)
                     /gene="TDEL0D03970"
                     /locus_tag="TDEL_0D03970"
                     /inference="similar to DNA sequence:INSDC:YBR036C"
                     /note="similar to Saccharomyces cerevisiae CSG2 (YBR036C);
                     ancestral locus Anc_3.227"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681192.1"
                     /db_xref="GeneID:11502415"
                     /db_xref="UniProtKB/TrEMBL:G8ZTN7"
                     /translation="MDTRIYWFTAVAGYIIQTKCFSYLQTRDKHDNISDDNVHRGLMV
                     VLAFMYFASLLLLSPVARFFDKAKETKRKRNSTAPLTLSSSSSDLELQTLTEEEPVAP
                     VAPVAVIRDNKIDSSQGISLTYCAKLLTLSILLLIPIMSYIMALSMSPGFDVALIQNT
                     SVFEITSLLYGVCGFTKRKKVVSKFMVMMIALLGILIVSYTKATCDLLAGKLSINEKT
                     GELNDPYLFDRLKSSLLCGLGALTMGPFAVFWNRWFNKRSQNVSLSQQCSHLSMIGII
                     CMVMLLPFFPSMMNTISAIYKDQQFWFFSLVSVFLGTWLHAVSLLQVNRKTSPEYSTT
                     INLGTIIFMGISDWICEPGQTTIVRWEVIGYIMLSVCCIMLSVSYYDKKRITIHP"
     gene            724657..724728
                     /gene="TDEL0Dtrna2E"
                     /locus_tag="TDEL_0Dtrna2E"
                     /db_xref="GeneID:11502416"
     tRNA            724657..724728
                     /gene="TDEL0Dtrna2E"
                     /locus_tag="TDEL_0Dtrna2E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:11502416"
     gene            <725056..>726237
                     /gene="TDEL0D03980"
                     /locus_tag="TDEL_0D03980"
                     /db_xref="GeneID:11503638"
     mRNA            <725056..>726237
                     /gene="TDEL0D03980"
                     /locus_tag="TDEL_0D03980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681145.1"
                     /db_xref="GeneID:11503638"
     CDS             725056..726237
                     /gene="TDEL0D03980"
                     /locus_tag="TDEL_0D03980"
                     /inference="similar to DNA sequence:INSDC:YBR025C"
                     /note="similar to Saccharomyces cerevisiae OLA1 (YBR025C);
                     ancestral locus Anc_3.226"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681193.1"
                     /db_xref="GeneID:11503638"
                     /db_xref="GOA:G8ZTN8"
                     /db_xref="InterPro:IPR004396"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR013029"
                     /db_xref="InterPro:IPR023192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZTN8"
                     /translation="MPPKKQVEEKKILLGRPGNNLKAGIVGLANVGKSTFFQAITKSP
                     LGNPANYPFATIDPEEARVIVPSSRFDELCQIYKPASEVPAHLTVYDIAGLTKGASAG
                     EGLGNAFLSHIRAVDSIYQVVRCFDDAEIIHIEGDVDPVRDLEIINEELRLKDIEFCE
                     KALENSLKIAKRGGQSLEVKQEKEKAALIERITKLLQEGQRVANQTWTPKEVEAINSM
                     FLLTAKPCIYLINLSERDYARKKNKHLLRIKEWVDKYSPGDLIIPFSVSLEEKLSTMS
                     EEEQAEELKTLQTTSALPKIVTTMRQKLDLISFFTCGPDEVREWTIRKGTKAPQAAGV
                     IHNDLMNTFILAQVMKYEDVIEYKDDAAIKSAGKLLQKGKDYVVEDGDIIYFRAGAGK
                     N"
     gene            complement(<726300..>727211)
                     /gene="TDEL0D03990"
                     /locus_tag="TDEL_0D03990"
                     /db_xref="GeneID:11502417"
     mRNA            complement(<726300..>727211)
                     /gene="TDEL0D03990"
                     /locus_tag="TDEL_0D03990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681146.1"
                     /db_xref="GeneID:11502417"
     CDS             complement(726300..727211)
                     /gene="TDEL0D03990"
                     /locus_tag="TDEL_0D03990"
                     /inference="similar to DNA sequence:INSDC:YBR024W,YBR037C"
                     /note="similar to Saccharomyces cerevisiae SCO2 (YBR024W)
                     and SCO1 (YBR037C); ancestral locus Anc_3.225"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681194.1"
                     /db_xref="GeneID:11502417"
                     /db_xref="GOA:G8ZTN9"
                     /db_xref="InterPro:IPR003782"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017276"
                     /db_xref="UniProtKB/TrEMBL:G8ZTN9"
                     /translation="MLRTRFFRGASPLLRSGVVRGPVCCRTVGQSFRFLSVTSNVNQQ
                     IEDSVKSKKKPLSRLPIGGSEQSSSQRVASDSIEFTTWKAAALFVVVGGTLYYFFSKE
                     KKRLEAEKEAEANRGYGRPVVGGPFNLINDDGEPFTEKNLVGKWSILYFGFTHCPDIC
                     PDELDKLGLWLNSLKKNHGIEMQPIFVTCDPARDSPAVLKQYLKDFHPDIVGLTGTYD
                     QVKSACKQYRVYFSTPPDVKPGQDYLVDHSIFFYLMDPEGQFVEAMGRNYDEKSGVDK
                     IIEHVKTFVPREEREKRKGKWYSFLFE"
     gene            <727556..>730402
                     /gene="TDEL0D04000"
                     /locus_tag="TDEL_0D04000"
                     /db_xref="GeneID:11502418"
     mRNA            <727556..>730402
                     /gene="TDEL0D04000"
                     /locus_tag="TDEL_0D04000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681147.1"
                     /db_xref="GeneID:11502418"
     CDS             727556..730402
                     /gene="TDEL0D04000"
                     /locus_tag="TDEL_0D04000"
                     /inference="similar to DNA sequence:INSDC:YBR038W"
                     /note="similar to Saccharomyces cerevisiae CHS2 (YBR038W);
                     ancestral locus Anc_3.224"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681195.1"
                     /db_xref="GeneID:11502418"
                     /db_xref="GOA:G8ZTP0"
                     /db_xref="InterPro:IPR004834"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR013616"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8ZTP0"
                     /translation="MTRNPFMVEPLSGSPVRGAVPQLSRFHTNNSGRSEGTDFIMDDV
                     EEDYDHSKRFQGLPQSPSKAAIRYSPDRRHRTQFYRDSAHNSPVAERFRSPQRPANPI
                     FQVNDYDVDTDNIISSYQTHPKQQTTIPTTRTGNLFGGRNYSQNSKYTVSTASTVSRS
                     SMEDEKKARYSFESLDDQSTIYSDNFAETKFELNHPVRKDYVRRANSESRRRPVLNNP
                     NLAKAILKLDNPIPRGLLDTLPRRDSPEFTEMRYTACTVEADEFLEEGYTLRFAEMNR
                     ECQIVICITMYNEDKFALARTINSIMKNVAHLCSRKRSQVWGPDGWKKVSVILVSDGR
                     TKVNQGALDYLAALGVYQEDMAKASVNGDPVKAHIFELTTQVSINSNLDYVSQDIVPV
                     QMVFCLKEENKKKINSHRWLFNAFCPVLQPNVVTLIDVGTRLNHTAIYHLWKVFDMDS
                     NVAGAAGQIKTMKGKWGMKLFNPLVASQNFEYKISNILDKPLESVFGYISVLPGALSA
                     YRYRALQNHEDGSGPLNSYFLGETQEGRDHDVFTANMYLAEDRILCWELVAKRNAKWV
                     LKYVKEATGETDVPEDVPEFISQRRRWLNGAMFAALYAQLHFYQIWKTKHSVTRKIFL
                     HVEFFYQFVQMLFSWFAISNFVLTFYYLAGSMNHVIKNGNAIFIFFKYLIFCDLASLF
                     IISMGNRPHGAKHLFIASMIILTICAAYALICGFVFAIKALEDKAESNSVFNNIIISL
                     LSTYGVYTFSSIMYLDPWHMVTSSIQYFLTLPAFTCTLQVFAFCNTHDVSWGTKGSTQ
                     SSKPLSKAIVVQGPDGKQIVETDWPQEVDKKFTEIKSRLKEVEFEETVVDESQKRNDY
                     YRDIRTRIVMIWMLSNLIFIMSITQVYKPENVNNGYLIFILWSVAALAVFRCTGSMAF
                     LSMKYLRMIVSYKNKAEGSGSYGFPKSNIFRRTG"
     gene            complement(<730486..>731841)
                     /gene="TDEL0D04010"
                     /locus_tag="TDEL_0D04010"
                     /db_xref="GeneID:11502419"
     mRNA            complement(<730486..>731841)
                     /gene="TDEL0D04010"
                     /locus_tag="TDEL_0D04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681148.1"
                     /db_xref="GeneID:11502419"
     CDS             complement(730486..731841)
                     /gene="TDEL0D04010"
                     /locus_tag="TDEL_0D04010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681196.1"
                     /db_xref="GeneID:11502419"
                     /db_xref="GOA:G8ZTP1"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR010158"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="UniProtKB/TrEMBL:G8ZTP1"
                     /translation="MTSRTITDTSAVTLNIPAVAPLAIASGRLNSTILETGSQFGAAH
                     RWGELPHEFGMRRLAGTDEDRQMRDWFIKECKSLGCKIKIDKIGNIFAVYPGKDKSGA
                     PPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKENDFTPNYDVCVVVWFNEEGARF
                     ARSCTGSSVWSHDLDLEEAYNLLSVGEDKPESVLESLSKIGYVGETPASYKENQIDAH
                     FELHIEQGPILEDENKKIGIVTGVQSYHWARITVQGEGAHAGTTPWRLRKDAMLMSAK
                     MIVAAADIAKSHQGLFTCGIIDAKPYSVNIIPGEVSFTIDIRHPDDAVEAVILQEVKD
                     EFAKLLKDNTAGALSYQWDVLQISPAVKFNDTCVECVSRSAFAQFEKSQVRQIWSGAG
                     HDSCQTAPHVPTSMIFIPSKDGLSHNYHEYSSAEEVEDGFKVLLQAIINYDNYRASKG
                     H"
     gene            <732383..>735841
                     /gene="TDEL0D04020"
                     /locus_tag="TDEL_0D04020"
                     /db_xref="GeneID:11502420"
     mRNA            <732383..>735841
                     /gene="TDEL0D04020"
                     /locus_tag="TDEL_0D04020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681149.1"
                     /db_xref="GeneID:11502420"
     CDS             732383..735841
                     /gene="TDEL0D04020"
                     /locus_tag="TDEL_0D04020"
                     /inference="similar to DNA sequence:INSDC:YBR023C"
                     /note="similar to Saccharomyces cerevisiae CHS3 (YBR023C);
                     ancestral locus Anc_3.223"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681197.1"
                     /db_xref="GeneID:11502420"
                     /db_xref="GOA:G8ZTP2"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8ZTP2"
                     /translation="MAMSNDLSNDDYFLQMDGGDQESLLRSRHSANSHGPHRQGSLVR
                     PERNRLDNPNNPHYYYVQKAQEQQDHLNVQPSTTGITPSNVRHSQARASLNSVVDDIT
                     DGYPMEDMGPENRKSDVHQDIEDLGNDNQTRLVPSNTATKPLGSKTKSAETISLWRLY
                     CYVISFWAPGPLLALCGMPKPERQMAWREKIGLISVIFYLGAFVAYWTFGFTSTACGS
                     SVLRLKNNEVSTGYMIINGKAFALDSSSHPAAAGIDAGANILYPPINAGGMDGSFLFQ
                     NVNGNCLDLIKPKDDCSIPHDDEGNLAWYFPCKVYSQDGSTAPNFTKSEYYDGWACHT
                     SEAARSAYYSLEPAADIYFTWDDIKNNSRNLVVYNGHVLDLGLLDWLQTDDLDYPPMF
                     DDLRTSAFQGYDLSIILANSYEKKIARCLTEIIKVGEMDSKTVGCIASDVVLYVSLIF
                     ILSVVVAKFLIACYFRWAVAKNQGAFPVDNKTMDQQLNSIEDWSENIQTNGPIKPVAP
                     DLRPVHQHSRNDSKLNMLAKRGSKMFQLNNNSADNTLLPDGTMGGLTTMTTQNAFRAA
                     NERNSLHLGNIFPSKNHSALLSTNSLMFNGNQLTPTPGGSSTQSLESSIIHPDAVQQP
                     PLDFAPYGFPLIHTICFVTCYSEDEEGLRTTLDSLSTTDYPNSHKLIMVVCDGMIKGS
                     GNDITTPEIALGMMDDFVTSPEDVQPYSYVAVASGSKRHNMAKIYAGFYKYNDDTVPP
                     EKQQRVPMITIVKCGTADEQGSAKPGNRGKRDSQVILMSFLQRMTFDERMSELEFQLL
                     KNIWQVTGLMADFYETVLMVDADTKVFPDSLTHMVAEMVKDPLIMGLCGETKIANKAQ
                     SWVTAIQVFEYYISHHQAKAFESVFGSVTCLPGCFSIYRIKSPKGSDGYWVPILANPD
                     IVERYSDNVTNTLHKKNLLLLGEDRYLSSLMLRTFPKRKQVFVPKAACKTIVPDKFKV
                     LLSQRRRWINSTVHNLFELVLIRDLCGTFCFSMQFVIGIELVGTLVLPLAICFTIYVI
                     IVAIVSKPTPTMTLILLAIILGLPGLIVVITATRWSYLMWMAIYIIALPIWNGLLPTY
                     AYWKFDDFSWGDTRTIAGGNKGAHDDVEGEFDHSKIKMRTWREFEREDKLNRLATDEE
                     SNSRMF"
     gene            complement(<736113..>737987)
                     /gene="TDEL0D04030"
                     /locus_tag="TDEL_0D04030"
                     /db_xref="GeneID:11502421"
     mRNA            complement(<736113..>737987)
                     /gene="TDEL0D04030"
                     /locus_tag="TDEL_0D04030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681150.1"
                     /db_xref="GeneID:11502421"
     CDS             complement(736113..737987)
                     /gene="TDEL0D04030"
                     /locus_tag="TDEL_0D04030"
                     /inference="similar to DNA sequence:INSDC:YBR021W"
                     /note="similar to Saccharomyces cerevisiae FUR4 (YBR021W);
                     ancestral locus Anc_3.221"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681198.1"
                     /db_xref="GeneID:11502421"
                     /db_xref="GOA:G8ZTP3"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="UniProtKB/TrEMBL:G8ZTP3"
                     /translation="MSDDLAATFSSLVLENCTEETMQLTTKDDIKFDKIEVSGKTCSD
                     EEGSIYGEVDEAIAEKSWWKRFYYKHVVVDSATLNVSLTQSFLYNYDLKPVEEDRRLW
                     SWHNYLWFWLADCFNISTWQVAATGMQLGLNWWQCWVTVWIGYAMAGAFVVLSSRVGA
                     TYHLSFPISVRASFGIFFSMWPIINRVVMAIVWYAVQAYLGGSTVSLMLKSIFGRDLN
                     ERIPDHFGSPNATTYEFMCFFLFWVGSIPFLIVPPHKLRHLFTVKAALVPFAAFGFLI
                     WAVKKSHGNIALGTLNDDAPHGSAFSWVFIRSMIGCLANFATLIVNAPDFSRLSKTPS
                     SSLWTQLVAIPFLFSITCLIGIIVTAAGYELYGINYWSPIDVLAQFLETTYTRGTRAG
                     VFLISFVFTLAQLGTNISANSLSCGTDMTALLPKYINIKRGSLFCAAMALCICPWNML
                     ASSNKFTMALSAYAIFLSSIAGVVVSDYFIVRRGYLKLTHLYSNQPGSFYMYNNRFGI
                     NWRAGVAYLCGVAPNLPGFIGTVGAPQVTVSDGALELYYLNYWVGFFIAALIYVGLCY
                     ISPVAGTPVKNILRDKGWFQRAADVEDFEQEWKKELRRKDLYDDVVDVYEYGNHKTCW
                     "
     gene            complement(<738550..>743052)
                     /gene="TDEL0D04040"
                     /locus_tag="TDEL_0D04040"
                     /db_xref="GeneID:11502422"
     mRNA            complement(<738550..>743052)
                     /gene="TDEL0D04040"
                     /locus_tag="TDEL_0D04040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681151.1"
                     /db_xref="GeneID:11502422"
     CDS             complement(738550..743052)
                     /gene="TDEL0D04040"
                     /locus_tag="TDEL_0D04040"
                     /inference="similar to DNA sequence:INSDC:YDR011W"
                     /note="similar to Saccharomyces cerevisiae SNQ2 (YDR011W);
                     ancestral locus Anc_3.220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681199.1"
                     /db_xref="GeneID:11502422"
                     /db_xref="GOA:G8ZTP4"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR005285"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029481"
                     /db_xref="UniProtKB/TrEMBL:G8ZTP4"
                     /translation="MSSAVRDERESLAGSDVSFRDALGQEELFKGSRPDLELRHTTTF
                     DAQTIEQIHTLARTLSKRTNKSSGDDDDNDDEGGFARASELHGFDAQKILAGMVSEAN
                     DQGIHSRETGVIMEEVGAEGVDESALEGATFGNILCLPVTIYKGIKAKKNSKMRKILR
                     GVNLLARPGEMVLVLGRPGAGCSSMLKTAAGVTDQFAGGVSGDISYNGISQDEIMKDF
                     RSDVIYNGELDVHFPYLTVKQTLDFAIACKTPAKRVNNMSEQEYIDFTRDFYATIFGL
                     THTYDTKVGNDFVRGVSGGERKRVSIAEAVVARGSVYCWDNATRGLDASTALEYAKAI
                     RIMTNLMHSTALVTIYQASENIYETFDKVTVLYSGRQIYYGHTSKAKNFFWKMGYSCP
                     PRQATAEFLTALTDPNGFHEIREGFEHKVPRTAEEFENYWRNSPEYSDLLTDIEKYKK
                     EMDTEGTRESYRNSMIQEKSKHARKSSYYTVSYWRQLRLCSQRGFQRIYGNKSYTIIN
                     VIAAIVQSFIVGSLCYNAPSSTSGAFTRGGVLYFALLYYSLMGLANISFEHRPILQKH
                     KYYSLYHPSAEALGSTISGFPFRMIGLTCFIIILFFLSGLHRTASTFFIVYLFLSMCS
                     EAINGLFEMVAAATDTLAQANAIAGVLMMSISMYSTYMIQLPSIHPWFIWVAYILPIR
                     YSFESMLNAEFHGRRMDCGSGLVPSGPGYENVASSEQVCAFTGSKPGQSWVLGDDYLK
                     VQFQYEYKHTWRNFGIMWCFLIGYIVLKSLITEFKRPIKGGGDALIFKKGAKSAIKRV
                     KADDEETADNMNLADVKEKLSSGESSNSNFPEGDDFEDLKSRGVFMWQKVCYTIPYKG
                     GPRRLLDNVSGYCVPGTMTALMGESGAGKTTLLNTLAQRNVGVITGDMLVNGRPIDAS
                     FERRTGYVQQQDLHIAEMTVRESLIFSARMRRKQSVPDAEKIEFAEKIIDILDMGEYA
                     EALVGEPGAGLSVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSAWAIVQLLRKLA
                     KAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGDVGKNSSILLEYFERNGARKC
                     EKSENPAEYILEAIGAGATASVEEDWHQIWTKSPEHKTNEEKIQKMISDLSSKPDDVS
                     EGKSATKYATSYFYQFKYVYLRTFTTFWRDVNYLMSKLMLMVVGGLYVGFTFYDVGES
                     YTGLQNALFAAFISIVLSAPAMNQIQARALASRELFEVRESKSNMFHWSLLLITQYLC
                     EIPYHFVFSTLYFVSFYFPLRIFFQASRSAVFFLNYCIMFQLYYVALGLSVLYMSPNL
                     PSASVLMGLILAFLLSFCGVVQPPSLMPGFWTFMWKASPYTYFVQNLLGIVLHEKPVV
                     CKKKELAFFDPPSGQTCGDYMEEFLSKAQGYIQNPEATENCAYCLSSVGDEYLRRIGA
                     SYSYLWRNFGIYWIFIVFNFFAMVAVYYIFHVRKVSLINVQAITNFTQILKGKMPFGK
                     KKASSV"
     gene            <743465..>743932
                     /gene="TDEL0D04050"
                     /locus_tag="TDEL_0D04050"
                     /db_xref="GeneID:11502423"
     mRNA            <743465..>743932
                     /gene="TDEL0D04050"
                     /locus_tag="TDEL_0D04050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681152.1"
                     /db_xref="GeneID:11502423"
     CDS             743465..743932
                     /gene="TDEL0D04050"
                     /locus_tag="TDEL_0D04050"
                     /inference="similar to DNA sequence:INSDC:YOL159C"
                     /note="similar to Saccharomyces cerevisiae YOL159C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681200.1"
                     /db_xref="GeneID:11502423"
                     /db_xref="UniProtKB/TrEMBL:G8ZTP5"
                     /translation="MLKIIRTLVIGFFLLTGVFSSNTTVIVSTADIFELIPYGWTSQQ
                     LCWLYLKSVHTRTTTDRSGRIMTSSSFGNEVVLIFKERLVPGQGAEPHTIDLDINTYS
                     GTKKYSESEDYCTIFVQQLASVLYMRSGDWRRSVRDVTFKNTKCEARKQWCPA"
     gene            744166..744247
                     /gene="TDEL0Dtrna4S"
                     /locus_tag="TDEL_0Dtrna4S"
                     /db_xref="GeneID:11502424"
     tRNA            744166..744247
                     /gene="TDEL0Dtrna4S"
                     /locus_tag="TDEL_0Dtrna4S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCU"
                     /db_xref="GeneID:11502424"
     gene            <744364..>745677
                     /gene="TDEL0D04060"
                     /locus_tag="TDEL_0D04060"
                     /db_xref="GeneID:11503652"
     mRNA            <744364..>745677
                     /gene="TDEL0D04060"
                     /locus_tag="TDEL_0D04060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681153.1"
                     /db_xref="GeneID:11503652"
     CDS             744364..745677
                     /gene="TDEL0D04060"
                     /locus_tag="TDEL_0D04060"
                     /inference="similar to DNA sequence:INSDC:YDL007W"
                     /note="similar to Saccharomyces cerevisiae RPT2 (YDL007W);
                     ancestral locus Anc_3.216"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681201.1"
                     /db_xref="GeneID:11503652"
                     /db_xref="GOA:G8ZTP6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZTP6"
                     /translation="MGQGVSSGQDKKKKKGSKEKPKYEPPVQSRFGRKKRRGGPATAE
                     KLPNISPSTRCKLKLLRMERIKDHLLLEEEFVTNSEILKPFEKKQEEEKKQLEEIRGN
                     PLSIGTLEEIIDDDHAIVTSPTMPDYYVSILSFADKELLEPGCSVLLHHKTMSIVGVL
                     QDDTDPMISVMKIDKSPTESYSDIGGLENQIQEIKEAVELPLTHPELYEEMGIKPPKG
                     VILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAP
                     SIVFIDEIDAIGTKRYESNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESL
                     DPALIRPGRIDRKILFENPDLGTKRKILGIHTSKMSLSSDVHLEELVTSKDDLSGADI
                     QAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNKVEENLEGLYM"
     gene            <746138..>746971
                     /gene="TDEL0D04070"
                     /locus_tag="TDEL_0D04070"
                     /db_xref="GeneID:11502425"
     mRNA            <746138..>746971
                     /gene="TDEL0D04070"
                     /locus_tag="TDEL_0D04070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681154.1"
                     /db_xref="GeneID:11502425"
     CDS             746138..746971
                     /gene="TDEL0D04070"
                     /locus_tag="TDEL_0D04070"
                     /inference="similar to DNA sequence:INSDC:YDL006W"
                     /note="similar to Saccharomyces cerevisiae PTC1 (YDL006W);
                     ancestral locus Anc_3.215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681202.1"
                     /db_xref="GeneID:11502425"
                     /db_xref="GOA:G8ZTP7"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:G8ZTP7"
                     /translation="MSTKVNGTNQYKLTYQVGVAENKNSKFRKAMEDVHTYVKNFASR
                     LDWGYFAVFDGHAGSQASKWCGSHLHTIVEQMLLEDENSDVRDILNRSFVLSDEQINS
                     KLPGNSGCTAAVGILRWELPSDSANQVSDLSQHRRKLYTANVGDSRIVLFRKGHSIRL
                     TYDHKASDILEMQRVEHAGGLIMKSRVNGMLAVTRSLGDKFFDGLVVGNPFTTSVEIT
                     PEDEFLILACDGLWDVIDDQEACEIIRDIKDPNEAAKTLVRYALENGTTDNVTAMVVH
                     L"
     gene            complement(<747068..>748003)
                     /gene="TDEL0D04080"
                     /locus_tag="TDEL_0D04080"
                     /db_xref="GeneID:11502426"
     mRNA            complement(<747068..>748003)
                     /gene="TDEL0D04080"
                     /locus_tag="TDEL_0D04080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681155.1"
                     /db_xref="GeneID:11502426"
     CDS             complement(747068..748003)
                     /gene="TDEL0D04080"
                     /locus_tag="TDEL_0D04080"
                     /inference="similar to DNA sequence:INSDC:YDL005C"
                     /note="similar to Saccharomyces cerevisiae MED2 (YDL005C);
                     ancestral locus Anc_3.214"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681203.1"
                     /db_xref="GeneID:11502426"
                     /db_xref="InterPro:IPR021017"
                     /db_xref="UniProtKB/TrEMBL:G8ZTP8"
                     /translation="MAGTQNQSASATPVSPAPVGAHRNRLTECFDDIMKVAAEMMVQQ
                     QLKTVQLDSAVVNGFSQAQQRVLSEKIHMFHAILDDLQTTLTKSKSYVGTIHEIALEK
                     QKVKEKERADLRKRQEEEEQRKNKEQEEKARREEMEKKADGQRQQQSRPDTGLGFPLE
                     TGGGILPDFSAASRDFGGSPSLPISVNQSAAATTPRPIPDSQPSPQSELQQSRASDLG
                     GMSNMDISMFPGLESSGFDMGNFNNGTNGTSRPVESTETTERNGEPNTNEEPGALSMG
                     DNGEDYLTLNDFNDMNIGWSAGGDSGDLDLNGFNI"
     gene            <748563..>749042
                     /gene="TDEL0D04090"
                     /locus_tag="TDEL_0D04090"
                     /db_xref="GeneID:11502427"
     mRNA            <748563..>749042
                     /gene="TDEL0D04090"
                     /locus_tag="TDEL_0D04090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681156.1"
                     /db_xref="GeneID:11502427"
     CDS             748563..749042
                     /gene="TDEL0D04090"
                     /locus_tag="TDEL_0D04090"
                     /inference="similar to DNA sequence:INSDC:YDL004W"
                     /note="similar to Saccharomyces cerevisiae ATP16
                     (YDL004W); ancestral locus Anc_3.213"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681204.1"
                     /db_xref="GeneID:11502427"
                     /db_xref="GOA:G8ZTP9"
                     /db_xref="InterPro:IPR001469"
                     /db_xref="InterPro:IPR020546"
                     /db_xref="UniProtKB/TrEMBL:G8ZTP9"
                     /translation="MFRLNAARTVSRSLNLAGKRFYAEAAPSGFLQLQFALPHETVFA
                     GSKVTQVNLPAQSGRIGILANHVPTVEQLTPGVIEVFEGTQSKKFFVSGGFAAMQPDS
                     TLCITSVEAFPLDSFSQENVRSLLSDAKSKASSSDERVAAEAAIQIEVLESLQSALK"
     gene            <749322..>751055
                     /gene="TDEL0D04100"
                     /locus_tag="TDEL_0D04100"
                     /db_xref="GeneID:11502428"
     mRNA            <749322..>751055
                     /gene="TDEL0D04100"
                     /locus_tag="TDEL_0D04100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681157.1"
                     /db_xref="GeneID:11502428"
     CDS             749322..751055
                     /gene="TDEL0D04100"
                     /locus_tag="TDEL_0D04100"
                     /inference="similar to DNA sequence:INSDC:YDL003W"
                     /note="similar to Saccharomyces cerevisiae MCD1 (YDL003W);
                     ancestral locus Anc_3.212"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681205.1"
                     /db_xref="GeneID:11502428"
                     /db_xref="GOA:G8ZTQ0"
                     /db_xref="InterPro:IPR006909"
                     /db_xref="InterPro:IPR006910"
                     /db_xref="InterPro:IPR023093"
                     /db_xref="UniProtKB/TrEMBL:G8ZTQ0"
                     /translation="MVQPHPYSSVRISTKSGPLAQIWLAANMSNLPKISVLQTSISES
                     ADEIAKASGCDDSSLERITLHTSGDLLQGIVRVYSKQATFLLADIKDTLMKITTLFKA
                     NQRINVTVGKANTITSIEQLVLQDSVTEREVLTLPSLDFLQDTESSPGLMNAGDNSMR
                     RKVQGAAPWDTSLEVGRRFNPDDSLEANRSSVLDLDFDFENEHASSPSKTWEEGTRQT
                     TLDEGSGIRGEQEPLIEDDDFPFDDPTNGNWDLGITENDDPENRSESRSNMSVELGRR
                     ADDASMIDEVVDLGIDLGIEKEPIEEFSVTEEDVTAPPAKRPKKNSELANTRKIDIDE
                     ETELDDVQNMEVTLTAPKQDQTSKDDLSLNRKRVLDELNLSLSYLPSSVLENILSYQQ
                     IKKQKPNFDEEEVDYSEPQMDITLGLDDELVSRDRSIESESEESDHFMPIDADIGLPM
                     PTQEDVEPHIEAESASSQPEEIATQQTQKVRLATGETASKATVYMAELLRTKFVDNEN
                     STFEDILKIKHTAEVSQSDKEITRGEASKAFFDLLSLANEDCIDLDQQIAFESINIQT
                     KPSLFEKFITA"
     gene            <751375..>758844
                     /gene="TDEL0D04110"
                     /locus_tag="TDEL_0D04110"
                     /db_xref="GeneID:11502429"
     mRNA            <751375..>758844
                     /gene="TDEL0D04110"
                     /locus_tag="TDEL_0D04110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681158.1"
                     /db_xref="GeneID:11502429"
     CDS             751375..758844
                     /gene="TDEL0D04110"
                     /locus_tag="TDEL_0D04110"
                     /inference="similar to DNA sequence:INSDC:YBL004W"
                     /note="similar to Saccharomyces cerevisiae UTP20
                     (YBL004W); ancestral locus Anc_3.211"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681206.1"
                     /db_xref="GeneID:11502429"
                     /db_xref="InterPro:IPR011430"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZTQ1"
                     /translation="MAKQKVTTKSSKRYTYSSFKGRIDDLRIEPAKNLQKRVHDYVET
                     SHLLASFEHWKEINLSAGFAHFADNAEELIQTLPQIIYHESKIFELLITSIDKHEEFA
                     LEALLDLLAQFCHDLGPDFLKFYERALKSLICLLEDAVRLESSKIFEWGFNCLAYMFK
                     YLSRVLSDDLIPTFNLLFPLLSHSKDYISRFSAEALSFLIRKAKAKSLRDFISFSFKK
                     LRDTTEPSLYDGILILFSETFISTEDALHSKSRMLIDALLDEVLKSNSEDLGVTLFCD
                     VWMNISRHASTENLSPLYDAIYERLIDDMSAQNLDGITRITSTLAFSESGRKIANWSR
                     IVTIAEQILSHGDERNPSSQNLAFLIAVLFRNCDLRALSTHHKVLFESYLQQHTGSFI
                     PFFFSVLTLCGEKALSFNANRYLQQYVTANGKEPDTKLALFLLEMEDRPQIAGKLNLR
                     VPDLLMSSLASMLENEPKTFTEDVLFDIYKRVVIFTSVDHDDTQCSETFSTLVKRILT
                     GSTELTEFVKDVIGHLLLAINGARLSSTILVKVLLERLDELKTSVYFVEGFNKFLGML
                     VSSDELCEFFESHESSVIDLSDNLLLPDRKIRRETLQLLGTIMKIRGEDLPQILNDCK
                     NLEDLPLTLQNARDITNRIRGMGVEFAKMEATTLEMSFFIKHMFGLLTVRFSPVWDGV
                     YEVIPSIFTKDQEMVWKLLIHFLVSPEKNYDLEYYGVSSTDEPGFGSWSSTIPRLKDT
                     LDAFSTHWNDYLVPDSSIIDIMKKRRGDTNISPQIRSQILKLMLMIPQLAERHSRDIV
                     PFIFNDAESEELFGSSETEQTPSSGATWTEADRNSLLKVIAKFRNIKAIYKSPEVRDR
                     LMTLLGSRNTDVQKIALEGLLAYRDPVMIKHRDSLKNLLDDALFKDEVTRLLTGSEVI
                     EKAEEIELMPYALRILFGRAQTPSTSGIKKGRKHAVISVLPGLKEEFLTEFFKLGSSK
                     FHYDYFFENGYQVDPSELTLPNLRRMIGYVTILNLSFDVLGSNFSRVISTTLRPLLYT
                     IAVSYCASSQDFKEVHVEKTVSNLRQQSLKSLNNLFQCSGDSPVLLEYMEEIHQIAIE
                     PRLAKFEEENLQQVSSLMKIIVFWSTNTALYPYLYYNDCASCAALMRVLLNENAKEPV
                     LATILKASNDIVSSPAANDEYVGLVTLVAATCLRVLPSLYQKLSDPNNSSIVIDLLLN
                     LVQAGYVQDNETREHLVGSLGLVIKGNFKGVSKKDIIKVLSVISVLVKEYQCGWSDIE
                     DLYVAVSGLYKSFADREIREAISDVFISFGKQFTSIAKVAELLSDLNSYSKGRVQEYD
                     FSRRLSSFKIFNEENYRSYTEFEWLPIINSCLFFINDKDELAIRTNASHTLRRFVDYI
                     NEKPSVESAKSAVEILEQVILPNIRIGLQRFSEELQKEYISVLAYVIQESKFYKGLED
                     MKPLLFDGDEEANFFANVNHIQLHRRLRAVRRLRDHVVGLSDNSIAHYLMPLIEQYVF
                     SQEEKYRNIGNEALITIGKLSNYLTWNQYKALFRRYISLLKSKPDQMKETVNLLCQIS
                     VALRETLRNVRESTGEIATLQKLPKNLDDVDKFIIAEVYPKLSKTLEFRDSETIVNRM
                     PLAEALVNLVLGLKREDTVSHLPGILTSLCQVLRSKSEELRDAVRKTLGSICRILGAD
                     YLPFVLKELISALKRGSHIHVLGFTVHHVLKAMDGLINHSDLDASSQMIVRIIMDDLF
                     GSAGEEKDSENYRTTMKEVKVNKCYDTAEMLASNISLPTFSTLLRPIENLLTERINLR
                     NQNKLEELLRRYTLGLKHNAEVSSPEVLNVCFEIFHRDQNEGIKKRSNQPLVIDENKE
                     FFLVNLNFKGAKVQNERTLVNSTLQKFALDLLHAVLFKSRQLLDPMYLDGFVPLLKDS
                     LLSEDESVLVSSLRVLILFVKLNFSEESATVFKIGARKVLNIIKDSPSTSSELCQVGM
                     KYLSSFIRHKDIKLKDSALSYVLGRILPDLNEPHKQGLAFNFLKALVSRHIRLPEIYD
                     VIDSVREIMVTNHTKEIRDVSRSVYYQFLMEYDQSKGRLEKQFRFMVDNLQYPSQDGR
                     QSVMELINLIVNKANAALLSKLSSSFFVALANVLVNDDISRCREMASVLLVNLLQKLD
                     PESLEVVNKYIIAWLKQTEDLSYLSLGLRVYKVYLSAIGAGRTSSLDELALNRVKSCI
                     ADSSSSDETKWTVLYTALTVFESYVQTSKDIYSSSFKITWTNVISCLLYPHLWVRQVA
                     ARLINHFIDNMDKFELPLTDSELQIVASRVLRQLGAPSISEDLASVSIKTLLKIAIYW
                     KKHNTKFIHKETLSASESKYDSSLEFMVSRVGAIIRSEENPADSFMSKKSCIQLLALL
                     IQVFDDELKARAKDIILPLFVYLEYDVSYTLNDMQKELSVLAQECLQILEAKLSVSDF
                     TKAYASVKREVLTRRQERKAKRSVLAVTEPEKAARRKLRKHERSREKRKHEKDESGYY
                     QRKNKRPRT"
     gene            complement(<758967..>759677)
                     /gene="TDEL0D04120"
                     /locus_tag="TDEL_0D04120"
                     /db_xref="GeneID:11502430"
     mRNA            complement(<758967..>759677)
                     /gene="TDEL0D04120"
                     /locus_tag="TDEL_0D04120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681159.1"
                     /db_xref="GeneID:11502430"
     CDS             complement(758967..759677)
                     /gene="TDEL0D04120"
                     /locus_tag="TDEL_0D04120"
                     /inference="similar to DNA sequence:INSDC:YDL002C"
                     /note="similar to Saccharomyces cerevisiae NHP10
                     (YDL002C); ancestral locus Anc_3.210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681207.1"
                     /db_xref="GeneID:11502430"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:G8ZTQ2"
                     /translation="MSDSELKRKVEDLKEGNEVLALAIQRTRLSVKRLKLEYSVLLER
                     LESRVELDPELRYENPLPTLESFKDELMTKPLKKPKSKRRKAKDRDPNMPKRPTNAYL
                     LFCEMNKEKMRENGSQDVSRDLTEAWKSLNENDRKPYYGLYNQDRLRYQREMELYAMK
                     VDRNNDDEEEVDESLVARERKPHNEDEEEEDEEDEEEEDEEETEPKPESQMTQHGDDE
                     EEEDDDEDDIADVPTSEV"
     gene            <760040..>761356
                     /gene="TDEL0D04130"
                     /locus_tag="TDEL_0D04130"
                     /db_xref="GeneID:11502431"
     mRNA            <760040..>761356
                     /gene="TDEL0D04130"
                     /locus_tag="TDEL_0D04130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681160.1"
                     /db_xref="GeneID:11502431"
     CDS             760040..761356
                     /gene="TDEL0D04130"
                     /locus_tag="TDEL_0D04130"
                     /inference="similar to DNA sequence:INSDC:YDL001W"
                     /note="similar to Saccharomyces cerevisiae RMD1 (YDL001W);
                     ancestral locus Anc_3.209"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681208.1"
                     /db_xref="GeneID:11502431"
                     /db_xref="InterPro:IPR003734"
                     /db_xref="UniProtKB/TrEMBL:G8ZTQ3"
                     /translation="MSTISGNEEQQPLLNQEVPTKSNSDASERYTPKPGSVSSGSQRI
                     SDNTPSEIKNKSNGKPKNMNPPAPGKQMRAGAQRTSRTAQKLKLLPEEPFQRDEEMQE
                     LRDRDVYSQVSRITDKPARRDAEKLGKGHRHLLPRATAYCTASSYHMKELIKWLKDCR
                     KIHHTHPKLFDECLYTPFMYNDWRGDKRFEHEDVIRLDDEGGEINVSDKQPELYIFEY
                     GVIVLWGFTEREEKAFLNDLERFEKEKLAEEDVQVEEFNYYVTQSYQPRIYNDFITLR
                     DGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIACSGKVSMSKEDIMKS
                     IGELFILRININLHGSVLDSPEIMWSEPQLEPIYHATRGYLEINQRVALLNQRLEVIS
                     DLLQMLKEQLGHSHEEYLEFIVILLVGMEVLIAVVNIAVDMWANSS"
     gene            complement(<761526..>761924)
                     /gene="TDEL0D04140"
                     /locus_tag="TDEL_0D04140"
                     /db_xref="GeneID:11502432"
     mRNA            complement(<761526..>761924)
                     /gene="TDEL0D04140"
                     /locus_tag="TDEL_0D04140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681161.1"
                     /db_xref="GeneID:11502432"
     CDS             complement(761526..761924)
                     /gene="TDEL0D04140"
                     /locus_tag="TDEL_0D04140"
                     /inference="similar to DNA sequence:INSDC:YBL003C"
                     /note="similar to Saccharomyces cerevisiae HTA2 (YBL003C);
                     ancestral locus Anc_3.208"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681209.1"
                     /db_xref="GeneID:11502432"
                     /db_xref="GOA:G8ZTQ4"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G8ZTQ4"
                     /translation="MSGGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRKGNYAQR
                     VGSGAPVYMTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNV
                     TIAQGGVLPNIHQNLLPKKSAKPGAASQEL"
     gene            <762423..>762821
                     /gene="TDEL0D04150"
                     /locus_tag="TDEL_0D04150"
                     /db_xref="GeneID:11502433"
     mRNA            <762423..>762821
                     /gene="TDEL0D04150"
                     /locus_tag="TDEL_0D04150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681162.1"
                     /db_xref="GeneID:11502433"
     CDS             762423..762821
                     /gene="TDEL0D04150"
                     /locus_tag="TDEL_0D04150"
                     /inference="similar to DNA sequence:INSDC:YBL002W"
                     /note="similar to Saccharomyces cerevisiae HTB2 (YBL002W);
                     ancestral locus Anc_3.207"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681210.1"
                     /db_xref="GeneID:11502433"
                     /db_xref="GOA:G8ZTQ5"
                     /db_xref="InterPro:IPR000558"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G8ZTQ5"
                     /translation="MSAKAEKKPASKAPAEKKPAAKKTAPGVDSKKRTKVRKETYSSY
                     IYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAV
                     RLILPGELAKHAVSEGTRAVTKYSSAASQA"
     gene            complement(<763089..>763409)
                     /gene="TDEL0D04160"
                     /locus_tag="TDEL_0D04160"
                     /db_xref="GeneID:11502434"
     mRNA            complement(<763089..>763409)
                     /gene="TDEL0D04160"
                     /locus_tag="TDEL_0D04160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681163.1"
                     /db_xref="GeneID:11502434"
     CDS             complement(763089..763409)
                     /gene="TDEL0D04160"
                     /locus_tag="TDEL_0D04160"
                     /inference="similar to DNA sequence:INSDC:YBL001C"
                     /note="similar to Saccharomyces cerevisiae ECM15
                     (YBL001C); ancestral locus Anc_3.206"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681211.1"
                     /db_xref="GeneID:11502434"
                     /db_xref="InterPro:IPR002767"
                     /db_xref="InterPro:IPR029756"
                     /db_xref="UniProtKB/TrEMBL:G8ZTQ6"
                     /translation="MPKLYTLVDVCMVPIGSGSASVSDFVTLVEKKIRESPLKSTLHS
                     AGTTIEGPWDDVFKLLGEIHEFAHENGYVRIQSSMRVGTRTDKHQTAQEKVDTVLRKL
                     EESK"
     gene            complement(<765368..>767791)
                     /gene="TDEL0D04170"
                     /locus_tag="TDEL_0D04170"
                     /db_xref="GeneID:11502435"
     mRNA            complement(<765368..>767791)
                     /gene="TDEL0D04170"
                     /locus_tag="TDEL_0D04170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681164.1"
                     /db_xref="GeneID:11502435"
     CDS             complement(765368..767791)
                     /gene="TDEL0D04170"
                     /locus_tag="TDEL_0D04170"
                     /inference="similar to DNA sequence:INSDC:YBR001C,YDR001C"
                     /note="similar to Saccharomyces cerevisiae NTH2 (YBR001C)
                     and NTH1 (YDR001C); ancestral locus Anc_3.205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681212.1"
                     /db_xref="GeneID:11502435"
                     /db_xref="GOA:G8ZTQ7"
                     /db_xref="InterPro:IPR001661"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR011120"
                     /db_xref="InterPro:IPR018232"
                     /db_xref="UniProtKB/TrEMBL:G8ZTQ7"
                     /translation="MSRSPRGSQGSALDFTSPPRSGHLRTPSQTSPLEPVDGFAVPFK
                     KSYRRSRTPSQGSRASVDGPKSDLDINQRPRRMSSLKDFSDPFSDAEIYYGPSTDPRK
                     QKVNHTLNRTRTMSVFGNASDYKKGSQANYHLQRRGSEDDSYLSSKGNRRFFIEDVDK
                     TLDDLLKSEDTDSNFQITIEDTGPKVIKIGTANSNGYKYVNVRGTYMLSNLLQELTIA
                     KSFRRHQIILDEARINENPVSRLERLIANQFWTNLTRRIDLNNIGEIAKDTKIDTPGA
                     QNPRIYVPYNCADQYEFYIQASQMHPSLNLEVEYLPQDITPEYVKSINDTPGLLALAM
                     EEHFDPSTGEKTLIGYPYAVPGGRFNELYGWDSYMMALGLLENNKADVARGMVEHFIF
                     EIEHYGKILNANRSYYLCRSQPPFLTDMALQVYNKTGGKSNPSAVDLVKRAFIAAIKE
                     YKTVWMAHPRLDPETGLSCYHPNGLGVPPETEADHFDSILLSYMEKYSLTREEFVKKY
                     NDGEIKEPALDEFFLHDRGVRESGHDTTYRFEGVCAYLATIDLNSLLYKYELDIADVI
                     EEFFDDDFHDPHDLLVTNSQHWRDLAEKRKQQINKYMWDEKTGFFFDYNVKTKQRTSY
                     ESATTFWALWAGVATQEQARDMVEKALPPLEVLGGIVACTEGSRGPISIQRPSRQWDY
                     PYGWAPHQILAWQGLCEYGYVGVATRLAYRWLYIMTKAFVDYNGIVVEKYDATRGTDP
                     HRVDAEYGNQGADFKGVAKEGFGWVNASYVLGLKYMNNHARRALGACIPPVPFFKSLK
                     PSERQLYSL"
     gene            <768597..>769220
                     /gene="TDEL0D04180"
                     /locus_tag="TDEL_0D04180"
                     /db_xref="GeneID:11502436"
     mRNA            <768597..>769220
                     /gene="TDEL0D04180"
                     /locus_tag="TDEL_0D04180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681165.1"
                     /db_xref="GeneID:11502436"
     CDS             768597..769220
                     /gene="TDEL0D04180"
                     /locus_tag="TDEL_0D04180"
                     /inference="similar to DNA sequence:INSDC:YDR002W"
                     /note="similar to Saccharomyces cerevisiae YRB1 (YDR002W);
                     ancestral locus Anc_3.204"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681213.1"
                     /db_xref="GeneID:11502436"
                     /db_xref="GOA:G8ZTQ8"
                     /db_xref="InterPro:IPR000156"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G8ZTQ8"
                     /translation="MSETTETKHNVEASKEVESAPKPPTSSVFSMFGGKKNEETAKKE
                     GESESKEEKVEKKNEDDESPESPDVHFEPIVHLEKVDVKTMEEDEEVLHKVRAKLFRF
                     DADAKEWKERGTGDVKFLKNKSSGKVRLLMRRDKTLKVCANHIIAPDYVLKPNVGSDR
                     SWVYACTADVSEGEPEAFTFAIRFGSKENADKFKEEFEKAQQLNKKD"
     gene            complement(<769327..>770181)
                     /gene="TDEL0D04190"
                     /locus_tag="TDEL_0D04190"
                     /db_xref="GeneID:11502437"
     mRNA            complement(<769327..>770181)
                     /gene="TDEL0D04190"
                     /locus_tag="TDEL_0D04190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681166.1"
                     /db_xref="GeneID:11502437"
     CDS             complement(769327..770181)
                     /gene="TDEL0D04190"
                     /locus_tag="TDEL_0D04190"
                     /inference="similar to DNA sequence:INSDC:YBR002C"
                     /note="similar to Saccharomyces cerevisiae RER2 (YBR002C);
                     ancestral locus Anc_3.203"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681214.1"
                     /db_xref="GeneID:11502437"
                     /db_xref="GOA:G8ZTQ9"
                     /db_xref="InterPro:IPR001441"
                     /db_xref="InterPro:IPR018520"
                     /db_xref="UniProtKB/TrEMBL:G8ZTQ9"
                     /translation="MMDGGSTIPGYSVALEWVKNLFSRTIKSSNCVPKHIGFVMDGNR
                     RYARKNEIEIKEGHEAGFSSLSQVLELCYEAGVDTATVFAFSIENFRRTPSEVDHLMR
                     LAREKIRQITQHGEIAEKYGVRIRVIGDVSRLHKSVYDDIVATTELTKSNTRATLNIC
                     FPYTSREEMLHSIKDVIAGGKKSGEINEASIERSLYTGDDPPLDLLIRTSGVTRLSDF
                     LLWQVSERGVVIELFDCLWPEFGPMKMAWALLKFAFRKTFSDKENELEDDDGVLENQD
                     DLYIKKTL"
     gene            <770451..>771860
                     /gene="TDEL0D04200"
                     /locus_tag="TDEL_0D04200"
                     /db_xref="GeneID:11502438"
     mRNA            <770451..>771860
                     /gene="TDEL0D04200"
                     /locus_tag="TDEL_0D04200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681167.1"
                     /db_xref="GeneID:11502438"
     CDS             770451..771860
                     /gene="TDEL0D04200"
                     /locus_tag="TDEL_0D04200"
                     /inference="similar to DNA sequence:INSDC:YBR003W"
                     /note="similar to Saccharomyces cerevisiae COQ1 (YBR003W);
                     ancestral locus Anc_3.202"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681215.1"
                     /db_xref="GeneID:11502438"
                     /db_xref="GOA:G8ZTR0"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR017446"
                     /db_xref="UniProtKB/TrEMBL:G8ZTR0"
                     /translation="MLKRLITGRHHAGQFHRHKSSFAAALAAASRLVTPKIMLSNPVS
                     LVSNEMNTLAKNIMALIGSGHPTLNRVTSYYFEAEGKKVRPLLVLLLSRALAEIPLER
                     RDHLKLDSEDVPEDPVYSKPPHMLLLEQPVRSFSPLHVLHGIKPLNPLTKGPEPLPQA
                     TFDHERGILPKQRRLAEIVEMIHTASLLHDDVIDYSDTRRGRPSGNVAFTNKMAVLGG
                     DFLLGRATVSISRLRNPEVVELMSNSIANLVEGEFMQLKNTAVDNDLTTIQHGTKEIP
                     PVSGKLDNKIHDYHVPTDQVQNVSHDQLIETAFEYYLHKTYLKTAALISKSSRAAAIL
                     SGADKSVVDQCYDFGKNLGVCFQLVDDMLDFTVAAKDLGKPAGADLELGIATAPVLYA
                     WKEDPSLGPLIQRNFSQSGDVERTAAAVAKFDGVKRTKELAVQYRDKALQNLRNALPD
                     SDARSALEFLTNSILTRRK"
     gene            complement(<772040..>773326)
                     /gene="TDEL0D04210"
                     /locus_tag="TDEL_0D04210"
                     /db_xref="GeneID:11502439"
     mRNA            complement(<772040..>773326)
                     /gene="TDEL0D04210"
                     /locus_tag="TDEL_0D04210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681168.1"
                     /db_xref="GeneID:11502439"
     CDS             complement(772040..773326)
                     /gene="TDEL0D04210"
                     /locus_tag="TDEL_0D04210"
                     /inference="similar to DNA sequence:INSDC:YBR004C"
                     /note="similar to Saccharomyces cerevisiae GPI18
                     (YBR004C); ancestral locus Anc_3.201"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681216.1"
                     /db_xref="GeneID:11502439"
                     /db_xref="GOA:G8ZTR1"
                     /db_xref="InterPro:IPR007315"
                     /db_xref="UniProtKB/TrEMBL:G8ZTR1"
                     /translation="MIVRTSLVFVVSRLVLYGLIFLAPEGQFDTSTELTLNRLVADGS
                     EDYWNRHLWNKLLSWDAVFFIKGMTSEDGIPEFEHEYAFSPLWIRFVRLCAGNNELYD
                     VLKVGVLLENVLFFLSSIVLYYLTRRLFSQSNRESFYAKRLAGISTDLFIFTSASGFL
                     TGIYSEPLSFALAFSGMLCRELSVEVTIPSGLDCMWSKWPLYILSSMCFSFATLNRPN
                     CVLLGIYYIFDLLQLAKDKKVLKAVAFPLLAGVFLFICCVYQHYILPFDTFCPQRGGW
                     CETQLSASLPFTSVNFYNHIQDHYWNVGFLKYWAINNIPNFLLAMPNIVVLLYSTIYF
                     SKIYPHYRLKPLIIITQALLIMLIFFAHVQIINRVSSFIPLHLWYMADRILKTSYKQD
                     DTRPIGDDKIVKAYIYWLALWIPLQTVLFACFLPPA"
     gene            <773551..>774171
                     /gene="TDEL0D04220"
                     /locus_tag="TDEL_0D04220"
                     /db_xref="GeneID:11502440"
     mRNA            <773551..>774171
                     /gene="TDEL0D04220"
                     /locus_tag="TDEL_0D04220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681169.1"
                     /db_xref="GeneID:11502440"
     CDS             773551..774171
                     /gene="TDEL0D04220"
                     /locus_tag="TDEL_0D04220"
                     /inference="similar to DNA sequence:INSDC:YBR005W,YDR003W"
                     /note="similar to Saccharomyces cerevisiae RCR1 (YBR005W)
                     and RCR2 (YDR003W); ancestral locus Anc_3.200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681217.1"
                     /db_xref="GeneID:11502440"
                     /db_xref="InterPro:IPR020999"
                     /db_xref="UniProtKB/TrEMBL:G8ZTR2"
                     /translation="MSPISPLRKEDGLVARYVFANDYNTGSGWVWGRWILFVIFVVFI
                     LGLGLTTLRVNKRRRHLGQAPIRGTAWMTPPSYRQSQRQYNGNPATTEDYVPQYTATA
                     NDQDLGYYDERGEFHLKSDGQPMPTVVREAGSDSSDSLERPGAAVTRDSLSTDIDEQD
                     FRRYRPTTAPPASTSDSQQGVERRASEDPVELQSITVPEKAKGRNN"
     gene            <774505..>775986
                     /gene="TDEL0D04230"
                     /locus_tag="TDEL_0D04230"
                     /db_xref="GeneID:11502441"
     mRNA            <774505..>775986
                     /gene="TDEL0D04230"
                     /locus_tag="TDEL_0D04230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681170.1"
                     /db_xref="GeneID:11502441"
     CDS             774505..775986
                     /gene="TDEL0D04230"
                     /locus_tag="TDEL_0D04230"
                     /inference="similar to DNA sequence:INSDC:YBR006W"
                     /note="similar to Saccharomyces cerevisiae UGA2 (YBR006W);
                     ancestral locus Anc_3.199"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681218.1"
                     /db_xref="GeneID:11502441"
                     /db_xref="GOA:G8ZTR3"
                     /db_xref="InterPro:IPR010102"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:G8ZTR3"
                     /translation="MCAKPVLKNKELLRDAAYVNGQWVNESKEYFEVTDPATGEVIAK
                     LPEQPVSAVEEAIDVAYESFKTFKNTSSRQRATWLRNIYDLIMENQDDLAKILTWENG
                     KALAEAQGEVKYGASYFQWFAEEAVRSYGVTIQPTVPSNRAFTIRQPVGVCGMICPWN
                     FPNAMITRKVAPALAAGCTVVLKPDSQTPLSALALAYLIEKAGVPKGVFNLVLSHAKT
                     PEFGLKLCESPKVKKITFTGSTNVGKILMKQSASTMKKLSFELGGNAPFIVFNDADLD
                     QAVEQAIACKFRGLGQTCVCANRLYVQSGIIDKFSEKLAAKVNNFVIGHGLDEGTTHG
                     CLISPKAFQKVEDHAQDAIKKGAKTVVQGGPLPEKGEAFYSPVVLSHVPQSAKVAKEE
                     TFGPLCPIFSFETLKEVVGYANDTNVGLAAYVFSKNIDTIYTISEALEAGMVSCNTGL
                     FTDASIPFGGVKESGFGREGSLYGIEDYTFIKTVTIGNLPDKI"
     gene            <776175..>777560
                     /gene="TDEL0D04240"
                     /locus_tag="TDEL_0D04240"
                     /db_xref="GeneID:11502442"
     mRNA            <776175..>777560
                     /gene="TDEL0D04240"
                     /locus_tag="TDEL_0D04240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681171.1"
                     /db_xref="GeneID:11502442"
     CDS             776175..777560
                     /gene="TDEL0D04240"
                     /locus_tag="TDEL_0D04240"
                     /inference="similar to DNA sequence:INSDC:YDR004W"
                     /note="similar to Saccharomyces cerevisiae RAD57
                     (YDR004W); ancestral locus Anc_3.198"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681219.1"
                     /db_xref="GeneID:11502442"
                     /db_xref="GOA:G8ZTR4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013632"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZTR4"
                     /translation="MDLYDELPWSELLYDEEFTALLDATKQHQVSVVELLTVNAKELA
                     RILQRSINEVSKFQEVLSLEFNKQLTQSKPSLTAEIEDPKSFSTTDVSIDDALGGGIH
                     THGITEIFGESSTGKSQLLMQLSLAVQLPPKLGGLGGKCVYITTEGDLPTQRLQEMIA
                     SRPEFKENGVSQDNIFTVSCNDLVNQEHILNVQLPILLENHEGAIKLVIIDSISHHLR
                     VELESKSFKDFQGNKFYIDQMAEGLLNLARKHLLAIVVANQVGDKPLSDRVDTCRQDV
                     DNYEYQLGWMVGWKDSTILYRQKYNEPRATISNNNEKISRDLESILSDDDDARLIEQE
                     LIKVTKMSNKPPAPIDQGNKRKLQEPGNNGGSLAHNRYDKIKKRKMDNQVPNLGLAWA
                     NHVATRILTGKTYKASSLIKRGELHLYKGTDPSAFWQVRRTMKVVFSTYAEPSQISFV
                     ISRRGIETVSA"
     gene            complement(<777798..>778984)
                     /gene="TDEL0D04250"
                     /locus_tag="TDEL_0D04250"
                     /db_xref="GeneID:11502443"
     mRNA            complement(join(<777798..778895,778979..>778984))
                     /gene="TDEL0D04250"
                     /locus_tag="TDEL_0D04250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681172.1"
                     /db_xref="GeneID:11502443"
     CDS             complement(join(777798..778895,778979..778984))
                     /gene="TDEL0D04250"
                     /locus_tag="TDEL_0D04250"
                     /inference="similar to DNA sequence:INSDC:YDR005C"
                     /note="similar to Saccharomyces cerevisiae MAF1 (YDR005C);
                     ancestral locus Anc_3.197"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681220.1"
                     /db_xref="GeneID:11502443"
                     /db_xref="GOA:G8ZTR5"
                     /db_xref="InterPro:IPR015257"
                     /db_xref="UniProtKB/TrEMBL:G8ZTR5"
                     /translation="MKFIDELDVERLNQTLNFETSDCKITGGCDIFTTKPVASDKKLY
                     KTIDHHLESLLQENESYNAALQQALIDSSGSLSPSLPDSNSRDYNSFWEQKRRMSVNE
                     KSNGNGYASNGNGQHLRSNKLNDQNLKELVSNSDSGYLSSSSTESASRIRGKIRRTSS
                     NNSLQGNRSSFTRRRSSAYDSSITIGPFGPINETASRRTFAYLIAILNASYPDHDFSS
                     LEPTDFIKVSLKTMISKFENSLYSLGKQPEEWMWEVINSHMDISDCVIYQYSPSRSFM
                     DDEPGHLWSLKWFLFNKKRKRVAYLYLTSSRLKSTSNSEINEDDEKEAARARYKRKFT
                     IGEDMNQYEGEYDLTYDENAIEDDEEDAIGNDK"
     gene            complement(<779323..>781386)
                     /gene="TDEL0D04260"
                     /locus_tag="TDEL_0D04260"
                     /db_xref="GeneID:11502444"
     mRNA            complement(<779323..>781386)
                     /gene="TDEL0D04260"
                     /locus_tag="TDEL_0D04260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681173.1"
                     /db_xref="GeneID:11502444"
     CDS             complement(779323..781386)
                     /gene="TDEL0D04260"
                     /locus_tag="TDEL_0D04260"
                     /inference="similar to DNA sequence:INSDC:YBR007C"
                     /note="similar to Saccharomyces cerevisiae DSF2 (YBR007C);
                     ancestral locus Anc_3.196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681221.1"
                     /db_xref="GeneID:11502444"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G8ZTR6"
                     /translation="MMNTDWGRPSPLDELRNQSDYFPDPTTYDDSESINTFQEESRNQ
                     QYMGTNRSMISFETVQTNERLLDKLELNAEDEALLQQALKEEEEKSRNLEIKQYSGPI
                     ICMPASKFPSLRTKGLSASRDMDHKVKELSLQSLNLRGNHSSSTVEQHYAAKSRYSYL
                     AEEDTDSDFNGPTDDEISHTSHSANEQQVLHEQTPLNVVNFENFRFENTKLINQYPLL
                     FVKDTRSKRSNGLQPIITSSEPRELTGDKTPQRSGRLYQNGSGNSTKTSFVDVGQLSK
                     PKTQSSADSDLSLNLSSKGLEGSQEAYVTTPSPVMDKSFLMDISKQPTPPYKAHRKKS
                     SFSFKNLFKSPKSTKSKTSVESRNSFEQSVRSSVESSPKKRPQYLRNFIFPANPVLQF
                     EPSTPRKSSHLVTRKAHHFRSLSDFHKTTPSTVDLTPTQKYNGQNASSKPRRKLSLDS
                     RRPAFPVSSFQTPPHSRHQSGNSLKFSNGRTVERPLYFTAGPNTPSNSSNQINLAIQM
                     RNRGKLEESARRLRNACQSDDGTAHLLYGLALRHGCGVPKDYKESLHYIKVATGVKSE
                     PEEVFNITVDPFGIEENGSLPQVVPEPMAPALYECGMAYLKGYGVENPDEQKGLKYLE
                     KAAALGHIDSMCLSATIWSKKSAVRKKDVARAAAWFRLAEKRGANLIGSDWIHKDKYM
                     KKAHR"
     gene            complement(<781778..>784486)
                     /gene="TDEL0D04270"
                     /locus_tag="TDEL_0D04270"
                     /db_xref="GeneID:11502445"
     mRNA            complement(<781778..>784486)
                     /gene="TDEL0D04270"
                     /locus_tag="TDEL_0D04270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681174.1"
                     /db_xref="GeneID:11502445"
     CDS             complement(781778..784486)
                     /gene="TDEL0D04270"
                     /locus_tag="TDEL_0D04270"
                     /inference="similar to DNA sequence:INSDC:YDR006C"
                     /note="similar to Saccharomyces cerevisiae SOK1 (YDR006C);
                     ancestral locus Anc_3.195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681222.1"
                     /db_xref="GeneID:11502445"
                     /db_xref="InterPro:IPR008862"
                     /db_xref="UniProtKB/TrEMBL:G8ZTR7"
                     /translation="MEQPRTHTSTTSASAAATATSTSPPPSAKTTTNSTPSSASTTQS
                     TANTKQSQSVSSSAGMTKVHTDSEDLDVDMDRSRSNSKKHSGPLLRPDDEDTVMDELD
                     ENCAILPDGRLSRKEYIEAGSSTSISGGTITPHNNPYMNPDTEGNLFKQFDSKTGQFL
                     RAQPLVKSKIGNSYRQPSNLNPITASTASSFKYLNKGKFRSHSVPTISHSSLRRLTNC
                     NNHAHYHYHQHQNNSMFNNAGVKKKKLLRSNFNNHNNTTHCIISGEPITTYKNSASIK
                     EDKDEKNLGSSSASSAAQRSTDQIRNQSSLRKAILLCQNQSTTPKYQDLTLQERITFI
                     TSQTAPIPAPPINLQCLKEIDLQEIVKNPQLRHDIIFDPLLQFRPNLDGERGIKKRQL
                     ADKYWNDVENEIYVYSQRPDVFHYDNTRLVPLFDTLREVLLTIVPQREAHVINNILDT
                     ELNVQELLKGSLIMSNLSEWLAQLFKHHCAPMRDAWVDKMSGKFKDAEKESSLSKLID
                     GLRLVFQILEAMKLDIANHQIRVLRTALLSNSVEFEKQYFQSLMTSNRINLKSSLVWF
                     DKKFDESDTVGLLPKGKVSPQDVYKVCVRGVTSLLSCRKMVREYPTSLSFDHARLILL
                     RADIRQIVCLLICRLLFKQLVANDTSIGKPTKDYITTSYTTKRLKTEIVSIITDDHGN
                     CRWTKNTMSIAIHLCKVINDLKAEYSRTLSDEAQGIAGLPSTPTLDTTKIDFAKSWLS
                     RQTQPLSEVYGVLENRVFKSLEESIFKRSGCTMDGRVKHDFIHLCSNINASNTSSSAM
                     PSATSTSHAESMMTPMHQGVQNPISLQPQSLKGSAAGISSFTDSREPVTTVSSSDSNS
                     NMFHGIEMEEFDNVYRHLYTVINFHWSVFGCHYLEFVAGKMENRTA"
     gene            complement(<785423..>785734)
                     /gene="TDEL0D04280"
                     /locus_tag="TDEL_0D04280"
                     /db_xref="GeneID:11502446"
     mRNA            complement(<785423..>785734)
                     /gene="TDEL0D04280"
                     /locus_tag="TDEL_0D04280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681175.1"
                     /db_xref="GeneID:11502446"
     CDS             complement(785423..785734)
                     /gene="TDEL0D04280"
                     /locus_tag="TDEL_0D04280"
                     /inference="similar to DNA sequence:INSDC:YBR009C"
                     /note="similar to Saccharomyces cerevisiae HHF1 (YBR009C);
                     ancestral locus Anc_3.194"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681223.1"
                     /db_xref="GeneID:11502446"
                     /db_xref="GOA:G8ZYX1"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR019809"
                     /db_xref="UniProtKB/TrEMBL:G8ZYX1"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEEVRAVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            <786230..>786640
                     /gene="TDEL0D04290"
                     /locus_tag="TDEL_0D04290"
                     /db_xref="GeneID:11502447"
     mRNA            <786230..>786640
                     /gene="TDEL0D04290"
                     /locus_tag="TDEL_0D04290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681176.1"
                     /db_xref="GeneID:11502447"
     CDS             786230..786640
                     /gene="TDEL0D04290"
                     /locus_tag="TDEL_0D04290"
                     /inference="similar to DNA sequence:INSDC:YBR010W"
                     /note="similar to Saccharomyces cerevisiae HHT1 (YBR010W);
                     ancestral locus Anc_3.193"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681224.1"
                     /db_xref="GeneID:11502447"
                     /db_xref="GOA:G8ZTR9"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G8ZTR9"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
     gene            <786841..>787488
                     /gene="TDEL0D04300"
                     /locus_tag="TDEL_0D04300"
                     /db_xref="GeneID:11502448"
     mRNA            <786841..>787488
                     /gene="TDEL0D04300"
                     /locus_tag="TDEL_0D04300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681177.1"
                     /db_xref="GeneID:11502448"
     CDS             786841..787488
                     /gene="TDEL0D04300"
                     /locus_tag="TDEL_0D04300"
                     /inference="similar to DNA sequence:INSDC:YDR007W"
                     /note="similar to Saccharomyces cerevisiae TRP1 (YDR007W);
                     ancestral locus Anc_3.192"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681225.1"
                     /db_xref="GeneID:11502448"
                     /db_xref="GOA:G8ZTS0"
                     /db_xref="InterPro:IPR001240"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G8ZTS0"
                     /translation="MSIKTPIVKVCGLQSVEAASRAIENGATLIGIICVPNRKRTVDP
                     QVAKEISRLVHDDSFNKVGTKLVGVFRNQALQEVKRIADDYNVDIIQLHGSEQWREFK
                     EVLQKPIIKRMIFPADCEEVVELSRRRDLEVWPLFDSEAGGTGELLDWQDISNWSEAE
                     GKGSKFILAGGLTTNNVSEALALSGVIGVDVSGGVETQGVKDLTKIDDFIAQAKS"
     gene            complement(<787554..>788417)
                     /gene="TDEL0D04310"
                     /locus_tag="TDEL_0D04310"
                     /db_xref="GeneID:11502449"
     mRNA            complement(<787554..>788417)
                     /gene="TDEL0D04310"
                     /locus_tag="TDEL_0D04310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681178.1"
                     /db_xref="GeneID:11502449"
     CDS             complement(787554..788417)
                     /gene="TDEL0D04310"
                     /locus_tag="TDEL_0D04310"
                     /inference="similar to DNA sequence:INSDC:YBR011C"
                     /note="similar to Saccharomyces cerevisiae IPP1 (YBR011C);
                     ancestral locus Anc_3.191"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681226.1"
                     /db_xref="GeneID:11502449"
                     /db_xref="GOA:G8ZTS1"
                     /db_xref="InterPro:IPR008162"
                     /db_xref="UniProtKB/TrEMBL:G8ZTS1"
                     /translation="MVYTTRQIGAKNTLDYRVFIEDDGKPVSPFHDIPLYADEEKQIF
                     NMVVEIPRWTNAKLEITKEEDLNPIIQDTKKGKLRYVRNCFPHHGYIHNYGAFPQTWE
                     DPNQIHPETKAVGDNDPLDVLEIGETIGYTGQVKQVKVLGIMALLDEGETDWKIITID
                     INDPLAPKLNDIEDVEKYFPGLLRATNEWFRIYKIPDGKPENQFAFSGEAKNKKYALD
                     IIRETHESWKQLISGKAPDNKGIALVNTTVSDSPTYSPSIASKIPAASPQPDGPIDKS
                     VDKWFFISGSA"
     gene            788866..788938
                     /gene="TDEL0Dtrna1T"
                     /locus_tag="TDEL_0Dtrna1T"
                     /db_xref="GeneID:11502450"
     tRNA            788866..788938
                     /gene="TDEL0Dtrna1T"
                     /locus_tag="TDEL_0Dtrna1T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:11502450"
     gene            complement(<789241..>789972)
                     /gene="TDEL0D04320"
                     /locus_tag="TDEL_0D04320"
                     /db_xref="GeneID:11503633"
     mRNA            complement(<789241..>789972)
                     /gene="TDEL0D04320"
                     /locus_tag="TDEL_0D04320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681179.1"
                     /db_xref="GeneID:11503633"
     CDS             complement(789241..789972)
                     /gene="TDEL0D04320"
                     /locus_tag="TDEL_0D04320"
                     /inference="similar to DNA sequence:INSDC:YBR014C,YDL010W"
                     /note="similar to Saccharomyces cerevisiae YBR014C and
                     YDL010W; ancestral locus Anc_3.189"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681227.1"
                     /db_xref="GeneID:11503633"
                     /db_xref="GOA:G8ZTS2"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR011899"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR014025"
                     /db_xref="UniProtKB/TrEMBL:G8ZTS2"
                     /translation="MSVSLKKRNLRVLSVTALLLLLVFFVVQNANSISFGEEELKAAT
                     FVNPVASGLTSAGTAVHNNDEIVVDKESGKKGKDQESALVDAEIDKIKQEVNSGSGAS
                     KDNSISQKAGSGSKDGTVSEGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTK
                     EYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKG
                     ELLESLNKWGDGDFTVKQLEKPSNN"
     gene            complement(<790232..>792028)
                     /gene="TDEL0D04330"
                     /locus_tag="TDEL_0D04330"
                     /db_xref="GeneID:11502451"
     mRNA            complement(<790232..>792028)
                     /gene="TDEL0D04330"
                     /locus_tag="TDEL_0D04330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681180.1"
                     /db_xref="GeneID:11502451"
     CDS             complement(790232..792028)
                     /gene="TDEL0D04330"
                     /locus_tag="TDEL_0D04330"
                     /inference="similar to DNA sequence:INSDC:YBR015C"
                     /note="similar to Saccharomyces cerevisiae MNN2 (YBR015C);
                     ancestral locus Anc_3.188"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681228.1"
                     /db_xref="GeneID:11502451"
                     /db_xref="GOA:G8ZTS3"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8ZTS3"
                     /translation="MALITKRYRKALKLATVVLVLCVTFIATSRFMDEGLSVSEYQDY
                     IKSYLGNAQPADTISRNPAVDVGLNAGREPIANGGNAKLKKFYEQVFEDLKNYSPSSK
                     SAREYSKQCSLSGDIGFRPENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKAL
                     GSLVLPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLC
                     ETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKT
                     LDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYT
                     KNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFS
                     QRASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAMLQHDVTQDYM
                     RYKTAQKAISNKYGAQAKISYDSSYSLHEFYKTYFGADEPNYPNEVDIMFAHSHAPKF
                     EPYTLWKNQDLIWEGKHIRSYTALSKINRYDLELENFKAINEYVCVKRTNVKYLNENL
                     ATSAEWASMCDYIRDRLAYLQSTHVQAVSPSK"
     gene            <792565..>792992
                     /gene="TDEL0D04340"
                     /locus_tag="TDEL_0D04340"
                     /db_xref="GeneID:11502452"
     mRNA            join(<792565..792609,792675..>792992)
                     /gene="TDEL0D04340"
                     /locus_tag="TDEL_0D04340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681181.1"
                     /db_xref="GeneID:11502452"
     CDS             join(792565..792609,792675..792992)
                     /gene="TDEL0D04340"
                     /locus_tag="TDEL_0D04340"
                     /inference="similar to DNA sequence:INSDC:YDL012C,YBR016W"
                     /note="similar to Saccharomyces cerevisiae YDL012C and
                     YBR016W; ancestral locus Anc_3.187"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681229.1"
                     /db_xref="GeneID:11502452"
                     /db_xref="InterPro:IPR028144"
                     /db_xref="UniProtKB/TrEMBL:G8ZTS4"
                     /translation="MSAKEYYSQSETKETYNRPNIPPPGHGKTAGAPNGQYVETQNER
                     GFFSGNQQQPQYYQQQQYQQQQYPPQQYPQYYQQGPPQHQQQPIYVQQQPPKSGNQDC
                     LTACLAAMCICCTLDMLF"
     gene            complement(<793070..>794740)
                     /gene="TDEL0D04350"
                     /locus_tag="TDEL_0D04350"
                     /db_xref="GeneID:11502453"
     mRNA            complement(<793070..>794740)
                     /gene="TDEL0D04350"
                     /locus_tag="TDEL_0D04350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681182.1"
                     /db_xref="GeneID:11502453"
     CDS             complement(793070..794740)
                     /gene="TDEL0D04350"
                     /locus_tag="TDEL_0D04350"
                     /inference="similar to DNA sequence:INSDC:YDL013W"
                     /note="similar to Saccharomyces cerevisiae SLX5 (YDL013W);
                     ancestral locus Anc_3.186"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681230.1"
                     /db_xref="GeneID:11502453"
                     /db_xref="GOA:G8ZTS5"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:G8ZTS5"
                     /translation="MVGGSANYVGPSDPVSNSDDVILIESDDEQHSSRDSGLRSSTTR
                     DTMSPNSNGSNQSEVVSRESSRNADSVSPMGSTAEYIDLEMEPAGNEEQDDMIVYDER
                     LSTPRDAEDDELIFVQEQTRPSTIQLNLPGRNPMRITATEYDRPARRSFEQQASNRQL
                     RHQTRVARRQPMRRAARRANHSMNGYESDDGGLTSNRNQINYDPEFAAIQRRLDSYPL
                     DIRSAFLHAQNMNEFSSIIENVDPLTWQDCRYDLERLFMDYRRMMARRAAQIGQNMPG
                     YRSPPNRTQGNADLLRRLGPLGVRIGIGTGMGESLTHYILEPGIFGYGSFRMIGNPGG
                     FDDGMEEEARTQSILNAIQEREEQERDAQTKSNMEKTRSQEENFIEKCKNLPEGYSAS
                     FDTTPTTVRLEPLNDGNKQAIVVEDESAIAEWEEIAVCCLCGVELGVGLPDDFTGISA
                     DDRHLSFDELVTKYCSHCPYQSLTSANGTERALSMKTFVASCGHTFCGRCVVRIENAR
                     THSKSSKKELSKFKGPLHPDNYGPRLCPATGCKQNIRLGRTKMREAFF"
     gene            complement(<796253..>797131)
                     /gene="TDEL0D04360"
                     /locus_tag="TDEL_0D04360"
                     /db_xref="GeneID:11502454"
     mRNA            complement(<796253..>797131)
                     /gene="TDEL0D04360"
                     /locus_tag="TDEL_0D04360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681183.1"
                     /db_xref="GeneID:11502454"
     CDS             complement(796253..797131)
                     /gene="TDEL0D04360"
                     /locus_tag="TDEL_0D04360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681231.1"
                     /db_xref="GeneID:11502454"
                     /db_xref="UniProtKB/TrEMBL:G8ZTS6"
                     /translation="MNEPKSGAAAITFLTLYAIYFVFAVFAVTKLGFKTRYSFLVFFA
                     ALRIGAQVSATAFSSLGLETASGVNCLIAYLVLGAEGYFTLILCALSFLIKGEFEVYG
                     TSQFKPSKEQANEKYPDSPSKARRMRFLSFAATFHWVLIPANILIIVGGSKMTSITTK
                     AGNHGEEMRQAKGLRGAGQGIFLAETVVLFLLALYLFFWRNVRGYKVKAVIVAWPFLL
                     VRGIFGVISVFVDKFNYYDFDNYTAAGLKPSFLCGEYIMGATMEFVSATLLLSTFYVH
                     YRSELKKIEMWNRKRH"
     gene            complement(<797479..>798471)
                     /gene="TDEL0D04370"
                     /locus_tag="TDEL_0D04370"
                     /db_xref="GeneID:11502455"
     mRNA            complement(<797479..>798471)
                     /gene="TDEL0D04370"
                     /locus_tag="TDEL_0D04370"
                     /product="rRNA methyltransferase NOP1"
                     /transcript_id="XM_003681184.1"
                     /db_xref="GeneID:11502455"
     CDS             complement(797479..798471)
                     /gene="TDEL0D04370"
                     /locus_tag="TDEL_0D04370"
                     /inference="similar to DNA sequence:INSDC:YDL014W"
                     /note="similar to Saccharomyces cerevisiae NOP1 (YDL014W);
                     ancestral locus Anc_3.185"
                     /codon_start=1
                     /product="rRNA methyltransferase NOP1"
                     /protein_id="XP_003681232.1"
                     /db_xref="GeneID:11502455"
                     /db_xref="GOA:G8ZTS7"
                     /db_xref="InterPro:IPR000692"
                     /db_xref="InterPro:IPR020813"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZTS7"
                     /translation="MSFRPGSRGGARGGSRGGFGGARGGSRGGFGGGRGGSRGGFGGG
                     RGGPRGGSRGGFGGGRGGGRGGPRGGSRGGPRGGARGGARGGAKVVLEPHKHDGVFIA
                     RGKEDLLVTKNMAPGESVYGEKRVSIEEPSKEDGVPPTKVEYRVWNPFRSKLAAGIMG
                     GLDELFIAPGKKVLYLGAASGTSVSHVSDVVGPEGVVYAVEFSHRPGRELISMAKKRP
                     NVIPIIEDARHPQKYRMLIGMVDCVFADVAQPDQARIIALNAHMFLKDQGGVVISIKA
                     NCIDSTVDAETVFAREVQKLREERIKPLEQLTLEPYERDHCIVIGRYMRSGLKK"
     gene            <798851..>799783
                     /gene="TDEL0D04380"
                     /locus_tag="TDEL_0D04380"
                     /db_xref="GeneID:11502456"
     mRNA            <798851..>799783
                     /gene="TDEL0D04380"
                     /locus_tag="TDEL_0D04380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681185.1"
                     /db_xref="GeneID:11502456"
     CDS             798851..799783
                     /gene="TDEL0D04380"
                     /locus_tag="TDEL_0D04380"
                     /inference="similar to DNA sequence:INSDC:YDL015C"
                     /note="similar to Saccharomyces cerevisiae TSC13
                     (YDL015C); ancestral locus Anc_3.184"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681233.1"
                     /db_xref="GeneID:11502456"
                     /db_xref="GOA:G8ZTS8"
                     /db_xref="InterPro:IPR001104"
                     /db_xref="UniProtKB/TrEMBL:G8ZTS8"
                     /translation="MGFTVKSRSKSLKDTKIADGKGVTLQSLLGEISRQNRSINKNRL
                     RLTYLKEEKQVPVSETFFEEQANLNDVEFFVKDLGPQVSWRLVFVVEYLGPILVHSLF
                     YYLSKCPTLVRKYHSKSVEYNPFMNKLAYTLIMGHYLKREFETLFVHQFSQSTMPLFN
                     IFKNSFHYWVLNGAIAFGYFGYGFIFSNAKLFEAYSTLKLNNLGALVALFTLAECWVA
                     YIHIKLRLWGEAQAKQGNTKKRVPINDGIFALLVAPNYAFESWAWIIFSLIFKLNLFA
                     LIFTAVSVAQMYLWAQKKNKRYGTKRAFLIPYIF"
     gene            complement(<799835..>801340)
                     /gene="TDEL0D04390"
                     /locus_tag="TDEL_0D04390"
                     /db_xref="GeneID:11502457"
     mRNA            complement(<799835..>801340)
                     /gene="TDEL0D04390"
                     /locus_tag="TDEL_0D04390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681186.1"
                     /db_xref="GeneID:11502457"
     CDS             complement(799835..801340)
                     /gene="TDEL0D04390"
                     /locus_tag="TDEL_0D04390"
                     /inference="similar to DNA sequence:INSDC:YDL017W"
                     /note="similar to Saccharomyces cerevisiae CDC7 (YDL017W);
                     ancestral locus Anc_3.183"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681234.1"
                     /db_xref="GeneID:11502457"
                     /db_xref="GOA:G8ZTS9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8ZTS9"
                     /translation="MDKSAVGAVEEVPQDIKDEMGRLYSDIPGLEEDYELIDKIGEGT
                     FSSVYKAKDLKGKICRKYDTHFWSLGSKYVALKKIYVTSSPQRIYNELNLLYVLTGCT
                     RVAPLCDATRVRDQVIAVLPYYPHEEFRNFYRDLPIKGIKMYLWEMLQALSFVHSKGI
                     IHRDVKPTNFLYNPELGRGVLVDFGLAELQVDYSNELAEKDNSFSMKDRRNQEQFCPC
                     ILRDFTGASPHQGATTPMVTIQNGKVVYLNNVNGVDLTKGYPKNETRRIKRANRAGTR
                     GFRAPEVLMKCGSQTTKIDIWSVGVILFSLLARRFPMFQSLDDTDSLLELCTIFGWKK
                     IRKCAALHGLGFEVSGLKYIKENGPAGELKGFVYELLEKECQTGTLPEYSIAFETYEY
                     LSQELHDKRSIEPRLPDVESTPEGPEAYELKKYQEEIWSDHYWCFQLLEQCFEMDPQK
                     RSSANELLRSAFFNEINESGVYTEIESTDEDDSDRSDGFDAGENDVVLISG"
     gene            <802411..>803079
                     /gene="TDEL0D04400"
                     /locus_tag="TDEL_0D04400"
                     /db_xref="GeneID:11502458"
     mRNA            <802411..>803079
                     /gene="TDEL0D04400"
                     /locus_tag="TDEL_0D04400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681187.1"
                     /db_xref="GeneID:11502458"
     CDS             802411..803079
                     /gene="TDEL0D04400"
                     /locus_tag="TDEL_0D04400"
                     /inference="similar to DNA sequence:INSDC:YDL018C"
                     /note="similar to Saccharomyces cerevisiae ERP3 (YDL018C);
                     ancestral locus Anc_3.182"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681235.1"
                     /db_xref="GeneID:11502458"
                     /db_xref="GOA:G8ZTT0"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:G8ZTT0"
                     /translation="MNALLLITFVCFFCHVSSSPITFELTKGQKECFYVLTPDVGCSI
                     SYYFAVQEGESNDFLINYEIYGPLDAYSPILERFKERLGEWSFYAEHRGEYAFCFYGG
                     QEHNKIVDLDISYQCGHEEDARSQRRKDRKEQRRLRDSHNDPSQISLENSVDKIERQL
                     YLLEQNMQYYENRNRRNHYTVCSTNRRIAWFSVYGILLVIGLGCAQVFVLNWFFRSSR
                     KHAV"
     gene            complement(<803139..>804776)
                     /gene="TDEL0D04410"
                     /locus_tag="TDEL_0D04410"
                     /db_xref="GeneID:11502459"
     mRNA            complement(<803139..>804776)
                     /gene="TDEL0D04410"
                     /locus_tag="TDEL_0D04410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681188.1"
                     /db_xref="GeneID:11502459"
     CDS             complement(803139..804776)
                     /gene="TDEL0D04410"
                     /locus_tag="TDEL_0D04410"
                     /inference="similar to DNA sequence:INSDC:YIR027C"
                     /note="similar to Saccharomyces cerevisiae DAL1 (YIR027C)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681236.1"
                     /db_xref="GeneID:11502459"
                     /db_xref="GOA:G8ZTT1"
                     /db_xref="InterPro:IPR002195"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="UniProtKB/TrEMBL:G8ZTT1"
                     /translation="MTVSEFAEGSIRAISSDRVVLDGTIKPATILYSTLSGKIVEIYD
                     EVIESLKDIRLKTFDVRTYENVSPNVIFPGLVDSHVHLNEPGRTEWEGFATGTRAACS
                     GGVTTVVDMPLNAIPPTTTMANFNTKLKAAEDQLWCDVAFWGGMVPDNLDHLVPLVRA
                     GVRGFKGFLIDSGVNEFPAIDKPYIKRAIQKLADCKTMMMFHAEMQIDDNLHTIVETE
                     EVTKIRSLDERNGVTEKQAQSLQLSRLLSPAEPRGGVPSHIVHNDDDITPPLETAAEI
                     DDELAKVDPCKYSSFLISRPDRFETDAISLILKCLEESIKEQGKAPPVHIVHLASMDA
                     IPLIRKAHEAALPITAETCFHYLSLAAENIPKGSTTFKCCPPIRTEANRVALWRALRE
                     GIISSVVSDHSPCTPELKNLAHGDFFSAWGGISSVGLGLSLLHTKGCMMKPSVSLSEI
                     AKWCCENTAKQVGLQHRKGFLRVGYDADFAIFDDAKEQSIDNASMHYKNKLTAYHGQT
                     VKGVVIKTVLRGKTVFTVKSGPSNLPLGNTLLEPRFA"
     gene            complement(<805178..>807901)
                     /gene="TDEL0D04420"
                     /locus_tag="TDEL_0D04420"
                     /db_xref="GeneID:11502460"
     mRNA            complement(<805178..>807901)
                     /gene="TDEL0D04420"
                     /locus_tag="TDEL_0D04420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681189.1"
                     /db_xref="GeneID:11502460"
     CDS             complement(805178..807901)
                     /gene="TDEL0D04420"
                     /locus_tag="TDEL_0D04420"
                     /inference="similar to DNA sequence:INSDC:YBR017C"
                     /note="similar to Saccharomyces cerevisiae KAP104
                     (YBR017C); ancestral locus Anc_3.181"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681237.1"
                     /db_xref="GeneID:11502460"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZTT2"
                     /translation="MWSPQPEALLQLGSLLKSSMAQNHDERTQAMEALKTFQLQPEFL
                     NYLCYMLIEGESDEVLKSHFSPQDLQTNRATCGLLLKNNMLEQGSLTHGNHDLQYVKA
                     NIIHGLYNTGNHLVSNVTGIVITTLFSTYYRQHREDPMGIELLSQLLELAANGNEPSI
                     KALSKIMEDSAQFFQLKWSGDIRPIDLLIDTFLKFISSPSSKPVIRSESIKCINTIIP
                     LQSQSFIVRLDEFLASIFQLAQSDESELTRAQICVSFSILLNYRPDKLVDHLSGIIQF
                     MLHLIGAVNDETVAIEACEFLHGFSTNNQIPAHVVEPFVADIIPVLLAKMVYNEESIV
                     MLEASNEDDALEEDKDEDIKPAAPRIVKKRDEEQSDDEDDEDDEAGDVDTQWNLRKCS
                     AATLDALTNSLPREVMMTAFPLLREHMTSGRWFIREATVLALGAMAEGGMKYFEDQLS
                     TLIPFLVELLKDFWAPVRKITCWTLSRFSIWILKDHTEFLIPVLEPIVNTLMDRKKDV
                     QEAAISSVAVFIENCDAELVETLLYNDLLNSFNKCFEFYKKKNLIILYDAVGRFAEKC
                     ELDDHAMQVLLPHLISKWSSLPDDDKELWPLLECLSYVATSLGEKFMPMAPDVYSRAY
                     RILCQCVELDARSQQDPTVVVPEKDFVITSVDMIDGLAQGLGSQSQSLLFPQEGRDTT
                     LLQLLLHCLQDPVHEVRQSAFALLGDIAYFYDPAIISSRLAEFLKLIGSEIMHNDDPD
                     GEPALINAIWCLGLIGERLNISHYIIDLSRVLLDLFVNPSQSLDQSVRENLAITIGRL
                     AISLPEVFASGPFASDAIWRKWCIAIQDLDSVEEKSSAYNGFIKIVNLSSDQVDISSD
                     TLKKIVEGMSVNVDTSPFAQDLYAFLVRYATKIQALQLTREGIAFLQQLSN"
     gene            complement(<808238..>810211)
                     /gene="TDEL0D04430"
                     /locus_tag="TDEL_0D04430"
                     /db_xref="GeneID:11502461"
     mRNA            complement(<808238..>810211)
                     /gene="TDEL0D04430"
                     /locus_tag="TDEL_0D04430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681190.1"
                     /db_xref="GeneID:11502461"
     CDS             complement(808238..810211)
                     /gene="TDEL0D04430"
                     /locus_tag="TDEL_0D04430"
                     /inference="similar to DNA sequence:INSDC:YAR014C"
                     /note="similar to Saccharomyces cerevisiae BUD14
                     (YAR014C); ancestral locus Anc_3.180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681238.1"
                     /db_xref="GeneID:11502461"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:G8ZTT3"
                     /translation="MENGGHELLADPNLVENYSDILKKKPDRMSTGGSETDFDSESAS
                     GSVVVTRSSTNTSPAKQRSSMLSNSSSHYSLRGGNDVIQPREGLEETVEEDEEDEDGA
                     EEVEEKENTGELHHDDDTTIEEITSNKVESPIGEMTHDYEYSDSDFEEDMEKRLQDLN
                     ASGSDTDLRNTVKEENDSDHMILGLSLSEDEDSEEDDKLHLGLDDELVESSSDSDDYQ
                     PLSPPKELDPEKLYALYAFHGPDPSHCQLRQDESCTLLNDQDSYWWLVRRSYDSKIGF
                     APAEILETFPERLARLNCWKNENMSSQLSGHSAGGDEGLDGKGDQETGTSSSEGYDSN
                     DKLEEKGSKSSVLKNYVKDNKSVSFNDVVSYADRFLEEDVNADDTVDAVHYDEFTEAD
                     MKLNRLPEEDEFSEVVSDVSFNTASMAPLNVEKVRRPKIDSNQDKEVIPDPETSNPKL
                     SAKQDNTDKPVKDEGDDLQKIFEAPTAPFHKGQNGGNRMQTSNSDYSISTIGDFSPSS
                     SEWTNDSPQLQNEQFGAESDSSTIPSSRAIQDFSKYVEEDGKIDSDTTSQCKSLETKI
                     GSKKLDGNNSLQDSKPNSIASTSSSSEQIFMDSERVNSCTSINSAASVSKNPLHVKNT
                     GMNKRHPLIDRLYNPIFDKMDELMRLLDEVANE"
     gene            <810716..>811636
                     /gene="TDEL0D04440"
                     /locus_tag="TDEL_0D04440"
                     /db_xref="GeneID:11502462"
     mRNA            <810716..>811636
                     /gene="TDEL0D04440"
                     /locus_tag="TDEL_0D04440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681191.1"
                     /db_xref="GeneID:11502462"
     CDS             810716..811636
                     /gene="TDEL0D04440"
                     /locus_tag="TDEL_0D04440"
                     /inference="similar to DNA sequence:INSDC:YAR015W"
                     /note="similar to Saccharomyces cerevisiae ADE1 (YAR015W);
                     ancestral locus Anc_3.179"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681239.1"
                     /db_xref="GeneID:11502462"
                     /db_xref="GOA:G8ZTT4"
                     /db_xref="InterPro:IPR001636"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR018236"
                     /db_xref="InterPro:IPR028923"
                     /db_xref="UniProtKB/TrEMBL:G8ZTT4"
                     /translation="MGVTIAQTNLDGILPLIARGKVRDIYEVDPKTLLFVATDRISAY
                     DCSMSNTIPDKGVMLTRLSEFWFHFLSNYVRNHLIEIPEGKTIFDFLPKELSEPKYKE
                     QLENRSLLVQKHKLIPLEAIVRGYITGSAWKEYCKTGSVHTIPQPQGLKESQEFPVAI
                     FTPSTKAEQGEHDENISPEQAQELIGKDVADRVAELAIRIYTKCREYAKTKGIIIADT
                     KFEFGIDESTGEIILVDEVLTPDSSRFWSGANYQVGKSQDSYDKQYLRDWLTSNKLAG
                     VPGVTMPEDIVVNTRAKYLEAFEALTGAKF"
     gene            complement(<811665..>812924)
                     /gene="TDEL0D04450"
                     /locus_tag="TDEL_0D04450"
                     /db_xref="GeneID:11502463"
     mRNA            complement(<811665..>812924)
                     /gene="TDEL0D04450"
                     /locus_tag="TDEL_0D04450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681192.1"
                     /db_xref="GeneID:11502463"
     CDS             complement(811665..812924)
                     /gene="TDEL0D04450"
                     /locus_tag="TDEL_0D04450"
                     /inference="similar to DNA sequence:INSDC:YAR018C"
                     /note="similar to Saccharomyces cerevisiae KIN3 (YAR018C);
                     ancestral locus Anc_3.178"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681240.1"
                     /db_xref="GeneID:11502463"
                     /db_xref="GOA:G8ZTT5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZTT5"
                     /translation="MSNMQNRRQILNEYYPTQPMSPPVTQPASQYQVLEEIGRGSFGA
                     VRKVIHLPTKKLMVRKDIRYGHMNSKERQQLIAECTILSQLKHENIVEFYSWDFNEQK
                     EVLYLYMEYCSRGDLSQMIKHYKQEHKYIPEKVIWGILAQLLMALYKCHYGDDLPQLT
                     TMYDRMKPPTKGKNIVIHRDLKPGNIFLSNENNDDKEVKNYRKMDYSQVVVKLGDFGL
                     AKSLEASIQFATTYVGTPYYMSPEVLMDHPYSPLSDIWSLGCVIFEMCSLHPPFQARN
                     YLELQKKIKLGKFDKIPDYYSDGLNLMIRSMIDVDLKTRPSTFELLQDIQIRTARKSL
                     QLERFERNLLDYENELVNIEKILEKQAMEYEREYSQLKEQFLRAVEDRVAEVINGKKI
                     GMVPESIDGYYNKRLPRPAYHWQTRYR"
     gene            complement(<813075..>815816)
                     /gene="TDEL0D04460"
                     /locus_tag="TDEL_0D04460"
                     /db_xref="GeneID:11502464"
     mRNA            complement(<813075..>815816)
                     /gene="TDEL0D04460"
                     /locus_tag="TDEL_0D04460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681193.1"
                     /db_xref="GeneID:11502464"
     CDS             complement(813075..815816)
                     /gene="TDEL0D04460"
                     /locus_tag="TDEL_0D04460"
                     /inference="similar to DNA sequence:INSDC:YAR019C"
                     /note="similar to Saccharomyces cerevisiae CDC15
                     (YAR019C); ancestral locus Anc_3.177"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681241.1"
                     /db_xref="GeneID:11502464"
                     /db_xref="GOA:G8ZTT6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZTT6"
                     /translation="MMNAERVNVTPAQQVDQNVPPVTLSQQRQRKNQVQYQLKQVIGK
                     GSYGIVYKAINRKTEQMVAIKEVTYDDDEELTDIMSEIDLLKNLNHMNIVKYHGFIKK
                     SHNLYIILEYCSRGSLKNVISRGKGIPESKAKVFIKQTLNGLHYLHEQGVIHRDIKAA
                     NLLLDSNSVVKLADFGVSTKVNTMTMAMTLAGSLNWMAPEIIGNRGASTLSDIWSLGA
                     TVLELLTGHPPFHNLVDINIYYAIENDTFIPPTSLSQDAQEFLARCFQKNMYMRPTAA
                     ELLKHKWLSTTDTDKLDLFKEDGDELDYRWDQDFKESTIINTPGVESQRVSTGDSSDS
                     ARPAVRSSEELLAHLNKSNDSELSFDSLKTIFDQMSVEDIYLRVVGQIEANQEFLNAL
                     FEYDKINNSSKLKECWITLGGIYEILDQNEIIERYFLKDSYKILIQCGILRRENMDLL
                     NDTLRLELIFRLLEVSDSASFWCNWCSQNLRVSALVSNLQNKFAQSIILKLSYFDESS
                     NWFYGQFINEILTVSQIDSLDQQTVSFIFKALSSILIKSHKRRASSSLAQSLSHSSNF
                     TSQSSLCSLPSSTVRSSVSKAALSLPPEFLPWLLRLLDEDLFYNIKNLHLWRYFFLVI
                     HHSTHLNKALLNRLLHSSRFLTLNLKFLLSKDDPSFLHEECRLPIVQLSLSIITEVSM
                     EMDSFSPLLQRLAVAFLKFDDECIAGGLEILFNYLQFALHSNLRISKTIKGLAIIPPM
                     TSSNAQVFNSSESDNFLNYQEVIDPFFNVHEDNIQFGNFIATFIKIYSLGPFDVAAMN
                     IILHPDFVKRSILFFDQYRNSLLIQIDLLKFIKLAFGRALDFYNSKSKSKAPLSKDVA
                     RQMSLKLQELNFVLENNWNSQQAGQIGCDSILIHQLCQDIKSLSLQTPSSYSMAHLR"
     gene            <816346..>818472
                     /gene="TDEL0D04470"
                     /locus_tag="TDEL_0D04470"
                     /db_xref="GeneID:11502465"
     mRNA            <816346..>818472
                     /gene="TDEL0D04470"
                     /locus_tag="TDEL_0D04470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681194.1"
                     /db_xref="GeneID:11502465"
     CDS             816346..818472
                     /gene="TDEL0D04470"
                     /locus_tag="TDEL_0D04470"
                     /inference="similar to DNA sequence:INSDC:YAR035W"
                     /note="similar to Saccharomyces cerevisiae YAT1 (YAR035W);
                     ancestral locus Anc_3.176"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681242.1"
                     /db_xref="GeneID:11502465"
                     /db_xref="GOA:G8ZTT7"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:G8ZTT7"
                     /translation="MPSKDTNSDLLKRLPIPDLNETLEKYLTRVEPLQDARQNRKTRK
                     CVLSDENVDLMRTLHERLVQYDGQLAKDVPQSSYIEQFWYDAYLLYDASVVLNSNPFF
                     QLQDDPTIRDTSETGSGPYGIFTGQVKRTAKLVTSILKFIREIRHGTLTKDMIRGKIP
                     LSMDQYGKLFGSSRIPPGPGQESCHLQTDTTSHHVIVMYKSQFYWFDVLDVNNFPIFS
                     TPEELEWNLYSIIMDNEKKPLDVDADEAPNIPFGVFTTENRRVWANIRDYVFHDSDPA
                     NWKNLKIIDSALFVICLDDVSFKNEEKDELVKSLLCGTSEIELDPTNTSRPFGVQRGT
                     CSNRWYDKLQLIVTRNGKAGINFEHTGIDGHTVLRLATDIYTDSILSFARGVTNVVPD
                     IFQSNDAVKPVPNKPSRANVITIPRKLEWKVDSFLLSSLHFAETRVSDVISQYEFATL
                     DFEQYGSTHMKSTFKTSPDAFVQQIFQVAYYALYGKFETTYEPAMTKMFQNGRTEAIR
                     SVTHESKRFVKSLFDRKPTDEERIKLLQQACAEHSRITKECSMGMGQDRHLYALYCLW
                     NESYKDQIPLPPIFQDNSWSLLNTNVLSTSNCGNPCLASFGFGPVTANGFGIGYIIRD
                     NSVSVVVSSRHRQTHRFLSLIEKSFLEVDHIFERHAAGISAVSAPVDDDTRRTTAKPR
                     ANSALKSEDLRFLLGGYDYFDVSVSG"
     gene            <818876..>822682
                     /gene="TDEL0D04480"
                     /locus_tag="TDEL_0D04480"
                     /db_xref="GeneID:11502466"
     mRNA            <818876..>822682
                     /gene="TDEL0D04480"
                     /locus_tag="TDEL_0D04480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681195.1"
                     /db_xref="GeneID:11502466"
     CDS             818876..822682
                     /gene="TDEL0D04480"
                     /locus_tag="TDEL_0D04480"
                     /inference="similar to DNA sequence:INSDC:YDL019C,YAR042W"
                     /note="similar to Saccharomyces cerevisiae OSH2 (YDL019C)
                     and SWH1 (YAR042W); ancestral locus Anc_3.175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681243.1"
                     /db_xref="GeneID:11502466"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR018494"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8ZTT8"
                     /translation="MSSVTSKAQHSNSQSVQSPPRLNKGLNEEESSNDEDTASQTVSR
                     PLLKLKLLDYLRQGSFTNLKQLIDSQFQPKNDPNVKAVKSLILHYAVQVAPLALIKEI
                     VAKWSGKEASDICLDINQTDENGNTPLHLAAFQSRGDVVSFLMDQPNVNDCVLNNSNL
                     QPIEMCKNLNIAQMMQVKRAHYVAEIAQEFRTAFNNRDFGHLESILSAPRNAELLDIN
                     GMDPETGDTVLHEFVKKRDVIMCRWLLEHGADPFKRDRQGKLPIDLVGKVNENNTATN
                     TKTAIEMELKKLLSKAAKEQSVIDVTNNLNEAPTYKGYLKKWTNFAQGYKLRWFILSK
                     DGKLSYYKDQSDTKNACRGSLSMSTCYLHLDSSEKLKFEIIGGSDGTIRWHLKANHPI
                     ETNRWVWAIQGAIRFSKDREMMNKSGNIPPSLAINKGAPSSNNVQKLHSYERQRHPLP
                     LEREEGRDRHHNRVPSASSSTKPRKPSATSSEVNLNDNLTESGKLYVNKVLENRESTS
                     RASSIKHFKTDSQSIENTSSINRNPSSKSNEGAASQSGSLFGTESAFADGQNTSMDQE
                     GDLMTDDEENTDVVNGDDEDVVVLYGPYAVKLAMLQRSIAMDLSSLNELLESGSPDQE
                     AWSTIKTSLATVSTTFEKMNSLSSARDKKLVSMLSKQRDINNVWIQSVKDLEIELIEK
                     SNRLASLDKERRNLKKLLQKGLVESSEPANVSEPNLPEETPNALEEIAKFIDATKGED
                     EGSDADEFYDAEELVEASTQLEEEKAEEIPKKEIPSDLEIATKSRKPVSQPPLEEERT
                     EEPSEQVSGVTEVETQERPAAQEDEKKPASSGVDEVTSTIAVTPEQEQKGKLILSEGT
                     YLGYEDGIRKRLKLDKDDRPSVSLWSVLKSMVGKDMTRMTLPVTFNEPTSLLQRVAED
                     LEYTHLLDEAASFEDPTLRLLYVGVFTASSYASTIKRVAKPFNPLLGETFEYARPDKH
                     FRFFTEQVSHHPPISATWTESPKWDFYGESNVDSKFNGRSFAFKHLGWWHISMRPDDK
                     SPDELYTWKKPDNTVIGILVGNPQVDNHGDVKIVNHTTGDYCMLNFKARGWRSSGAYE
                     MRGEVFNKKGQKMWVLGGHWNDTIYGKKVTAKDSGEIPLQKTATASSSAFTGPKFDGS
                     KFLIWKTAPRPDAPFNLTPFAITLNAPQPKLLPWLAPTDTRLRPDQRDMEDGRYDEAA
                     KEKHRVEEKQRAERKKRESKNEKYCPKWFVQEQHPITKNKYWRFNGNYWMMRKEHKLK
                     NCGDIF"
     gene            <823254..>824912
                     /gene="TDEL0D04490"
                     /locus_tag="TDEL_0D04490"
                     /db_xref="GeneID:11502467"
     mRNA            <823254..>824912
                     /gene="TDEL0D04490"
                     /locus_tag="TDEL_0D04490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681196.1"
                     /db_xref="GeneID:11502467"
     CDS             823254..824912
                     /gene="TDEL0D04490"
                     /locus_tag="TDEL_0D04490"
                     /inference="similar to DNA sequence:INSDC:YOL055C"
                     /note="similar to Saccharomyces cerevisiae THI20
                     (YOL055C); ancestral locus Anc_3.174"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681244.1"
                     /db_xref="GeneID:11502467"
                     /db_xref="GOA:G8ZTT9"
                     /db_xref="InterPro:IPR004305"
                     /db_xref="InterPro:IPR004399"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="InterPro:IPR027574"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:G8ZTT9"
                     /translation="MTMTTIKINTPPPYLTLARDEHLPVVMSVAGTDSSGGAGIEADV
                     KTITAHRCYAMTCVTALTAQTPAEVFKVHPTPKEFVQKVLDVNLQDMECHVIKTGMLT
                     VDAVNVLSSKLRSLPAEERPKLVVDPVLVATSGCALGGSDLVKAIKEELTPLADLLTP
                     NIPECFELVGQKSKIASMTQLCELAEKVSNATSCSNVLVKGGHIPWDDEQRKYITDVL
                     YVGSESKCIVYKGNYIDTTHTHGTGCTLASAISSNLARGFSLGQAVYGGIEYVQNGIS
                     IGCEVVKSHITNNGPINHVYAIEIPLEKMVQDECFNAHDIVTKSVTLDQIPGEGDFFQ
                     YLINHPKVKPHWESYVHHDFVKQVAQGTLKREKFRFFIEQDYAYLIDYARVHCIAGSK
                     APTLEDIEKELNIVGSVRNEMGQHEKRLVEEFGVKDKEYFQKIQRGPALNNYSRYFND
                     IARRGNWQELVASLSPCLMGYGYALINQKKFITVEEDDVYYEWCQTYLSVWYQDAMAR
                     GKELLNQIALTGSKAELDTLVTIFADVCELETKFWDAAVNYTSN"
     gene            <825355..>826758
                     /gene="TDEL0D04500"
                     /locus_tag="TDEL_0D04500"
                     /db_xref="GeneID:11502468"
     mRNA            <825355..>826758
                     /gene="TDEL0D04500"
                     /locus_tag="TDEL_0D04500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681197.1"
                     /db_xref="GeneID:11502468"
     CDS             825355..826758
                     /gene="TDEL0D04500"
                     /locus_tag="TDEL_0D04500"
                     /inference="similar to DNA sequence:INSDC:YDL020C"
                     /note="similar to Saccharomyces cerevisiae RPN4 (YDL020C);
                     ancestral locus Anc_3.173"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681245.1"
                     /db_xref="GeneID:11502468"
                     /db_xref="GOA:G8ZTU0"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8ZTU0"
                     /translation="MTSTELALNRTLTDILEDELYNMHAGHHHPLSMAKSKNVMELPL
                     QLSFDEHTNNDNHSDPNGGANDYYWTSPQESDSQQYKIFNKYADPSLTTTSMQKQSSN
                     RAAMATTPVQKTVNLHSVMKVANPFHMKEQLPYDVKVTNDVMHAGDFGYSSQSDDELI
                     GYDTSYDPKVYWPLQDSNVALSNEDARMIFDHEFAADDDDLSDDEDDDDVQNLPLQHA
                     YNLQGDRNETEGRVFNSCNFVDSNMVHSNYDDKESSHNITSDIAVVDDEEEDDNMIDE
                     DDLYEPSLRNDRKESVVYNNPPTAESRTKSESTPPILPVVKSQSSKAATRRKLSSSVG
                     GSSPSSTSRRKVVTNKRNHQSPSPPEHITTESSNGTEIYTCMIMNSITEQPCSAQFSR
                     SYDLTRHQNTIHAKKKAVFRCSECISSLGQEGYQKTFSRLDALTRHIKSKHENLSLEQ
                     RQELTRYARDNIGYVVG"
     gene            complement(<827015..>827920)
                     /gene="TDEL0D04510"
                     /locus_tag="TDEL_0D04510"
                     /db_xref="GeneID:11502469"
     mRNA            complement(<827015..>827920)
                     /gene="TDEL0D04510"
                     /locus_tag="TDEL_0D04510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681198.1"
                     /db_xref="GeneID:11502469"
     CDS             complement(827015..827920)
                     /gene="TDEL0D04510"
                     /locus_tag="TDEL_0D04510"
                     /inference="similar to DNA sequence:INSDC:YDL021W,YOL056W"
                     /note="similar to Saccharomyces cerevisiae GPM2 (YDL021W)
                     and GPM3 (YOL056W); ancestral locus Anc_3.172"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681246.1"
                     /db_xref="GeneID:11502469"
                     /db_xref="GOA:G8ZTU1"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR005952"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G8ZTU1"
                     /translation="MTASNDTLKVILLRHGQSELNHENIFCGWIDASLTDKGKHQARN
                     AAQLIQKYCQDENVALPQVGYTSRLVRTQQTIEVMLDELHLKGSYEVVPGIQYDTTEK
                     LESNEVKVLQTWRLNERHYGSWQGQRKPDILKEYGKEQYMYIRRDYQGKPPKADLKRE
                     MIQEVNDPGSSTGYDFKEPNRHKKYSLEEGFDVELPNSESLCDVVERLKPFLNDVVLK
                     TAKEHNLQSCLLVGHGSSVRSILKILQGISDDDIKDVDIPNATPLVVELDKETFKFVN
                     RYYLDPETANKDAEKVRQEGFQNNP"
     gene            complement(<828204..>830264)
                     /gene="TDEL0D04520"
                     /locus_tag="TDEL_0D04520"
                     /db_xref="GeneID:11502470"
     mRNA            complement(<828204..>830264)
                     /gene="TDEL0D04520"
                     /locus_tag="TDEL_0D04520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681199.1"
                     /db_xref="GeneID:11502470"
     CDS             complement(828204..830264)
                     /gene="TDEL0D04520"
                     /locus_tag="TDEL_0D04520"
                     /inference="similar to DNA sequence:INSDC:YOL057W"
                     /note="similar to Saccharomyces cerevisiae YOL057W;
                     ancestral locus Anc_3.171"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681247.1"
                     /db_xref="GeneID:11502470"
                     /db_xref="GOA:G8ZTU2"
                     /db_xref="InterPro:IPR005317"
                     /db_xref="UniProtKB/TrEMBL:G8ZTU2"
                     /translation="MVTTQRVADHDAPITLLKVTDKFELLTDSEQKYAHYMSAASHAG
                     TRVVLRQVSHESEAIFDLILGLHRDLHGEYPRCNETGLYLDYVTQFLANLGNYKSFGD
                     SKFVPGCTKQYFYKLLELAKWDLNGSPRCHCPFASWKELIEDGIYKVEGKGSLGYTSD
                     GFTSSYYMGEPISQMDMALLKHEVFGPLSILPENIRINKVSNDSFEIWVASTAKAKPL
                     YEATTLSNGVKVSFKFGDHSREMQCIVESLEHAKEFAANTTQKKMLKWYIEHFKTGSG
                     QAHKESQKLWVKDISPTIETNIGFIETYREPSGVIGEFESLVAIQNKERTEKFSQLVN
                     NAQEFISLLPWTADWEKPVFNPPDFTSIEVLTFTGSGIPAGINIPNYDDVRINIGFKN
                     VSLGNILSASAKSSSKHPPSFISDQDRPIYEKWQGDSFEVQVGIHELLGHGSGKLLCE
                     VEDGFNFDEKNPPLGLDGTPVTTYYKFGETWGSKFGAMAGPFEECRAEVIAMYLITNR
                     KILDIFGFNTKQDQDDVIYAGYLQMCRAGLMALEFWDPNTGKWGQPHMQARFSIMKTF
                     LKHSPDPAFLSLITDADQIIVKLERSLIETAGHECIKDYLKHLHIYKCSGDYERGSQY
                     FNDRCTVTADLAKLRDTVISKRLPRRQFIQTNTRISNYNKVVLQEYEETPKGMLESFI
                     ERQL"
     gene            complement(<830289..>831533)
                     /gene="TDEL0D04530"
                     /locus_tag="TDEL_0D04530"
                     /db_xref="GeneID:11502471"
     mRNA            complement(<830289..>831533)
                     /gene="TDEL0D04530"
                     /locus_tag="TDEL_0D04530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681200.1"
                     /db_xref="GeneID:11502471"
     CDS             complement(830289..831533)
                     /gene="TDEL0D04530"
                     /locus_tag="TDEL_0D04530"
                     /inference="similar to DNA sequence:INSDC:YOL058W"
                     /note="similar to Saccharomyces cerevisiae ARG1 (YOL058W);
                     ancestral locus Anc_3.170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681248.1"
                     /db_xref="GeneID:11502471"
                     /db_xref="GOA:G8ZTU3"
                     /db_xref="InterPro:IPR001518"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR018223"
                     /db_xref="InterPro:IPR023434"
                     /db_xref="InterPro:IPR024074"
                     /db_xref="UniProtKB/TrEMBL:G8ZTU3"
                     /translation="MSKGKVCLAYSGGLDTSIILAWLLDEGYEVVAFMADVGQEEDFD
                     AAREKALKIGATKYVVVDCREDFVNDILFPAVQVNAVYEDIYLLGTSLARPVIAKAQI
                     DVARQEGCFAVSHGCTGKGNDQIRFELAFYALKTDVKVIAPWRLPEFFERFAGRKDLL
                     DYAAEKGIPVAQTKAKPWSTDENQAHISYEAGILEDPDTTPPKDMWKLTVDPMDAPNT
                     PQDLSIDFEVGLPVKVSYEQDGKKVEVTKPIDIFNHVSNLARANGVGRIDIVEDRYIN
                     LKSRGCYEQAPLTVLRRAHVDLEGLTLDKEVRALRDQFVTPTYSKLLYNGSYFTPECE
                     FIRSMIKPSQKSVNGTVRVRLYKGNVMILGRSSKTEKLYDPTESSMDELTGFSPIDTS
                     GFIAIQAIRVKKYGDANKNLTL"
     gene            complement(<831729..>832916)
                     /gene="TDEL0D04540"
                     /locus_tag="TDEL_0D04540"
                     /db_xref="GeneID:11502472"
     mRNA            complement(<831729..>832916)
                     /gene="TDEL0D04540"
                     /locus_tag="TDEL_0D04540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681201.1"
                     /db_xref="GeneID:11502472"
     CDS             complement(831729..832916)
                     /gene="TDEL0D04540"
                     /locus_tag="TDEL_0D04540"
                     /inference="similar to DNA sequence:INSDC:YDL022W,YOL059W"
                     /note="similar to Saccharomyces cerevisiae GPD1 (YDL022W)
                     and GPD2 (YOL059W); ancestral locus Anc_3.169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681249.1"
                     /db_xref="GeneID:11502472"
                     /db_xref="GOA:G8ZTU4"
                     /db_xref="InterPro:IPR006109"
                     /db_xref="InterPro:IPR006168"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR011128"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR017751"
                     /db_xref="UniProtKB/TrEMBL:G8ZTU4"
                     /translation="MAASDRLNQTSEIISHSMQQSESTTSLAAADHPFKVTVIGSGNW
                     GTTIAKVVAENTALNPQLFARRVDMWVFDEDIKGEKLTEIINTRHENVKYLPGIELPE
                     NLHANPDLIDSVKDVDIIVFNIPHQFLPRIVQQLKGHVDRKVRAISCLKGFEVGVKGV
                     QLLSTYVTEELGIECGALSGANLAPEVAKEHWSETTVAYHIPEDFRGEGHDVDHKVLK
                     ALFHRPYFHVSVIEDVAGISIAGALKNVVALGCGFVEGLGWGNNAAAAIQRVGLGEII
                     KFGKMFFPESKVETYYQESAGVADLITTCSGGRNVRVAKAMAKNPDKSAEDVEKELLN
                     GQSAQGLITCKEVHEWLERCNHLDDFPLFEAVYQIVYNNVPMDKLPDMIEELDLGLKE
                     SAH"
     gene            <833759..>835612
                     /gene="TDEL0D04550"
                     /locus_tag="TDEL_0D04550"
                     /db_xref="GeneID:11502473"
     mRNA            <833759..>835612
                     /gene="TDEL0D04550"
                     /locus_tag="TDEL_0D04550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681202.1"
                     /db_xref="GeneID:11502473"
     CDS             833759..835612
                     /gene="TDEL0D04550"
                     /locus_tag="TDEL_0D04550"
                     /inference="similar to DNA sequence:INSDC:YOL060C"
                     /note="similar to Saccharomyces cerevisiae MAM3 (YOL060C);
                     ancestral locus Anc_3.168"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681250.1"
                     /db_xref="GeneID:11502473"
                     /db_xref="GOA:G8ZTU5"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR002550"
                     /db_xref="UniProtKB/TrEMBL:G8ZTU5"
                     /translation="MTLRRSNRLSYFVVTVALPRIIHSLPLARRDAHLLHEGDGTVDP
                     NRNTYLFISALLVLLGGVFAGLTLGLMGQDEIYLKVISSSGTAQEQRLSRKVLALINR
                     GKHWVLVTLLLSNVITNETLPIVLDRCLGGGWQAVFCSTVLIVIFGEIIPQSICVKYG
                     LEVGAFFAPFVLVLMYLMYPVAYPIASLLDYMLGEDHGTMYKKSGLKTLVTLHRTMGG
                     VERLTHDEVTIISAVLDLKEKKVKEIMTPIENVFTISADTVLDEKHVAEIFDSGFSRI
                     PIYLPNEPTNFIGMLLVRILISYDPEDCLPVSHFPLATLPETSPNTSCLNILNYFQEG
                     KSHMCVVSEEPGSSMGALGVLTLEDVIEELIGEEIVDESDVFVDIHQKIMRAQPGPLS
                     KRHITSYLHHLYTDRTKDDPQGKSSPSHALSPQDSEAHTPQTLEPHQLAMPSNPASNP
                     LDVKKPYVTIKKPSNRLSKADENLYNKHLDMSQRAIDFTNMTGQPSQVTSRTSPAPNA
                     DDDNDDYSSSHSKRQPVMISSSYKSTKNGIVESVITVKGVPKTIIEPANSWDENSRLV
                     TPDHTGSYVEDSIHGPDSNFIPLSPSSSTALHQKKSKSDHSLSTRNKSPRH"
     gene            <835822..>837885
                     /gene="TDEL0D04560"
                     /locus_tag="TDEL_0D04560"
                     /db_xref="GeneID:11502474"
     mRNA            <835822..>837885
                     /gene="TDEL0D04560"
                     /locus_tag="TDEL_0D04560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681203.1"
                     /db_xref="GeneID:11502474"
     CDS             835822..837885
                     /gene="TDEL0D04560"
                     /locus_tag="TDEL_0D04560"
                     /inference="similar to DNA sequence:INSDC:YDL025C"
                     /note="similar to Saccharomyces cerevisiae YDL025C;
                     ancestral locus Anc_3.167"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681251.1"
                     /db_xref="GeneID:11502474"
                     /db_xref="GOA:G8ZTU6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZTU6"
                     /translation="MPIHDQEANRLAPHDSGNSVNSSSSNSSIPSVFNKRKLMGFGKL
                     FGGKNHQDPKQSAGHSQNVRSYDKEHMNSGREFLGHLLSPKASNSSVNSNGKSQSPQT
                     RYTSQGQSKSAVVTPGSNNSSQSFFGDPALTAVTNPLSNHLHNPYNYTTMLSPSSSEL
                     SHMHPVEILQKQIEDHQSLTRSKNSSLSSVPKLATQNSEGLAEHQKKKKPLKLKRFFK
                     KIQPEPLAHTSTRERQEQKLKHEADEAAPSHGVFVRTDESKMTHKTIYETDNAKELIE
                     KYGVPGRKLGEGSSGSVSVVERTDGKMFAVKMFRLRNNAKQSQLAFSKKVTAEFCIGS
                     TLHHPNIIETLDMLQEGEAFLVVMEYVPYDFFTLVMSDLMTKNEVACYFKQICSGVHY
                     LHSMGLAHRDLKLDNCVVTDQGILKLIDFGSAVVFQYPYEPEIVQARGIVGSDPYLAP
                     ELLIQATYDPRPVDVWSIAITFYCMSLRRFPWKAPRKNYTSFKLFCEEPDNPRDTTKG
                     PFKILKLLPRSSRKLVGQMLRIDPKKRILMNDVMKDEWLQSIEVCEPNEDGTLDDGKP
                     RDHEHHLITEDELIELNKKRAAEAKAIREEKIKKVQDEKHNHEHSHDHLHGHSHGHNH
                     GHGHSHGHHHEHAHKHHHKDSSQDNSEAQSKDDTKPDSKTTDAPATGAEPVQISNPVL
                     KEENA"
     gene            complement(<838072..>839442)
                     /gene="TDEL0D04570"
                     /locus_tag="TDEL_0D04570"
                     /db_xref="GeneID:11502475"
     mRNA            complement(<838072..>839442)
                     /gene="TDEL0D04570"
                     /locus_tag="TDEL_0D04570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681204.1"
                     /db_xref="GeneID:11502475"
     CDS             complement(838072..839442)
                     /gene="TDEL0D04570"
                     /locus_tag="TDEL_0D04570"
                     /inference="similar to DNA sequence:INSDC:YOL061W"
                     /note="similar to Saccharomyces cerevisiae PRS5 (YOL061W);
                     ancestral locus Anc_3.166"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681252.1"
                     /db_xref="GeneID:11502475"
                     /db_xref="GOA:G8ZTU7"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:G8ZTU7"
                     /translation="MGDIVILGGNSHPELVKMICDNLGVHPSRVQLGKFSNGETSISV
                     SESVREKDVYVIQSGCGHVNDSFMELLILISACKTASASRVTAVMPYFCYSRQPDIPY
                     TAKGAPLISKVKESGAINGKEAQSPLNSTLMTHRPGEDSRFKSLDTAIRATANTMDQH
                     RSHSGTNLKNVASFSRIPMIPGGKEAGSARADAGELFNSQNAGYKLWVAQAGTLIANL
                     LTTAGADHVITMDLHDPQFQGFFDIPVDNLYCQPIAQNYIQHCIPNYKEAVVVSPDAG
                     GAKRATAIADSLKLSFALIHKERRSQLLKGPPTTTGLPMASKPLVTTFNSAEMHPSSS
                     NSKYVQTTMLVGDVRNKVCILVDDLVDTSYTITRAAKLLKDQGATKVYAIVTHGIFSG
                     DALSRISQSCIDKLIVSNSVPQQETIEYLGKENVDILDVSRVFAEAIRRIHNGESISM
                     LFEHGW"
     gene            <840369..>841817
                     /gene="TDEL0D04580"
                     /locus_tag="TDEL_0D04580"
                     /db_xref="GeneID:11502476"
     mRNA            <840369..>841817
                     /gene="TDEL0D04580"
                     /locus_tag="TDEL_0D04580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681205.1"
                     /db_xref="GeneID:11502476"
     CDS             840369..841817
                     /gene="TDEL0D04580"
                     /locus_tag="TDEL_0D04580"
                     /inference="similar to DNA sequence:INSDC:YOL062C"
                     /note="similar to Saccharomyces cerevisiae APM4 (YOL062C);
                     ancestral locus Anc_3.165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681253.1"
                     /db_xref="GeneID:11502476"
                     /db_xref="GOA:G8ZTU8"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:G8ZTU8"
                     /translation="MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRS
                     PILTLGSTTFHHIRSDGSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTL
                     KENFMNCYEILDTVLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLN
                     LSTPGDSSSTLSMPKFLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKI
                     SILVSRDGSILKSYVDGTIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKK
                     AIPKAAAGRVMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKV
                     TPIVTSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVP
                     EESAMIWKFTKYTGLTENTLSAVTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLV
                     VRYFKVSDKDERYRTAKWIKYISKSGSYEIRY"
     gene            <841954..>843084
                     /gene="TDEL0D04590"
                     /locus_tag="TDEL_0D04590"
                     /db_xref="GeneID:11502477"
     mRNA            <841954..>843084
                     /gene="TDEL0D04590"
                     /locus_tag="TDEL_0D04590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681206.1"
                     /db_xref="GeneID:11502477"
     CDS             841954..843084
                     /gene="TDEL0D04590"
                     /locus_tag="TDEL_0D04590"
                     /inference="similar to DNA sequence:INSDC:YDL027C"
                     /note="similar to Saccharomyces cerevisiae YDL027C;
                     ancestral locus Anc_3.164"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681254.1"
                     /db_xref="GeneID:11502477"
                     /db_xref="UniProtKB/TrEMBL:G8ZTU9"
                     /translation="MNANLQLRIRLGLNVLSPSRHSRAFSLLARPTLLDSPAKTTNPP
                     WVQRYRQVSACRSLTLTRHSPYVRPLSFVGNRLFHTTTPRYMPPYPNQPPFKVYRISP
                     IVAVLTGIGFLMLLFAVLPFIFTFFFPLIIAGICAYQFSKWKRKVLFQDILRHLKTST
                     MKVNYNTVKALHVKSLDKIVRLEQQNAKVFEDLLKSFDADLRARLDKFSSAKADKLLR
                     FIDDRLLEAIETNEQGIRNYFLGDDVGRWVEDNYQLELDTTQYKTNAQVGDGELIMLL
                     VFPLYLKSNSNPRKHLANVSLALLQGLFEGTNGANYLEFLSSISETDAECQMVIAVQP
                     VTNFSTKLFVISTDGRSGDWYSKYDSKEDSDGHTEYTVKSNN"
     gene            <843530..>845917
                     /gene="TDEL0D04600"
                     /locus_tag="TDEL_0D04600"
                     /db_xref="GeneID:11502478"
     mRNA            <843530..>845917
                     /gene="TDEL0D04600"
                     /locus_tag="TDEL_0D04600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681207.1"
                     /db_xref="GeneID:11502478"
     CDS             843530..845917
                     /gene="TDEL0D04600"
                     /locus_tag="TDEL_0D04600"
                     /inference="similar to DNA sequence:INSDC:YDL028C"
                     /note="similar to Saccharomyces cerevisiae MPS1 (YDL028C);
                     ancestral locus Anc_3.162"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681255.1"
                     /db_xref="GeneID:11502478"
                     /db_xref="GOA:G8ZTV0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZTV0"
                     /translation="MSEYLGIYPSSLERKKSHAAYKDDSDDEKITGPPKLSDFGVALL
                     MEKENMAPSMVRRGEPSPNSFKRELKTRFGPTNTDYFSGSNNQTSFSQTYVSANSGEP
                     SQSTIFAQSRFNQQPSMTTMDTNGIKIPASDLETSFGRIKSMQQNMREELTTRHAQRR
                     SRRFLHGTRIGVLGPAKRASSTNGADMSDLSIGNVQMVQQTDNTPLEEHREVQSPAEI
                     KPDLTKKETRTRDVLDYKSIDFGDMNPVQYLKLHNLSSSELPKLSKVYFERQREEIHQ
                     MALQKSISSREALTNKVQRSFSSISSSGNSIRRESSMPLYPRRKLSDTSVSSAAKTSF
                     QSSFSSPLAYPKKNFLIDQPVVTSKPAADHGKNLTKQYAQREQYTLESSFKKREALAN
                     IDINRNSQESLQQPKRFKPIRTQEQLSESHLPEPYVNKEEYLNREPPKPRATKRVEIL
                     EPKPSQGQSRKNVVKVNDVEYEKVELLGRGGSSKVYKVRDRSNNVYALKRVVFDEFDD
                     SSVSGFKGEIELLKKLENQNRVVQLVDHEMEHGVLYLIMECGDHDLSRILNHRAGMPL
                     DMEFVRYHAREMLRCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVN
                     IYRENQIGTPNYMAPEALVAMNYTQDDEKYQQQNRWKVGKPSDIWSCGCIIYQMIYGR
                     PPYGGFQGQNRLLAIMNPDVKIIFSDKTSRDETIPRSALDTMKACLTRNPDKRLTVDE
                     VLESNFLKPLMVTPFFIRDLIKNAVRYGADQKEVSKEKVEELADDVLSRLSDFRL"
     gene            complement(<846092..>847338)
                     /gene="TDEL0D04610"
                     /locus_tag="TDEL_0D04610"
                     /db_xref="GeneID:11502479"
     mRNA            complement(join(<846092..847245,847317..>847338))
                     /gene="TDEL0D04610"
                     /locus_tag="TDEL_0D04610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681208.1"
                     /db_xref="GeneID:11502479"
     CDS             complement(join(846092..847245,847317..847338))
                     /gene="TDEL0D04610"
                     /locus_tag="TDEL_0D04610"
                     /inference="similar to DNA sequence:INSDC:YDL029W"
                     /note="similar to Saccharomyces cerevisiae ARP2 (YDL029W);
                     ancestral locus Anc_3.161"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681256.1"
                     /db_xref="GeneID:11502479"
                     /db_xref="GOA:G8ZTV1"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="InterPro:IPR027306"
                     /db_xref="UniProtKB/TrEMBL:G8ZTV1"
                     /translation="MDPHNPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEER
                     ANVSTPLKDIMIGDEASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFDQMKLPTTS
                     NGKILLTEPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGD
                     GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEK
                     VCYVSYDLDLDTKLARETTTLVENYELPDGRVIKVGQERFEAPECLFQPSLVDVEQAG
                     VGELLFNTIQTADVDIRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDAS
                     RLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQESGPAAMAKFGPR"
     gene            complement(<847509..>849059)
                     /gene="TDEL0D04620"
                     /locus_tag="TDEL_0D04620"
                     /db_xref="GeneID:11502480"
     mRNA            complement(<847509..>849059)
                     /gene="TDEL0D04620"
                     /locus_tag="TDEL_0D04620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681209.1"
                     /db_xref="GeneID:11502480"
     CDS             complement(847509..849059)
                     /gene="TDEL0D04620"
                     /locus_tag="TDEL_0D04620"
                     /inference="similar to DNA sequence:INSDC:YDL030W"
                     /note="similar to Saccharomyces cerevisiae PRP9 (YDL030W);
                     ancestral locus Anc_3.160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681257.1"
                     /db_xref="GeneID:11502480"
                     /db_xref="GOA:G8ZTV2"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR024598"
                     /db_xref="UniProtKB/TrEMBL:G8ZTV2"
                     /translation="MNTLESRRSHLEDLEVIEQSIASRFERNPGLYYGYLQKRALIDD
                     IPLSSSITNAYNANRIYKAKRSKRNRKQFVLQQHEIDLFLQESMRKLRDLGSLKGPVN
                     THSLRDEEATFEIFKQNLEEIKDKYKDLGSDSLFSDVNEEISKHAMFSALTTDSKPVT
                     ILSRSAKNLRLNDVFSREEQYGEYLDLDRFHSSWLNVIRSTECTLLQFYSILEKFLDD
                     RQYILAPPMDRKNGRYAEFLVEISNYLEKFFQKANVLLNHTKLERRIQSEFSRSLATP
                     LHTGGKGFYCIACCKWFKVPTVFDSHLTGKHHKNNLSKRSKHLQAEYKLHRYLTLLSE
                     EFRRTREFTERKVAFTAEERMQEMARLNHDYHAPDYGPDEKEQEDPDSNKAELDKNSA
                     LGGSFDLPLGADGLPIPYWLYKLQGLDVEYSCEICTNQTYKGRRAFEKHFLEPTHTFH
                     LKCLGIEPSITFKGITGIQEAQDLWRQTSSRNRPQTQKKIDLEVEDQEGNVLTQKVYQ
                     ELKKQGLV"
     gene            complement(<849268..>852174)
                     /gene="TDEL0D04630"
                     /locus_tag="TDEL_0D04630"
                     /db_xref="GeneID:11502481"
     mRNA            complement(<849268..>852174)
                     /gene="TDEL0D04630"
                     /locus_tag="TDEL_0D04630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681210.1"
                     /db_xref="GeneID:11502481"
     CDS             complement(849268..852174)
                     /gene="TDEL0D04630"
                     /locus_tag="TDEL_0D04630"
                     /inference="similar to DNA sequence:INSDC:YDL031W"
                     /note="similar to Saccharomyces cerevisiae DBP10
                     (YDL031W); ancestral locus Anc_3.159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681258.1"
                     /db_xref="GeneID:11502481"
                     /db_xref="GOA:G8ZTV3"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012541"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZTV3"
                     /translation="MKVSGKRKLGDDASLSDGSESGSEEDYDIVNDIALNSSDSDEDD
                     SSEDSEGGEQDIIEYSDEEEEHQHEKKKSAPKDKSFPKLEASGDEAEDDADDVNEYFS
                     TTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLART
                     GSGKTAAFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLL
                     TGGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFE
                     EQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFL
                     STKHDEREAALLYLIQEVIQIPLATEEQIKLIKDKSPDSDEESDDDNGKRSHNKHKKE
                     KFKKVRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQ
                     LYNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWA
                     YSIISESELPYLLDLELFLGKKILTTPMYEAATDLLEKRWVEEGKEKILFKAPKPSYT
                     NRLVLGSCPRLDIDSMGDLYKNLMSSFELETLRGVAKKAEKLYLRTRTAASVESVKRS
                     RELMTSGWDEQNVMFGKNLEKEKLDFLAKLQDRTNKETVFEFARNADDETSMLMKKRR
                     FQVAPITEKAKKRKELLELQKAAGFSHAMEDELLNDNELIKESVPEEVLQEFEDADKL
                     LEDQEKLGRKKSKSFRDPNFFLSHYAPQGGLHENELNLTSGFTTDAAQAACDINGDDK
                     VQVHKQNATVKWDSKKKKYINSQGADNKKYIVGESGQKIPASFRSGKYAEWSKARNLQ
                     PIKVGARESPTAANMLRNPAQNHPTDGQRTVGGKFKHKQVKAPKLPDKHRDDYHKQKK
                     KVKEALDKGINVKGYNTRGAPKNELQSIAQIRKQRQTSEKKHAKNARPSKKRKY"
     gene            <852354..>853583
                     /gene="TDEL0D04640"
                     /locus_tag="TDEL_0D04640"
                     /db_xref="GeneID:11502482"
     mRNA            <852354..>853583
                     /gene="TDEL0D04640"
                     /locus_tag="TDEL_0D04640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681211.1"
                     /db_xref="GeneID:11502482"
     CDS             852354..853583
                     /gene="TDEL0D04640"
                     /locus_tag="TDEL_0D04640"
                     /inference="similar to DNA sequence:INSDC:YDL033C"
                     /note="similar to Saccharomyces cerevisiae SLM3 (YDL033C);
                     ancestral locus Anc_3.158"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681259.1"
                     /db_xref="GeneID:11502482"
                     /db_xref="GOA:G8ZTV4"
                     /db_xref="InterPro:IPR004506"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR023382"
                     /db_xref="UniProtKB/TrEMBL:G8ZTV4"
                     /translation="MLARWAKLVSDRQLLKYRPQRLPGKLDNVIIAMSSGVDSSVAAA
                     LFAGEYPNARGIYMQNWSKSQSLTDPKDDPCYERDWKDVVKVSEHLNLPVEKVNFEQD
                     YWIDVFEPMLEGYNKGWTPNPDISCNKFVKFGKLIQHLNSKYGNDNYWLVTGHYARIM
                     ESELDKEAHLLRSFYPQKDQSYYLSLVDPKILSRLLFPIGHLTKPEVRQLAKEIALPS
                     ANKPDSQGICFVNNSQHGKFKNFLEHYLVESKGDIVTLDQGKKRKWGEHKGLWSYTIG
                     QKIGLSMPQGDPKYAGTWYVSEKLQDSNELVIVHGSNNPALYKDTLQVQDFTIQGNKK
                     SLLKSLMHSAVLEGRLTMQYRSLQEPIPITAFDLSDKKVLNLKLTAKQRAMAPGQNCC
                     LYIGDRVLGSGTIREVA"
     gene            <853777..>854871
                     /gene="TDEL0D04650"
                     /locus_tag="TDEL_0D04650"
                     /db_xref="GeneID:11502483"
     mRNA            <853777..>854871
                     /gene="TDEL0D04650"
                     /locus_tag="TDEL_0D04650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681212.1"
                     /db_xref="GeneID:11502483"
     CDS             853777..854871
                     /gene="TDEL0D04650"
                     /locus_tag="TDEL_0D04650"
                     /inference="similar to DNA sequence:INSDC:YOL064C"
                     /note="similar to Saccharomyces cerevisiae MET22
                     (YOL064C); ancestral locus Anc_3.157"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681260.1"
                     /db_xref="GeneID:11502483"
                     /db_xref="GOA:G8ZTV5"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="InterPro:IPR006239"
                     /db_xref="InterPro:IPR020550"
                     /db_xref="InterPro:IPR020583"
                     /db_xref="UniProtKB/TrEMBL:G8ZTV5"
                     /translation="MGFEKELLVATQAVRKASLLTKRIQSEVIAHRNSTTITKSDNSP
                     VTVGDYAAQTIIINAIKTNFPNDKIVGEESSDGLENAFVSEILREIKENDEVFESKFA
                     GHQEKSLLVNETFPLETIQNVKTIIDYGDYEGGNKGRVWCLDPIDGTKGFLRGEQFAV
                     CLALIVDGTTQLGVIGCPNLSLEQYGGKDLPGYEPFGYIFRAVRGNGASYAPAAAATP
                     GTENIWQKAHARELTSTDGMVSLEGVEKSHSAHDEQSIIKEKLGIKKSLHLDSQVKYC
                     MLAAGLGDVYLRLPIKLEYQEKIWDHAAGNVIVEEAGGIHTDALQNVPLNFGQGRTLT
                     TKGVIASCGPTNLHKLVVSTSSDVMKAAKH"
     gene            <855339..>857882
                     /gene="TDEL0D04660"
                     /locus_tag="TDEL_0D04660"
                     /db_xref="GeneID:11502484"
     mRNA            <855339..>857882
                     /gene="TDEL0D04660"
                     /locus_tag="TDEL_0D04660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681213.1"
                     /db_xref="GeneID:11502484"
     CDS             855339..857882
                     /gene="TDEL0D04660"
                     /locus_tag="TDEL_0D04660"
                     /inference="similar to DNA sequence:INSDC:YDL035C"
                     /note="similar to Saccharomyces cerevisiae GPR1 (YDL035C);
                     ancestral locus Anc_3.156"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681261.1"
                     /db_xref="GeneID:11502484"
                     /db_xref="GOA:G8ZTV6"
                     /db_xref="InterPro:IPR017452"
                     /db_xref="InterPro:IPR022596"
                     /db_xref="InterPro:IPR023041"
                     /db_xref="UniProtKB/TrEMBL:G8ZTV6"
                     /translation="MVGEVLPAKVQVPHQLLDVNTTTVNQLLGLPGMFSTFVAKDLRG
                     LRILALTASSASIVACTASIFFLVNIDRRKRVFRHDLVFFLIICDLVKALVLMIYPLV
                     ILVRNDVYADPRFFNTLGWFTAYCVEGADLAIFFFAIHFALLIFLPSWKWRRSGSRKM
                     EGGLYGVRKYIWPITSLVPVLLASLAFINFQLLDFEELVNGTTVILDNDNYHVRYDAR
                     LGGYKPYSAWCYLPPYPVWYKLVLSWGPRYFIIIFILVLYISIYVFVKKESKRIKRHL
                     YDFRDQRAEEHIAELRAKSRWELLKIRLFRFLVKPFVQFLLNLKNFLSFSFDESSVPT
                     SGRNSMTSGGSFYATDEGASFDQVPNIRVSRALDRAGTPPGEDSFTNNESSQASKSGN
                     IQSGTLKENDDLDSHNNLHGHTPPIPGKLMPPNGNSHRFSRCISPIQTPSVHDNRAAE
                     NEHEGEVPQANKSDPRRASTTDVKHVQATFQKQTYATMKRRRAQIQKNLRSIFIYPFS
                     YIGIWIFPLIVDITQYRHEIIHGPIVWLIYIATLAQPLNGLVDTLVFVYREKPWRYSW
                     SEVQFRELLEAYSLRDKMGEQDIKELYHSELGKKGWYYCGRFDRLCCWKHKPQWWKRA
                     GWYVYRSLCGLIQNKYDFEDTCEDLPLDCNYDSKDSWTCFNLNKLRCEQHERQFSFPS
                     DSTTGSGPVQSRRGSDSNIDYVRVPTFWRFIHLLPMLKGIDLDELDRQLRQKAIDHDF
                     VLPGLHFALNKDTDGRHDLNRTYSKPIFKPEYSINNEKKAANKTQNGESARAHPASAH
                     VHLDVNADFGDTVKKEPAKYFEEGDTQSHGNESDKDRIGMLAFLNGPTN"
     gene            <858045..>859154
                     /gene="TDEL0D04670"
                     /locus_tag="TDEL_0D04670"
                     /db_xref="GeneID:11502485"
     mRNA            <858045..>859154
                     /gene="TDEL0D04670"
                     /locus_tag="TDEL_0D04670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681214.1"
                     /db_xref="GeneID:11502485"
     CDS             858045..859154
                     /gene="TDEL0D04670"
                     /locus_tag="TDEL_0D04670"
                     /inference="similar to DNA sequence:INSDC:YOL065C"
                     /note="similar to Saccharomyces cerevisiae INP54
                     (YOL065C); ancestral locus Anc_3.155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681262.1"
                     /db_xref="GeneID:11502485"
                     /db_xref="GOA:G8ZTV7"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:G8ZTV7"
                     /translation="MSNMWRVYVTTFNCAKKFPFEENEAKTAILNEIVPQALEHDIYV
                     FGFQELISTWEASFPKMIAPKIQDLVDLTLKFINRHASGKTFRAVGSTSTGAVGLIAF
                     ADEKIGLRKVSYSNLRCGLFNSSLKGSASLCCTLQGQNKEQETFTFICSHLNANEGPE
                     NAELRVSNYASIMSACATDFRLMPFKTSHIFFFGDLNFRVNGLQDTVTDFSNIENISK
                     VLTNHEELNKLRKEKLVFDGFDEGQISFSPTYKYQVSQEKEYDGRRTPSWCDRILFKQ
                     YPRDSFKILSYNSVSRTSHLQFTDHQAVTLDIKVPSMTSGTELKIPTTVPSSQQIFVG
                     DIADTLIGYVGWALTKNIHYGIIAALGLIIFYTLL"
     gene            <859334..>861190
                     /gene="TDEL0D04680"
                     /locus_tag="TDEL_0D04680"
                     /db_xref="GeneID:11502486"
     mRNA            <859334..>861190
                     /gene="TDEL0D04680"
                     /locus_tag="TDEL_0D04680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681215.1"
                     /db_xref="GeneID:11502486"
     CDS             859334..861190
                     /gene="TDEL0D04680"
                     /locus_tag="TDEL_0D04680"
                     /inference="similar to DNA sequence:INSDC:YDL036C,YOL066C"
                     /note="similar to Saccharomyces cerevisiae PUS9 (YDL036C)
                     and RIB2 (YOL066C); ancestral locus Anc_3.154"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681263.1"
                     /db_xref="GeneID:11502486"
                     /db_xref="GOA:G8ZTV8"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR006225"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:G8ZTV8"
                     /translation="MLIRFLRSLKPRYRPRMCSRNLSKVPSSSECNTSENGSEASSTF
                     DDHLQKELEHFKQVQEARAKRQKNKKPGRTTELRDEAGFKLRLADTNQKRHKQADPEY
                     EVIIDGPLRKLAPYYYTYMTFCKLRWRDRNLLEVFESEFRDREKSYYKKTIASGSVLL
                     NGEPANLDSIIRNGDLITHKIHRHEPPVTSKPIGTVYEDDDILVIDKPSGIPVHPTGR
                     YRFNTITKILEKQWGKAVHPINRLDRLTSGLMFIAKTPKGADEMSDQMKAREVSKEYV
                     ARVVGEFPVGELCVEEPLRSVEPRLGLNAVCRMEEEGAKHAKTIFNRVSFDGQTSIVK
                     CRPLTGRTHQIRVHLQFLGHPIANDPIYSNVKVWGPSLGKGYITDFKDIITELHEYGR
                     TKCAESWYEPNAQGEALLEEKCPVCETDLYSDPGPNDLDLWLHAYRYESLEVDPATNK
                     KNRSYRTQLPLWALEPHRKYMELALKEAAKCGPTTTAFSVGAVLVNGSETLSTGYSRE
                     LIGNTHAEQCALEKYFTQVGAREVPEGTVLYTTMEPCSFRLSGNEPCVHRILAQNGNI
                     KNVFVGVIEPDTFVKNNTSYDILLGQGIDYIQIPGYEEICKKLAFKGHESAH"
     gene            <861474..>863987
                     /gene="TDEL0D04690"
                     /locus_tag="TDEL_0D04690"
                     /db_xref="GeneID:11502487"
     mRNA            <861474..>863987
                     /gene="TDEL0D04690"
                     /locus_tag="TDEL_0D04690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681216.1"
                     /db_xref="GeneID:11502487"
     CDS             861474..863987
                     /gene="TDEL0D04690"
                     /locus_tag="TDEL_0D04690"
                     /inference="similar to DNA sequence:INSDC:YDL040C"
                     /note="similar to Saccharomyces cerevisiae NAT1 (YDL040C);
                     ancestral locus Anc_3.153"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681264.1"
                     /db_xref="GeneID:11502487"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR021183"
                     /db_xref="UniProtKB/TrEMBL:G8ZTV9"
                     /translation="MPVFGRSNEQTQFLEALKLYESKSYKKSIKILDGTLKKDSAFVD
                     ALALKGLDLLSLGEKSDAESYVKNALNKIEGTTASPICCHVLGIYMRTTKKYAESVKW
                     FQASLNNGSTNQQIYRDLATLQSQIGDLKGALVSRKKYWEAYLGYRANWTALAIAQDI
                     NGEHQQAVNTLSQFEKLVEGKLVKQRCTRHNECLMYKNEIMYRAAGNNKEKLQNVLKH
                     LNDIEPNVYDKYGLLEEKASIYMKLGELKEASKIYRTLIKRNPDDFRYYKLLEVALGV
                     QGHIPLRKALYEKLQSFYPRSEPPVFIPLTFIEDEKELSQKLKDYIIPQLQRGVPAAF
                     CNVKPLYQARASVVPSLLEQIVVDYSLTLDPTKEPLPYIWTCYYLAQHFLHLKQFQKS
                     QEFIDRAIKHTPTLVELYIFKGRVLKHLGLLEEAAETLEAGRKLDLQDRFINTKTVKY
                     YLRANNIEKATDIASLFTKNDDSVNGIKDLHLVEAAWFIIEQAEAYYRLYVTSSRKLQ
                     NLVTKAEELEAKEDPEVEALIRDIKIEEWETKKNQGLALKRFQAISKFYDQFEDDQLD
                     FHSYCMRKGTPRAYIDMLKWAKTIYTKPVYVRALKGAFKIYSKLHDNSKLTEEEDIFS
                     RISKLMKRHAKKAKKETSTINKGKNEEKKQVLAYPEADDEDVFGTDLLNTKEPLKAFS
                     ETFYSKYSEQVTELEKDYPLEFNFQYRSGKLALCLAALSKYTKYHGQKCGLAGAMAIT
                     LLLSTKDEASFDVIGKKVAIKGLESLFPELPSSEKDKEEFDWLNYFTENFNGHDLNAL
                     SFIYGYKNLFDSSKVKEMILQELANCEPFTQNAVLQYKL"
     gene            <864167..>864772
                     /gene="TDEL0D04700"
                     /locus_tag="TDEL_0D04700"
                     /db_xref="GeneID:11502488"
     mRNA            <864167..>864772
                     /gene="TDEL0D04700"
                     /locus_tag="TDEL_0D04700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681217.1"
                     /db_xref="GeneID:11502488"
     CDS             864167..864772
                     /gene="TDEL0D04700"
                     /locus_tag="TDEL_0D04700"
                     /inference="similar to DNA sequence:INSDC:YOL067C"
                     /note="similar to Saccharomyces cerevisiae RTG1 (YOL067C);
                     ancestral locus Anc_3.152"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681265.1"
                     /db_xref="GeneID:11502488"
                     /db_xref="GOA:G8ZTW0"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:G8ZTW0"
                     /translation="MRGSVSSSVTSTASNQLSRVDRKRRDNINDRIQQLLTMIPNEFF
                     QDYYKNSSCTDSEYGSGDTPSSATTPKPGTNAAKIKGTGTRDGKPNKGQILTQAVEYI
                     MSLQNEIDSKNREEVELILKVQDLSKITGTIVNDINLENTSAEMALAKIGVGSLAGEI
                     AQDDEQGQLDSQTALPANPQYANPKISNFEYGGYSEYGDGI"
     gene            <864988..>866646
                     /gene="TDEL0D04710"
                     /locus_tag="TDEL_0D04710"
                     /db_xref="GeneID:11502489"
     mRNA            <864988..>866646
                     /gene="TDEL0D04710"
                     /locus_tag="TDEL_0D04710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681218.1"
                     /db_xref="GeneID:11502489"
     CDS             864988..866646
                     /gene="TDEL0D04710"
                     /locus_tag="TDEL_0D04710"
                     /inference="similar to DNA sequence:INSDC:YDL042C,YOL068C"
                     /note="similar to Saccharomyces cerevisiae SIR2 (YDL042C)
                     and HST1 (YOL068C); ancestral locus Anc_3.151"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681266.1"
                     /db_xref="GeneID:11502489"
                     /db_xref="GOA:G8ZTW1"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR007654"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:G8ZTW1"
                     /translation="MSIPQAMSSHGILDNKRPFEGEDDAVSRGVSESHSQQVSSGTTV
                     DGNGVEGSKKPKLTENDEDMALEVPAKGDELQEVVNEYDTSGNQKILGDAEGLNGRSD
                     DDVLTPITPNRPVSIGKDRKTGKYIFSSITKDDSLNARMFLKYHGLRKFLDTYLPEEL
                     NSLYLYFLIKLLGFEIKDREMINAIHSYVESSPSPDADLTFTAVEDPLEKRHAVRLIK
                     DLQKAINKVLCTRLRLSNFSTVDTFVKRLQSAKKILVLTGAGVSTSLGIPDFRSSEGF
                     YSKIRHLGLDDPQDVFNYDIFMQDPSVFYNIAHMVLPPENLYSPLHSFIKMLQDKGKL
                     LRNYTQNIDNLESYAGIKEEKLVQCHGSFATASCITCHWRLPGEKIFSNIRNLELPLC
                     PYCYQKRREFFPHDNVSDGETDNANNNLINAAMKSYGVLKPDITFFGEALPSKFHKTI
                     REDILKCDLLICIGTSLKVAPVSDIVNMLPAHVPQVLINRDPVKHAEFDLNLLGFCDD
                     VATYVAQKCGWDIPHDKWDQLKKMNFDCKEDERGVYNVSALLPS"
     gene            <866844..>867605
                     /gene="TDEL0D04720"
                     /locus_tag="TDEL_0D04720"
                     /db_xref="GeneID:11502490"
     mRNA            <866844..>867605
                     /gene="TDEL0D04720"
                     /locus_tag="TDEL_0D04720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681219.1"
                     /db_xref="GeneID:11502490"
     CDS             866844..867605
                     /gene="TDEL0D04720"
                     /locus_tag="TDEL_0D04720"
                     /inference="similar to DNA sequence:INSDC:YDL043C"
                     /note="similar to Saccharomyces cerevisiae PRP11
                     (YDL043C); ancestral locus Anc_3.150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681267.1"
                     /db_xref="GeneID:11502490"
                     /db_xref="GOA:G8ZTW2"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8ZTW2"
                     /translation="MDYQNRAGSKKGAGGVASDAQADLARRKQVEDLLKGGEDIPYTF
                     QETNDQEEKLRKNPYIYKNHSGKLVCKLCNTMHVSWSSVERHLSGKKHGLNVLRRGNT
                     TSNGNGGSEYSAKNDRDREFHKEVETRRSALQNNGLVPKCSVVSVRDESTNSEGVAIR
                     VDYDEDGAIADESITPMIRIVSGLELQEAEKKDRKYLAIAYEPFEIVAIEIPSDRQIK
                     MDKLETIRDSVDEVNSKSTFWDPVHGKFYVQVFFE"
     gene            complement(<867639..>869009)
                     /gene="TDEL0D04730"
                     /locus_tag="TDEL_0D04730"
                     /db_xref="GeneID:11502491"
     mRNA            complement(<867639..>869009)
                     /gene="TDEL0D04730"
                     /locus_tag="TDEL_0D04730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681220.1"
                     /db_xref="GeneID:11502491"
     CDS             complement(867639..869009)
                     /gene="TDEL0D04730"
                     /locus_tag="TDEL_0D04730"
                     /inference="similar to DNA sequence:INSDC:YOL069W"
                     /note="similar to Saccharomyces cerevisiae NUF2 (YOL069W);
                     ancestral locus Anc_3.149"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681268.1"
                     /db_xref="GeneID:11502491"
                     /db_xref="GOA:G8ZTW3"
                     /db_xref="InterPro:IPR005549"
                     /db_xref="UniProtKB/TrEMBL:G8ZTW3"
                     /translation="MSADIFPLLDYSELAICLQSCDFSLATEENIARPTSQFVITLYK
                     QIIDSFMGISSDALLKKGQEHINDATEYEEENEEAFYSESLQVLVLNKICYKFFQNIG
                     VSDFNMMDLYRPDTQRTKRLLSAVVNYARFREERMFDCNRFISQTEALLGQLRSKFDE
                     YNLLQQQMKRYEEEEKQIDEVGVQSNGDELEALESNNRSIETQLKKLTQIQETLSIDY
                     NNYKEQKQRMLKELETLGFQIVELDSQWEKLEKYAESNMDELERSIEELGMLLEAKQQ
                     KLSQLEHSQENLRTSAQTFQRVIEELYGILQIVSVEIQNSHRKEEGLVELKRQLALRH
                     SKVENILTSWVMVKLSILEEQLEMTKKQLTELTESSKNNHEANAQHFLSLQQKYTEQI
                     MPEIQEAEMHIEKDLMVGEVKKLEGKMHRLQVEFQQEVEAIDMEYSLLAGHMNKYLEV
                     MLEKMN"
     gene            <869648..>871357
                     /gene="TDEL0D04740"
                     /locus_tag="TDEL_0D04740"
                     /db_xref="GeneID:11502492"
     mRNA            <869648..>871357
                     /gene="TDEL0D04740"
                     /locus_tag="TDEL_0D04740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681221.1"
                     /db_xref="GeneID:11502492"
     CDS             869648..871357
                     /gene="TDEL0D04740"
                     /locus_tag="TDEL_0D04740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681269.1"
                     /db_xref="GeneID:11502492"
                     /db_xref="GOA:G8ZTW4"
                     /db_xref="InterPro:IPR020946"
                     /db_xref="UniProtKB/TrEMBL:G8ZTW4"
                     /translation="MIRKVAVIGGGPAGLTTVYNSIKVNKDSENSFICVGFEARSKLG
                     GVWSDTPGANLDTFPSTFDQLRFLQDERIAGDPRALFYEGSPLIGANYRQINLGSLTG
                     SSPSKTIKVAKKARLARDGIFFTDKTGLYDNFMSNVPEDLMRYEDDTRDYKKDIAPRN
                     SAISPLVDLPTITTHLKNFILENKLEEHYRLNTSIEYVDKMGPDKWIVVAKKSDPNKD
                     HDDWYLESFDAVVVANGHFQIPYVPYYMSSPGREGNSGIHQFNQKFPGKLVHVRDIDL
                     WYRRELPNYEGKSHHRRIVLVGKSFSCMDVLKRIIHLQKSGSLEIFISTDIPPMPENK
                     ANPFYWFDEWLVKTNRVTLKPEILSFTSESNKPTLTFTDGTQIKVVDHVIFATGYLYS
                     YPFMSQVLMEQRKIFVTPDPRNVDHRPSNISRVTGLYLHTFSIAEPTLAFPGVSSNAN
                     FQSFHISAKAIVGAFSSFNQLFKKCEPTDYPYYDSIWHQILPSINDQLEWSRKRLAET
                     GNNGSYHFYYPLPLLKEGWERPCEELFPQGQDSKHLFPSDAPKLSKDGITRLKDIFLE
                     VME"
     gene            <871611..>873230
                     /gene="TDEL0D04750"
                     /locus_tag="TDEL_0D04750"
                     /db_xref="GeneID:11502493"
     mRNA            <871611..>873230
                     /gene="TDEL0D04750"
                     /locus_tag="TDEL_0D04750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681222.1"
                     /db_xref="GeneID:11502493"
     CDS             871611..873230
                     /gene="TDEL0D04750"
                     /locus_tag="TDEL_0D04750"
                     /inference="similar to DNA sequence:INSDC:YOL070C"
                     /note="similar to Saccharomyces cerevisiae YOL070C;
                     ancestral locus Anc_3.148"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681270.1"
                     /db_xref="GeneID:11502493"
                     /db_xref="UniProtKB/TrEMBL:G8ZTW5"
                     /translation="MPKEGSTNVALSTQRLSAMIDSLQREDVDEQLLRIAKPKTSEYP
                     SQPEAINFTPPKVTQRSPSKLYRSPAGLVSLDSADNRTSMISDYSGVEMEGVGVSYIV
                     QNQNKSKSNQDLPNLPALPSVETLKTFADVSDAKRISSGSDDLVVKAVANAKAVARMV
                     STSSKVSATSEYSERNPEAVGTAVESLRLLSINKRHMAPSSVGSGNLASESGSSYYNH
                     ARDEEAETFLLNNDETKSPVTKVSNPHSGSSDNISVATSIVPPLWTTVTGNQEGEKPS
                     RSETSSFNPTIPPRNKNRPRSRLFIRDTLDEIEQQLREQIRDPIEEQEAPETVTRTSS
                     TTNHSDAYFSATSYQDDDKDIHEILKDSNNSKDVEYLERPLPNVPSPLRRDSTIRIQE
                     SQVKSNGKEDSTVVLDEDEQYEDLDETEQQISDGSSNRTPVKGNPTHVSKSKSSNGKA
                     SHKKKTGKKKRQELRSFDIDTLSQLLNFTKGTLIGSEFTNLGMNIEEKRALERLVDSL
                     SRLTADMVLDPDRYEEGLRRLDKATKALEGF"
     gene            <873448..>874737
                     /gene="TDEL0D04760"
                     /locus_tag="TDEL_0D04760"
                     /db_xref="GeneID:11502494"
     mRNA            <873448..>874737
                     /gene="TDEL0D04760"
                     /locus_tag="TDEL_0D04760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681223.1"
                     /db_xref="GeneID:11502494"
     CDS             873448..874737
                     /gene="TDEL0D04760"
                     /locus_tag="TDEL_0D04760"
                     /inference="similar to DNA sequence:INSDC:YDL044C"
                     /note="similar to Saccharomyces cerevisiae MTF2 (YDL044C);
                     ancestral locus Anc_3.147"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681271.1"
                     /db_xref="GeneID:11502494"
                     /db_xref="UniProtKB/TrEMBL:G8ZTW6"
                     /translation="MLRFTRLLKHRKVYGRAIYSVKAPNTKDTSSTQNVQFKDEGDLA
                     SVQERALFGAVFNKLMKREEIRKKSGGEILSHATSIVPGENNDHNDDDSRGLQVVFEK
                     KNQEIRPEDRKLFDFFKNTSGSSQLGDIGESAKLTTDDIRNYPVSLISSIFSEKDHKQ
                     MPGSEKASKILTDDKVTALLDKVAGVESSLNLKMNKEVLETLEAKERLNAAINGAMEK
                     YLADLHSQIETDYDFLALVKRFLNMYVNRDTILDNNDLKSSAEIVSHIKNQLSFNSKD
                     LPRPYGVTLPFTLVKLLTSKELNFPSERKYALASYIYQECKNSNDISLYLNVCNVDFY
                     NLLLQLSWDNFREVYQLKQLTTEMSINGIRGDIYTVEILGKIAHELRHINDGIVDEDT
                     GIIEGNPLTVGVVWCRENSVDLLLLENYLKKLKESLA"
     gene            <874943..>875866
                     /gene="TDEL0D04770"
                     /locus_tag="TDEL_0D04770"
                     /db_xref="GeneID:11502495"
     mRNA            <874943..>875866
                     /gene="TDEL0D04770"
                     /locus_tag="TDEL_0D04770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681224.1"
                     /db_xref="GeneID:11502495"
     CDS             874943..875866
                     /gene="TDEL0D04770"
                     /locus_tag="TDEL_0D04770"
                     /inference="similar to DNA sequence:INSDC:YDL045C"
                     /note="similar to Saccharomyces cerevisiae FAD1 (YDL045C);
                     ancestral locus Anc_3.146"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681272.1"
                     /db_xref="GeneID:11502495"
                     /db_xref="GOA:G8ZTW7"
                     /db_xref="InterPro:IPR002500"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G8ZTW7"
                     /translation="MDLGQIAQYCYNLTTSYLRIENATSVISETQDAIKLTRRCFLDD
                     IFPTWSPLNSEISFSYNGGKDCQALLLLYLSCIWEFFLLTLEHSLYDPKYHAFPLKEL
                     PTVFIDHEQTFSTLEEFVATSSKRYCLSLYESGRDNERDTSMADAFKKYLEVHPEMKA
                     FVIGIRHTDPYAANLKAIQRTDANWPDFVRLQPFLHWKLANVWSFLIYSNEPICGLYG
                     LGLTSIGSINNTLPNPHLKVDQDDKPNLMFQWEIEHAFSDSKDASGEAVNVSTVNAAD
                     LKLLNQPQDRYLPGWYLTDDSLERAGRIKKE"
     gene            complement(<875937..>876224)
                     /gene="TDEL0D04780"
                     /locus_tag="TDEL_0D04780"
                     /db_xref="GeneID:11502496"
     mRNA            complement(<875937..>876224)
                     /gene="TDEL0D04780"
                     /locus_tag="TDEL_0D04780"
                     /product="mitochondrial 37S ribosomal protein YmS-T"
                     /transcript_id="XM_003681225.1"
                     /db_xref="GeneID:11502496"
     CDS             complement(875937..876224)
                     /gene="TDEL0D04780"
                     /locus_tag="TDEL_0D04780"
                     /inference="similar to DNA sequence:INSDC:YDL045W-A"
                     /note="similar to Saccharomyces cerevisiae MRP10
                     (YDL045W-A); ancestral locus Anc_3.145"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein YmS-T"
                     /protein_id="XP_003681273.1"
                     /db_xref="GeneID:11502496"
                     /db_xref="InterPro:IPR017264"
                     /db_xref="UniProtKB/TrEMBL:G8ZTW8"
                     /translation="MSGKPPIHRLPPLPRLKVKKPIITQEANKCLVLMSNLLQCWSSN
                     GHMNTVCENLAKELKVCTAERALGKGNKVEKSNINYHAARLYDRISGKPHD"
     gene            complement(<876408..>876899)
                     /gene="TDEL0D04790"
                     /locus_tag="TDEL_0D04790"
                     /db_xref="GeneID:11502497"
     mRNA            complement(<876408..>876899)
                     /gene="TDEL0D04790"
                     /locus_tag="TDEL_0D04790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681226.1"
                     /db_xref="GeneID:11502497"
     CDS             complement(876408..876899)
                     /gene="TDEL0D04790"
                     /locus_tag="TDEL_0D04790"
                     /inference="similar to DNA sequence:INSDC:YOL071W"
                     /note="similar to Saccharomyces cerevisiae EMI5 (YOL071W);
                     ancestral locus Anc_3.144"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681274.1"
                     /db_xref="GeneID:11502497"
                     /db_xref="GOA:G8ZTW9"
                     /db_xref="InterPro:IPR005631"
                     /db_xref="InterPro:IPR028882"
                     /db_xref="UniProtKB/TrEMBL:G8ZTW9"
                     /translation="MLRTISTRLSLRYSTARPTSVAFVPRLGVSYYSSGEKPAEEDDV
                     FLRIKVQPIERKGESIDKKRARLIYQSRKRGILETDLLLSRFAAKYLKDMSLKELEEY
                     DSLLNELDWDIYYWATKNFDTSPLPKKWENSKLLEKLQDFSQNKEKEILRMPDLKNYW
                     LKE"
     gene            complement(<877065..>877619)
                     /gene="TDEL0D04800"
                     /locus_tag="TDEL_0D04800"
                     /db_xref="GeneID:11502498"
     mRNA            complement(<877065..>877619)
                     /gene="TDEL0D04800"
                     /locus_tag="TDEL_0D04800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681227.1"
                     /db_xref="GeneID:11502498"
     CDS             complement(877065..877619)
                     /gene="TDEL0D04800"
                     /locus_tag="TDEL_0D04800"
                     /inference="similar to DNA sequence:INSDC:YDL046W"
                     /note="similar to Saccharomyces cerevisiae NPC2 (YDL046W);
                     ancestral locus Anc_3.143"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681275.1"
                     /db_xref="GeneID:11502498"
                     /db_xref="InterPro:IPR003172"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:G8ZTX0"
                     /translation="MRSVPLVLNGLCLLATGALGGLVNFFPAPPSNNKPIPGGSPVSQ
                     CDVSESQLLELSSLHLTPNPPVRGKNVTITAVGDLLDEVDEGAYVDVEVRLGYIKLLT
                     QTFDLCETLEDNDVGGLTCPLSAGHYSVQKEVEIPAEVPPGKYVVLARAYNVDDELIT
                     CLTGEIVFPSTGGAQLSKLRHKLY"
     gene            complement(<877998..>878933)
                     /gene="TDEL0D04810"
                     /locus_tag="TDEL_0D04810"
                     /db_xref="GeneID:11502499"
     mRNA            complement(<877998..>878933)
                     /gene="TDEL0D04810"
                     /locus_tag="TDEL_0D04810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681228.1"
                     /db_xref="GeneID:11502499"
     CDS             complement(877998..878933)
                     /gene="TDEL0D04810"
                     /locus_tag="TDEL_0D04810"
                     /inference="similar to DNA sequence:INSDC:YDL047W"
                     /note="similar to Saccharomyces cerevisiae SIT4 (YDL047W);
                     ancestral locus Anc_3.142"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681276.1"
                     /db_xref="GeneID:11502499"
                     /db_xref="GOA:G8ZTX1"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8ZTX1"
                     /translation="MVEKGPDEWLERIKNCQSLTENEMKQLCEMVKELLMEESNIQPV
                     QTPVTVCGDIHGQFHDLLELFRTAGGFPDHINYIFLGDYVDRGYYSLETFTLLMCLKV
                     KYSSRITLVRGNHESRQITQVYGFYEECLNKYGSTTVWKYCCQVFDFLTLAAIIDGRI
                     LCVHGGLSPEIRMLDQIRVLSRAQEVPHEGGFSDLLWSDPDNVEAWQVSPRGAGWLFG
                     SKVAREFNHVNGLNLIARAHQLVMEGFKYHFPEKDVVTVWSAPNYCYRCGNVASVMKV
                     EEDLEPTFKIFSAVPDDYIQETAANHNNQRGGYFL"
     gene            complement(<879279..>880688)
                     /gene="TDEL0D04820"
                     /locus_tag="TDEL_0D04820"
                     /db_xref="GeneID:11502500"
     mRNA            complement(<879279..>880688)
                     /gene="TDEL0D04820"
                     /locus_tag="TDEL_0D04820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681229.1"
                     /db_xref="GeneID:11502500"
     CDS             complement(879279..880688)
                     /gene="TDEL0D04820"
                     /locus_tag="TDEL_0D04820"
                     /inference="similar to DNA sequence:INSDC:YOL072W"
                     /note="similar to Saccharomyces cerevisiae THP1 (YOL072W);
                     ancestral locus Anc_3.141"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681277.1"
                     /db_xref="GeneID:11502500"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="UniProtKB/TrEMBL:G8ZTX2"
                     /translation="MMDYSLQQLFQDVRNGNYEVLSANLNQNGHRIAALQRELHADSR
                     LVDDKSLKVSIESQNFQFSGKSWTRFTMMLVSFLQYCRDVNPWSTWESCDLIFKFYQD
                     LSNCLLNDNYPTDCLVPLFMEMTEYVVPISIELDVNYMALKTDKNQFVSHTSSIISKV
                     FNSVKPSRSADDDDQERPTSSLPEKQRILLYLVNKLVNLYFRIQAPQLCSNIFKNFKP
                     KSMASSFRTYPIKQQIEYRYLLGRYYLLNHRVTNAFVQLSTAFNELVSITSTTDAPQV
                     GRNLSRILRYLVPAGLIMGKIPRFDFISVMDSELSSKYSVLYQCIRSGKISGLNHWLK
                     NHERQLCEEHLLLLLLEKLPMICYRNLVKTVLLNFVIPQNTGKLPYATLETAMKLSIG
                     DTHIKGIDIYSSIHSPANVENVLVTLINLGLLRGNCFPELSLCVVKKTQVICDILPLV
                     QDRIVANFPLNPEDSWLDD"
     gene            <880842..>881939
                     /gene="TDEL0D04830"
                     /locus_tag="TDEL_0D04830"
                     /db_xref="GeneID:11502501"
     mRNA            <880842..>881939
                     /gene="TDEL0D04830"
                     /locus_tag="TDEL_0D04830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681230.1"
                     /db_xref="GeneID:11502501"
     CDS             880842..881939
                     /gene="TDEL0D04830"
                     /locus_tag="TDEL_0D04830"
                     /inference="similar to DNA sequence:INSDC:YGR072W"
                     /note="similar to Saccharomyces cerevisiae UPF3 (YGR072W);
                     ancestral locus Anc_3.140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681278.1"
                     /db_xref="GeneID:11502501"
                     /db_xref="GOA:G8ZTX3"
                     /db_xref="InterPro:IPR005120"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8ZTX3"
                     /translation="MDDKRSKSLRPASQSSCSNHSKAAEAFPLETKGQSKSSRKQNVE
                     RNKTGKGRRRDRGKKNDDVGVKLVLRLLPPDLSQDQFLETIKPEVGEFSDCGVLEWYY
                     VRGHYPQKLSTRPVYSRCYLIFESTESLAEFTKKVQPIKFVDDKDNATNVVTRVSTYV
                     KRFVPNTVDPSPVSAALEGTITEDPLFLTFMKSLKILEEKKSDYSFADVSILKPLEKE
                     VAKQKAVESEIQRKTENALIALTGDSGKKKKKEKKKGKKKELKPKEEAGGESTSGRKR
                     KGTKKKNKALKGGEHAAKDTVKNNNIVILEAAGRKELQRRKKMQLEKEKALESPSKAK
                     IKPKQRAKGKSEDSEDGTKLKMLKRKVPEQS"
     gene            complement(<881957..>882613)
                     /gene="TDEL0D04840"
                     /locus_tag="TDEL_0D04840"
                     /db_xref="GeneID:11502502"
     mRNA            complement(<881957..>882613)
                     /gene="TDEL0D04840"
                     /locus_tag="TDEL_0D04840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681231.1"
                     /db_xref="GeneID:11502502"
     CDS             complement(881957..882613)
                     /gene="TDEL0D04840"
                     /locus_tag="TDEL_0D04840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681279.1"
                     /db_xref="GeneID:11502502"
                     /db_xref="GOA:G8ZTX4"
                     /db_xref="InterPro:IPR007248"
                     /db_xref="UniProtKB/TrEMBL:G8ZTX4"
                     /translation="MTQPKTQSLVKTYNRLLLRHPLLVKSITGASLSSLGELISQWAA
                     IVIQKDESKDEKQHQRKSLLHTLKRLICEPKLLKIFIMFCYGGLINAPINHFMYRYIT
                     QITNAHIRSPKARQLTQLLAALSIVSPTQVFFLISTLTVVNTNTRLQGNILTIWPHIQ
                     RNLKAQYAKILTSSCLTSTFLVSFAQKFIEPEKWSVFFSFAYVVLGTGQNIYLKLKDN
                     "
     gene            <883029..>883481
                     /gene="TDEL0D04850"
                     /locus_tag="TDEL_0D04850"
                     /db_xref="GeneID:11502503"
     mRNA            <883029..>883481
                     /gene="TDEL0D04850"
                     /locus_tag="TDEL_0D04850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681232.1"
                     /db_xref="GeneID:11502503"
     CDS             883029..883481
                     /gene="TDEL0D04850"
                     /locus_tag="TDEL_0D04850"
                     /inference="similar to DNA sequence:INSDC:YGR074W"
                     /note="similar to Saccharomyces cerevisiae SMD1 (YGR074W);
                     ancestral locus Anc_3.139"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681280.1"
                     /db_xref="GeneID:11502503"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:G8ZTX5"
                     /translation="MKLVYFLKKLRNEQVTVELKNGTTVWGTLQTVSPQMNVTLTDVQ
                     LSLPRSTFNNAGSNALAGVYLADGQTSTNSAGGGMAKTTTSLQYINIRGNTIRQIILP
                     DSLNLDALLVDEDQLKKLRRSGKITNDSNKKRRADFVSNPSKRIRRGI"
     gene            complement(<883478..>884146)
                     /gene="TDEL0D04860"
                     /locus_tag="TDEL_0D04860"
                     /db_xref="GeneID:11502504"
     mRNA            complement(<883478..>884146)
                     /gene="TDEL0D04860"
                     /locus_tag="TDEL_0D04860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681233.1"
                     /db_xref="GeneID:11502504"
     CDS             complement(883478..884146)
                     /gene="TDEL0D04860"
                     /locus_tag="TDEL_0D04860"
                     /inference="similar to DNA sequence:INSDC:YGR075C"
                     /note="similar to Saccharomyces cerevisiae PRP38
                     (YGR075C); ancestral locus Anc_3.138"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681281.1"
                     /db_xref="GeneID:11502504"
                     /db_xref="InterPro:IPR005037"
                     /db_xref="UniProtKB/TrEMBL:G8ZTX6"
                     /translation="MSREFYVESYLSTKELNNQSVSLVIPRLTRDRIHNVIYYKANLH
                     TVALRGDTMKQLCKVIIRDLGTLQSTSINRKNVLGGVEFKCILMKLVEIRPTWDQLAL
                     LLRNPHPSYNNKYVIALVLTYLRVQYFYLKNDDILAQNIKGAFKEYICDYRKMKSVSL
                     EMDCWSASQNVTVEIIHMDELVDWLTTKDEIWGIPLGRCQWCSSLDLDVDSSDSDEES
                     SDSD"
     gene            complement(<884302..>884766)
                     /gene="TDEL0D04870"
                     /locus_tag="TDEL_0D04870"
                     /db_xref="GeneID:11502505"
     mRNA            complement(<884302..>884766)
                     /gene="TDEL0D04870"
                     /locus_tag="TDEL_0D04870"
                     /product="mitochondrial 54S ribosomal protein YmL25"
                     /transcript_id="XM_003681234.1"
                     /db_xref="GeneID:11502505"
     CDS             complement(884302..884766)
                     /gene="TDEL0D04870"
                     /locus_tag="TDEL_0D04870"
                     /inference="similar to DNA sequence:INSDC:YGR076C"
                     /note="similar to Saccharomyces cerevisiae MRPL25
                     (YGR076C); ancestral locus Anc_3.137"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL25"
                     /protein_id="XP_003681282.1"
                     /db_xref="GeneID:11502505"
                     /db_xref="UniProtKB/TrEMBL:G8ZTX7"
                     /translation="MSTKHLFDQLPAQLKNFFKKYPPSIKFADKPVSTHAIEANPFLP
                     NKHPVTGRYHEPKYSLRRSSDLYKMAYLYGVQNMLPPMKKKFFEEKYENKKMMKGVLL
                     PKGHKHELQREGKIAKMQEAIKNADKFIIDAKGAKYMRKLEEKKKANAKTWF"
     gene            complement(<884906..>886639)
                     /gene="TDEL0D04880"
                     /locus_tag="TDEL_0D04880"
                     /db_xref="GeneID:11502506"
     mRNA            complement(<884906..>886639)
                     /gene="TDEL0D04880"
                     /locus_tag="TDEL_0D04880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681235.1"
                     /db_xref="GeneID:11502506"
     CDS             complement(884906..886639)
                     /gene="TDEL0D04880"
                     /locus_tag="TDEL_0D04880"
                     /inference="similar to DNA sequence:INSDC:YGR077C"
                     /note="similar to Saccharomyces cerevisiae PEX8 (YGR077C);
                     ancestral locus Anc_3.136"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681283.1"
                     /db_xref="GeneID:11502506"
                     /db_xref="UniProtKB/TrEMBL:G8ZTX8"
                     /translation="MSKSLDMADQAIDHLLNVLNSRKTPLSPTISNNLVYYIPRVKSA
                     PKLTRLINATFQETNRPDSDFIELFEMAQAIAQWKLQISEPIIPPAQFFKIWDSCFVT
                     CQLWTGPKLAILAGILSTRDSFISIQSDNFIDETGHIGKLYDKWEQSIFIPTWCALLK
                     NFKKDPGELILLYSAISKPSDGAKYLYLPWDLITLYLSHMFSDFMVDQAHCPQFFAKH
                     LSQMAKTLQTSLANGSITSVNNFLTQVCRSSYNMNFKELNSLTADKDYASKHYSGILF
                     TIVISINSILQTVPEIPIIWYSQVLMTLLNINFIATDVGVVGFDSYESVYEILCSGIT
                     MTVKPDTYYSVARTMRDNVWVNQSYQNKVNKSKLLFLLNFLGSTLCHVSMISSNFIST
                     FIEPLKKTYVTSAEEEIRESVHIMMLSLFTNNSSANNLLHWQARHYLDHIELSTDQFM
                     LGNISEKQLTMIYQEMSSRLPSLQTIDRHLAREVLHRTYLRILNCSSGERTKQAVLLK
                     CIVYQLAYLSENHFVGWLDTVQELLSSIPFSKEECDDILTTLWNFLSHRRSDTALKWW
                     YGHLDTLRSRL"
     gene            <886783..>887652
                     /gene="TDEL0D04890"
                     /locus_tag="TDEL_0D04890"
                     /db_xref="GeneID:11502507"
     mRNA            <886783..>887652
                     /gene="TDEL0D04890"
                     /locus_tag="TDEL_0D04890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681236.1"
                     /db_xref="GeneID:11502507"
     CDS             886783..887652
                     /gene="TDEL0D04890"
                     /locus_tag="TDEL_0D04890"
                     /inference="similar to DNA sequence:INSDC:YOL073C"
                     /note="similar to Saccharomyces cerevisiae YOL073C;
                     ancestral locus Anc_3.135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681284.1"
                     /db_xref="GeneID:11502507"
                     /db_xref="UniProtKB/TrEMBL:G8ZTX9"
                     /translation="MSMETPTGLYQFPVTKLCMVSTVAVAFAASVANCKYIFLARYDP
                     FISEYRQYSRYLLFQLGCVNETDVALIVLLWYQFRNLERFMGSYKYISVLFVALIYTT
                     VSLAGLNLLLNILLPGKIWNSLCTGSLPLILAMFHFYKEYTPQIYEFDILLTQPWSKS
                     INKKQRKWKLNDQFLVNGLVVMLLLNQGFAGIGCGFISWICGIFLDKGLFPGVDRWRL
                     PFIKKLLVTDGNSNPSTEALDGSSQDEDRDRSTDADAGAAHENESFPVDDEAGNDEPA
                     RPLGVQFLDTFRR"
     gene            complement(<887671..>888240)
                     /gene="TDEL0D04900"
                     /locus_tag="TDEL_0D04900"
                     /db_xref="GeneID:11502508"
     mRNA            complement(<887671..>888240)
                     /gene="TDEL0D04900"
                     /locus_tag="TDEL_0D04900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003681237.1"
                     /db_xref="GeneID:11502508"
     CDS             complement(887671..888240)
                     /gene="TDEL0D04900"
                     /locus_tag="TDEL_0D04900"
                     /inference="similar to DNA sequence:INSDC:YGR078C"
                     /note="similar to Saccharomyces cerevisiae PAC10
                     (YGR078C); ancestral locus Anc_3.134"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003681285.1"
                     /db_xref="GeneID:11502508"
                     /db_xref="GOA:G8ZTY0"