GenomeNet

Database: RefSeq
Entry: NC_016507
LinkDB: NC_016507
Original site: NC_016507 
LOCUS       NC_016507             946563 bp    DNA     linear   CON 03-APR-2018
DEFINITION  Torulaspora delbrueckii CBS 1146 chromosome 7, complete genome.
ACCESSION   NC_016507
VERSION     NC_016507.1
DBLINK      BioProject: PRJNA79345
            BioSample: SAMEA2272433
            Assembly: GCF_000243375.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Torulaspora delbrueckii (Candida colliculosa)
  ORGANISM  Torulaspora delbrueckii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Torulaspora.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 946563)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 946563)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-DEC-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE616748.
            Accession numbers for all the chromosomes in this genome project:
            HE616742-HE616749.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..946563
                     /organism="Torulaspora delbrueckii"
                     /mol_type="genomic DNA"
                     /strain="type strain:CBS 1146"
                     /db_xref="taxon:4950"
                     /chromosome="7"
     gene            1647..1719
                     /gene="TDEL0Gtrna8T"
                     /locus_tag="TDEL_0Gtrna8T"
                     /db_xref="GeneID:11505339"
     tRNA            1647..1719
                     /gene="TDEL0Gtrna8T"
                     /locus_tag="TDEL_0Gtrna8T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:11505339"
     gene            6065..6138
                     /gene="TDEL0Gtrna4V"
                     /locus_tag="TDEL_0Gtrna4V"
                     /db_xref="GeneID:11505336"
     tRNA            6065..6138
                     /gene="TDEL0Gtrna4V"
                     /locus_tag="TDEL_0Gtrna4V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:11505336"
     gene            complement(<9857..>12145)
                     /gene="TDEL0G00100"
                     /locus_tag="TDEL_0G00100"
                     /db_xref="GeneID:11505325"
     mRNA            complement(<9857..>12145)
                     /gene="TDEL0G00100"
                     /locus_tag="TDEL_0G00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682540.1"
                     /db_xref="GeneID:11505325"
     CDS             complement(9857..12145)
                     /gene="TDEL0G00100"
                     /locus_tag="TDEL_0G00100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682588.1"
                     /db_xref="GeneID:11505325"
                     /db_xref="InterPro:IPR018789"
                     /db_xref="UniProtKB/TrEMBL:G8ZYA2"
                     /translation="MLSYLLLCLLGVASAASDNTYETDFYSNNGDSALVRRTSSAVSG
                     VTNMCPNLNFKWHAKNTNTMPYYMDLLSVDWVGDNTYELSINVKGDQQIDMKYLYSLK
                     IIGINGPMGTKQLWGKNENTYIIDNPTDFTTKIQVYGQKYNGDECKVAMPSFQIQYEY
                     LQGDAAQYWQTWKWGATAFDLMTGCNADNNGNSNADFPLWYWDNAKCSTSSTSSTSST
                     SSTSSTSSTSSVPASTTKEPASSVSILTTSAPSKSTSSVPSASSSATSVPISTSSPSS
                     TSSSSASSSTTSVPASTTREPASWISSVPSNSASISSAHSSASSSSSVPGSTTKTLQP
                     TSSKSLVSSNSRSSAASSTSSSSTLSAPSSSTSSAPSNPASSSTTSVPASTTKQPASW
                     ISSAPSSSASSTPSSSASSSTTSVPASTTKQPASWTSSPPSSSASSAPSSSASSSTTS
                     VPASTTKQPASWISSAPSSSASSAPSSSASSALSGSASSSTTSVPSTSIASGSTFLVA
                     STSTSVLPSYTSVMETTSTVVVSIRSCSGLSSCTLVPPNSTPLVSSDSAPFVTCSRSD
                     STDSTQNSATFVPRSPVTLTPSPASSGSIGIQSQVECEACAQSSEVSQLPETSTDTGV
                     SVTSSSEGTTATVTKVRSHRTTTLSIPGSHIAPTESLSSVASTINYGETLSSNPSSTH
                     ASATTNQQLSGQSEVVSGLQSTMTTISQAPASTSSIPKSEPSSTGFASIHTQASLTSY
                     EGSAARVRSSLSVLLLSLVCLF"
     gene            <16157..>17617
                     /gene="TDEL0G00110"
                     /locus_tag="TDEL_0G00110"
                     /db_xref="GeneID:11504381"
     mRNA            <16157..>17617
                     /gene="TDEL0G00110"
                     /locus_tag="TDEL_0G00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682541.1"
                     /db_xref="GeneID:11504381"
     CDS             16157..17617
                     /gene="TDEL0G00110"
                     /locus_tag="TDEL_0G00110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682589.1"
                     /db_xref="GeneID:11504381"
                     /db_xref="GOA:G8ZYA3"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR005815"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8ZYA3"
                     /translation="MTPLNYSTEVQNCLEWDKEHLWHPFSTLKDPFPVYPVSSSNGCQ
                     LTLETENGLQVIEAMSSWWCVIHGYNNKELNQAMKYQIDQFSHVMFGGLTHKPAIKLG
                     QKLLTLINHPELHSIFFADTGSVAVEVAMKLAIQYNYTAKEGGRKKIKFLTIRNGYHG
                     DTFGAMSIGDPNNPMRTFFKDHLPENIFVKPPSVLRTLPTSNIALENPSTFAELTKWN
                     PDEFAEFERAMDENHDQICAVILEPLLQGAGGIRIYHPQFLIEARKACNKYAIPFIMD
                     EVATGFGRTGEIFAFKHCAKYQEIMNVPEEERIDVFPDIMCVGKGLTGGYLSFSAVLT
                     TKQISDGVSISQGPTRGYFMHGPTFMGNPLACSVANKSLDILLRGEWIDQVNRIEKQL
                     FEELYQAISANETLMKHVVDHVRVTGAVGVVQLQDPINVPWFQEQSISRGVYIRPFKN
                     LCYIMPPFTISEEELRVVTKAIKEVLNLLLKDKTNS"
     gene            <18080..>19111
                     /gene="TDEL0G00120"
                     /locus_tag="TDEL_0G00120"
                     /db_xref="GeneID:11504382"
     mRNA            <18080..>19111
                     /gene="TDEL0G00120"
                     /locus_tag="TDEL_0G00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682542.1"
                     /db_xref="GeneID:11504382"
     CDS             18080..19111
                     /gene="TDEL0G00120"
                     /locus_tag="TDEL_0G00120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682590.1"
                     /db_xref="GeneID:11504382"
                     /db_xref="InterPro:IPR008775"
                     /db_xref="UniProtKB/TrEMBL:G8ZYA4"
                     /translation="MASKNQNLFNTFEKDGKKYAVIPKNTILSNVQPKYSDLVVNDKA
                     DLKAIVKKLELYGLCIVKKYLPADTCEQIKEELEPHYFRDESWNGSPFPKQTTVVTRA
                     ALRSPTCLKKIACDDTFYKVSHNFLSESNIFWIGDGKLRRSESDVQLYSSIIYRVGPG
                     AGDQMYHREDMSLHNVHPRREEYHYGDDAQVGFALALTPMNKKNGATRAIIGSHLWGP
                     LDAPTGYDSSQEIYLELDEGDGAFMLGSTYHAASSNHSDAARIGAFFFMNKSYQRQEE
                     NYHVSVPPSYFENLSFPELKILGLHTSLPFCGHVDYKSPAFVLNPKLEETSQTSKGNY
                     TEVIHAVFE"
     gene            complement(<19362..>19955)
                     /gene="TDEL0G00130"
                     /locus_tag="TDEL_0G00130"
                     /db_xref="GeneID:11504383"
     mRNA            complement(<19362..>19955)
                     /gene="TDEL0G00130"
                     /locus_tag="TDEL_0G00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682543.1"
                     /db_xref="GeneID:11504383"
     CDS             complement(19362..19955)
                     /gene="TDEL0G00130"
                     /locus_tag="TDEL_0G00130"
                     /inference="similar to DNA sequence:INSDC:YJL218W"
                     /note="similar to Saccharomyces cerevisiae YJL218W"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682591.1"
                     /db_xref="GeneID:11504383"
                     /db_xref="GOA:G8ZYA5"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="InterPro:IPR018357"
                     /db_xref="InterPro:IPR024688"
                     /db_xref="UniProtKB/TrEMBL:G8ZYA5"
                     /translation="MEILKQTSNGKLYLPADPAVAQLRLNAQMKFHELNKLSPDRSEE
                     KDRILRELLGSYGDKISIDPPFYCDYGVNIHLGENFYSNYNLVILDCAEVHIGNNVMF
                     GPNVSVYTAGHPIGHKSRLTGEEYALPISIGDNVWVGGNAVILPGVTIGENSVIGAGS
                     IVVKSIPSGVIAAGNPCKVIREVTEEDEKTTQFHAKK"
     gene            complement(<20315..>21460)
                     /gene="TDEL0G00140"
                     /locus_tag="TDEL_0G00140"
                     /db_xref="GeneID:11504384"
     mRNA            complement(<20315..>21460)
                     /gene="TDEL0G00140"
                     /locus_tag="TDEL_0G00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682544.1"
                     /db_xref="GeneID:11504384"
     CDS             complement(20315..21460)
                     /gene="TDEL0G00140"
                     /locus_tag="TDEL_0G00140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682592.1"
                     /db_xref="GeneID:11504384"
                     /db_xref="GOA:G8ZYA6"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8ZYA6"
                     /translation="MTHLSTACIHADDIHNRVTDVAPPINVSTTFRYDNENLVPEVEI
                     ENFIETIEQTPVYSRESHPNSLRLQTVLSDILGGHATVYNSGVSAFHALIFHYNPKRF
                     FMDDGYSGVRGIATLYQEKHGLETYKLHQIEEFAEKGDLIHLEVPLNPYGTCRDIAAL
                     AKRVHKKGAILSIDSTLAPPPLQDAWDFGADVVMHSATKYLGGHSDLLAGVVVVKTME
                     QQRKLIRERIFLGTNVGNLESFLLLRSLRTFEMRVLKQSENAAKIVSFLHENKAKYSK
                     VLNEVYHSSLQKEAFVQRQLAGGHGAVFSVTLRSVEQCKKLPAKLVYFQHATSLGGVE
                     SLIEWRALSDTKIDPFLVRLSIGCENADDLIQDLDNALQVLQGAAKD"
     gene            complement(<22315..>23214)
                     /gene="TDEL0G00150"
                     /locus_tag="TDEL_0G00150"
                     /db_xref="GeneID:11504385"
     mRNA            complement(<22315..>23214)
                     /gene="TDEL0G00150"
                     /locus_tag="TDEL_0G00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682545.1"
                     /db_xref="GeneID:11504385"
     CDS             complement(22315..23214)
                     /gene="TDEL0G00150"
                     /locus_tag="TDEL_0G00150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682593.1"
                     /db_xref="GeneID:11504385"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8ZYA7"
                     /translation="MSTFEQKIDMTPNFGKIKVDQGVKIWYRTAGKWGAPTILLLHGF
                     PSSSNMFRNLIPLLAARFYVVAPDIPGFGFTEYPEDYEFNFANLTNSIEQFLKALNIK
                     KYSVYVFDYGAPIGFRLALKSPSAITGIVVQNGNAYDEGLDDRFWEPIINYWEQEQTD
                     PEYVKIFTDYLQDEKNVKSQYLTGVDDSVTVDPSNYTLDFALLSRPGQTAIQIKLFHD
                     YETNVDMYPDFQEFLRNAKIPVLVTWGWNDQIFTVEGAESYRKDVKCLKIVYFKTGHF
                     ALETHAAEIAHEIVAFLYQKVIR"
     gene            <24611..>25705
                     /gene="TDEL0G00160"
                     /locus_tag="TDEL_0G00160"
                     /db_xref="GeneID:11504386"
     mRNA            <24611..>25705
                     /gene="TDEL0G00160"
                     /locus_tag="TDEL_0G00160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682546.1"
                     /db_xref="GeneID:11504386"
     CDS             24611..25705
                     /gene="TDEL0G00160"
                     /locus_tag="TDEL_0G00160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682594.1"
                     /db_xref="GeneID:11504386"
                     /db_xref="GOA:G8ZYA8"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR026992"
                     /db_xref="InterPro:IPR027443"
                     /db_xref="UniProtKB/TrEMBL:G8ZYA8"
                     /translation="MSFNSIPVIDLEEAFDSGLKSQFLEKLRYALIDVGFLLLVNHER
                     YGPSQRDFADIKEQAIDFFNLPEHAKQSCEMIKSPHFLGYSRLGNEITAGRSDHREQI
                     DLATELPPPREGEPLYKQIEGPNLWPDEKHAPKFRPVVTSYIAKMTKLATTFRRLVCE
                     AIGLPPDSLDSYFKENQQCKMKLIAYPDIPQENESDFNQGVGPHRDSDFLTYIFQASQ
                     HSGSLQVQNFQGKWVAIDNVPGSLVVNVGQTLEALTNGVCKATIHRVANPDSGLGTRL
                     SIPFFQTIDLDSRKSIVADIPSNILQLRDTRDKLITDWGVDVGFQFSPDMSKNPVGYA
                     VFRNRIKSHQDVAAKWYPQVLEQVLTEYSA"
     gene            27972..28069
                     /gene="TDEL0Gtrna8L"
                     /locus_tag="TDEL_0Gtrna8L"
                     /db_xref="GeneID:11505340"
     tRNA            join(27972..28010,28025..28069)
                     /gene="TDEL0Gtrna8L"
                     /locus_tag="TDEL_0Gtrna8L"
                     /product="tRNA-Leu"
                     /note="codon recognized: CUA"
                     /db_xref="GeneID:11505340"
     gene            <30643..>32223
                     /gene="TDEL0G00170"
                     /locus_tag="TDEL_0G00170"
                     /db_xref="GeneID:11505335"
     mRNA            <30643..>32223
                     /gene="TDEL0G00170"
                     /locus_tag="TDEL_0G00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682547.1"
                     /db_xref="GeneID:11505335"
     CDS             30643..32223
                     /gene="TDEL0G00170"
                     /locus_tag="TDEL_0G00170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682595.1"
                     /db_xref="GeneID:11505335"
                     /db_xref="GOA:G8ZYA9"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR015830"
                     /db_xref="InterPro:IPR020556"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="UniProtKB/TrEMBL:G8ZYA9"
                     /translation="MTNWEVIARRKRESVQNAIPEEWLVPDINKRMTEAGYINSKLYI
                     DTLVPSQEKKITDCTVLELSAKISAGQLSSWDVCNAFCHRAALAHQLLNCCVEIFFYR
                     ALDKARELDEIFARTGKTVGPFHGIPISLKDQLNIPGIDTTIGYVGYVDIQAKKQSLL
                     ASILEKNGALFYVKTTVPMAMMAPETVSNLMGVTLNGVNSRFSSGGSSGGEGALIAAR
                     GSLLGLGTDIGGSIRIPAAFQGLYALRPSHGRISYMDVANSYVGQEVVPSVIGPLATS
                     LEDIELLTKTVVESEAWKLDPKVVPIPWRDMSHLRKEKLRFVCNVMDGMVMVHPPVTR
                     ALSKVVNALTGAGHEIIEYDFDHHKAVLNLATKAFTADQGKEIEEVCNLSGEPFVEAI
                     KPLVGYDPNEPPISVEEWWAIGESKSHLREKFFKYWQDTAKQFSDGKMIDAILCPVWP
                     SAGFKKDDGNYAAINYTVPFNILDCPSVILPVTLSDKMIDLPNDTYVPVDDFDEKIHN
                     YYDPNEFHGMPVCIQIVC"
     gene            <32417..>33946
                     /gene="TDEL0G00180"
                     /locus_tag="TDEL_0G00180"
                     /db_xref="GeneID:11504388"
     mRNA            <32417..>33946
                     /gene="TDEL0G00180"
                     /locus_tag="TDEL_0G00180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682548.1"
                     /db_xref="GeneID:11504388"
     CDS             32417..33946
                     /gene="TDEL0G00180"
                     /locus_tag="TDEL_0G00180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682596.1"
                     /db_xref="GeneID:11504388"
                     /db_xref="GOA:G8ZYB0"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="UniProtKB/TrEMBL:G8ZYB0"
                     /translation="MHVVAASFLLPLNVIVYTALGGLKATFISDWVHTVIIYLILIVS
                     VYTTYCSSSLIGSPGKMWDLLKEIQDVFPMASGKSYLSFKSRDMILLSWSVTLGGMSS
                     VLGDPGYSQRAIASDSRSVFLGYTMGGLCWWVIPWALGSSAGLACRALLTNPASVTFP
                     NELSPAELNASMPVIYGLAAIFGKSGAAAGLVMLFMSVTSATSAELIAFSSITTYDLY
                     RTYINPNATGKQLVRASHISVISFGIFMAALSVVFNYIGVTVGWLLSFLGILLNPEAG
                     AVVLCLFWPRMTKLGLLIGAPLGTVTGIVCWLGSTYAFGGHVVNKNTVMTAEATFIGN
                     IVSLFSGTIYIIVFSLLTPNSASYDLRLLRNAIKVADDVDDEEEKALILTEADEKVLG
                     HQSYLSLAVNVFVLLGVYVVVTCALYGWGGDFSKSSFTAFMVVMMIWLLVAAFSIILL
                     PLWQGRDTIKLVVRSILKKEPEVVYFTDAASSSSQGDAVQDGEIVAGKKNDIHITVSG
                     M"
     gene            35548..35621
                     /gene="TDEL0Gtrna5V"
                     /locus_tag="TDEL_0Gtrna5V"
                     /db_xref="GeneID:11504389"
     tRNA            35548..35621
                     /gene="TDEL0Gtrna5V"
                     /locus_tag="TDEL_0Gtrna5V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:11504389"
     gene            complement(<36313..>36712)
                     /gene="TDEL0G00190"
                     /locus_tag="TDEL_0G00190"
                     /db_xref="GeneID:11505329"
     mRNA            complement(join(<36313..36360,36422..>36712))
                     /gene="TDEL0G00190"
                     /locus_tag="TDEL_0G00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682549.1"
                     /db_xref="GeneID:11505329"
     CDS             complement(join(36313..36360,36422..36712))
                     /gene="TDEL0G00190"
                     /locus_tag="TDEL_0G00190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682597.1"
                     /db_xref="GeneID:11505329"
                     /db_xref="GOA:G8ZYB1"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:G8ZYB1"
                     /translation="MLNMLNDKFIHMQQKTYIEGNACIGGSEQSVTDRSSKSTSLETD
                     ISVTSSTVTRKRLSDEVRLLLERLYERKRALNSKERHLVAKVCGLSPRQVRVWFANKR
                     RRANAAYNRN"
     gene            <37398..>38735
                     /gene="TDEL0G00200"
                     /locus_tag="TDEL_0G00200"
                     /db_xref="GeneID:11504390"
     mRNA            <37398..>38735
                     /gene="TDEL0G00200"
                     /locus_tag="TDEL_0G00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682550.1"
                     /db_xref="GeneID:11504390"
     CDS             37398..38735
                     /gene="TDEL0G00200"
                     /locus_tag="TDEL_0G00200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682598.1"
                     /db_xref="GeneID:11504390"
                     /db_xref="UniProtKB/TrEMBL:G8ZYB2"
                     /translation="MVCVSECTLPKAGLEYTDESKDFVFFRLGDKKQANSVKFTFVGQ
                     KVFKTNQLAEFNLSDEGTKKKDSQTLITRPRNCFIIMRTLIHNVIIRCLEKCDISSLK
                     HVSAITSQLWGKNDGIFQLYFELLSQFEEHWHLNIYPEYRYHKVNKISRQLENKLVYQ
                     NMLNRMRYFTASSLLSKLEGILTFPVASAADTAVDATAAAEIPTAAEPFSSTYTYFSL
                     SFHQSGVNHQYHSRQQHRQVINSTVRVGKTQQQDFASPQERKSFDALHNKRPRADSVD
                     DGKLNRKNRCKAVTQETLCDRIKFGLPKRNGRSLLSLKRARKSNTSRSKESLNQEQNA
                     LKTVTTSAQTDPTDSTRKCSALFSHGRIPVSQQTFFKSMPFKDVQSTSVPSTMASSTQ
                     LPGSNVNSLRKNPKRVYSKPQCMVGSKQRLDVQDLYLEKKPIIVLSSDQPYND"
     gene            complement(<40994..>42586)
                     /gene="TDEL0G00210"
                     /locus_tag="TDEL_0G00210"
                     /db_xref="GeneID:11504391"
     mRNA            complement(<40994..>42586)
                     /gene="TDEL0G00210"
                     /locus_tag="TDEL_0G00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682551.1"
                     /db_xref="GeneID:11504391"
     CDS             complement(40994..42586)
                     /gene="TDEL0G00210"
                     /locus_tag="TDEL_0G00210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682599.1"
                     /db_xref="GeneID:11504391"
                     /db_xref="GOA:G8ZYB3"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G8ZYB3"
                     /translation="MSNTSTSSLEAQIVSIEQKDNAGSKNAAGLLKDEYKVVSSRDAD
                     VTLNFLEEHDSEVPLITPDEDRKLRRKVAAIVVGLTFLVNLTLYSDKATLSYASIFGL
                     WEDTGLTQETYNDANTLFYVGYLIGQANMFLCKNYPIGRVVTVMCALWTIIIFLHCVA
                     YNHQGIIALRFFLGFVESVAVPTLNITMNQFLTPDEKNSYGPIWYVSSIGVSIPVGFI
                     AYGILHAKSSVPIWKLFMIIIGGCTFLLTIIIFFFYPNNPTDAKFLSTKEKVWVIRRV
                     QESSQASIEQKVVKKYQIVEAFKDPITWFFSIFFLFQQLANNLAYQQNLLFQGIGNIT
                     NLSSTLVSVAAGGFASICAVIATVFLLYKRNYTAFSVVFWTIPSFAGSIALVSIDWDK
                     KIALLAMLCLACPLFGIPWILMFSWNTTSCAGYTKRLTRNAIIMFWYAIANIISPQIW
                     RSKDKPRFIPAWIVQIVLSFFLAPLTALVIWYILKKRNNERLAERHKSHVAVELEGKV
                     VETNVAMLDLTDLENETFIYPL"
     gene            <43381..>44037
                     /gene="TDEL0G00220"
                     /locus_tag="TDEL_0G00220"
                     /db_xref="GeneID:11504392"
     mRNA            <43381..>44037
                     /gene="TDEL0G00220"
                     /locus_tag="TDEL_0G00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682552.1"
                     /db_xref="GeneID:11504392"
     CDS             43381..44037
                     /gene="TDEL0G00220"
                     /locus_tag="TDEL_0G00220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682600.1"
                     /db_xref="GeneID:11504392"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G8ZYB4"
                     /translation="MTKTAVNKTTDVAKVQQTLSIAFGDSAACQYLITKFEDRTATEP
                     LTKEEIYQSYSTLSKKYMAQGGFLLEAGDYDCVAVVVPPLENHAKAQRTKDPLFNKQF
                     IEAGENYKKALGLGTKLKMFYLFMIGKNLNQPEVRGSARAILEYLKEEADKQDAAVIL
                     EAINEKAKKVYEYFGFMDYGEINYGKGEVNSQGEPDSNGEGFKANFMVYYKGGKLPIN
                     "
     gene            complement(<44234..>46135)
                     /gene="TDEL0G00230"
                     /locus_tag="TDEL_0G00230"
                     /db_xref="GeneID:11504393"
     mRNA            complement(<44234..>46135)
                     /gene="TDEL0G00230"
                     /locus_tag="TDEL_0G00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682553.1"
                     /db_xref="GeneID:11504393"
     CDS             complement(44234..46135)
                     /gene="TDEL0G00230"
                     /locus_tag="TDEL_0G00230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682601.1"
                     /db_xref="GeneID:11504393"
                     /db_xref="InterPro:IPR021988"
                     /db_xref="UniProtKB/TrEMBL:G8ZYB5"
                     /translation="MLRRRSNVAWVVLIVIVFLLYRSLGPHPLPQGSARKSLGYRNKQ
                     TVQRKTDLLNADISQALKRQPWDLSPINHRITKQKYEDEEVVAFASNLDVDKVLVKKA
                     KAAKKNEQDGNQLGLTFGSKDYKNSITCEDLAYRSVIQHSQEKAQLHDDLAELRHRLM
                     SVPNFLSKEVTGEDEEEMTVPEIIEKKWYQFGSSAVWLESEQCYVVYSRVIYSSNHIK
                     NHPHLSLVRAQAFDKDWNEIKGKRIPYVDVPRPADMQAALRQIDEEIGISDCSVHRSN
                     QLAYDACVVENTRNGLTADKRRESILSKFYMTYPTILNIPFKTDGDWKGPEDPHVVLR
                     RTEHGEEPVVIYNIRDEDLDRRIMVAFLPHRKIEPMVKFSIGGREQREIEKNWTPFFH
                     RNVGESLISRGFIHFIYSFSPLEILKCSLNDGVCNLVFEADTLKISESNKFGGIRGGT
                     QFIPLPDVLPQVDGAQVWIGFPKQHIDECGCGSVYYRPMFSVLVERDGVYSQEMMVPA
                     MGFNMDVLAWDLKTTACKETNILSPNSIAYWGVAGQDPHTRKYEDYLIITVSEADSIS
                     KVITLKGVLNYILGIYREKDIMEKFAINEQADEIIGQTLHCLISSAFDSCKAYGEAHP
                     EIKEEEKQE"
     gene            complement(<46296..>47012)
                     /gene="TDEL0G00240"
                     /locus_tag="TDEL_0G00240"
                     /db_xref="GeneID:11504357"
     mRNA            complement(<46296..>47012)
                     /gene="TDEL0G00240"
                     /locus_tag="TDEL_0G00240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682554.1"
                     /db_xref="GeneID:11504357"
     CDS             complement(46296..47012)
                     /gene="TDEL0G00240"
                     /locus_tag="TDEL_0G00240"
                     /inference="similar to DNA sequence:INSDC:YMR314W"
                     /note="similar to Saccharomyces cerevisiae PRE5 (YMR314W);
                     ancestral locus Anc_5.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682602.1"
                     /db_xref="GeneID:11504357"
                     /db_xref="GOA:G8ZYB6"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8ZYB6"
                     /translation="MFRNNYDGDTVTFSPTGRLFQVDYTKLYDALEAIKQGSVTVGLH
                     SKKYAVLVALKRNADELSSYQRKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCNYSNL
                     VFNRKLSVEKAGHLLCDKAQKNTQSYGGRPYGVGLLIIGHDKSGAHLLEFQPSGNTLE
                     LYGSAIGARSQGAKTYLERTLDTFLEIEDPNELIKQGVEALRQSLKDETLSNNNLSIA
                     IVGEDLPFTQYDNEAVSQFL"
     gene            <47199..>48953
                     /gene="TDEL0G00250"
                     /locus_tag="TDEL_0G00250"
                     /db_xref="GeneID:11504358"
     mRNA            <47199..>48953
                     /gene="TDEL0G00250"
                     /locus_tag="TDEL_0G00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682555.1"
                     /db_xref="GeneID:11504358"
     CDS             47199..48953
                     /gene="TDEL0G00250"
                     /locus_tag="TDEL_0G00250"
                     /inference="similar to DNA sequence:INSDC:YMR313C"
                     /note="similar to Saccharomyces cerevisiae TGL3 (YMR313C);
                     ancestral locus Anc_5.2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682603.1"
                     /db_xref="GeneID:11504358"
                     /db_xref="GOA:G8ZYB7"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR021771"
                     /db_xref="UniProtKB/TrEMBL:G8ZYB7"
                     /translation="MLTNWILSVVYATLDRIPPVVWQVIHVVSDIYFFWIHKLLNYLR
                     PNSRVLYHEASKELERCTTYETWYAKAMVVDEITGANLWRRNFFSVRYDFNSVLEQHA
                     QLQRALETGDIAAVKDKFLSTGPSMLRNFGGIVDRRLFTKSLIGTKLLIEQYMDRIIE
                     GLELLDSAGTPTFFFQRCKLSLGTTALILQGGSLFGMFHLGVIKRLFFQNLIPNVISG
                     SSMGSCIASLYACMSNQELRRLLHGENILNMIKLDVELLRSCGYGNVDQHLNLGTLIQ
                     NLIHHGYSQDVYLFIQFVLKYIVKDLTFEEAFQNTGKILSIVIHPTDLSCPKLLNYVT
                     SPNVLISSAINCSLGSGVISDDTRLLCRNLDNEIVSFLSEEKTKITKFLAPENATETS
                     ESPYTRLTELFNVNNFVVSLARPYLAPLVVNDLKHEIKTSRYYYYKHYPDTPGSVDLS
                     ELGFPQLNFTEMEPLAFKFKYHLERKLKNIATMEFRHRMEMLDNLGLLSSWIKRLTID
                     EKTPRSATEITIVPRMKSLSLTRIIEGQLDNIPYGITCGEQSTWPVLSLIRTRSSVEY
                     KLDRIIRARRNKLNPYVG"
     gene            complement(<48963..>49748)
                     /gene="TDEL0G00260"
                     /locus_tag="TDEL_0G00260"
                     /db_xref="GeneID:11504359"
     mRNA            complement(<48963..>49748)
                     /gene="TDEL0G00260"
                     /locus_tag="TDEL_0G00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682556.1"
                     /db_xref="GeneID:11504359"
     CDS             complement(48963..49748)
                     /gene="TDEL0G00260"
                     /locus_tag="TDEL_0G00260"
                     /inference="similar to DNA sequence:INSDC:YMR312W"
                     /note="similar to Saccharomyces cerevisiae ELP6 (YMR312W);
                     ancestral locus Anc_5.3"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682604.1"
                     /db_xref="GeneID:11504359"
                     /db_xref="UniProtKB/TrEMBL:G8ZYB8"
                     /translation="MSNVQKQDLVLFSDSSVISKELCTGKSHDLITITSSPATSSFWL
                     LTTLVETRLTGAPFSLNSTSVPVVTHKNMNLITIASFIHNAQYYTDALNRLKLGPESY
                     KYIDLLTNFVIKNIGKPRAKVLSELLEKFPQDSTSVVILEQPEVLLTLLDGLTSDELH
                     RKFIMPLMQRCGLLIISTNINYSPNGQTKDAIEFSRFVAGCFYKSIAVLSLKPLDTGR
                     AADVTGSFRITRGGASNSHLSCHVVENEYLYLNQKENTKLFYR"
     gene            <49939..>51240
                     /gene="TDEL0G00270"
                     /locus_tag="TDEL_0G00270"
                     /db_xref="GeneID:11504360"
     mRNA            <49939..>51240
                     /gene="TDEL0G00270"
                     /locus_tag="TDEL_0G00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682557.1"
                     /db_xref="GeneID:11504360"
     CDS             49939..51240
                     /gene="TDEL0G00270"
                     /locus_tag="TDEL_0G00270"
                     /inference="similar to DNA sequence:INSDC:YGR285C"
                     /note="similar to Saccharomyces cerevisiae ZUO1 (YGR285C);
                     ancestral locus Anc_5.4"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682605.1"
                     /db_xref="GeneID:11504360"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:G8ZYB9"
                     /translation="MFTLPELKSDITVNVISDAKKSEAIRRPVEPVGKHFLHHAQRTL
                     RNHTWSEFEKIQAEQNVKRVDESNTDPDEALFDDELADESLLEHDPRDWKTADLYAAM
                     GLSKLRYRATENQIIKAHRKQVLKHHPDKKSASGAGLEQDGFFKIIQKAFETLTDNNK
                     RAQYDSCDFNADVEPPKKGTEYDFFEAWGPVFAAEARFSKKKPVPTLGDLNTPKKEVE
                     QFYSFWHRFDSWRTFEFLDEDVPDDSSNRDQKRYTERKNKAARDKKKTADNARLVKLV
                     ERAVNEDPRIKLFKEEEKKEKERKKWEREAGARAEAEAATKAAAEAKAKAEAEATASA
                     AAKVDKKKAKEAAKAAKKKNKRIVRNAAKEAEYFGEADKAAAIEEQTGFIVDSLDDEQ
                     LVAVAEKIKADPQAAKQVLKDASQTLVDAKKLPASVLSYYL"
     gene            <51447..>52376
                     /gene="TDEL0G00280"
                     /locus_tag="TDEL_0G00280"
                     /db_xref="GeneID:11504361"
     mRNA            <51447..>52376
                     /gene="TDEL0G00280"
                     /locus_tag="TDEL_0G00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682558.1"
                     /db_xref="GeneID:11504361"
     CDS             51447..52376
                     /gene="TDEL0G00280"
                     /locus_tag="TDEL_0G00280"
                     /inference="similar to DNA sequence:INSDC:YGR284C"
                     /note="similar to Saccharomyces cerevisiae ERV29
                     (YGR284C); ancestral locus Anc_5.5"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682606.1"
                     /db_xref="GeneID:11504361"
                     /db_xref="GOA:G8ZYC0"
                     /db_xref="InterPro:IPR002995"
                     /db_xref="UniProtKB/TrEMBL:G8ZYC0"
                     /translation="MSYRGSFNNLNGAPNGGRPGNSYGSFSGARSSAGAALNVQGIMK
                     TVESYSQKIENLTDHPLAIKVRPYIPAIARFFIVATFYEDSFRIISQWSDQIFYLHKW
                     KHYPYLFVVLFLVLVTVSMLAGATLLVLRKQTVYATGILCGCIILQALIYGLFTGSSF
                     VLRNISVIGGLLIAFSDSIVQNKTTFGMLPELTSKGGKTKGYLLFAGRLLIVLMFIAF
                     TFSKSWFTVFLTIIGTVCFAIGYKTKLASIMLGLILTFYNITLNNYWFYDQTKRDFLK
                     YEFYQNLSIIGGLLLVTNTGAGELSVDEKKKIY"
     gene            <52537..>53055
                     /gene="TDEL0G00290"
                     /locus_tag="TDEL_0G00290"
                     /db_xref="GeneID:11504362"
     mRNA            <52537..>53055
                     /gene="TDEL0G00290"
                     /locus_tag="TDEL_0G00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682559.1"
                     /db_xref="GeneID:11504362"
     CDS             52537..53055
                     /gene="TDEL0G00290"
                     /locus_tag="TDEL_0G00290"
                     /inference="similar to DNA sequence:INSDC:YMR311C"
                     /note="similar to Saccharomyces cerevisiae GLC8 (YMR311C);
                     ancestral locus Anc_5.6"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682607.1"
                     /db_xref="GeneID:11504362"
                     /db_xref="GOA:G8ZYC1"
                     /db_xref="InterPro:IPR007062"
                     /db_xref="UniProtKB/TrEMBL:G8ZYC1"
                     /translation="MGGILKNPLPADQNGPESEESTSEFRKQVLMNTQLNAKLTSKKK
                     GEIASHKHGLPKDTLSLKREQEAEESLQWNQKNLDANEIAKQQYQDIHIDEPKTPYQG
                     AIDPNGEYYRDDDENEAELENFSLDGQPLPPQKSEHSRFEEMRKKHYSREGAVPHSRT
                     FEDDQDDAQDDE"
     gene            <53221..>54294
                     /gene="TDEL0G00300"
                     /locus_tag="TDEL_0G00300"
                     /db_xref="GeneID:11504363"
     mRNA            <53221..>54294
                     /gene="TDEL0G00300"
                     /locus_tag="TDEL_0G00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682560.1"
                     /db_xref="GeneID:11504363"
     CDS             53221..54294
                     /gene="TDEL0G00300"
                     /locus_tag="TDEL_0G00300"
                     /inference="similar to DNA sequence:INSDC:YGR283C,YMR310C"
                     /note="similar to Saccharomyces cerevisiae YGR283C and
                     YMR310C; ancestral locus Anc_5.7"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682608.1"
                     /db_xref="GeneID:11504363"
                     /db_xref="InterPro:IPR003750"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:G8ZYC2"
                     /translation="MRRSMVLLIRKQKKKVKPVAKLKKSIKILSKTVNYSLCIPTTVL
                     ANCRNLEQITFAIYQIAKTATIFNVGEIVVLNLGDRSEKSKKHENSLSDAMLIASLLQ
                     YFVTPPYLVNTVFKKQYTRYFQAAAKLPRLSALPFMRHRNEDKGRYREGLAIRMTKPG
                     QASIKKKNKEFKQTKFINIGKAEPLELKSQLVPVNVRVTVDTVEQRVVSPQEAYGDFV
                     GANASFGYHVRVANNFGSIFTECAFPNGYSQAIWINSGDYYYNDQLKKYRKVETNLPY
                     VNKIIKPTESTDSTPPANVLLVGGKWDHINESFQQSRDQFEGCDGAQQFFDGQLELPG
                     AAPQGNLAIPDSCMISLTLVNTL"
     gene            <54494..>55423
                     /gene="TDEL0G00310"
                     /locus_tag="TDEL_0G00310"
                     /db_xref="GeneID:11504364"
     mRNA            <54494..>55423
                     /gene="TDEL0G00310"
                     /locus_tag="TDEL_0G00310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682561.1"
                     /db_xref="GeneID:11504364"
     CDS             54494..55423
                     /gene="TDEL0G00310"
                     /locus_tag="TDEL_0G00310"
                     /inference="similar to DNA sequence:INSDC:YGR282C"
                     /note="similar to Saccharomyces cerevisiae BGL2 (YGR282C);
                     ancestral locus Anc_5.8"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682609.1"
                     /db_xref="GeneID:11504364"
                     /db_xref="GOA:G8ZYC3"
                     /db_xref="InterPro:IPR000490"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G8ZYC3"
                     /translation="MRFSTLAAGLLFAATQVAAVGDLGFNLGVKNNDGTCKSTSDYEA
                     DLEVLKPYGNVVKVYAVSDCNTLQQLAPAVEAAGFRAFLGVWPNDDAHFAAEKEALTT
                     YLPTIKISNVAGILVGSEALYREDLTASELADKINNVRDTVKDIKDADGNSYSSIQVG
                     TVDSWNVLVAGYNAPAIEASDFVMANAFSYWQGQTMDNATYSFFDDIMQALQTIQSVK
                     GTTDISFWVGETGWPTDGTNFEAAYPGVDNAQQFWQEAICGMRAWGINVLAFEAFDED
                     WKPDTSGISDVEKHWGIWTSGRTLKYDIDCKFD"
     gene            <55822..>58242
                     /gene="TDEL0G00320"
                     /locus_tag="TDEL_0G00320"
                     /db_xref="GeneID:11504365"
     mRNA            <55822..>58242
                     /gene="TDEL0G00320"
                     /locus_tag="TDEL_0G00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682562.1"
                     /db_xref="GeneID:11504365"
     CDS             55822..58242
                     /gene="TDEL0G00320"
                     /locus_tag="TDEL_0G00320"
                     /inference="similar to DNA sequence:INSDC:YMR309C"
                     /note="similar to Saccharomyces cerevisiae NIP1 (YMR309C);
                     ancestral locus Anc_5.9"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682610.1"
                     /db_xref="GeneID:11504365"
                     /db_xref="GOA:G8ZYC4"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR008905"
                     /db_xref="InterPro:IPR027516"
                     /db_xref="UniProtKB/TrEMBL:G8ZYC4"
                     /translation="MSRFFAANYEYDSGSSSSEEDLMSSSEESLNSSLSEEEEVSDDS
                     FFNDSESESDIDSDDSDGRPYGPDWFKKSEFRKGGTNKFLKGASYSDSESEDEGKKVV
                     KSAKEKLLDEMQAVYSSVENAGMTQDWVTILSEFDNISRLLIRAQQQNYGIPNIFIKV
                     LAQIEDAVAGTTQNDIKNKGVARAFNTTKQRVKKVARENETLLAKFREDPESFDKEED
                     LEASVDADVVPTFGKKGINLSTLATATSEAGFFAALRIVLDTRGKKNADQYGLIRTME
                     ELLQITKTPYETIMAYLTLIPIRFDASANLSYQPIEQWKASYNDIMKLLEILHEQLDN
                     FQVSELANRNETIEEEPEADENGVKKILGSVFSFVERLDDEFNKSLLNTDPHSSDYLV
                     RLRDEQLIYNLILRTQIYLEATLPEEEKERLLARPLVKRLDHIYYKSSPLVSIIETNA
                     WASLPNNFTSSYIPYNGTADETYVTNLIGTLAESLRKHKNGGFRKRATLYQVYFTALN
                     NDFNTAKDMLINSKVQAYINNSDPSLQILFNRVVVQLGLAGFKLCLIEDCHQVLNELL
                     ASSHLREILGQQTLQRVSANVGSSSSADEREQLCLPYHQHINLDLIDLVFMTCSLLIE
                     VPQMTAFYSGIKVKRIPYSQKSIRRALEHYDKSTFQGPPETLRDFVLHAAKSMQKGDW
                     QKCNSYLQCIPTWKLLPNAKTVLENLAERVQVESLKTFFFTYKRFYSKLSLEKLSDLF
                     SLPKDKVSSIIEEVTAEFDINATMNEEKTIVTVEGDEITKLEEVALKLNKEAKIAKER
                     LNPSTNRR"
     gene            complement(<58587..>62984)
                     /gene="TDEL0G00330"
                     /locus_tag="TDEL_0G00330"
                     /db_xref="GeneID:11504366"
     mRNA            complement(<58587..>62984)
                     /gene="TDEL0G00330"
                     /locus_tag="TDEL_0G00330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682563.1"
                     /db_xref="GeneID:11504366"
     CDS             complement(58587..62984)
                     /gene="TDEL0G00330"
                     /locus_tag="TDEL_0G00330"
                     /inference="similar to DNA sequence:INSDC:YGR281W"
                     /note="similar to Saccharomyces cerevisiae YOR1 (YGR281W);
                     ancestral locus Anc_5.10"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682611.1"
                     /db_xref="GeneID:11504366"
                     /db_xref="GOA:G8ZYC5"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZYC5"
                     /translation="MVNLKKPRYPGGRANAHDKSNTSSSESTSADESLEGRNDYKGES
                     SDTQGLSTTGEYVVDRNKPETFLNSDDLEKVTQSDIYAQKRLFSFLHRRKVPEIPADD
                     ERKVYPMLRTNYISRIFLWWVLPIVRVGYKRTVQPNDLFIMDEKMSIEKLFAAFDGNM
                     RYYFDKSRKEYLKNHPDATEEEVLDNARLPKLTTLRALYFTFQRQYLWAVTCAILANC
                     ASGFNPMVTKRLIEFVGEKAVLPHLPVNKGVGYAIGACVVLLINGLLFNHFFLASQTI
                     GVQAKAVLTKAALNKMFYASGYARHQYPNGKVTSFVTTDLSRIEFALSFQPFLAGFPA
                     ILAICIVLLIVNVGPIALVGIGIFFAVFFIAMFAFKYIITLRIKANILTDARVTMMRE
                     LLNNMKMVKFYAWEDAYEKNVRDIRTKEIGKVRNMQFTRNFMIALAMSLPNIASLVTF
                     LSLYKVNNGARSPGNIFASLSLFQVLSLQMFFLPISIATGIDMILGLGRLQNLLEAPE
                     EKGNELEERLPTPSLPSNIALRMRNASFEWEDYESKDFEETKKEEEAQAEKKLNKKQK
                     QKQKQKKITPQPAEKGGENDKAEKKSFHGFKNLNIDIKKGDFVMITGPIGTGKSSLLS
                     AMAGFMRKTSGTVEVDGDLLMCGYPWIQNATVRDNIIFGSPYDKERFDEVVRVCSLKA
                     DIDILPGGELTEIGERGITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHI
                     MDECLLGRLKGKTRILATHQLSLIEKASVVIVLGVDGSFEAGKLEDLKRSNKTLINLL
                     HFSSQKSSSKEADTSEKDLALKTSIEEVKTHDSESKEWEELQKQLSKKSRDELVDGRL
                     TTKEERAVNSLKLDVYKKYIAAAVGKWGIVVIPLYLILVIGTTFLSLFSSVWLSFWTE
                     QKFPNRSTSFYMGLYSFFVFGGYLFMNGQYTLICYMGVTASKVLNLKAVERVLHTPMA
                     YMDTTPIGRILNRFTKDTDSLDNELTESLRLFMTQFANIIGVCVMCIIYLPWFAIAIP
                     FLVLIFVLIADHYQASGREVKRLDAIQRSFVYNNLNEVLGGMDTIKAYGSQERFLVKT
                     DFLINKMNEAGYLLVALQRWVAIFLDMIAVAFALIISLLCVTRQFHISPASVGVLLTY
                     VLQLPGLLNTILRALTQTENDMNSAERLVYCANELPLEADYKRPELAPPESWPSKGEI
                     VFEDVSFAYRPGLPVVLKGISLDIKSQEKIGICGRTGAGKSTIMSALYRLNELSDGKI
                     FIDSVDIGQIGLYDLRKKLSIIPQDPVLFRGTIRKNLDPFQEHPDELLWKSLVSGGAI
                     SAEEVEVVKGQKPDSIGSLSSMHKFHLDQKVEEEGANFSLGERQLLALTRALVRQSKI
                     LILDEATSSVDYETDNKIQSRIAAAFGDCTILCIAHRLKTILTYDRILVLEQGEIEEF
                     DTPRSLYEKKDGIFRQMCIKSGINESDFE"
     gene            <65496..>68774
                     /gene="TDEL0G00340"
                     /locus_tag="TDEL_0G00340"
                     /db_xref="GeneID:11504367"
     mRNA            <65496..>68774
                     /gene="TDEL0G00340"
                     /locus_tag="TDEL_0G00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682564.1"
                     /db_xref="GeneID:11504367"
     CDS             65496..68774
                     /gene="TDEL0G00340"
                     /locus_tag="TDEL_0G00340"
                     /inference="similar to DNA sequence:INSDC:YMR308C"
                     /note="similar to Saccharomyces cerevisiae PSE1 (YMR308C);
                     ancestral locus Anc_5.11"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682612.1"
                     /db_xref="GeneID:11504367"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZYC6"
                     /translation="MSALPDEVNNSLINVLHGFASADNETRAAAEKVLNQEWITPANI
                     EILLIFLSEQASSSQDLTSSALSAVLFRKLALRAPPSSKTVIIAKNITQLSTNGLNQI
                     RATLLKGFVSDRPGSIRHKLSDAMAECAQDDLPEWPELLQALIEALKNQDPNFRESSF
                     RILSTVPHLINNVDVMNILPVFEAGFTDPDDNVKIASVTAFVGYFKQLPKAHWSKLGV
                     LLPSLLNSLPKFLDDGKEDALAAVFESLIELVELAPKLFKDMFDQLIQFANMVIKMKD
                     LDTPARTTALELLTVFSENSPQMCKANSNYAQTMIVSTLLMMTEVSIDDDEATDWRES
                     DDAEEDEEEVVYDHARQALDRVSLKLGGKYLAAPLFHYLQEMVGSSQWRERFGALMAL
                     SSAAEGCRDVLIGEIPKILDMVLPLINDPHPRVQYGCCNVLGQISTDFAPLIQRTSHD
                     RILPALISKLTNSSIDRVQTHAAAALVNFSEHANQAILEPYLDSLLTNLLTLLQSNQL
                     YVQEQALTTIAFIAEAAEKKFIKYYDTLMPLLINVLKMDVNGANRVLKGKCIECATLI
                     ALAVGKDKFSEYSQVLVDLLILYQNNGIQDDDPIKTYLEHGWSRICRILREDFVPLLP
                     IVLPPLLETAKATQDVSLIEEEEAANFQQYVDWDVVQIQGKHIAIHTSVLDDKVSAME
                     LLQVYSTVLKSLFAGYVSEIMNDIAIPSIDFYLHDGVRATGASLIPVLLSCLIAAVGL
                     QNEEVQLLWQSASSKLISGIMSEPMPEITQIYHSSLVDTLKTMGTDCLTEDAQVKFTK
                     GLSANLTDVFERVKQRHTEDDEYNEELDQEYEDFTDEDLLDEINKSIAAFFKASKGDY
                     ITHFQSIWSLVDTYLHDSEIILTLFALVALGDMVQYCGERSAPFKDSFVPKVSGYLVS
                     PEPSIRQAAAYIIGVCAQYAPSTYGDVCVSSLETLFQVVSIPDAQSDENQTATENASA
                     AIAKILHAFSANMPNLETYLANWLRTLPIIVDDEAAAFSYRFLSHLIDTNSPVVSGPS
                     NIPVVVDNVVQALHHKSISGKTAAAVVESTKRLLGTLPQADAMGILQRYPSDVMQTIQ
                     VWFS"
     gene            <69338..>70180
                     /gene="TDEL0G00350"
                     /locus_tag="TDEL_0G00350"
                     /db_xref="GeneID:11504368"
     mRNA            <69338..>70180
                     /gene="TDEL0G00350"
                     /locus_tag="TDEL_0G00350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682565.1"
                     /db_xref="GeneID:11504368"
     CDS             69338..70180
                     /gene="TDEL0G00350"
                     /locus_tag="TDEL_0G00350"
                     /inference="similar to DNA sequence:INSDC:YGR280C"
                     /note="similar to Saccharomyces cerevisiae PXR1 (YGR280C);
                     ancestral locus Anc_5.12"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682613.1"
                     /db_xref="GeneID:11504368"
                     /db_xref="GOA:G8ZYC7"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="UniProtKB/TrEMBL:G8ZYC7"
                     /translation="MGLAATKTKQRFGLDPRNTAWSNDTARFGHTMLEKFGWKPGMGL
                     GMIPAESHKSHIKVSIKDDNLGLGAKIKRKERKDEFDNGECAGLDVFQRILGRLNGKE
                     QKISDELEKQRVEKVFTGRWGVHFVKGEVLSSTWDPETKKLVSYSNKRKRSESLKEAS
                     DESSDEDEKEAKRSKKHKSDKKRSKKDKSDKKERKHKKDKKDKKHKSDKKKKSSKDKK
                     NSQSDSCKKAVFLESSKTASKIPANVSTRLSVRAKHIRQKRAATMDSKALNEIFMITD
                     GGFS"
     gene            complement(<70335..>71984)
                     /gene="TDEL0G00360"
                     /locus_tag="TDEL_0G00360"
                     /db_xref="GeneID:11504369"
     mRNA            complement(<70335..>71984)
                     /gene="TDEL0G00360"
                     /locus_tag="TDEL_0G00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682566.1"
                     /db_xref="GeneID:11504369"
     CDS             complement(70335..71984)
                     /gene="TDEL0G00360"
                     /locus_tag="TDEL_0G00360"
                     /inference="similar to DNA sequence:INSDC:YMR307W"
                     /note="similar to Saccharomyces cerevisiae GAS1 (YMR307W);
                     ancestral locus Anc_5.13"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682614.1"
                     /db_xref="GeneID:11504369"
                     /db_xref="GOA:G8ZYC8"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR012946"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G8ZYC8"
                     /translation="MLFKTLAAAALASVFSSCVTADDLPAIEVVGNKFFFSNNGSQFY
                     VRGIAYQADTANATDGDSINDPLADYDKCSRDIPYLQKLNTNVIRVYAVNTSLNHDEC
                     MSALNDAGIYVIADLSAPKDSINRLSPSWDIDLYDQYTSVVDEFSQYPNVMGFFAGNE
                     VTNNNTNTDASPFVKAAVRDMKAYIKEKGYRSIPVGYSSNDDEDTRVPMADYFACGDS
                     DAKADFYGINMYEWCGDANFQNSGYADRTKDFANLSIPIFFSEYGCNEVKPRKFTEVE
                     ALYGDNMTDVWSGGIVYMYFEEDNQYGLVSIDSNNDVKTLDDFNNYSSEIAKISPTSA
                     NTASYSATSTSLECPATNSNWMAATDLPPTPSEDLCDCMKAALSCVVKDDVDEDDYQD
                     MFDYICSQISCDGITANGTTGDYGSYSFCQPKEKLSFVMNLYYNQQGGSKSNCDFSGS
                     ATLQSATTQSACGTALSQVGSSGTNKPSSSVSFSGSKSSSKSGSGSASGSSTSSGSSG
                     SSTSTGSRNAAISNARINLSQVILSSIATISLVAGVGFALA"
     gene            complement(<72619..>77976)
                     /gene="TDEL0G00370"
                     /locus_tag="TDEL_0G00370"
                     /db_xref="GeneID:11504370"
     mRNA            complement(<72619..>77976)
                     /gene="TDEL0G00370"
                     /locus_tag="TDEL_0G00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682567.1"
                     /db_xref="GeneID:11504370"
     CDS             complement(72619..77976)
                     /gene="TDEL0G00370"
                     /locus_tag="TDEL_0G00370"
                     /inference="similar to DNA sequence:INSDC:YMR306W"
                     /note="similar to Saccharomyces cerevisiae FKS3 (YMR306W);
                     ancestral locus Anc_5.14"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682615.1"
                     /db_xref="GeneID:11504370"
                     /db_xref="GOA:G8ZYC9"
                     /db_xref="InterPro:IPR003440"
                     /db_xref="InterPro:IPR026899"
                     /db_xref="UniProtKB/TrEMBL:G8ZYC9"
                     /translation="MSGSPISLTDLEHPAWCQDEEVPVTKGEIRAMFAELAAKFGFQK
                     ANRENMFHHLMAQLDSRASRTNGQNALVSLHVSYIGGEQANFRKWYFAAQQDLDEELG
                     FQNMELRGKSRQRNLKLAKKRGISIKEQMEEWNQKEQEFINNHPKITLTHEQLQDKTS
                     LQTANYKWKLKMKQLSHHEMARQLILYLLCWGEANQVRFAPECLCFIFKCALDYDTAT
                     ECAMQDSAQDTAVPEFTFLNDVITPLYNFLKLQVYRKNSKGKWERRDRDHKEVIGYDD
                     VNQLFWYPEGIEKIVLHNGDRLVDKPLKERYLYLKDVEWSKVFYKTFIESRGWMHCVT
                     NFNRFWIIHLAPFWFFTSFNAPTFYTKDYVQLLNNPPTPQSKLSAIALGGTVSCLIQI
                     LATLFEWRFVPRRWPGAQHLTRRLIGLIVCLLINVGPSVYIFGFFDLDVHSKSAYILS
                     IIQLIIAFLTTLFFAIRPLGGMFGSYLNRGKQKRRYVSSQIFTASFPRLSGRSKWFSY
                     GLWFGVFLGKFIESYFFLTLSLRDPIRVLSILDMTRCAGDKLIGRWFCSWQSKITLGL
                     MIFTDLGLFFLDTYLWYIICNCAFSIMLSFSLGTSILTPWKNIYARLPKRIYTKILAT
                     SEMDIKYKPKILISQVWNAIVISMYREHLLSIEHIQRLLFQQVDSMSQDKKMLRSPTF
                     FIAQDDSTFKSVEFFPKNSEAKRRISFFAQSLSTPINEPVPVECMPTFTVLIPHYSEK
                     ILLTLKEVIKEESNKSKITVLEYLKQLHSAEWDSFVRDTKLLSMEKDATKSICDEMKG
                     RDDEVSNKGTLSKYIDHGSVFSDDKVGEDVVQKKISDLPYHVFGFNSSEASYTLRTRI
                     WASLRCQTLYRTISGFMNYSKAIKLLYRIENPSLLQLYENAPEALENGLESMVNRKFR
                     MLVAMQRYAKFNKEEREATELLFKVYPTMYVSYLLEEQSPDDDETLYYSCLTNGFAEV
                     DPDTGLRKPLFKVRLSGNPILGDGKADNQNHSLIFYRGEYIQVIDANQDNYLEECLKI
                     RSVLSEFEEMDVDSTIPYIPGIEYDEEPPAVAIVGAREYIFSENIGVLGDIAAGKEQT
                     FGTLFARTLAEIGGKLHYGHPDFLNAIFMTTRGGLSKAQRSLHLNEDIYAGMNAMCRG
                     GRIKHSDYFQCGKGRDLGFGSILNFTTKIGAGMGEQLLSREYYYLGTQLPIDRFLSFF
                     YAHPGFHLNNLFISLSVQLFFLLLLNLGSLNHETILCNYDRDLPITNLEEPIGCYNIQ
                     PALHWVSIFVLSIFIVFFIAFAPLLIQELLEKGIWKATERFFHHLFSMAPLFEVFVCQ
                     VYSNSLLSDLTFGGAKYISTGRGFAITRIEFAVLYSRFVNIAIYSGLQVFLMLVFGMV
                     SMWQPALLWFWITVISMCFAPFIFNPHQFVFTDFFIDYRNFIHWLSSGNTKFHKESWS
                     TFTKVSRARFTGYKQKLIGDLSEEGAGDARKAKLGNVLLAELFTPLVVFLFNFTGYTF
                     INAQTGVPRPEPTHSIIRLVLVTFLPIILNTGLLMILFMLSLVALPLLSLCCKKSGSG
                     IAGAAHAFSVVVYLIDFEVMWFLEGWNFARTLILLISTINLHILLFKTFTILILTKEH
                     KNNSSHIAWWTGIWYNTGMGWSIILQPIREFSVKIMESSYFAGDFFLSHLLLYAQTPL
                     ILIPFIDRWHSMVLFWLKPTSIITSKRIFTRKQRKRRNNIVRKYFILYFGLLSILLAL
                     IIAPFFAKQLVDDPARMLTGSPFSGVIQPNRQNNNDTGPNAPMTILTTTPPFPRFKTV
                     P"
     gene            <78655..>79779
                     /gene="TDEL0G00380"
                     /locus_tag="TDEL_0G00380"
                     /db_xref="GeneID:11504371"
     mRNA            <78655..>79779
                     /gene="TDEL0G00380"
                     /locus_tag="TDEL_0G00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682568.1"
                     /db_xref="GeneID:11504371"
     CDS             78655..79779
                     /gene="TDEL0G00380"
                     /locus_tag="TDEL_0G00380"
                     /inference="similar to DNA sequence:INSDC:YGR279C,YMR305C"
                     /note="similar to Saccharomyces cerevisiae SCW4 (YGR279C)
                     and SCW10 (YMR305C); ancestral locus Anc_5.15"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682616.1"
                     /db_xref="GeneID:11504371"
                     /db_xref="GOA:G8ZYD0"
                     /db_xref="InterPro:IPR000490"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G8ZYD0"
                     /translation="MRFSSLIAGASLIGAAVGAPAIQHEHKRDVATTTVRAQVTVVVG
                     GNGQAITTTSATPVAEKAAVEPVTTTSSSSAAAVEVASSSSQGSTEAVSSSSSSSSAS
                     ASSSSGSSSDSDVTIGAAGVKGITYSPYTDSGSCKSSSQIKSDLASLSGYPVIRLYGV
                     DCDQVANVLQAKGSSQKLFLGIFDVSAIEGGVQTIASAIEQYGSWDDVVTVSVGNELV
                     NGGEATPSQVGQYVSSAKSALKAAGYTGSVVSVDTFIAVINNPELCQYSDYMAVNAHA
                     YFDKNTVASDAGKWVLEQIQRVSTTCNNEKTVVVTESGWPSQGETYGVAVPSKSNQKS
                     AVESIAKTCGSATYLFTAFNDLWKADGAYGVEKYWGVLSN"
     gene            complement(<80116..>81762)
                     /gene="TDEL0G00390"
                     /locus_tag="TDEL_0G00390"
                     /db_xref="GeneID:11504372"
     mRNA            complement(<80116..>81762)
                     /gene="TDEL0G00390"
                     /locus_tag="TDEL_0G00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682569.1"
                     /db_xref="GeneID:11504372"
     CDS             complement(80116..81762)
                     /gene="TDEL0G00390"
                     /locus_tag="TDEL_0G00390"
                     /inference="similar to DNA sequence:INSDC:YGR278W"
                     /note="similar to Saccharomyces cerevisiae CWC22
                     (YGR278W); ancestral locus Anc_5.16"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682617.1"
                     /db_xref="GeneID:11504372"
                     /db_xref="GOA:G8ZYD1"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR003891"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZYD1"
                     /translation="MDNEELRIAPGEDEQRSNWRVMESYLDSCLKEINLSNFEKVLKD
                     IYEVNVILARDIVVRLIIKYQTMNDQANLYAGLAAALNLIVPEIGGVLTRESTAYFIV
                     AYNKLDDVQAFAMVSLLAQLFNYEVTHEIVILQIIHLLSEDLNESSVHIIIHLLRQCG
                     KHLSEVSSTAHNMIFEKLREVLQEGKLSKTANHYLEELFDLRRLDYKASSFKSLLKDK
                     DMEHTTHTFMVDPEASRPNADLGHFVYHKDFMEIERKYYDLKQKIELSEVENAEPVPT
                     VAKDMTGKNDVEFKKQFYLILKSSLSSDEAAHKILRLRIPDADKHKVVNVIVKSSIQE
                     PTYSKFYGLLAERLCSSHKTWKPAFEQTFRANYDEIEELEPAQLRTLGRFWGHVLASD
                     FIGFEVFENVHMSEDGTSASGRIFLKFIFQEVVAALGINELKERFKEDYIQPFLINLF
                     PKEDPENIRYSINYFTAIGLGVLTEDMRKQLDLIQAKEQETEIAKKRENRPRANSRYR
                     PHERASRRARSITPPRRQRKKSVTPPRRRARSRSPIARRR"
     gene            <81954..>82823
                     /gene="TDEL0G00400"
                     /locus_tag="TDEL_0G00400"
                     /db_xref="GeneID:11504373"
     mRNA            <81954..>82823
                     /gene="TDEL0G00400"
                     /locus_tag="TDEL_0G00400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682570.1"
                     /db_xref="GeneID:11504373"
     CDS             81954..82823
                     /gene="TDEL0G00400"
                     /locus_tag="TDEL_0G00400"
                     /inference="similar to DNA sequence:INSDC:YGR277C"
                     /note="similar to Saccharomyces cerevisiae YGR277C;
                     ancestral locus Anc_5.17"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682618.1"
                     /db_xref="GeneID:11504373"
                     /db_xref="GOA:G8ZYD2"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G8ZYD2"
                     /translation="MKAAIVLQDLETLDFSRLETHFEECLRDLSFDDAGELDVILMDE
                     FESSAYLDTILGKLYSSAREVFLNKGLYLTSINVLFGKCAVSSLDLDWLYVPKESLKK
                     HFNHRNYKVFEQPVIQGYSYSGENYLADVNKYKVSALGGTFDHIHDGHKILLSVAAFL
                     TSSKLIIGITDEELLLKKKYKEFLEPFDKRADNVKRFLSLLKPALTAQIVPIKDVCGP
                     TGTVPDIECLVVSRETISGGEFVNKTRLAKGLSKLDISVVNVLGGNEEDGWKEKLSST
                     ELRKILMDVKNRS"
     gene            complement(<82945..>86505)
                     /gene="TDEL0G00410"
                     /locus_tag="TDEL_0G00410"
                     /db_xref="GeneID:11504374"
     mRNA            complement(<82945..>86505)
                     /gene="TDEL0G00410"
                     /locus_tag="TDEL_0G00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682571.1"
                     /db_xref="GeneID:11504374"
     CDS             complement(82945..86505)
                     /gene="TDEL0G00410"
                     /locus_tag="TDEL_0G00410"
                     /inference="similar to DNA sequence:INSDC:YMR304W"
                     /note="similar to Saccharomyces cerevisiae UBP15
                     (YMR304W); ancestral locus Anc_5.18"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682619.1"
                     /db_xref="GeneID:11504374"
                     /db_xref="GOA:G8ZYD3"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR002083"
                     /db_xref="InterPro:IPR008974"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR024729"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="InterPro:IPR029346"
                     /db_xref="UniProtKB/TrEMBL:G8ZYD3"
                     /translation="MADAITGSVTDQIDLGKHNEEILPLLDEDLEAQVVAEGGFTWHL
                     DDWSQLTGDKYVSPRFKIGEFEWDILLFPQGNQNRSLAVYLEPHADERLNTETGESEL
                     VNPDWFCCAQFAIVLSRPDEDDKVHLINTSHHRFNSVDTDWGFANFIDLAYLKYPAKG
                     RVSGILNKGRLNVTAYVRIVKDPTGVLWHNFINYDSKKVTGYVGFRNQGATCYLNSLL
                     QSYYFTKYFRRLVYQIPTEGENPNDSVTLALQRAFYQLQVSQFPLDTMELTRSFGWDN
                     AEAFTQHDVQELNRILMDRLETRMKGTSVEGKINELFVGKMKSYIRCINVDYQSVRTE
                     DFWDIQLNVKNMRDLQTSFENYIEVELMDGENQYAAQGHGLQDAKKGVVFESFPPVLH
                     LQLKRFEYDFNYDQLIKVNDRYEFPDSIDLAPYMDSEALEQNPGPKIYKLHGVLVHTG
                     DISTGHYYTLIKPSTKDEWYRFDDDRVWRATKKQIFDDNFGFDRLPDEKIRTMTREQY
                     QDYLIQRHTNAYMLVYIAEEKEEEILQPVTEADVPEYVVTKVREENKERELREKEIRE
                     AHLYTNIRINSLKNFTHYQGFDTAPNVRSSLYSPELYAEDTLPITLKVSCKAYMKDIY
                     KKINEQLNIPHGRNVRYWKMGYRRNGTLRLEEPLPLAFEEMTLEETFENESSGKVPSL
                     NVFVEEPYLELGFLHKLKKSGAFPSVENNDELIDNFRNSISSIVSPDNIPTVKDDDNY
                     QVIFLKQFDPLQQSLMGYSYCVVNQLDDISKLSQIVSEFIGSSQPVQFYEELQPGAIE
                     PISLKEKFYTAELSSGDILTFQTPESSLPDSFPIYKDLKSFYEYLRNRTKLVFTKAES
                     PSEEYVVENIESENFEFWISTKASYSDVARVVSQYTGVQPEYLKIFAVYANGRFPMKS
                     DSPLSDYIIRDYNSDLKPLFEYEVLSIPLKELEHLRSLKFYWLNDSYIHFQTYEFKVT
                     ETCTVKEFLDKVQAKIGFSDKDKGNILLWTNYNFQFRGILSENSTMKSVSKSVLLFGR
                     ILPEELKLVKQLDTLSNADEDSMDDDEEDLGVKVNGPKTELQGCVVMVAQYFKDIENR
                     HGISFLFKLVPNEPFPQTRARLHEKFGLGQREFAKIHLAISFATPTGSSFRSLEGYSK
                     EELEKLVLFNVMSNLDCIYMDHPDRLRSQSSHDRPMVIKN"
     gene            <86739..>89195
                     /gene="TDEL0G00420"
                     /locus_tag="TDEL_0G00420"
                     /db_xref="GeneID:11504375"
     mRNA            <86739..>89195
                     /gene="TDEL0G00420"
                     /locus_tag="TDEL_0G00420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682572.1"
                     /db_xref="GeneID:11504375"
     CDS             86739..89195
                     /gene="TDEL0G00420"
                     /locus_tag="TDEL_0G00420"
                     /inference="similar to DNA sequence:INSDC:YMR302C"
                     /note="similar to Saccharomyces cerevisiae YME2 (YMR302C);
                     ancestral locus Anc_5.19"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682620.1"
                     /db_xref="GeneID:11504375"
                     /db_xref="GOA:G8ZYD4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR018850"
                     /db_xref="UniProtKB/TrEMBL:G8ZYD4"
                     /translation="MWLTRIGSLPGLVARRPHLIGSGVSLGKRFVSSEIQQKDEQAGE
                     SSTATDTGIIHKTEQETLIYFDNVYPRATSFWSPAQWYNLVLTNQSREAVRDKIKNFA
                     SPADNPIHGLELRSSIPVKRDGGVFATFLVPHQYTKAQVNAMIQQNTSQESSKSILSY
                     FTKAAAFPVKGYPWIEDLRRLPNKTIVVKFQGPALTEEEIYSLFRRYGTISDIFPVTG
                     SDNTARVKYRSFRGAICAKNCVSGIEIHNTVLHIQYEKIEQGHLISNFFINHTRIAIP
                     VMIGLLSIIAVLIFDPIREFSIEQKITHRYSISWDNHWLKQIRKLTSSTMSQFRNYWG
                     SEDASNSQKHLWEERIEKVNDLKMWLEENNNTFVVIRGPRGSGKHELVMQHTLQNRDN
                     VLYLDCDKFIKSRTDAKFLRNAANQLGYFPIFPWFNSVTNVIDLMVQGLTGQKSGLSE
                     TKEAQFRNMLTTGLMSIRHIALKGYRTTIKNGDESINIKEEDYLQQHPEEKPVIVIDR
                     FTGKSEINGFIYKELSDWAAMLVQMNIAHVIFLTETVAPNQILSESLPTQVFKTLILS
                     DASKENSKKYVLAQLIDQNMQTAKLVADGENTDVEKKVDIDEKIIKEIDEVLEPLGGR
                     MLDLQAFVRRVKSGEEPKEALDKMVEQSSEQITQIFLSDKVDPIKSAQAWELIELLTE
                     HPKVTFEDIVFRPLFKAAPELGITELENNGLVSVSRERGVLKEIFPAKPLYRAAFQYL
                     VNDPDLSTILKTRYLLKVVGFEAGRIKKWEEELRPLGKSGDPKMFKSRLTYLAKKIDA
                     SSAVIDKCEEEIKNLSQKNK"
     gene            <89431..>91521
                     /gene="TDEL0G00430"
                     /locus_tag="TDEL_0G00430"
                     /db_xref="GeneID:11504376"
     mRNA            <89431..>91521
                     /gene="TDEL0G00430"
                     /locus_tag="TDEL_0G00430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682573.1"
                     /db_xref="GeneID:11504376"
     CDS             89431..91521
                     /gene="TDEL0G00430"
                     /locus_tag="TDEL_0G00430"
                     /inference="similar to DNA sequence:INSDC:YMR301C"
                     /note="similar to Saccharomyces cerevisiae ATM1 (YMR301C);
                     ancestral locus Anc_5.20"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682621.1"
                     /db_xref="GeneID:11504376"
                     /db_xref="GOA:G8ZYD5"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZYD5"
                     /translation="MQRIGGSGIWPSALLPSRIAIRNRLTVRSLNFSTYRPLKFKSSG
                     PQIWKQSNGKMTGKPIVQPKIEAPKPQTNETKSRAPTMSELKILRNLVHYIWPKGNNK
                     VKLRVIAALMLLIGAKLLNVQVPFFFKDVVDSMNVDWSDSTVALPAAIALTVICYGAA
                     RFGSVLFGELRNAVFARVAQNAIRTVSLETFKHLMKLDLGWHLSRQTGGLTRAMDRGT
                     KGISYVLSAMVFHILPITFEISVVCGILTYQFGASFAGITFATMLLYSIFTIKVTAWR
                     TAFRRDANKADNKAASVALDSLINFEAVKHFNNENYLAGKYHNSLMKYRDSQVKIAQS
                     LAFLNAGQNFIFTSALSAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVY
                     RELKQSLIDMEALFNLRNNKIKIHNNDKPLMLPENAGPFEIKFENVTFGYDTRRKILR
                     NASFTIPAGVKTAIVGPSGSGKSTILKLVFRFYDPESGRVLVNGKDVREYDLDSFRKV
                     IGVVPQDTPLFNDTIWENVKFGRIDATDDEVTNAIEKAQLAPLIHKLPVGSATIVGER
                     GLMISGGEKQRLAIARVLLKNSQIMFFDEATSALDTHTEQSLLKTIRENFDRGSRTSV
                     YVAHRLRTIADADKILVLEEGCVREEGSHTELLSRPNSLYKQLWDIQENLDVIDQEIK
                     QERQLEDQLNQHKG"
     gene            <91838..>93370
                     /gene="TDEL0G00440"
                     /locus_tag="TDEL_0G00440"
                     /db_xref="GeneID:11504377"
     mRNA            <91838..>93370
                     /gene="TDEL0G00440"
                     /locus_tag="TDEL_0G00440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682574.1"
                     /db_xref="GeneID:11504377"
     CDS             91838..93370
                     /gene="TDEL0G00440"
                     /locus_tag="TDEL_0G00440"
                     /inference="similar to DNA sequence:INSDC:YMR300C"
                     /note="similar to Saccharomyces cerevisiae ADE4 (YMR300C);
                     ancestral locus Anc_5.21"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682622.1"
                     /db_xref="GeneID:11504377"
                     /db_xref="GOA:G8ZYD6"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR005854"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:G8ZYD6"
                     /translation="MCGILGIALADESSPVAPELCDGSIFLQHRGQDAAGVATCGPRG
                     RIYQCKGNGMARDVFTESRVSGLVGSMGIVHLRYPTAGSSANSEAQPFYVNSPYGIMM
                     AHNGNLVNTVSLKRYLDEDVHRHINTDSDSELLLNIFAAELEKYNKYRVTSEDIFHAL
                     EGVYRFVRGGYACVGVLAGFGLFGFRDPNGIRPLLFGERQNENGTKDYMLASESVVLK
                     AHNFTTYRDLLPGEAVIIPKNCGKEEPQFKQVVPINSHRPDLFEYVYFARPDSVLDGI
                     SVYHTRLRMGTKLAENILEQLGPDEIDVVVPVPDTARTCALQCSNALGKPYREGFVKN
                     RYVGRTFIMPNQKERVSSVRRKLNPMASEFEGKKVLIVDDSIVRGTTSKEIVNMARES
                     GATKVYFASAAPAIRYNHIYGIDLTDNKNLIAFNRDDDEVAKEIGCDKVIYQSLEDLI
                     ECCKTDEIDKFEVGVFTGNYVTGVEDGYLHELERVRELNKAKKIDLKSEVDIGIYNSA
                     DY"
     gene            <93541..>94488
                     /gene="TDEL0G00450"
                     /locus_tag="TDEL_0G00450"
                     /db_xref="GeneID:11504378"
     mRNA            <93541..>94488
                     /gene="TDEL0G00450"
                     /locus_tag="TDEL_0G00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682575.1"
                     /db_xref="GeneID:11504378"
     CDS             93541..94488
                     /gene="TDEL0G00450"
                     /locus_tag="TDEL_0G00450"
                     /inference="similar to DNA sequence:INSDC:YMR299C"
                     /note="similar to Saccharomyces cerevisiae DYN3 (YMR299C);
                     ancestral locus Anc_5.22"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682623.1"
                     /db_xref="GeneID:11504378"
                     /db_xref="InterPro:IPR022780"
                     /db_xref="UniProtKB/TrEMBL:G8ZYD7"
                     /translation="MSNPWTELLKKIDDRAVPRYKKVIIVCAPNVESSRQFEARFLPT
                     GVQTLNETLNVLGFDAISLEIRTSNGRLEHFLDLDVYTIPFPVKSQSIEYLRAFVKLE
                     DHQNCDIHYFFLLDWSMSNQRTWLRQLNSSVQLLQDAGSYVSQGSITVCCMNTEHIYT
                     WQKNTAQWLPRHVEFVQQSVRSFCLLKECTLLYRTSLANSEKEETDQTVFVDIVSGDF
                     SNIMADLVNPSKLLIPFGSDSIGLIKTVCDSFDPIRVLEEEFIRKKFETLVPTLDDSS
                     LRDEAPSNLDLLTPYKVDIQQELAKIYHKVQAQKAADNV"
     gene            <95021..>96997
                     /gene="TDEL0G00460"
                     /locus_tag="TDEL_0G00460"
                     /db_xref="GeneID:11504379"
     mRNA            <95021..>96997
                     /gene="TDEL0G00460"
                     /locus_tag="TDEL_0G00460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682576.1"
                     /db_xref="GeneID:11504379"
     CDS             95021..96997
                     /gene="TDEL0G00460"
                     /locus_tag="TDEL_0G00460"
                     /inference="similar to DNA sequence:INSDC:YGR276C"
                     /note="similar to Saccharomyces cerevisiae RNH70
                     (YGR276C); ancestral locus Anc_5.23"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682624.1"
                     /db_xref="GeneID:11504379"
                     /db_xref="GOA:G8ZYD8"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:G8ZYD8"
                     /translation="MGDVAHSDSQNESTEVKCSSTKVAPLEDGKKSEQQDENTLVNSR
                     VARLSICEGNAITDDIILSLKSKDKVDQDADSTNGSTDSQGKRTKTSKRRRRSSAAVP
                     GPGKLKPAPKHSASGTIQVKKKKKILKPLLEVRDRLDRKINVRELRDLVVYAMDGNNN
                     APKWVTIENRSAIQKVIVLLVPGLQVEDFNLPKGSKFSESKEQLRESHLKGLNDPTII
                     KELQAFPVSAPGSNTSLFSAYNSFVNVQLSKNEKKKRREELENRKITINDLLMSVDDL
                     LENDYPIHMETAGLTDELRNELTQRYEEQPVKYLPTLSFEHEGSHIFALDCEMCRAEE
                     GLVLARVSIVNFNLEVVYDKLVKPSVPIIDYMTRYSGITEEKLSDVTTTLQDVQHDIL
                     KIVGTEDILIGHSLQSDFDVLQMRHPKVVDTAAIFDHKAGPPFRPALRYLASTFLNDD
                     IQNDNGLGHDSIEDATACMKLVKAKIANGMGFGLTINTENLFNKLSKVGVKSMRLSDT
                     GPKLHVAGTNHLESAIRCRSDREIMSVMTENLNKYDLFVCRLRGLEFGRGYATPSALR
                     PCEVSTPEDALEFFSASLQEVYAKCCSGTMIMVMSGSGDTRQWSGIMKELNDLDKEVR
                     AEERQKLQKEIEDAVEVARDGVGFIILKRNGPLE"
     gene            complement(<97044..>97601)
                     /gene="TDEL0G00470"
                     /locus_tag="TDEL_0G00470"
                     /db_xref="GeneID:11504380"
     mRNA            complement(<97044..>97601)
                     /gene="TDEL0G00470"
                     /locus_tag="TDEL_0G00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682577.1"
                     /db_xref="GeneID:11504380"
     CDS             complement(97044..97601)
                     /gene="TDEL0G00470"
                     /locus_tag="TDEL_0G00470"
                     /inference="similar to DNA sequence:INSDC:YGR275W"
                     /note="similar to Saccharomyces cerevisiae RTT102
                     (YGR275W); ancestral locus Anc_5.24"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682625.1"
                     /db_xref="GeneID:11504380"
                     /db_xref="InterPro:IPR018304"
                     /db_xref="UniProtKB/TrEMBL:G8ZYD9"
                     /translation="MNSLIDRANSTSYFGVAEKKCHWKYDWYATTSPETSSGSHTHAN
                     ADSSRGNEDGKHSLRFKTWLRSDMPVFGGWPDIEKSDLFDLSKYTTNANSSSTKAKNG
                     HTINTGAVGDSMTEEDIRGAVGNSESMITLSSSAANANAAQPDSTASADTKEEPKVQA
                     EHVMNANNEDEKPQAADVEGDVNME"
     gene            <97832..>100888
                     /gene="TDEL0G00480"
                     /locus_tag="TDEL_0G00480"
                     /db_xref="GeneID:11504394"
     mRNA            <97832..>100888
                     /gene="TDEL0G00480"
                     /locus_tag="TDEL_0G00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682578.1"
                     /db_xref="GeneID:11504394"
     CDS             97832..100888
                     /gene="TDEL0G00480"
                     /locus_tag="TDEL_0G00480"
                     /inference="similar to DNA sequence:INSDC:YGR274C"
                     /note="similar to Saccharomyces cerevisiae TAF1 (YGR274C);
                     ancestral locus Anc_5.25"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682626.1"
                     /db_xref="GeneID:11504394"
                     /db_xref="GOA:G8ZYE0"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR022591"
                     /db_xref="UniProtKB/TrEMBL:G8ZYE0"
                     /translation="MSATQKGKKQKGEDLSNEDDAYGAIFEGEFGTLEIGNYIGQGEE
                     TETKHLPDAIDFEDEDELADEELPDEEISRPGRSITTGLEDGGLAMSGNTGHDHVNDF
                     MGRDMPGADYDGGNNALFMGMESGQGVYMERNHSFGAYNAAETQQQQQQQEKLQIEQQ
                     KLRQQQRLLKEAERKAKEDKSLLRSYFPDFKKGKVLKWNRLLYRRAGKYAWAFENSTT
                     RKNLDPLIPLDLNLRVQPDQKRLFNTKDNVWKSSSSLVPSNSNRRQRRGIVTVTLDEI
                     YPEVHHEEKKDHHTHEISEELLIATDDWDQERIINEGAVSTKNQANLTQYPLKEDDQD
                     WDWDEDDLVDAKLNDNRARLDMNDEQLLLIKETTTRKSESAKANLLPLNEKGLVQKFN
                     ISNDVEYNVLRRNHQTKVRATISNLNIDHSQPAIRLQSPYYKVNMPKRDLRHFHRPNF
                     GKSIRPGTNIVFSKLKVRKRKRDKGKEVKESFSSTQDLTVGDTAPVFLLEYTEQTPIV
                     LSKFGMANKLINYYRKMNEQDASRPKLPVGETHVLGVQDKSPFWNFGFVEPGHIVPTL
                     YNNMVRAPVFKHDVSGTDFLLVRSSGNGVSNRFYLRPINHLFAVGQTFPVEEVPGPNS
                     RKVTSMRTTRLRMVVYRILNRTPSQAISIEPIARHFPDQDYGQNRQKIKEFMKYQREG
                     SDKGLWKLKDGEPLLDNENAKKLISPEQVSEVESMNQGLQFQEDSEFFNFDEKLLKLE
                     ENLLPWNATKNFVNATQMRAMIQIHGAGDPTGCGEGFSFLKTSMKGGFLKSGNENAKD
                     KSSGGHSYNVAEQQRAYEEEISKTWYTHAKSLSITNPFEEIEDPDEINPTNRHVLTNR
                     SDGKVLRIVRKKRDENGIIQRQTVVIRDPRVIKGYLRSKEKRREANLDVEKLLDEEST
                     AVNNVEDIEMQKKLLQSELASLEKSQQRRAARQVTKSKSDGKVAKSKNTTRRCARCGQ
                     VGHIRTKKSCPMYDGTLGSSQGNNIGEDGTPAAPEVPIASPQETSQ"
     gene            complement(<100940..>101365)
                     /gene="TDEL0G00490"
                     /locus_tag="TDEL_0G00490"
                     /db_xref="GeneID:11504395"
     mRNA            complement(<100940..>101365)
                     /gene="TDEL0G00490"
                     /locus_tag="TDEL_0G00490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682579.1"
                     /db_xref="GeneID:11504395"
     CDS             complement(100940..101365)
                     /gene="TDEL0G00490"
                     /locus_tag="TDEL_0G00490"
                     /inference="similar to DNA sequence:INSDC:YMR298W"
                     /note="similar to Saccharomyces cerevisiae LIP1 (YMR298W);
                     ancestral locus Anc_5.26"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682627.1"
                     /db_xref="GeneID:11504395"
                     /db_xref="UniProtKB/TrEMBL:G8ZYE1"
                     /translation="MARRKAQINNLFICTVICLSIIAAVEYFKYGTRINYEWFHCTPV
                     VEKIGTPESSVIMLSSRGGPSCDKRGEFKTIVKRISRDFEPNNEHLSFCIKENLEVPP
                     VHYPIHENKGLPGYIAYAGYDKDYSLVKEMCADTQIYHF"
     gene            complement(<101552..>103150)
                     /gene="TDEL0G00500"
                     /locus_tag="TDEL_0G00500"
                     /db_xref="GeneID:11504396"
     mRNA            complement(<101552..>103150)
                     /gene="TDEL0G00500"
                     /locus_tag="TDEL_0G00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682580.1"
                     /db_xref="GeneID:11504396"
     CDS             complement(101552..103150)
                     /gene="TDEL0G00500"
                     /locus_tag="TDEL_0G00500"
                     /inference="similar to DNA sequence:INSDC:YMR297W"
                     /note="similar to Saccharomyces cerevisiae PRC1 (YMR297W);
                     ancestral locus Anc_5.27"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682628.1"
                     /db_xref="GeneID:11504396"
                     /db_xref="GOA:G8ZYE2"
                     /db_xref="InterPro:IPR001563"
                     /db_xref="InterPro:IPR008442"
                     /db_xref="InterPro:IPR018202"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8ZYE2"
                     /translation="MKSFGTLAVALSAAVVNGLSFQQPFAFEEHGSSLLEKAIEAWKQ
                     DPKAVAGLMSDEVRKSWDELPLKFPAEISQMQFVTKPKDPSAIFTRKQWDATVESEDL
                     ENYQLRVNKIKDPKILGIDGDVKQYSGYLDVRDEDKHFFFWTFESRNDPENDPVVLWL
                     NGGPGCSSLTGLFFELGPSSIGEDIKPIHNPYSWNNNATVIFLDQPVNVGFSYSGSEG
                     VTDTVAAGKDVYAFLQLFFKQFPEYAANGQDFHIAGESYAGHYIPVFATEILSHPVSK
                     RNFNLTSVLIGNGLTDPLNQYPAYEPMACGEGGEPAVLEPEECQSMSDSLDRCLGLIQ
                     SCYESESVWSCVPASIYCNNAQINPYSRTGKNVYDIRKECEGQLCYKDMQFIDDYLNL
                     DYVKEAVGAEVDKYESCNFDINRNFLFAGDWMKPYHKAVSELLNQDIPVLIYAGDKDF
                     ICNWLGNKLWTDVLPWKSADEFAKQPVRHWVANLTNEKSGEVKSFEQLTYLRVYGGGH
                     MVPYDVPENALSMLNEWIHGNFTI"
     gene            complement(<103987..>104874)
                     /gene="TDEL0G00510"
                     /locus_tag="TDEL_0G00510"
                     /db_xref="GeneID:11504397"
     mRNA            complement(<103987..>104874)
                     /gene="TDEL0G00510"
                     /locus_tag="TDEL_0G00510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682581.1"
                     /db_xref="GeneID:11504397"
     CDS             complement(103987..104874)
                     /gene="TDEL0G00510"
                     /locus_tag="TDEL_0G00510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682629.1"
                     /db_xref="GeneID:11504397"
                     /db_xref="GOA:G8ZYE3"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZYE3"
                     /translation="MSAFAESDFNADRYDRSRPSYPSDFYRILDQYHKGQRHLLVDVG
                     CGPGTATLQMAKELREFDKIIGTDISDAMVKKAQQSQSTVKHERLSFALVPSDDFSFL
                     GPVENDRQVVDMITAVECVHWFDYQKFQASIAANLRSNGTIAIWGYADAVFIDYPDLD
                     DILDDVAYGSDQLGPYWEQPGRKILRTMLANWSFNLDKFTDIREVNLKATSLRTTSVS
                     EIQPQPLVIVKEMTVADYAAYVKTWSAYHAWYKKFGDSKPDVTEEFVKRVNSTYPELT
                     ANSTVKVAWNTFYKFARRI"
     gene            complement(<105980..>106867)
                     /gene="TDEL0G00520"
                     /locus_tag="TDEL_0G00520"
                     /db_xref="GeneID:11504398"
     mRNA            complement(<105980..>106867)
                     /gene="TDEL0G00520"
                     /locus_tag="TDEL_0G00520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682582.1"
                     /db_xref="GeneID:11504398"
     CDS             complement(105980..106867)
                     /gene="TDEL0G00520"
                     /locus_tag="TDEL_0G00520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682630.1"
                     /db_xref="GeneID:11504398"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZYE4"
                     /translation="MSAFAQTDFNSDRYERCRPTYPNEFFQILDNYHQDKQRLLVDVG
                     CGPGTATIQMAGEWKAFDRIIGTDLSPAMIQTANQLSNTVHDNRLSFYVSSSDDFAFL
                     GPNYKNQQTVDMITAAECAHYFDEKRFQGAVASNLRSRGTIAIFGYGDAIFLDYPKTD
                     AIINDVSYGKEKLGSLWDEPGRTIAREMLAKWSFDPKFFTDIEDFSLQATTLRSTAAS
                     ELPQKPLLIIREMTVAEYASNIRTWSAYHTWQKKFGGSKPELGNEFIKNVNKVYPELT
                     ASTKVRVAYSTYYKFARRI"
     gene            <108042..>109709
                     /gene="TDEL0G00530"
                     /locus_tag="TDEL_0G00530"
                     /db_xref="GeneID:11504399"
     mRNA            <108042..>109709
                     /gene="TDEL0G00530"
                     /locus_tag="TDEL_0G00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682583.1"
                     /db_xref="GeneID:11504399"
     CDS             108042..109709
                     /gene="TDEL0G00530"
                     /locus_tag="TDEL_0G00530"
                     /inference="similar to DNA sequence:INSDC:YMR296C"
                     /note="similar to Saccharomyces cerevisiae LCB1 (YMR296C);
                     ancestral locus Anc_5.28"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682631.1"
                     /db_xref="GeneID:11504399"
                     /db_xref="GOA:G8ZYE5"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8ZYE5"
                     /translation="MAHIPQVLPSSIPIPSFVVKTYSYVWYYLYAILMKIPGGPYVIS
                     YVRKSHQDDPYRTAVEIILILYGIGYYLSKPQQKTGLQGTKPNLTEQEVELLIEDWQP
                     ESIVDESAMELQRWRLEKMPVLEMGENENRVTVTRNEGSERYTDVLNLASNNFLQLAG
                     TPEVVEIVKKTIRNYGVGACGPAGFYGNQDVHYNFQYALAEFFGTEDAVLYGQDFCVA
                     SSVLPAFTKRGDLIVADDQVSISSQNALQLSRSTVYYFEHNNMESLEALLQELTEMEK
                     KERLPAISRKFIVTEGLFHNSGDIPPLPVLTHLKNKYKFRLFVDETFSLGVLGASGRG
                     LAEHFNMERASSIDVTIGSMATALGSSGAFVLGDHVMSHHQQIGSNAYCFSASLPAYT
                     TTAATQVLKIMDRDNSAVTRLHQLSQQLHDFFNSDSQLSDFITVTSHERSPVLHIQLT
                     PELRSSKFNYTAQELFETVSHLQKRCVTTKFVEPYEQEEQFLQSIVDTLLSQHGILIT
                     RNTIVLRQETLPVVPSLKVCINSNIEDSELTTACNAIKASILHYCSH"
     gene            <109955..>110551
                     /gene="TDEL0G00540"
                     /locus_tag="TDEL_0G00540"
                     /db_xref="GeneID:11504400"
     mRNA            <109955..>110551
                     /gene="TDEL0G00540"
                     /locus_tag="TDEL_0G00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682584.1"
                     /db_xref="GeneID:11504400"
     CDS             109955..110551
                     /gene="TDEL0G00540"
                     /locus_tag="TDEL_0G00540"
                     /inference="similar to DNA sequence:INSDC:YGR273C,YMR295C"
                     /note="similar to Saccharomyces cerevisiae YGR273C and
                     YMR295C; ancestral locus Anc_5.29"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682632.1"
                     /db_xref="GeneID:11504400"
                     /db_xref="InterPro:IPR018809"
                     /db_xref="UniProtKB/TrEMBL:G8ZYE6"
                     /translation="MMHFRKKSSSSGNSDGSGGHGGQQAKVQISREDADRLKIRTGSI
                     ADPILEAVQEAQPFEQAAETFQDNMNRKSYFSVDGSGVLRDVFGQPINQPDVSNPTRA
                     RDERPLDTIRSFEYAVSGDPSWAQQLETPQYGFRVRPDFPLFASNPYGAPQGMAPQQQ
                     SYAEQTVYQAPVDTGEQQKKRKERFLWKEEEQELIKAY"
     gene            <110877..>111554
                     /gene="TDEL0G00550"
                     /locus_tag="TDEL_0G00550"
                     /db_xref="GeneID:11504401"
     mRNA            <110877..>111554
                     /gene="TDEL0G00550"
                     /locus_tag="TDEL_0G00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682585.1"
                     /db_xref="GeneID:11504401"
     CDS             110877..111554
                     /gene="TDEL0G00550"
                     /locus_tag="TDEL_0G00550"
                     /inference="similar to DNA sequence:INSDC:YGR272C"
                     /note="similar to Saccharomyces cerevisiae YGR272C;
                     ancestral locus Anc_5.30"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682633.1"
                     /db_xref="GeneID:11504401"
                     /db_xref="InterPro:IPR019310"
                     /db_xref="UniProtKB/TrEMBL:G8ZYE7"
                     /translation="MAYNAQQNKRLRSKGSSLEMAQFIDAGANKIKKRIRDLERLLSR
                     KRDSLPDTIIVEKERTLEALKFELENAKLKSKVKDNAKKYHMVRFFERKKALRKYKKA
                     LKAVEELKENEKSKDALLQSKIDLCYVVNFPKTEKYIALYPTGEELSDKSGLEKTELR
                     KKAFRDLIAKQLEEGTLPVSLEAILSGKRLDKEGSGVSLVESNVEKKEQSPDEKHEEE
                     EEDEFFE"
     gene            complement(<111606..>117485)
                     /gene="TDEL0G00560"
                     /locus_tag="TDEL_0G00560"
                     /db_xref="GeneID:11504402"
     mRNA            complement(<111606..>117485)
                     /gene="TDEL0G00560"
                     /locus_tag="TDEL_0G00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682586.1"
                     /db_xref="GeneID:11504402"
     CDS             complement(111606..117485)
                     /gene="TDEL0G00560"
                     /locus_tag="TDEL_0G00560"
                     /inference="similar to DNA sequence:INSDC:YGR271W"
                     /note="similar to Saccharomyces cerevisiae SLH1 (YGR271W);
                     ancestral locus Anc_5.31"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682634.1"
                     /db_xref="GeneID:11504402"
                     /db_xref="GOA:G8ZYE8"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZYE8"
                     /translation="MSTQYSVDSAGSYMQAMQVMAEVSESLSFERMKRTSPHENDGKG
                     KTSSKSVDNKMALTVLAQDKNDWDAIFEEFKNLSFEKLNSVLKSHKKGSSKATYRKML
                     RLIQNCSSPLPQDVLLESILEILHAQDKSQLESELLNLLGAGNIEIISFVLQSKKQLA
                     SQPIDQTLHLILNPDSSSRLMTNREMKEQVAENAYLAKNQKLNAAEKVVKYPHVFRKY
                     EQGGSSILSVSGQKYTLPVGTTRSSLQTHEEIRIPAADQAAHRKSLYTKLLKVNDLDR
                     YCKAVFSYETLNQIQTLVYPVAYETNENMLICAPTGAGKTDVALLTIINTIKQFSIIN
                     ELGDIDIQYDDFKVVYVAPLKALAAEIVDKFQKKLSCFDIKVRELTGDMQLKKSEIME
                     TQIIVTTPEKWDVVTRKANGDNSLVSKVKLLIVDEVHLLHEDRGSVIETLVARTLRQV
                     ESSQSMIRIIGLSATLPNFMDVADFLGVNRQVGMFYFDQSFRPKPLEQQLLGCRGKDG
                     SKQCKENIDKVSYEKLIEMIQNGYQVMVFVHSRKDTVRSSRTFISMAQSNGELDLFAP
                     DPTMQTKYAKELAKNRDRDIKEIFQFGFGVHHAGLARTDRNLTERMFKDGAIKVLCCT
                     ATLAWGVNLPADCVIIKGTQVYDSKKGGFTNLGISDVIQIFGRAGRPGFGSANGTGIL
                     CTSSDSLDDYVSLLTQQHPIESKFGSKLVDNLNAEISLGSVTNVEEAVQWLGYTYMFV
                     RMRKNPFTYGIDWEEVASDPQLYDKRKTMIVNAAKRLHTLQMIVYDEVQLNFIPKDLG
                     RVSSDFYLLNESVEIFNQMCDPRATEADVLSMISYSSEFDGIKFREEEATELARLSET
                     AAECQIGGNLDTPQGKTNLLLQAYISQTRIMDSALASDSNYVAQNSARICRALFLIGM
                     NRRWGKFAKVMLDICKSIEKRIWTFDHPLCQFDLPDNILRQIRSKNPSMEHLLDLDPE
                     ELGELVHNRKMGSKLFSILNKFPKIDIDAEIFPITANVMRIHVTLSPNFAWDYRIHGE
                     AQFFWVTIEESDKSQILHFEKFILNKRQLANSHEMDFMIPLSDPLPPQVVVKAVSDNW
                     IGCESVHVISFQHLIRPHNETLQTKLQRLRPLPIQALQNPLVESIYPFKYFNPMQTMT
                     FHTLYNTNENVFVGSPTGSGKTVVAELAIWHAFRDYPGKKIVYIAPMKALVRERVDDW
                     RKRITPVTGDRVVELTGDSIPDPRDIRDSTIVITTPEKFDGISRNWQTRQFVQDISLV
                     IMDEIHLLASDRGPILEMIVSRMNYIASRTRQPVRLLGMSTAVSNAYDMAGWLGVKSR
                     GLYNFPSSVRPVPLKMYIDGFPDNLAFCPLMKTMNKPAFMAIKQHSPHKPALIFVASR
                     RQTRLTALDLIHLCGMEDNPRRFLNIDDDEELRYYLSQITDDTLRLSLQFGIGLHHAG
                     LVEKDRTISHQLFQKNKIQILIATSTLAWGVNLPAHLVIIKGTQFFDSKIEGYRDMDL
                     TDILQMMGRAGRPAYDTTGTAIVYTREAKKMFYKYFLNVGFPVESSLHKVLDDHVGAE
                     IASGAISNKQEAMDFLNWTFFFRRAHHNPTYYGIEEDTTTAGVNKALSALIDTTISNL
                     EKSQCVETFGTEIECTPFLSIASYYYLSHKTIRTLLSQIHDKASFKEVLKWLSLAEEF
                     NELPVRGGEMIMNVEMSAQSRYSVESTFNDQNEINMFDPHIKAFLLLQAHLSRVNLPI
                     ADYIQDTISVLDQSLRILQAYVDVASELGYLSTVLTIIKCMQSVKQGYWYEDDPVGIL
                     PGCSLTRRDENLFDERGFIIKEVEAKPLLSLQKIGEMGYKKLQSVMNTLNVHEDERKQ
                     FLHVCQRLPVLADIQVEEQENAEKLVIFAKHAGSKWNKHFEVYCEKFPKMQKELWFVI
                     AYQGNELMMIKRCQPREHGKEVKIICDFIVPEELMGKKLTFLIINDALDLKYELEYQL
                     K"
     gene            complement(<117619..>118719)
                     /gene="TDEL0G00570"
                     /locus_tag="TDEL_0G00570"
                     /db_xref="GeneID:11504403"
     mRNA            complement(<117619..>118719)
                     /gene="TDEL0G00570"
                     /locus_tag="TDEL_0G00570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682587.1"
                     /db_xref="GeneID:11504403"
     CDS             complement(117619..118719)
                     /gene="TDEL0G00570"
                     /locus_tag="TDEL_0G00570"
                     /inference="similar to DNA sequence:INSDC:YMR294W"
                     /note="similar to Saccharomyces cerevisiae JNM1 (YMR294W);
                     ancestral locus Anc_5.32"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682635.1"
                     /db_xref="GeneID:11504403"
                     /db_xref="UniProtKB/TrEMBL:G8ZYE9"
                     /translation="MEFIDISADDGNIDDLGEIDTSGQEVYECAALEELDQEDIQDKP
                     SNYGGSLDYESATPIKETRKMMEGPGLEKLMNNLVIANTSYNNPIAPESVEKRLLRIE
                     KELEDISGDQLRDLSPQTAQKLKDTKGLYSQVSKAYKDRLGTIRKVLTEELEADGELE
                     MISLPCIAFDTKDMRRLLNLERRVHNIETLVGPRELTDKSLATELGELAAQAKLIHND
                     SETLDQFHRRVQEIEKEYENSLLGRKSKDDRVLHRHAVDQMESQESRVNELYRYLGVL
                     KKYGPILPQLTNRIKEINGISMKQTESLNIIRTIDVSIEDLQKQVQQWEEVTQTMEQK
                     LTAQEVELEENIKYFNHTVAKLEDRIRPSNSC"
     gene            <119181..>120575
                     /gene="TDEL0G00580"
                     /locus_tag="TDEL_0G00580"
                     /db_xref="GeneID:11504404"
     mRNA            <119181..>120575
                     /gene="TDEL0G00580"
                     /locus_tag="TDEL_0G00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682588.1"
                     /db_xref="GeneID:11504404"
     CDS             119181..120575
                     /gene="TDEL0G00580"
                     /locus_tag="TDEL_0G00580"
                     /inference="similar to DNA sequence:INSDC:YMR293C"
                     /note="similar to Saccharomyces cerevisiae YMR293C;
                     ancestral locus Anc_5.33"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682636.1"
                     /db_xref="GeneID:11504404"
                     /db_xref="GOA:G8ZYF0"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR004412"
                     /db_xref="InterPro:IPR020556"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="UniProtKB/TrEMBL:G8ZYF0"
                     /translation="MSLKTALSRIRSIPELQKRYNIFINIDPSAEKRLVDNADKELPL
                     SHLVAGIKDNIVTKDLPTTCASKILETYQSPYDATCVRRLREAGVVIAGKTNLDEFGM
                     GSGGIHSHFGPVLNPLYPSTKITAGGSSSGSAAAVAAGAVDFALGTDTGGSVRLPAAF
                     NAVLGFKPSYGRISRYGVVAYAQSLDTVGILSKGMPVLRKVYNVLNEYDSKDPTSLSN
                     DLRKKANKLFKEKGKLRIGIPQEFLQASISADYKNLFFRFIKELMDMGHEFYPVTIPS
                     VKDSLPIYYTLSPAEAVSNLSRYDGIRYGTRADTTDIENGTLFAPTRANFGREVQDRI
                     ILGNYNLCSETFKNNYVKAQKLRVGLMNDFDEIFRGPNIISNSKGNVSGVDLIISLTA
                     TGPPSTIESFTSAENSSPTNEYLNDVFTMPMSLAGLPTLSIPLGNDVPLGVQVTAQFA
                     DDETVLNFADRIVN"
     gene            complement(<120616..>124500)
                     /gene="TDEL0G00590"
                     /locus_tag="TDEL_0G00590"
                     /db_xref="GeneID:11504405"
     mRNA            complement(<120616..>124500)
                     /gene="TDEL0G00590"
                     /locus_tag="TDEL_0G00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682589.1"
                     /db_xref="GeneID:11504405"
     CDS             complement(120616..124500)
                     /gene="TDEL0G00590"
                     /locus_tag="TDEL_0G00590"
                     /inference="similar to DNA sequence:INSDC:YGR270W"
                     /note="similar to Saccharomyces cerevisiae YTA7 (YGR270W);
                     ancestral locus Anc_5.34"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682637.1"
                     /db_xref="GeneID:11504405"
                     /db_xref="GOA:G8ZYF1"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZYF1"
                     /translation="MGRHLRDRHNGGERRADHGELGEIKDRNGIIHTTSRSLRKVNYA
                     EVESGFDYLDDEDGNSENAEENTREPQVDKEEIYAAEEVEVPKKRLNDPEAEDESFHE
                     DDGEGEAMDDDDDSENSADDGFYGRNDVKRRRRMADKSFVVADPDDDDDIDDEDEDED
                     EDDVALRASRRRRSARQRVRPETPPRRMSRRLRSRTRMHDHDEDEVHRHHDLDDEALS
                     LEEEIRELQEDSPIREKRSLRERTKPVNYRLPPPLSEANAEEHANRQNTSSFMNPSPR
                     RGRGGWNASQNMGPTRRLFPTGGPFGGNDVTTIFGQNTNFYNHGPSGENNKLLIDSDS
                     SEDEILPLGATPKPKSNSLKKKKKPEIADLDPLGVDMNVKFGDIGGLDNFIDQLKEMV
                     ALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALAASCSSEGHKITFFMRKGAD
                     ILSKWVGEAERQLRLLFEEAKKQQPAIIFFDEIDGLAPVRSSKQEQIHASIVSTLLAL
                     MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPLPNLESRAQILRIHTKSWK
                     TSLSDDFVKHLALLTKGYGGADLRALCTEAALLSIQRKYPQIYQSDEKLVVDPSQVKT
                     STGDFMLALKKIIPSSARSTGNTAQPLPESLKPLLGMQFEAVKMKLQRIFPEDDNLVK
                     SSSSLIQHYLEYEDDTETNEGTGGFAHRALIDRIANSRICNPKLLLTGPAGNGQQYIG
                     SAILNYFEQFNVQRLDLATLVSDSGRTLESAVVQSFLEARKRQPSVIFIPNIEVWCRA
                     VPESVILTLSTLLRSLQGNERVLLLGVSDTVHQNDLLSGPIAHFEFGREVLNIEEPTS
                     HQRKEYFSFIAQLLRMKPTSFITNRKRSKPLPKLPLAKEDNKPDENKDESEQSSCDAL
                     RKKLKSFQRQDLRLKNVLKIKLSGLMDLFKSRYKRFRKPPVDDAFLVHLFEPQTDPNW
                     QPAYVKDNDMILEVASGRRFYNMDLDLIEERLWNGYYSEPKQYLKDIELIYRDATTTG
                     DRERVIKASEMFANAQMGIEEMSTADFIHDCKATRQRDLERQELFLRDEEVRVEKEKQ
                     QLKNAEANGDIMDNTVSEGVAAGSQLQAQLQFNDEEEIGPQPDQSPDDDPKKEEISST
                     AQQSEEQHQTTPMDNPATGLQTHSEHNVNRKEETVQADNKDHASAEGSDEEAEEDEKG
                     DAKESESDCERENSRTSESEAEDADASHELIVDEDLLKEIVILLVKKTKGYTVSALEK
                     LHSDLTEIIWTERFVWDRTRTAVKVKEYITGI"
     gene            complement(<124963..>125445)
                     /gene="TDEL0G00600"
                     /locus_tag="TDEL_0G00600"
                     /db_xref="GeneID:11504406"
     mRNA            complement(join(<124963..125276,125424..>125445))
                     /gene="TDEL0G00600"
                     /locus_tag="TDEL_0G00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682590.1"
                     /db_xref="GeneID:11504406"
     CDS             complement(join(124963..125276,125424..125445))
                     /gene="TDEL0G00600"
                     /locus_tag="TDEL_0G00600"
                     /inference="similar to DNA sequence:INSDC:YMR292W"
                     /note="similar to Saccharomyces cerevisiae GOT1 (YMR292W);
                     ancestral locus Anc_5.35"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682638.1"
                     /db_xref="GeneID:11504406"
                     /db_xref="GOA:G8ZYF2"
                     /db_xref="InterPro:IPR007305"
                     /db_xref="UniProtKB/TrEMBL:G8ZYF2"
                     /translation="MWLSESQTLGNVLFLVGVLLIIGPQKTYIFFTRPNKRRGSFFLV
                     LGVLLILSKWTFIGFLIESLGIIGLFGDFFGVAVQFLRSLPIVGPILSHPAVAPVVDR
                     LAGIRVLPV"
     gene            <126581..>127141
                     /gene="TDEL0G00610"
                     /locus_tag="TDEL_0G00610"
                     /db_xref="GeneID:11504407"
     mRNA            <126581..>127141
                     /gene="TDEL0G00610"
                     /locus_tag="TDEL_0G00610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682591.1"
                     /db_xref="GeneID:11504407"
     CDS             126581..127141
                     /gene="TDEL0G00610"
                     /locus_tag="TDEL_0G00610"
                     /inference="similar to DNA sequence:INSDC:YGR268C"
                     /note="similar to Saccharomyces cerevisiae HUA1 (YGR268C);
                     ancestral locus Anc_5.36"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682639.1"
                     /db_xref="GeneID:11504407"
                     /db_xref="UniProtKB/TrEMBL:G8ZYF3"
                     /translation="MPGDLPTYEEVLKEDAQRVQSSQSAPAPTSPPPRPARPARPSSS
                     KPTGQLPRPTHPAAPAQPNLPWRYPHGYHCSKCNNSGYKLKNGRSCKSCWRRFAPPNN
                     SNSVPALTYGRSYPSSSYGIRPMFQGSAPIAQPYNSMGQPIVVSPGDPRLGGVLCGEC
                     RGTGRVTFLFDEDICPLCRGIGRLVA"
     gene            <127308..>128039
                     /gene="TDEL0G00620"
                     /locus_tag="TDEL_0G00620"
                     /db_xref="GeneID:11504408"
     mRNA            <127308..>128039
                     /gene="TDEL0G00620"
                     /locus_tag="TDEL_0G00620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682592.1"
                     /db_xref="GeneID:11504408"
     CDS             127308..128039
                     /gene="TDEL0G00620"
                     /locus_tag="TDEL_0G00620"
                     /inference="similar to DNA sequence:INSDC:YGR267C"
                     /note="similar to Saccharomyces cerevisiae FOL2 (YGR267C);
                     ancestral locus Anc_5.37"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682640.1"
                     /db_xref="GeneID:11504408"
                     /db_xref="GOA:G8ZYF4"
                     /db_xref="InterPro:IPR001474"
                     /db_xref="InterPro:IPR018234"
                     /db_xref="InterPro:IPR020602"
                     /db_xref="UniProtKB/TrEMBL:G8ZYF4"
                     /translation="MYHPQVEALQARQGTPLNTRPVSPYTLRLPVDEDGFSWPSVGTR
                     ERAQESEEQENARIERISGAVKTILEELGEDVTREGLLDTPTRYAKAMLYFTRGYQIN
                     IMDDVIKNAVFQEDHDEMVIVRDIEIYSLCEHHLVPFYGKVHIGYIPNKNVLGLSKLA
                     RLAEMYARRLQVQERLTKQIAMALSEILKPMGVAVVIEATHMCMVSRGIQKTGSATVT
                     SCMMGCFRAHRTREEFLSLLGKKSL"
     gene            complement(<128151..>129764)
                     /gene="TDEL0G00630"
                     /locus_tag="TDEL_0G00630"
                     /db_xref="GeneID:11504409"
     mRNA            complement(<128151..>129764)
                     /gene="TDEL0G00630"
                     /locus_tag="TDEL_0G00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682593.1"
                     /db_xref="GeneID:11504409"
     CDS             complement(128151..129764)
                     /gene="TDEL0G00630"
                     /locus_tag="TDEL_0G00630"
                     /inference="similar to DNA sequence:INSDC:YMR291W"
                     /note="similar to Saccharomyces cerevisiae YMR291W;
                     ancestral locus Anc_5.38"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682641.1"
                     /db_xref="GeneID:11504409"
                     /db_xref="GOA:G8ZYF5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020675"
                     /db_xref="InterPro:IPR020679"
                     /db_xref="UniProtKB/TrEMBL:G8ZYF5"
                     /translation="MATAQLPSVTTTAVATPPDSEGKVADDYVPWPVLDKSPGTAPCK
                     YVTRGNMLGDGHFSVVKECMNVYTKDLYAMKLVHKSMIKGKLPLIQREVKLLRLVSDK
                     VRQLEKKEFRTFDVFEGHHHVLQLFDFFETSESIALITQLCEKGDLYEKIIDSGSLDL
                     ELQAKSYCACLLSVLEFLHANGVVHRDLKAENVLFRSRVNKNEPDEHHGDFNYDLKAH
                     DVILADFGLATQIDSNTSSTCLKEFVGTMSYIAPEIVRCKGVGSLSQNEVAKLESYSY
                     PVDIWALGVLTYFMALGYTPFDCDNDEETLECIQKVDYYVDEEMRADPKMKEFWSFLQ
                     CCFIEDPAKRPSAALLKHHPFVKDFFATSAADANAIEIPESLKRSGSTSSLHSLRQPS
                     RSTSSSTLAYLAINNNTSPSITAQSSKSGTPLYLEPRSTRDRNLRQVRETLRKTLSMT
                     SLRNANASLPTVESKLNSTFVLEPKPPTNSLMNGCYSTTPESKSNLSTPKSLSRQSST
                     NSVYVTNQTASVDDYMNDDDDDEDMGIMI"
     gene            complement(<130283..>132397)
                     /gene="TDEL0G00640"
                     /locus_tag="TDEL_0G00640"
                     /db_xref="GeneID:11504410"
     mRNA            complement(<130283..>132397)
                     /gene="TDEL0G00640"
                     /locus_tag="TDEL_0G00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682594.1"
                     /db_xref="GeneID:11504410"
     CDS             complement(130283..132397)
                     /gene="TDEL0G00640"
                     /locus_tag="TDEL_0G00640"
                     /inference="similar to DNA sequence:INSDC:YGR266W"
                     /note="similar to Saccharomyces cerevisiae YGR266W;
                     ancestral locus Anc_5.39"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682642.1"
                     /db_xref="GeneID:11504410"
                     /db_xref="UniProtKB/TrEMBL:G8ZYF6"
                     /translation="MSFGENWFDSWDPESLYAESVVGCNGCVEGSPIESSGIVVGPVL
                     RLKKVDYELGIYNGSVLIVTRDLQDAVPRIQFTVGCSLKSDLKVSSKPRNGEFESTLF
                     HEETWDESVYRFFRYNIEIPLADIEQMVKYSVDGRNEPHYRFFIPSKTTNFNTISYSC
                     NGFSLNVDTTKFKGSMWFDILNKHAKVRYNVMLGGGDQIYSDGIEVFCEKVKEWAQRK
                     KLIHKFTTKVDAEFRRQLDAFYLREYIEWYGYGHWRGSTPKSKCTQKCFPYAMATIPS
                     VNIWDDHDIIDGFGSYSDTFMKTDVFSSIGKFAYKYYMLFQHHVSLNEREAYLEDPIW
                     LLGKKPSPYIEEVNHSVFTRIGPTMGLLGLDCRTERKLKEIVSESTYEIVFKKLAQEA
                     QAAKMDHLMVMLGVPIAYPRMVLMEWIFSSRLLSPLRKLSRRTAFASGLVNDFNGDIE
                     LLDDLNDHWCARHHKKERNMLMGRLQDFGAKYGVRVTILSGDVHLASIGRFKTKRHRH
                     HLYNTSEDEKHNAKVDNEPENDLRLMFNVISSAVVNTPPPNPMVTLLQSKANVHHFDH
                     ETDEDAVPLFNIEVSGAGNRREKCFLNRRNWSDIIPVENALKNEYLAKLYNVKIGDKV
                     MPGIVSPATGLYREESTKKLAEKGFFQYPITEKGVVVSLNMETEPENPHSKSTRYCLP
                     IPELRTTCAALSHSGLKHWNLK"
     gene            <132659..>134116
                     /gene="TDEL0G00650"
                     /locus_tag="TDEL_0G00650"
                     /db_xref="GeneID:11504411"
     mRNA            <132659..>134116
                     /gene="TDEL0G00650"
                     /locus_tag="TDEL_0G00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682595.1"
                     /db_xref="GeneID:11504411"
     CDS             132659..134116
                     /gene="TDEL0G00650"
                     /locus_tag="TDEL_0G00650"
                     /inference="similar to DNA sequence:INSDC:YMR290C"
                     /note="similar to Saccharomyces cerevisiae HAS1 (YMR290C);
                     ancestral locus Anc_5.40"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682643.1"
                     /db_xref="GeneID:11504411"
                     /db_xref="GOA:G8ZYF7"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZYF7"
                     /translation="MSESRKRSAEEESMENDDVVEEFSGLNLSDATMKAVEKMGFSSM
                     TPVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIERLHSLKFKPRNGTGVIVITPT
                     RELALQIFGVARELMEFHSQTYGIVIGGANRRQEADKLAKGVNMLIATPGRLLDHLQN
                     TKGFVFKNLKALVIDEADRILEIGFEDEMRQIIKILPNDDRQSMLFSATQTTKVEDLA
                     RISLRPGPLFINVVSEKDNSTADGLEQGYVVCDSDKRFLLLFSFLKRNQKKKVIVFLS
                     SCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDVAARGLDI
                     PAVDWIIQFDPPDDPRDYIHRVGRTARGTKGKGKSLMFLTPSELGFLRYLKAAKVPLN
                     EYEFPTNKIANVQSQLEKLIKSNYYLHQTAKDGYRSYLQAYASHSLKTVYQIDKLDLA
                     KVAKSYGFPVPPKVNITIGASGKTPQVKKRKINKN"
     gene            <134384..>136636
                     /gene="TDEL0G00660"
                     /locus_tag="TDEL_0G00660"
                     /db_xref="GeneID:11504412"
     mRNA            <134384..>136636
                     /gene="TDEL0G00660"
                     /locus_tag="TDEL_0G00660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682596.1"
                     /db_xref="GeneID:11504412"
     CDS             134384..136636
                     /gene="TDEL0G00660"
                     /locus_tag="TDEL_0G00660"
                     /inference="similar to DNA sequence:INSDC:YGR264C"
                     /note="similar to Saccharomyces cerevisiae MES1 (YGR264C);
                     ancestral locus Anc_5.41"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682644.1"
                     /db_xref="GeneID:11504412"
                     /db_xref="GOA:G8ZYF8"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014758"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="InterPro:IPR018285"
                     /db_xref="InterPro:IPR023458"
                     /db_xref="InterPro:IPR029038"
                     /db_xref="UniProtKB/TrEMBL:G8ZYF8"
                     /translation="MSVQIAFDKVKGRQQALSLSNNLKITLALEYASKDFKIAVNEEL
                     EGPQLINGDNLRLIDTDAILRYILNDFEGQRSDEYHYALSSLESLFQKNDIPEQHVEA
                     CVSKSLDNYLLSLEEPLSATRLITFANTYALRPELVQKKFSELPKKITDALQACKKLS
                     PRSSEDFKRTGAVNVTNDYKVKEQDKEILPKENERNVLITSALPYVNNVPHLGNIVGS
                     VLSADIFARYCKARNYNTLFICGTDEYGTATETKALEEGVSPRELCDKYHKIHSDVYK
                     WFQIGFDYFGRTTTNQQTEIAQEIFTKLNNNGYLEEQTMKQLFCPVHKSFLADRFVEG
                     VCPKCHYEDARGDQCDKCGGLLDPFELINPRCKLDNATPEIRFSDHVFLSLDKLEGSV
                     ADWVKKSSVEGNWSKNSKTITNAWLKDGLKPRCITRDLIWGTPVPLEKYSDKVLYVWF
                     DATIGYPSITANYTKKWEQWWRNPDHVKLYQFMGKDNVPFHTVIFPGSQLGTGDKWTM
                     LHHLNTTEYLQYEGGKFSKSRGVGVFGNNAQDSGVSPSVWRYYLAAVRPESSDSHFSW
                     DDFVARNNSELLANLGNLVNRLVKFVNAKYNGVVPNYNIKNLANFPTLKKDIDEILSS
                     YIDEMELGHERRGLEIAMSLSARGNLFLQENKLDNTLFSEHPDKADAVVGVGLNIVYA
                     VASVVGPFIPETAEKIYKMLNAPALKIDNEFHLAILGGHNISKAEYLFQRIDEKQIEQ
                     WRQKYGGKQT"
     gene            <136909..>137700
                     /gene="TDEL0G00670"
                     /locus_tag="TDEL_0G00670"
                     /db_xref="GeneID:11504413"
     mRNA            <136909..>137700
                     /gene="TDEL0G00670"
                     /locus_tag="TDEL_0G00670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682597.1"
                     /db_xref="GeneID:11504413"
     CDS             136909..137700
                     /gene="TDEL0G00670"
                     /locus_tag="TDEL_0G00670"
                     /inference="similar to DNA sequence:INSDC:YGR262C"
                     /note="similar to Saccharomyces cerevisiae BUD32
                     (YGR262C); ancestral locus Anc_5.43"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682645.1"
                     /db_xref="GeneID:11504413"
                     /db_xref="GOA:G8ZYF9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008266"
                     /db_xref="InterPro:IPR010440"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR022495"
                     /db_xref="UniProtKB/TrEMBL:G8ZYF9"
                     /translation="MSQDIVKKISSCLGPNIPIESVAQGAEAVVFSTTVHPYHPNAGT
                     DKKYIVKYRPPKRYRHPSIDQALTKRRTLGESRLLSKLYLIEGLNVPKLIACDPYNGC
                     IWLEFLGQELPNGNGFSNLKNFLWMYASKGYNPHDNVVKETLHAVGQQIGLLHWNDYC
                     HGDLTSSNIVLGKVKDGWKAYLIDFGLSSTSNLVEDKGVDLYVLERAIMSTHSSYADD
                     YNAWLLEGFSQVYQSQGSKGETKLKEVLNRFNEVRLRGRKRSMIG"
     gene            complement(<137784..>138947)
                     /gene="TDEL0G00680"
                     /locus_tag="TDEL_0G00680"
                     /db_xref="GeneID:11504493"
     mRNA            complement(<137784..>138947)
                     /gene="TDEL0G00680"
                     /locus_tag="TDEL_0G00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682598.1"
                     /db_xref="GeneID:11504493"
     CDS             complement(137784..138947)
                     /gene="TDEL0G00680"
                     /locus_tag="TDEL_0G00680"
                     /inference="similar to DNA sequence:INSDC:YMR289W"
                     /note="similar to Saccharomyces cerevisiae YMR289W;
                     ancestral locus Anc_5.44"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682646.1"
                     /db_xref="GeneID:11504493"
                     /db_xref="GOA:G8ZYG0"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="UniProtKB/TrEMBL:G8ZYG0"
                     /translation="MGFKRRTGMKELTASQQKVMDVLQKEIIERYFNPAVDGDEFEIL
                     STIRYDPCFTNVFLDLPNGEHSSHLCEIDSRLRLLDYDQCEDLFSQEHPTTCENQGLD
                     SLFDTIRESSSSFGDYDDSLMSFLNRSEATERSSPPESSCDHADLYPVFYNRFLLLGE
                     HYKRLNFSLEFFKWGTHIPMKLLLEKLIEALPEHHEVSSIEEKMPLLLNESASYKMRV
                     LISKSGRMRVEAHPLVRPPSYFQFPSTSSYFINTILGGFLPNAPAVWNVFVDTKPMTV
                     SPFTTFKTTYRDHYGAARERLNEMASSYGQSARNEILVFNDAYQLMEGSITSVAIIKY
                     KEDDPNKFRFITSPLASGCLCGTMRYYLLKQGLIDEYPIDVRDLKEGDSVIFI"
     gene            <139083..>141476
                     /gene="TDEL0G00690"
                     /locus_tag="TDEL_0G00690"
                     /db_xref="GeneID:11504494"
     mRNA            <139083..>141476
                     /gene="TDEL0G00690"
                     /locus_tag="TDEL_0G00690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682599.1"
                     /db_xref="GeneID:11504494"
     CDS             139083..141476
                     /gene="TDEL0G00690"
                     /locus_tag="TDEL_0G00690"
                     /inference="similar to DNA sequence:INSDC:YGR261C"
                     /note="similar to Saccharomyces cerevisiae APL6 (YGR261C);
                     ancestral locus Anc_5.45"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682647.1"
                     /db_xref="GeneID:11504494"
                     /db_xref="GOA:G8ZYG1"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR026739"
                     /db_xref="InterPro:IPR026740"
                     /db_xref="UniProtKB/TrEMBL:G8ZYG1"
                     /translation="MVDSISRITSALESARVITLEAAAVASSKLSESSYTHYSQGIAP
                     EQLRDLLSSRNPREVKDGLRRLIAVIASGDNSIDAESYFADVVKNIIFNDAKVKMLVC
                     IYLQRFAERDTNLALLSINSLQKTLSDGNPDTRSLSIKALSDIKVPSLYPIVLHTLKK
                     AVSDPSATVRNEVSYAVLKLFIAQNEDIEDELIVLLKDLLSDADPQVISSAVLVLKEC
                     FPEKLELLSGHFRYFCNVLHELDSWSQVALIPLMINYTKKFIPRPTVVDTSSQESITL
                     PDRYNEIKFPVYDVMNHPDLDLFFRSLEKLVYSSNAAVIVASSNAFLQLATPVQFKKS
                     RFPQALMRVVSFSANRGIQISVLQTVLLLSSVDSTLFSPYIKKFFVLPSDCPTVGSLK
                     MKILSFLINESNVKMIVKELKYIISASGMPALVIAATNSLAECAKLSPGWEAHIIKDL
                     VSHMEVDKLPSSVLGSYVDVIRALVQRSPQRHLSSIMKLAEVLETRKSLDDKAKAGIV
                     WLFGEIAGFEYKICPDVLRKLVPGFAYEGPETRRQILLLSAKLLSYDIDNSKVEGSDE
                     QYDFDNSRIAQIYKYVLYLAEFDEEFDIRDRARTISSLFESGKHEIASLLFQAPKPTP
                     RVALALNDLNEEEIDEGQCDFSTFRLDSSVLAHHKMIPWNSKEEETSEYVEIPATLKD
                     YSRYKKSFSSEAPNRAGSRSFASSLEPATPSSNISSTGVTSRQGKKYRLQTLDEFFSD
                     IPTTSNASRKKKIVLQEESTSEEDDSDEAEPSDEYQEDDSDETSTSSLSSSSATDLV"
     gene            complement(<141517..>144399)
                     /gene="TDEL0G00700"
                     /locus_tag="TDEL_0G00700"
                     /db_xref="GeneID:11504495"
     mRNA            complement(<141517..>144399)
                     /gene="TDEL0G00700"
                     /locus_tag="TDEL_0G00700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682600.1"
                     /db_xref="GeneID:11504495"
     CDS             complement(141517..144399)
                     /gene="TDEL0G00700"
                     /locus_tag="TDEL_0G00700"
                     /inference="similar to DNA sequence:INSDC:YMR288W"
                     /note="similar to Saccharomyces cerevisiae HSH155
                     (YMR288W); ancestral locus Anc_5.46"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682648.1"
                     /db_xref="GeneID:11504495"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZYG2"
                     /translation="MMGLEMDYKRQLGGQYSISHDLKVSIREEASKNEQEDQLMQRMS
                     KKSSYAKEDEYHKRRLDREITGNGPQDGKRPLEVNDSDSQVVVKRSRWDVQSYQIPEK
                     TRQMNRDLEGTLMEFPGSNNVRFLKPSDQKHFALALQDKPIEDLTKEEQKERTLVSLL
                     LRIKNGNTASRKRAMKGLQEKCNDFGPQLIFDRLLPILIDQTLEDQERHLMIKVIGRV
                     LYMLGSSVGPYTHQILMVISPLLIDEDPIARETGREIITTLAHAAGLVGMLATMRPDI
                     DSEDEYVRNTTSRAMAVVAKALGVPNLIPFLNAVSHSKKSWRARHTGLKIILQIGLLL
                     KRDILPHLQGLMECVKDGLTDEHTPIRTIAANTIATLAQMSYPYGIESFNIVLEPLWR
                     GMRTHRGKVLASFLRALGNLIPLMDAEYAGYYTEEIMRVVNREFDSPDDEMKKAVLMV
                     LQKCCKTEGVTPKYLRQEVAPNFFKYFWVRRTALDRQLNKLVTYTTTILSEKVGAPFI
                     IENLLTPLRDEAEPFRTMAVHAVSKVVALLGIADLDERLEIRLIDALLIAFQEQTNHD
                     SGIFRGFGIVATALDKRMKPFLSPIISIILNHLKHKSPLVREHAADLCAILIPVIKNC
                     GELEMLNKLSIILYESLGEVYPEVLGSILSAMSSAVMCSNLSKLQPPINQIVPTLTPI
                     LRNRHRKVEINIIELIGRIASLAPEYVAPKEWMRICFELLELLKSPNKATRRVANETF
                     GSIARAIGPQDVLVALLNNLKVQERQLRVCSAIAIGIVAKSCGPYTALPAMMNEYKTP
                     ETNVQNGILKALAFMFEYIGDMSQDYIYLVAPLVEDALTDRDLVHRQTAANVIKHLAL
                     NCSGSGCEDAFIHFLNLLIPNIFETSPHVISRILEGLEALSFATGPSVASNYVWAGLF
                     HPAKHVRVAFWRLYNSIYVQHADSLVPNYPAIGHEASSIPELDIVL"
     gene            <144595..>146592
                     /gene="TDEL0G00710"
                     /locus_tag="TDEL_0G00710"
                     /db_xref="GeneID:11504496"
     mRNA            <144595..>146592
                     /gene="TDEL0G00710"
                     /locus_tag="TDEL_0G00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682601.1"
                     /db_xref="GeneID:11504496"
     CDS             144595..146592
                     /gene="TDEL0G00710"
                     /locus_tag="TDEL_0G00710"
                     /inference="similar to DNA sequence:INSDC:YHR188C"
                     /note="similar to Saccharomyces cerevisiae GPI16
                     (YHR188C); ancestral locus Anc_5.47"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682649.1"
                     /db_xref="GeneID:11504496"
                     /db_xref="GOA:G8ZYG3"
                     /db_xref="InterPro:IPR007245"
                     /db_xref="UniProtKB/TrEMBL:G8ZYG3"
                     /translation="MKGIGIALFLSWLLSLAICDTEVAESSALEIDQDIVLPNDDDAP
                     SSTVVDSCVLDVPYDAYSGSTVVDDQSSVKNVDENTNVEISPSIDVKEEISYPYEEKL
                     MIKPLPNNYLLTSFSFRMDSEEFMPGKSALDYDGYGHYTVFPMAFKPMMDRTATRQLH
                     LRFTRGFWDSESWGRLPHDGFKSGGSGVELWAIIEAESDDQAYKQWKILANSLSGLFC
                     ASINFIDTSKTTYPVKSFQPDGQLPLFDDTKKLFLVRAALANEPVCTENLTPFVKLFP
                     TKGRSGISTLLDGHKVFDSSWHSLSIDITTECSASGETCKYQMEALVDVVMNVPNVLA
                     RNERPIPKPVAGDKLRCDLSKPFDAFQCFPLPEETKVSYSLSKIYGKQILGSNEISNH
                     PSHVCVDATDDWTAYIKIDDTYFSTDDNCFELKSSLNHDVYLESENTSSVIRYESAPL
                     YVSRSLTGYGQDRGGLRTVFKNPHSNPVKAVYFESLPWFMRVYLSTLKLEPGENCDGD
                     GGISLERVMNSTYYLPAVDRARPTHLEYVITVPANTSFAISYQFDKSLLQYAEYPPDA
                     NHGFEIESAVITIIEPSEYQMRTATLLLLLSTPDFSMPYNVIILTSTVIGLIFGTLFN
                     LIMKRVVSMQLADRVQATSGIKYKIKMLKQKLLSKVKRLTG"
     gene            complement(<146639..>147544)
                     /gene="TDEL0G00720"
                     /locus_tag="TDEL_0G00720"
                     /db_xref="GeneID:11504497"
     mRNA            complement(<146639..>147544)
                     /gene="TDEL0G00720"
                     /locus_tag="TDEL_0G00720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682602.1"
                     /db_xref="GeneID:11504497"
     CDS             complement(146639..147544)
                     /gene="TDEL0G00720"
                     /locus_tag="TDEL_0G00720"
                     /inference="similar to DNA sequence:INSDC:YHR187W"
                     /note="similar to Saccharomyces cerevisiae IKI1 (YHR187W);
                     ancestral locus Anc_5.48"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682650.1"
                     /db_xref="GeneID:11504497"
                     /db_xref="GOA:G8ZYG4"
                     /db_xref="InterPro:IPR019519"
                     /db_xref="UniProtKB/TrEMBL:G8ZYG4"
                     /translation="MSTSLHNPSILLKRVLSLADFSPLVLAIDSIAQSSCKLIEEVYY
                     NAKESGDFTIIYISFETANEPSYADIFIRAEALSLEKLSQTIQSYLPPSNRPTKSKFL
                     VVIDSINHISTNHISQFVGSIASLHSTLLAVYHADLPEYQEKTLAHYPSSIELLNFMA
                     TTILKVQQVTSKNATEEEIENDLSRFLIPRGLNNDIFKLTLTTRRKSGRSQSYSFHIN
                     TKTHSYETIIASSPADGEGNENPEMLQGLSTFNLSTSAKQKMAKEQVELPFLEAQSFN
                     TGGAIVYQFEKDDDYDEEDPFEDPF"
     gene            <147888..>152492
                     /gene="TDEL0G00730"
                     /locus_tag="TDEL_0G00730"
                     /db_xref="GeneID:11504498"
     mRNA            <147888..>152492
                     /gene="TDEL0G00730"
                     /locus_tag="TDEL_0G00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682603.1"
                     /db_xref="GeneID:11504498"
     CDS             147888..152492
                     /gene="TDEL0G00730"
                     /locus_tag="TDEL_0G00730"
                     /inference="similar to DNA sequence:INSDC:YHR186C"
                     /note="similar to Saccharomyces cerevisiae KOG1 (YHR186C);
                     ancestral locus Anc_5.49"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682651.1"
                     /db_xref="GeneID:11504498"
                     /db_xref="GOA:G8ZYG5"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR004083"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR029347"
                     /db_xref="InterPro:IPR029429"
                     /db_xref="UniProtKB/TrEMBL:G8ZYG5"
                     /translation="MPVVYGPQPLRPLNLETRHGFDEQYSSEQYLQSLANDFIFYFDD
                     KRHRTNGNPTPEEEKTQDVNNYYQPIYDWKIMKERQKTVSAALLLCLNLGVDPPDVIK
                     THPCARTEAWVDPLNFQDSKKAIEQIGKNLQSQYETLSLRTRYKQSLDPCVEDVKRFC
                     NSLRRTSKDDRILFHYNGHGVPQPTPSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIY
                     VYDCNSAGNIVTNFQKFVQKRIRDEEEGIPNAAAPSRASAYAECFQLASCRANELLLT
                     SPELPADLFTCCLTCPIEISVRVFLMQSPLKDSKYSIFFKSPSGDNTNESQNSFKANV
                     PSVNIPGVLSDRRTPLGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMVAALFRNFL
                     LAKRLMPWYNCHPVSDPELPDSIADHPMWKSWDLALDEVLNKLVNDLKNAPPSADLET
                     KMILQQQESLQTQQSQQQQQPQEMKSGSIQEKSRFAVANLSTMSLANHPAALAASKKS
                     SGNVAQAAQQQQQQPQQQQFTGFFEQNLTAFELWLKYASNTRHPPEQLPIVLQVLLSQ
                     VHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVLKLLQSPAPELKPILVFIWARIMSI
                     DYKNTQAELMKEKGYMYFVSVLVPDWGLNMSPTTGGSLSAGSPLTMTASPSIHAPRGQ
                     HYQQQMANGFRASSPALHYPSSDTTDEQKAMSVFVLSSFVRDFPLGQKNCFSLELVNK
                     LCFYIDNSDIPLLRQWCIILIGQLCQQNPLNRYICMTAGIIDTLVRSLKDPVPEVRTA
                     VLLALKHFISDIDDGDNILKLQQDLEQHYQQLHTQFQQLQSSAHQQQTQQIEHQQLKV
                     EQQLQHCQVMQMQIQNIESRKLKRQEISNLVSVLALINDGSPLVRKEVIIFFSQVVYR
                     YINFFVVVAFNELTEEMIQMEGTDAEAQSYTDKHSISHGSVFTTVWEALLILAEDPFS
                     ENRLLAGHVVEYILSELSVHKELSEAFSKMEQYLTKSGNNAHNGKTGFSAAQVQVLKP
                     TGPFSIEHSRQKETQKQEQNISHSKGNLGRIFRALGFKDLATEERETAHLRNSRKTKS
                     SGISLLSQPHGAAPLAKTVCAGRNKSTLKLPLESTFLDYSREYFQEPQMRKQEADEFG
                     SVEYSSRLWRRNRNEMVIQETQAQKSLSLYGDWSNRWATLDNKTHPKVISFSQFENYL
                     VSADERDIITVFDWEEKETLAKFSNGNPFGTKVTDLKFLNEDDAALLLAASSEGIVKV
                     YKNINASEDLEMITSWRGLTDMLLTPKSSGLLTEWQQIRGSLLATGDVKIIRIWDAHT
                     ETIEVDIPAKTSSLVTSITSDQLAGNVFVAGFAEGSIRVYDRRMDPRDSMLRLWRSGS
                     GRQRTCINNVHMQRGGYRELVSGATNGLVELWDIRYQDPVESFRDENMQQQGAQKRMT
                     TMTTTQVHEHAPIVATGTKQIKIWTTSGDLLNSFKNYHNTGGVAGTLAATGIRSTVPS
                     SSFLSAMVFHPHRMMLAATNSHDSSINIYKCEDRRSDLYY"
     gene            complement(<152596..>154155)
                     /gene="TDEL0G00740"
                     /locus_tag="TDEL_0G00740"
                     /db_xref="GeneID:11504499"
     mRNA            complement(<152596..>154155)
                     /gene="TDEL0G00740"
                     /locus_tag="TDEL_0G00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682604.1"
                     /db_xref="GeneID:11504499"
     CDS             complement(152596..154155)
                     /gene="TDEL0G00740"
                     /locus_tag="TDEL_0G00740"
                     /inference="similar to DNA sequence:INSDC:YGR260W"
                     /note="similar to Saccharomyces cerevisiae TNA1 (YGR260W);
                     ancestral locus Anc_5.50"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682652.1"
                     /db_xref="GeneID:11504499"
                     /db_xref="GOA:G8ZYG6"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZYG6"
                     /translation="MNECSDSPMEFVDRVIFDDSVQNEPTRRGADSLKEKNGGYDYDQ
                     EITATATTTDDDGLPSPSHPMEQKILRKMDLFLIPLMAILYFLSNLDKSNIGNAAVAG
                     LTEDLNLVGKQYNTCVTVFFATYVLFDPIGTNLLKIMGPPTLMSGCLFVFGVISLCTA
                     WVKNYGHLIAVRLLLGAFEGMIYPSINMYLSVCYRREQYAKRFAYVFSAACLSSSFGG
                     LIGYACSKISGSLRAWQYIYIVEGAISIGFVPFYFFGLSKNLEDSWYFTAEEKEYIIQ
                     RYKTMNTSDPNEKFEWFQAWLAIKDIKTWASAIALFGIDLTTFGLTVFLPIIIESMGF
                     TSVKVNLMTVPVYFLTAIVFFVCAKWSDHLRLRSPFIIGACLTTCIGLSIVLGSQVHG
                     VRYFGVYILCMGIYVNAAVNCLWLSGNIGNYFKRATAVGINLFLGSGSGLVSGQIFLA
                     SDKPRYIRGLSICLAFQVLSIVFTVIQFLLYRRENKKKEAIIDRCHELNEPIPFDPRL
                     GDENPQFRYMY"
     STS             153768..155331
                     /standard_name="ha2417"
                     /db_xref="UniSTS:515542"
     gene            155508..155580
                     /gene="TDEL0Gtrna6V"
                     /locus_tag="TDEL_0Gtrna6V"
                     /db_xref="GeneID:11504500"
     tRNA            155508..155580
                     /gene="TDEL0Gtrna6V"
                     /locus_tag="TDEL_0Gtrna6V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUG"
                     /db_xref="GeneID:11504500"
     gene            <155703..>158741
                     /gene="TDEL0G00750"
                     /locus_tag="TDEL_0G00750"
                     /db_xref="GeneID:11505332"
     mRNA            <155703..>158741
                     /gene="TDEL0G00750"
                     /locus_tag="TDEL_0G00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682605.1"
                     /db_xref="GeneID:11505332"
     CDS             155703..158741
                     /gene="TDEL0G00750"
                     /locus_tag="TDEL_0G00750"
                     /inference="similar to DNA sequence:INSDC:YGR258C"
                     /note="similar to Saccharomyces cerevisiae RAD2 (YGR258C);
                     ancestral locus Anc_5.51"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682653.1"
                     /db_xref="GeneID:11505332"
                     /db_xref="GOA:G8ZYG7"
                     /db_xref="InterPro:IPR001044"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR019974"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:G8ZYG7"
                     /translation="MGVHSFWDIVGPTAKPVRLESLQDRRMAVDASIWIYQFLKAVRD
                     QEGNALKNSHIVGFFRRICKLLYFGIKPVFVFDGGVPALKRSTIQQRKERRQGKRDNA
                     SITARKLLAIQLQKKEGSGAANNVSNDDENKEDSSELFKPQDEWHLPVIPGFKYDRDD
                     QRVVSAKTFEQMVNKVDDELENIDLDSINPASAEFEELPKSTQYLILSTLRLKSRLRM
                     GYTRDQLEQLFPDSMDFSRFQIDMVKRRNFFTQKLMGATGVHDGGASKLDDEVIKRVS
                     GRMNKEYKLTKTENGWTLGLGDMDGSESQKAILLDDKDIDAMNYIQNRKGRQAEHLKA
                     LESRNNDLIEDNDDEDDENLEWEDVDVKPQTIQKREDYSINAAKLPKLGQQVNSVGSR
                     SFLDRRHDQVSPMKRPFAQIIRHMEDNEDGRRDELEDDDYDDDDDYKKQLEEIELVEA
                     TQKSKNIMRKQRVEDTLKEKSNNVEPKNLEEIMDTAFQDNENDMINNNVTKNLSPVVS
                     FQQAAPISQDEMVPLTVQQKKPVAGESKAVPLTESEQNLQHIVSKIPEFSFGGKDSFL
                     FQDSSLSKSKDVVEDDVNEKQNEKPVQETPAWFSSSDVQQNPFSSSNFVKDQEVLNTP
                     KSTENYQLLSGLDAQELLQKDGKDEDDIEEVIEVASEKEDQMNEMDTGSLEENGGGHR
                     KEREALAYDYDFSEGEEEDIAENMRKEQLDFATFKNALNNRIVDNAFVEDELFEQQMK
                     DKRDSDEVTTDMIVEVQDLLSRFGIPFITAPMEAEAQCAELLGLKLVDGIITDDSDVF
                     LFGGSRVYKNMFHEKNYVEFYDYQSIKQNLGLDRDTMIELAQLLGSDYTNGIKGMGPV
                     SSMEVLAEFGNLIKFRDWYNEGQFDTKKQQAENKYERDLRKRLVKNEVVLSSDFPSEL
                     VRDSYLSPEVDHDKSTFIWGAPDLDMLRQFMRARVGWTQEKSDEILVPLIRDINNRKK
                     QARQMTLNEFFPSEYIQEKKLNFGKRLTTASNKLKKRKMK"
     gene            <158915..>159769
                     /gene="TDEL0G00760"
                     /locus_tag="TDEL_0G00760"
                     /db_xref="GeneID:11504501"
     mRNA            <158915..>159769
                     /gene="TDEL0G00760"
                     /locus_tag="TDEL_0G00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682606.1"
                     /db_xref="GeneID:11504501"
     CDS             158915..159769
                     /gene="TDEL0G00760"
                     /locus_tag="TDEL_0G00760"
                     /inference="similar to DNA sequence:INSDC:YHR185C"
                     /note="similar to Saccharomyces cerevisiae PFS1 (YHR185C);
                     ancestral locus Anc_5.52"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682654.1"
                     /db_xref="GeneID:11504501"
                     /db_xref="UniProtKB/TrEMBL:G8ZYG8"
                     /translation="MPHRRVAASSKLTPSMPLKMNAESCPNSFLNGAEPRERDILKSR
                     RNRRLESSPIRDSFHMDKPTTAAPVNMSATQSASNTADFYSKLKGTPQSSSERVKNYC
                     QPNESMLQQYTLMTYSSGPMMSSLYPNYNVSVPYLPSRYSPYFLQSKVNGSPVQALPK
                     EKNNQSTTYHGQSFPAFFNPRTASNMPHKEKVNNWIENIPIFEIEGGTWESNCYDSNY
                     SMNWEENEFDDSSKMNNISFITHDELLFLQGKKFESLVRKLYKSEYESRNSRNDPLLD
                     NPTLTDFI"
     gene            <159967..>161037
                     /gene="TDEL0G00770"
                     /locus_tag="TDEL_0G00770"
                     /db_xref="GeneID:11504502"
     mRNA            <159967..>161037
                     /gene="TDEL0G00770"
                     /locus_tag="TDEL_0G00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682607.1"
                     /db_xref="GeneID:11504502"
     CDS             159967..161037
                     /gene="TDEL0G00770"
                     /locus_tag="TDEL_0G00770"
                     /inference="similar to DNA sequence:INSDC:YGR257C"
                     /note="similar to Saccharomyces cerevisiae MTM1 (YGR257C);
                     ancestral locus Anc_5.53"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682655.1"
                     /db_xref="GeneID:11504502"
                     /db_xref="GOA:G8ZYG9"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8ZYG9"
                     /translation="MGSGSSENLTIRERMISAGVGSLFTSLILTPMDVVRIRLQQQEM
                     LPDCSCNVELPKGKVSVAAIPKSETVFWQDPCFKELNCKSSSVRFNGTLEAFSKIAQN
                     EGILTLWRGSLCNTVDGNTGKCCIFHGYEYLRDVSPIGKYYPAFNPLVCGAFARVFAA
                     TTVAPLELLKTRLQSIPRSSKSTSTWVIMKDLLQETRNEMATGGYRVLFRGLEITLWR
                     DVPFSAIYWGSYEFCKKHLYFQFRSSSLSSNQQSNWNHFFNSFIGGSISGAIAAICTH
                     PFDVGKTRWQISYVGKTPQSTLTKQPTRRDRNMFRFLDTIRRQEGLGSLYTGLFVRVA
                     KIAPSCAIMISSYEISKRLFSS"
     gene            complement(<161129..>162874)
                     /gene="TDEL0G00780"
                     /locus_tag="TDEL_0G00780"
                     /db_xref="GeneID:11504503"
     mRNA            complement(<161129..>162874)
                     /gene="TDEL0G00780"
                     /locus_tag="TDEL_0G00780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682608.1"
                     /db_xref="GeneID:11504503"
     CDS             complement(161129..162874)
                     /gene="TDEL0G00780"
                     /locus_tag="TDEL_0G00780"
                     /inference="similar to DNA sequence:INSDC:YHR184W"
                     /note="similar to Saccharomyces cerevisiae SSP1 (YHR184W);
                     ancestral locus Anc_5.54"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682656.1"
                     /db_xref="GeneID:11504503"
                     /db_xref="UniProtKB/TrEMBL:G8ZYH0"
                     /translation="MENWNHIQGQRQIIEPPPELPIYKVPSKSPHKEVAGKRFVNKVK
                     GWFSGGRRNDDWYSFPEYLAHGRLQKGESAHEDSYSRHELHEIGESEEDDPHGNSQRL
                     VVQESAKTFLTGNNIYANHIPQFPAKGRLENHYLARKKSLPDMNIVSNPSSSLEFKKR
                     PMSLVVNEPQKMSVLTTSYLQSRNVTLHKISRRLNSIGNKKLECAKLTKKLLKDLTIW
                     GEKTTSDNIDVTELVEELYELFQKRYVVGTKISERLKVLTNELEFIGKRENEMAEEKR
                     HLLAALKKYDYCKERRGENDEESNLFKERVMAHEKSYETYQLNYQYAVSVSARQLFKE
                     VAIEYYERTSDLKENSGAFLLNALKTLENTHNNEVFLKDLDKLRMLRAERNWTRLKPE
                     QRNNPQNWVDLVSGKHDNDDTLMKKVYEGLPIAYTPMPEVSPAKTPHLDLRTGLEESF
                     SGIKSDRFNPITSNEFFLDRSPSKNEDDQDESNYETVRPDRIEEKVEEDTIPRSLNPN
                     VLKDDRNKIPSLRTHLKDNTLQKKIEVKDKSPKGLTEIEKSKHGFLVNFGEMSRQFKD
                     AEQYLQENKWTEPSA"
     gene            complement(<163167..>164709)
                     /gene="TDEL0G00790"
                     /locus_tag="TDEL_0G00790"
                     /db_xref="GeneID:11504504"
     mRNA            complement(join(<163167..164631,164699..>164709))
                     /gene="TDEL0G00790"
                     /locus_tag="TDEL_0G00790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682609.1"
                     /db_xref="GeneID:11504504"
     CDS             complement(join(163167..164631,164699..164709))
                     /gene="TDEL0G00790"
                     /locus_tag="TDEL_0G00790"
                     /inference="similar to DNA sequence:INSDC:YGR256W,YHR183W"
                     /note="similar to Saccharomyces cerevisiae GND2 (YGR256W)
                     and GND1 (YHR183W); ancestral locus Anc_5.55"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682657.1"
                     /db_xref="GeneID:11504504"
                     /db_xref="GOA:G8ZYH1"
                     /db_xref="InterPro:IPR006113"
                     /db_xref="InterPro:IPR006114"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="InterPro:IPR006184"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR012284"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZYH1"
                     /translation="MAAVADFGLIGLAVMGQNLILNVADHGFTVVAYNRTTSKVDHFL
                     ENEAKGKSIVGAHSLEELVSKLKKPRKIMLLVKAGKPVDYLINDLVPLLDKGDIIIDG
                     GNSHFPDSNRRFEELEKKGILFVGSGVSGGEDGARYGPSLMPGGAEEAWPHIKPIFQA
                     ISAKSDGEACCDWVGPAGAGHYVKMVHNGIEYGDMQLICEVYDILKRVGGFEDKEISE
                     VFAKWNTGVLDSFLIEITRDILKKNDTDGVPIVEKILDTAGQKGTGKWTAINALDLGQ
                     PVTLIGEAVFSRCLSALKAERGRASKVLPGPEIPKNAITDKKQFVDDLEQALYAAKII
                     SYAQGFMLIREAGKTYGWKLNNPAIALMWRGGCIIRSAFLGEITKAYRQNPELENLLF
                     HSFFSDAVSKAQSGWRKTAALATQYGIPTPAISTALAFYDGYRCERLPANLLQAQRDY
                     FGAHCFKVLPEFASATFPEGKDIHVNWTGHGGNISASSYDA"
     gene            complement(<165198..>167180)
                     /gene="TDEL0G00800"
                     /locus_tag="TDEL_0G00800"
                     /db_xref="GeneID:11504505"
     mRNA            complement(<165198..>167180)
                     /gene="TDEL0G00800"
                     /locus_tag="TDEL_0G00800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682610.1"
                     /db_xref="GeneID:11504505"
     CDS             complement(165198..167180)
                     /gene="TDEL0G00800"
                     /locus_tag="TDEL_0G00800"
                     /inference="similar to DNA sequence:INSDC:YHR182W"
                     /note="similar to Saccharomyces cerevisiae YHR182W;
                     ancestral locus Anc_5.56"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682658.1"
                     /db_xref="GeneID:11504505"
                     /db_xref="GOA:G8ZYH2"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:G8ZYH2"
                     /translation="MPGIDRRDACRFWSKDYISGISALIGCIDNDIDRLEKEAHFYKW
                     FIDDWSKNLLQSLGKAAQDTELFEHEALCDLLIDLKRSLNVEELEGQCLGPLQATIKR
                     EKEVRQEMEQQLKSFHTNYSKDLKALKDSFKLYNRKASASPFVESKLSEPTQTGIVLD
                     DHLSFTNSNELQSFLERVKQPMPVQKKGFMNYLGVEGKNSFQGKVMLDAIKRNTEKLD
                     TSPYNLDRLGQKMLDLKLIEEDSMAIGGKHLFTQDGYFQWPQPSKDPTANNSLTSWFK
                     GLPIGSVNDIGIDELKERYFAKCCKLEYSRFELEKAIYQVYKSYFQNSAQEIDRHLVN
                     NRRTFNKLFKRDKSPEDIIENPIPVVRYFTRDSSTHIIKWEFEQDRLVRREMMFGCPA
                     IDEDTIAAIHLILNHVRDFNDEKDLEAKIAKSWTSGSVVDMNRAISLKMDLIKIFKDV
                     NNATNTKAVETIIRSNHYTAVDDWIGLIKLWLLEIPDSLVPPICCDLITKNHDWTDKV
                     PLNNLRVLIEICSHLQSIKMPITQPENPIYHYFIRPADCLRNFTKDYNTFEPWALSLP
                     TTIESLQLAYHNRRQEEQLQISQPAPKTTPSILIRSIEEPTTPPRLDETFIPRPFRTV
                     SAASSTPGSPVPSRASKRISGLVIELPGSPTTTTES"
     gene            complement(<167292..>167975)
                     /gene="TDEL0G00810"
                     /locus_tag="TDEL_0G00810"
                     /db_xref="GeneID:11504506"
     mRNA            complement(<167292..>167975)
                     /gene="TDEL0G00810"
                     /locus_tag="TDEL_0G00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682611.1"
                     /db_xref="GeneID:11504506"
     CDS             complement(167292..167975)
                     /gene="TDEL0G00810"
                     /locus_tag="TDEL_0G00810"
                     /inference="similar to DNA sequence:INSDC:YHR181W"
                     /note="similar to Saccharomyces cerevisiae SVP26
                     (YHR181W); ancestral locus Anc_5.57"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682659.1"
                     /db_xref="GeneID:11504506"
                     /db_xref="InterPro:IPR007277"
                     /db_xref="UniProtKB/TrEMBL:G8ZYH3"
                     /translation="MFLQLVSYVGAVLGFLFLTLSIASGLYYISEIVEEHTESTRRFL
                     TRAIYTIIATFVLLLLFDSFPFKLSIFSIISNVIYLQNLKTFPFISLTSPIFILSSCC
                     VVLNHYFWFKYFNDNEVPPQFKFNPNYIPKRRASFSEVASFFGICVWFIPFALFVSLS
                     AGDYVLPTTTASSSKKTDLPAGEEEPRLRKRAVGLARVVINSLRQYVYSIARVFGYEI
                     DPNHDTLVI"
     gene            complement(168194..168265)
                     /gene="TDEL0Gtrna9T"
                     /locus_tag="TDEL_0Gtrna9T"
                     /db_xref="GeneID:11504507"
     tRNA            complement(168194..168265)
                     /gene="TDEL0Gtrna9T"
                     /locus_tag="TDEL_0Gtrna9T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACA"
                     /db_xref="GeneID:11504507"
     gene            complement(<168417..>169613)
                     /gene="TDEL0G00820"
                     /locus_tag="TDEL_0G00820"
                     /db_xref="GeneID:11505338"
     mRNA            complement(<168417..>169613)
                     /gene="TDEL0G00820"
                     /locus_tag="TDEL_0G00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682612.1"
                     /db_xref="GeneID:11505338"
     CDS             complement(168417..169613)
                     /gene="TDEL0G00820"
                     /locus_tag="TDEL_0G00820"
                     /inference="similar to DNA sequence:INSDC:YHR179W"
                     /note="similar to Saccharomyces cerevisiae OYE2 (YHR179W);
                     ancestral locus Anc_5.58"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682660.1"
                     /db_xref="GeneID:11505338"
                     /db_xref="GOA:G8ZYH4"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G8ZYH4"
                     /translation="MSFVQDFKPIALADTKLFKPIKIGNNELAHRVVMPPLTRMRATH
                     PGNVPNKDWAVEYYDQRSKRPGTLIITEGAFPSAQSGGYDNVPGIWSPAQLEQWKKIF
                     AKIHENKSFVWVQLWVLGRQSFADTLARDGLRYDSASDGVYMDEEQRERAVKSNNPQH
                     GLTKAEIKQYISEYVDAAKKSIEAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSI
                     ENRARFVLEVVDAVTEAIGCDKVGIRLSPYGTFGTMSGGSEPLIVAQFAYVLGELEKR
                     GKAGKRLSFVHLVEPRVTNPFYTEGQGEYTEGTNDFAYSVWKGPIIRAGNLALHPEVV
                     KKMVEDDRTLIGYGRFFISNPDIVDRVEKGLPLNKYNRDTFYAMTANGYLDYPTYDEA
                     VKLGYK"
     gene            complement(<170169..>172229)
                     /gene="TDEL0G00830"
                     /locus_tag="TDEL_0G00830"
                     /db_xref="GeneID:11504508"
     mRNA            complement(<170169..>172229)
                     /gene="TDEL0G00830"
                     /locus_tag="TDEL_0G00830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682613.1"
                     /db_xref="GeneID:11504508"
     CDS             complement(170169..172229)
                     /gene="TDEL0G00830"
                     /locus_tag="TDEL_0G00830"
                     /inference="similar to DNA sequence:INSDC:YHR178W"
                     /note="similar to Saccharomyces cerevisiae STB5 (YHR178W);
                     ancestral locus Anc_5.59"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682661.1"
                     /db_xref="GeneID:11504508"
                     /db_xref="GOA:G8ZYH5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G8ZYH5"
                     /translation="MMDNGYTDTEPGFQSYSCARCRRLKKRCPKQSPACQTCLKAGET
                     CLYLGRAPRRTRKELEEAKLRGEFQPKKKHHTDKSEPGNSSESNTANSNSSPGLTNDV
                     LVDPRGKPLLETDNVDGGGTQLHSPTGSSVHLDRVSSLVSVLGAMAEGAQLSTSPMGL
                     VLNHKGASFPHKNYVDIHIQTPDQESENDFQKHKLPALRSNQWKPPLENGSTPVDAPS
                     IQAEAITGIFKGGRITPWITENGQYKPIERSLYDRFIAAYFKHNHKSFYMMDKVAFLN
                     KVSTIRDFTMMDGEFEDHFIFQLYMAMAIGCTTLQRAEMLTDEEGDLSEHFAFLAMKR
                     FRPVIRRQNIETIKCLLLLGIFALFEPKGVSSWTISGLIMRISIGLGFNRALAGERLK
                     KFTPVEAELRYRVFWSAYCFERLVCTSLGRMSSIDDDEITVPLPQPLNDEEKEDLEVA
                     NMMISLRRMSGRIYKKVHLVSVGRKNYTIEQKNEIIESLRQEIDEIYQRESASINEKN
                     ANKWGGGSLSFHCSDIWLAMRYAQLQIMLYRPSVLIPKPPMKSLTKLGEFCLQALKHT
                     YTLYKKKLLPLNWITLFRTLTICNTMLYCLCHWSIDIAESEIEIQQCVEILRHFGEKW
                     VFPKKCAEVFQNISSTILDISLSTGQIPNMEKLTRELFGASDEYQDILDENNVDVSWI
                     DKLI"
     gene            complement(<172381..>173715)
                     /gene="TDEL0G00840"
                     /locus_tag="TDEL_0G00840"
                     /db_xref="GeneID:11504509"
     mRNA            complement(<172381..>173715)
                     /gene="TDEL0G00840"
                     /locus_tag="TDEL_0G00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682614.1"
                     /db_xref="GeneID:11504509"
     CDS             complement(172381..173715)
                     /gene="TDEL0G00840"
                     /locus_tag="TDEL_0G00840"
                     /inference="similar to DNA sequence:INSDC:YHR176W"
                     /note="similar to Saccharomyces cerevisiae FMO1 (YHR176W);
                     ancestral locus Anc_5.60"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682662.1"
                     /db_xref="GeneID:11504509"
                     /db_xref="GOA:G8ZYH6"
                     /db_xref="InterPro:IPR000960"
                     /db_xref="InterPro:IPR020946"
                     /db_xref="UniProtKB/TrEMBL:G8ZYH6"
                     /translation="MTVAIVKRLAIIGGGPGGLAAARVFLKNAPNFEIDLFERDRTVG
                     GLWHYGDQKRQGSPMYDHLETNISKHIMKFSGFPFPEKVPTYPWRKDVFEYLKSYSEK
                     FLENEDRVRILLNHRVDSLSKKGSVWSLVSHNNVDNKDSRKEYDYVVVANGHHHEPRL
                     PQNVAGLDQWFESGAAFCARDFQNCKFAQGKNVVVVGNGSSGSDILNQVSTVAHKLYH
                     SVRNPEEVAKTTGYPQLDILTTVPKITSVDWQTRSVNLENGETIKNVDYLVYATGYLY
                     SLPFFEPTLRADLLGGPSKTSAARVHNLWKQIFYVKDPTLAFALLPQLIVPFPLAELQ
                     AALMVKAFNGDLQVPAKSDDELDPELAKKQPAYHPIPDFKDLDYYNELQSILDTAGGA
                     KDPLQPVKWDETYQQMRITSTSDKQKRNIILTKHAKESRAQNKPYELIKFSL"
     gene            complement(<174094..>174522)
                     /gene="TDEL0G00850"
                     /locus_tag="TDEL_0G00850"
                     /db_xref="GeneID:11504510"
     mRNA            complement(<174094..>174522)
                     /gene="TDEL0G00850"
                     /locus_tag="TDEL_0G00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682615.1"
                     /db_xref="GeneID:11504510"
     CDS             complement(174094..174522)
                     /gene="TDEL0G00850"
                     /locus_tag="TDEL_0G00850"
                     /inference="similar to DNA sequence:INSDC:YHR175W"
                     /note="similar to Saccharomyces cerevisiae CTR2 (YHR175W);
                     ancestral locus Anc_5.61"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682663.1"
                     /db_xref="GeneID:11504510"
                     /db_xref="GOA:G8ZYH7"
                     /db_xref="InterPro:IPR007274"
                     /db_xref="UniProtKB/TrEMBL:G8ZYH7"
                     /translation="MNHGDMDMGEDSCSMNMLFTWNYKNTCVVFRWWHIKRLSDLLLS
                     FLAIMILGYLYEYMRYYIHKSLANRGSQTTNVDRRRNKLYNSCLYGLQVGYSFMLMLV
                     FMTYNGWLMIAVVLGAIWGHYSWGSHVKTLAEDIPAMACH"
     gene            complement(<174751..>176064)
                     /gene="TDEL0G00860"
                     /locus_tag="TDEL_0G00860"
                     /db_xref="GeneID:11504511"
     mRNA            complement(<174751..>176064)
                     /gene="TDEL0G00860"
                     /locus_tag="TDEL_0G00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682616.1"
                     /db_xref="GeneID:11504511"
     CDS             complement(174751..176064)
                     /gene="TDEL0G00860"
                     /locus_tag="TDEL_0G00860"
                     /inference="similar to DNA sequence:INSDC:YGR254W,YHR174W"
                     /note="similar to Saccharomyces cerevisiae ENO1 (YGR254W)
                     and ENO2 (YHR174W); ancestral locus Anc_5.62"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682664.1"
                     /db_xref="GeneID:11504511"
                     /db_xref="GOA:G8ZYH8"
                     /db_xref="InterPro:IPR000941"
                     /db_xref="InterPro:IPR020809"
                     /db_xref="InterPro:IPR020810"
                     /db_xref="InterPro:IPR020811"
                     /db_xref="InterPro:IPR029017"
                     /db_xref="InterPro:IPR029065"
                     /db_xref="UniProtKB/TrEMBL:G8ZYH8"
                     /translation="MAVSKVFARSVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVH
                     EALELRDGDKHRWMGKGVTKAVANVNNVIAPAFVKANIDVKNQEAVDEFLNSLDGTPN
                     KGKLGANAILGISMAAARAAAAEKNVPLYQHLADLSQSKASPFVLPVPFLNVLNGGSH
                     AGGALALQEFMIAPTGAKNFAEAMEIGSEVYHNLKSLTKKRYGASAGNVGDEGGVAPN
                     IQTAEEALDLIVDAIKAAGHEGKVKIGLDCASSEFYKDGKYDLDFKNPNSDASKWLSG
                     PQLADLYHSLTKKYPIVSIEDPFAEDDWEAWSHFFKTAGVQIVADDLTVTNPLRIKTA
                     IEKKAADALLLKVNQIGSLSESIKAAKDSFAADWGVMVSHRSGETEDTFIADLVVGLR
                     SGQIKTGAPARSERLAKLNQLLRIEEELGDKAVYAGENFHHGFKL"
     gene            complement(<176737..>179148)
                     /gene="TDEL0G00870"
                     /locus_tag="TDEL_0G00870"
                     /db_xref="GeneID:11504512"
     mRNA            complement(<176737..>179148)
                     /gene="TDEL0G00870"
                     /locus_tag="TDEL_0G00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682617.1"
                     /db_xref="GeneID:11504512"
     CDS             complement(176737..179148)
                     /gene="TDEL0G00870"
                     /locus_tag="TDEL_0G00870"
                     /inference="similar to DNA sequence:INSDC:YHR172W"
                     /note="similar to Saccharomyces cerevisiae SPC97
                     (YHR172W); ancestral locus Anc_5.63"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682665.1"
                     /db_xref="GeneID:11504512"
                     /db_xref="GOA:G8ZYH9"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="UniProtKB/TrEMBL:G8ZYH9"
                     /translation="MEAKAVDDYVELSNAAKNGPLLGRLVNYQPLFSTDPKVRSYPLS
                     ELSAPDQKRTQEALVVRDLLNVLVGLEGVYIRYNNYYDPHSDVVPEFKIAKTMDPSLK
                     SFSKRIAKLGKYYIVLTKVAEKWSEPSFGNILHRFGFEVKRFLRLNYLHFIADRLERD
                     FKESTTFSISELEQVITDVEITKQLELLYTVSERIDREDRTRRNMDRVKEDFNNFIND
                     LKDQGQSSNAFILATDTRVLPIAKGGVILRIIQEMVHENLGDRTNVAFLNNILNDVAG
                     NYCEMLFKWLTEGKLNDPYDEFMVVDTMKNVNDITPHMKYGDRLWDTQFVIRKDGLLK
                     QYDSNADNELLFMVLTTGKLVNLVKTSLNKVNLTLATNRDDEIKNFSELMEGSTLELY
                     INKWYNEANKLCLQMYLEGYELVKLIRMLQKHYFGYHNANGVSRFLQKNMVELTRRYR
                     KNGYEREKLQRAFEIERESKYSSNNDLVKQLLNLQLDDQPFGEVILQYVRQGEEQREE
                     LTISGEDDGTRLLRANNFQNLKDILLQELTSAHDGSEDIKALKSNIYYLNFEMIVPYP
                     ISIIITRPCIVQYQIISRYFFLLQYYSKLLDDTWIEINKNIVWKYRGFTKLVRQRVIK
                     RSRVLHNQMSQFVKLVLEYFTQDVVEREMNAMTSTTTKKASILDWQSCSQECLTNIMT
                     NCCLSQLIEIQLQIFEIIHKFCKFITSMRREFCQLDANLYEMYTSSNSRRVDIPTNIY
                     TPEEYTTRTSEYITYIDMVVQGFQQHVLAFKEGLGHHHRSNRSRDTNGDDHHSAARLL
                     TSLSS"
     gene            <179880..>180662
                     /gene="TDEL0G00880"
                     /locus_tag="TDEL_0G00880"
                     /db_xref="GeneID:11504513"
     mRNA            <179880..>180662
                     /gene="TDEL0G00880"
                     /locus_tag="TDEL_0G00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682618.1"
                     /db_xref="GeneID:11504513"
     CDS             179880..180662
                     /gene="TDEL0G00880"
                     /locus_tag="TDEL_0G00880"
                     /inference="similar to DNA sequence:INSDC:YGR253C"
                     /note="similar to Saccharomyces cerevisiae PUP2 (YGR253C);
                     ancestral locus Anc_5.64"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682666.1"
                     /db_xref="GeneID:11504513"
                     /db_xref="GOA:G8ZYI0"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8ZYI0"
                     /translation="MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSE
                     GVVLGVEKRATSPLLEADSIEKIVEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLY
                     YDEDMSVESLTQSVCDLALRFGEGAAGEERLMSRPFGVALLIAGYDKESGYQLFHAEP
                     SGTFYRYNAKAIGSGSEGAQSELQNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQ
                     LSSTTKEDGFKIYDDSKTAEIIKELKEKEAQEAPEDRDVEMS"
     gene            complement(<180736..>182220)
                     /gene="TDEL0G00890"
                     /locus_tag="TDEL_0G00890"
                     /db_xref="GeneID:11504514"
     mRNA            complement(<180736..>182220)
                     /gene="TDEL0G00890"
                     /locus_tag="TDEL_0G00890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682619.1"
                     /db_xref="GeneID:11504514"
     CDS             complement(180736..182220)
                     /gene="TDEL0G00890"
                     /locus_tag="TDEL_0G00890"
                     /inference="similar to DNA sequence:INSDC:YGR252W"
                     /note="similar to Saccharomyces cerevisiae GCN5 (YGR252W);
                     ancestral locus Anc_5.65"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682667.1"
                     /db_xref="GeneID:11504514"
                     /db_xref="GOA:G8ZYI1"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="UniProtKB/TrEMBL:G8ZYI1"
                     /translation="MVAKRRKARTRHEEKVEEPELKKQKATQGKEEVKPNIEEQEPQE
                     TSIDDKEDLKEQELESSNAEQSAEKTLAKDESNEIKKDQEETPKEEAAQEKPADEVKE
                     NHIEELKQEPEVTAVTHEVIEDENNGITKFEFDGVEYKFKERASVIEEREGRIEFRVV
                     NNDNTKENLMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVVRKPLTVVGGITY
                     RPFEKREFGEIVFCAISSTEQVRGYGAHLMNHLKDYVRNTTSIKHFLTYADNYAIGYF
                     KKQGFTKEITLEKSIWMGYIKDYEGGTLMQCTMLPRIRYLDAAKILLLQEAALRRKIR
                     TISKSHIIRPGLKVFKDVKNIKPVDPMTIPGLKEAGWTPEMDELAQRPKRGPHYASMQ
                     NILTELQNHAAAWPFLQPVNREEVPDYYDFIKEPMDLSTMEVKLENNRYEKMENFIYD
                     ARLIFNNCRMYNGENTSYFKYANRLEKFFNSKIKEIPEYSHLVD"
     gene            complement(<182372..>184252)
                     /gene="TDEL0G00900"
                     /locus_tag="TDEL_0G00900"
                     /db_xref="GeneID:11504515"
     mRNA            complement(<182372..>184252)
                     /gene="TDEL0G00900"
                     /locus_tag="TDEL_0G00900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682620.1"
                     /db_xref="GeneID:11504515"
     CDS             complement(182372..184252)
                     /gene="TDEL0G00900"
                     /locus_tag="TDEL_0G00900"
                     /inference="similar to DNA sequence:INSDC:YHR171W"
                     /note="similar to Saccharomyces cerevisiae ATG7 (YHR171W);
                     ancestral locus Anc_5.66"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682668.1"
                     /db_xref="GeneID:11504515"
                     /db_xref="GOA:G8ZYI2"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR006285"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZYI2"
                     /translation="MSKAGMKYGAPVQSFIDTSFFQELSRLKLDVLKLESKGLPLFCT
                     LEKSFTSKSSKSVPLFLNEQSFREESLGIAGGVPFKGFIYNYNVFEDFKTLDKKKFID
                     TIAEEKFVDGKSDINDSVGFYIISFADLKKYRFYYWVCVPCFQKQSLAIELLNEEPLI
                     SATPYQSWFEENTDQWVLIINAADQLVHYTKEEAKTCRALVIRDTSRLDRIPSAIAKN
                     FLTIFNHDNPQKCELDVYFIRPDNSSFALKLSLSLAGQDDHLQVSGWERNTQNKLGPR
                     AIDLSSLIDPLKIADQSVDLNLKLMKWRIAPQIDLQKIKETKVLLLGAGTLGCYVSRA
                     LMAWGVRKITFVDNSTVSYSNPVRQPLFEFSDVGKPKAQAAAAALKKVFPLMNVEGVE
                     LSVPMIGHPITSDEIERSDYDRLCNLFDQHDVVFLLMDSRETRWLPTVLGKFKNKVVI
                     NAALGFDSYLVMRHGSYFDEPSSRLGCYFCHDVFAPKDSLTDRTLDEMCTVTRPGVAL
                     MAASQAVELLVSMLQPKDPQDSTRNILGDIPHQIRGFLNNFSTLKLETPAYAHCSACC
                     PEVIGSCKEFGWDFVQAALNDHTYIEQISGLAQVQQDAERATQEWDQDDEEFSDELYD
                     MD"
     gene            complement(<184417..>185970)
                     /gene="TDEL0G00910"
                     /locus_tag="TDEL_0G00910"
                     /db_xref="GeneID:11504516"
     mRNA            complement(<184417..>185970)
                     /gene="TDEL0G00910"
                     /locus_tag="TDEL_0G00910"
                     /product="60S ribosomal export protein NMD3"
                     /transcript_id="XM_003682621.1"
                     /db_xref="GeneID:11504516"
     CDS             complement(184417..185970)
                     /gene="TDEL0G00910"
                     /locus_tag="TDEL_0G00910"
                     /inference="similar to DNA sequence:INSDC:YHR170W"
                     /note="similar to Saccharomyces cerevisiae NMD3 (YHR170W);
                     ancestral locus Anc_5.67"
                     /codon_start=1
                     /product="60S ribosomal export protein NMD3"
                     /protein_id="XP_003682669.1"
                     /db_xref="GeneID:11504516"
                     /db_xref="InterPro:IPR007064"
                     /db_xref="UniProtKB/TrEMBL:G8ZYI3"
                     /translation="MNYTHMDQDQLQQQQQQVATVLCCNCGVPIDGSGGLVMCYDCIK
                     MTVDITAGIPREANVSFCRNCERFLQPPGQWVRADLESRELLAICLRRLKGLTKVRLV
                     DASFIWTEPHSRRIRVKLTVQGEAIANTIIQQTFEVEYVVIAMQCPDCAKSYTTHTWR
                     AAVQIRQKVPHKRTFLYLEQLILKHNAHVDTISISEAKDGLDFFYGQKNHAVKMIDFL
                     NAAVPIKYKKSEELISQDTHTGSSTYKFSYSVEIVPICRDDLVVLPGKLAKSLGNISP
                     FVLCSKVTNAVQFLDPNTLQTADVPASVYWRAPFHSLADVSQLIEFIVLDVEPTGVSR
                     GKRVLADITVARAADLGVNDQEYYVRSHLGAICHAGDSVMGYYVANSNYNSDLFDGLN
                     IDHVPDVVLVKKLYRRKTKKNRNWKLKRMAKEHKEIDASQDYSSRAQRQEMERAERDY
                     EVFLQELEEDDELRQGVNLYKSAGQASAEHEMEEEDEEDAPQIDIDELLDELDDMTLE
                     DGGADETVA"
     gene            complement(<186133..>186696)
                     /gene="TDEL0G00920"
                     /locus_tag="TDEL_0G00920"
                     /db_xref="GeneID:11504517"
     mRNA            complement(<186133..>186696)
                     /gene="TDEL0G00920"
                     /locus_tag="TDEL_0G00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682622.1"
                     /db_xref="GeneID:11504517"
     CDS             complement(186133..186696)
                     /gene="TDEL0G00920"
                     /locus_tag="TDEL_0G00920"
                     /inference="similar to DNA sequence:INSDC:YGR251W"
                     /note="similar to Saccharomyces cerevisiae YGR251W;
                     ancestral locus Anc_5.68"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682670.1"
                     /db_xref="GeneID:11504517"
                     /db_xref="InterPro:IPR022592"
                     /db_xref="UniProtKB/TrEMBL:G8ZYI4"
                     /translation="MSRANEIQQKLNLQAELQKTFNGNARKVMGWLDKNEPDKQPDVT
                     ELNSSKESFFTLPVVQAGSGLNFAAATTNLDHKEDIHTVGEFIRSDKKVSSLSKKRRH
                     QPDIRANTVHRISNDDTRAMIALKRKMRQTQRDSIRHDVRLEKTAPDARTANSNEDDS
                     EDEEERAVQKTTKKTVGLLFNGKKKRK"
     gene            complement(<186836..>188146)
                     /gene="TDEL0G00930"
                     /locus_tag="TDEL_0G00930"
                     /db_xref="GeneID:11504518"
     mRNA            complement(<186836..>188146)
                     /gene="TDEL0G00930"
                     /locus_tag="TDEL_0G00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682623.1"
                     /db_xref="GeneID:11504518"
     CDS             complement(186836..188146)
                     /gene="TDEL0G00930"
                     /locus_tag="TDEL_0G00930"
                     /inference="similar to DNA sequence:INSDC:YHR169W"
                     /note="similar to Saccharomyces cerevisiae DBP8 (YHR169W);
                     ancestral locus Anc_5.69"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682671.1"
                     /db_xref="GeneID:11504518"
                     /db_xref="GOA:G8ZYI5"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZYI5"
                     /translation="MSESSVSTFKSLGLPRWLVDALSAMRITQPTSIQKGCIPAIMKG
                     GDCIGGAKTGSGKTIAFAAPMLTKWSEDPSGMFGVVLTPTRELAMQIAEQFTALGSSM
                     NIRVSIVVGGESIVKQALELQRKPHFIIATPGRLAHHILNSGEDTVGGLMRAKFLVLD
                     EADSLLTSTFAKDLNVCVSALPPKDKRQTLLFTATITDQVRALQDAPSQENKPPLYCY
                     EVENVDNVAVPSTLKTEYILIPEYVKEAYLYHLLTSEEYKDSSAIIFVNRTMTAEIMR
                     RTLKNLDIRVASLHSQMPQQERTNSLQRFRANAARVLIATDVASRGLDIPVVELVVNY
                     DIPSDPDVYIHRSGRTARAGRRGDAISFITQRDISRIEAIETRINKKMEECTLVGDTA
                     VIRKSLNKVTKAKRESLMAMEKENFGERRKIQRQKNMNQKGHRA"
     gene            complement(<188353..>190005)
                     /gene="TDEL0G00940"
                     /locus_tag="TDEL_0G00940"
                     /db_xref="GeneID:11504519"
     mRNA            complement(<188353..>190005)
                     /gene="TDEL0G00940"
                     /locus_tag="TDEL_0G00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682624.1"
                     /db_xref="GeneID:11504519"
     CDS             complement(188353..190005)
                     /gene="TDEL0G00940"
                     /locus_tag="TDEL_0G00940"
                     /inference="similar to DNA sequence:INSDC:YHR168W"
                     /note="similar to Saccharomyces cerevisiae MTG2 (YHR168W);
                     ancestral locus Anc_5.70"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682672.1"
                     /db_xref="GeneID:11504519"
                     /db_xref="GOA:G8ZYI6"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR006169"
                     /db_xref="InterPro:IPR014100"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZYI6"
                     /translation="MKRGLSLRLNCSGICGRRLLSQKSINAPDNAPRAADNEQWLDQL
                     RRTRRGPNPAFSSTQSNDPLPDRVKKQNSNRFPVEILSSPPDTQYIEVEAALANFTSI
                     KYLQHFDRHKHRQGNFVDVRIIKCRSGNGGDGVVSFFRDAGRSIGPPDGGDGGDGGSV
                     YVLAVEGLNSLSKLRTTYIASEGSNGASDQLDGARGKDILITVPVGTVIRWCMDPKLT
                     REFVHKKLKDQNEGSLRAILNDNKVRLDCTGKYELDTHPKNIQLFRDAYKPGEGWLFK
                     GKHEEYHKDKDWFIDLSKKVESYDLNLYDTELREDKFPLFGLDLNKPTDKPICLLKGG
                     KGGLGNMHFLTNLIRNPRFAKSGRKGLEQYLMFELKSIADLGLVGLPNAGKSTILNRI
                     SNAKPRIGHWEFTTLSPTIGTIDLNVGESSFTVADIPGIVKDASHDRGMGLEFLRHIE
                     RSKGWVFVVSIANDDPMADLQILINELGGLEKVKAKNVLVVCNKADIDCNKEEPILKF
                     QKVKEFCSEHNWDVLPMSALKGENVDILVQKMAKCAEAVRLS"
     gene            complement(<190124..>190900)
                     /gene="TDEL0G00950"
                     /locus_tag="TDEL_0G00950"
                     /db_xref="GeneID:11504520"
     mRNA            complement(<190124..>190900)
                     /gene="TDEL0G00950"
                     /locus_tag="TDEL_0G00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682625.1"
                     /db_xref="GeneID:11504520"
     CDS             complement(190124..190900)
                     /gene="TDEL0G00950"
                     /locus_tag="TDEL_0G00950"
                     /inference="similar to DNA sequence:INSDC:YHR167W"
                     /note="similar to Saccharomyces cerevisiae THP2 (YHR167W);
                     ancestral locus Anc_5.71"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682673.1"
                     /db_xref="GeneID:11504520"
                     /db_xref="InterPro:IPR018557"
                     /db_xref="UniProtKB/TrEMBL:G8ZYI7"
                     /translation="MESGCFDMLCEQEQALQENHRRLDAVVKVLSELAEPAKTEPEQI
                     RLLQSLSEEYEELVGSSIDLRYVKYQTRESQIAASNKTRRNADYTKLQNIEGLAEFVT
                     LYEMVSMDYLRYVNLLERLSVDLVKEIEIADPTVTEFVVNKWNPPKGIFEILDELADP
                     ATDVVAVRSRLNGYLDRIKMERAKYTIENKHSLQGTLRDLNKEVSNWRKEWDSIENVM
                     FGDGSHSMKKMLQNIDSLKSKLDIEKSAQDTEVEMERSAF"
     gene            <191061..>192929
                     /gene="TDEL0G00960"
                     /locus_tag="TDEL_0G00960"
                     /db_xref="GeneID:11504521"
     mRNA            <191061..>192929
                     /gene="TDEL0G00960"
                     /locus_tag="TDEL_0G00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682626.1"
                     /db_xref="GeneID:11504521"
     CDS             191061..192929
                     /gene="TDEL0G00960"
                     /locus_tag="TDEL_0G00960"
                     /inference="similar to DNA sequence:INSDC:YHR166C"
                     /note="similar to Saccharomyces cerevisiae CDC23
                     (YHR166C); ancestral locus Anc_5.72"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682674.1"
                     /db_xref="GeneID:11504521"
                     /db_xref="GOA:G8ZYI8"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR007192"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G8ZYI8"
                     /translation="MIVEEPAQVEQEIRLQLRKSATELSKWKLHKSSKWSAEALWGMA
                     ELPPSSPTSSNAAGSAGTGGYDRSTEAPQERSCGSFADLSEQEYDLYLLASTLFDCKE
                     FDRCAFFLKNVTNPCLKFLKLYSEYLSWDRKSRGNMEDVLTTGKPPKHMIRGGSHTGE
                     TDTTHVPQNAFPESASRDEQQTDSSAIMKELSSYLEELKTKEKNSGLGVSLLYYLKGV
                     LLKQDDNKSEATSCFLRSLSGYSFNWTCWVELLDCLSRSDESLLLMKHMEERFKLEET
                     ENIGSQGTIENNIMMKFFRLALFQEFSGDVDIFIEELHFLHTIFPNFTYLKAQNALTN
                     YNYMDYMNAENLFDQIIKSDPYRLDDLDTYSNILYVMQKHFKLAYLAQFTSHVDKFRP
                     ETCCAIANYYSARQEHEKSIMYFRRALTLNKNCTNAWTLMGHEFVELRNSHAAIECYR
                     RAVDMNTKDFKAWYGLGQAYEVLDMHLYSLYYFQKACTLKPLDKRMWQALASCYAKVG
                     NRQEAIKCYERALQLSVNVDQNSVLFYRLAELCEQVHDIVNCRKFMIQCVDVEDATEG
                     IVTDETAKARLWLAKYEAKRKNYEQAYNYAVGVSHGTSQEIEEARSIARECRQRIQ"
     gene            <193144..>200406
                     /gene="TDEL0G00970"
                     /locus_tag="TDEL_0G00970"
                     /db_xref="GeneID:11504522"
     mRNA            <193144..>200406
                     /gene="TDEL0G00970"
                     /locus_tag="TDEL_0G00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682627.1"
                     /db_xref="GeneID:11504522"
     CDS             193144..200406
                     /gene="TDEL0G00970"
                     /locus_tag="TDEL_0G00970"
                     /inference="similar to DNA sequence:INSDC:YHR165C"
                     /note="similar to Saccharomyces cerevisiae PRP8 (YHR165C);
                     ancestral locus Anc_5.73"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682675.1"
                     /db_xref="GeneID:11504522"
                     /db_xref="GOA:G8ZYI9"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR012591"
                     /db_xref="InterPro:IPR012592"
                     /db_xref="InterPro:IPR012984"
                     /db_xref="InterPro:IPR019580"
                     /db_xref="InterPro:IPR019581"
                     /db_xref="InterPro:IPR019582"
                     /db_xref="InterPro:IPR021983"
                     /db_xref="InterPro:IPR027652"
                     /db_xref="UniProtKB/TrEMBL:G8ZYI9"
                     /translation="MSDSPPPVPPPPLNHSNGNGRSPMGLPPPPPPPGFDGFDLPPPP
                     PGIDQNFILPPPPPGLEEDMGPPPPPPLPPASELNDEVPTSVPEASKRMNGHSTVVLD
                     NIATNKKRKLDSDNLNNSQRKRIKKEKRRLKKLKGGKVSSHKAEMPPEHLRKIIDSHS
                     DMTSKRFNYDKRSFLGALKYMPHAVLKLLENMPQPWEEVKEVRVLYHVTGAITFVNEI
                     PRVIEPVYAAQWATMWLAMRREKRDRSHFKRMRFPAFDDDEPPLSYSQNIQDIEPLDP
                     IRLNLDKFDDEFVKDWLYDSRPLQDDQKKVNGTSYKSWYLPLPVMANLQRLTSPLAND
                     LADRNKFYLYDKKSFFTSKALNTAIPGGPKFEPLYPLEEEEDFNEFNSIDRIIFRIPV
                     RSEYKVAFPQLYNSRPRSVEITWYNDPVSCLIRCDEDPEIPSFYFHSSLNPIISRRNE
                     RKSLQKKEDSGFLLPEGLKPLMDEEDLVLPETKDALELYYAPYPFNRNSGNTVRAQDV
                     PLLKSWYLQQPDEDYPIKTRVSHQKLLKTHVLNELRKRSSTNGKKVKLLKAFSNTKYF
                     QQTNIDWVEAGLQVCRQGHNMLNLLIHRRGLTFLHLDYNFNLKPTKTLTTKERKKSRF
                     GNAFHLMREIMKVTKLLVDSHVQHRLGNIDAFQLADAIYYIFNHLGQLTGIYRYKYKV
                     MHQIRACKDLKHLVYYRFNKIIGKGPGCGFWQPAWRVWIFFMRGIIPLLERWLGNLMT
                     RQFEGRTNEIVKTTTKQRTDAYYDLELRASVMKDILEMIPEGIRQNKARTILQHLSEA
                     WRCWKANIPWNVPGMPKPIKNIIERYIKAKADGWVSAAHYNRERIRRGAHVEKTVVKK
                     NLGRLTRLWIKNEQERQQLIEKNGPEITPDEATAIFSTMVSWFESRNFSPIPFPPLAY
                     KNDTKILVLALENLKDVYNSKVRLNATEREELALIEEAYDNPHETLNRVKKYLLTQRV
                     FKSVDLTMVDQYQSIKPVFSVDPLEKITDAYLDQYLWFEADERNLFPNWIKPSDAEIP
                     PLLVYKWCQGINNLSGAWDVSDGQSTAIIEATLGEMAEKIDFTLLNRLLRLIMDPNMA
                     DYMTAKNNVILTYKDMAHVNKYGLLRGLQFSSFIYQYYGLVMDLLLLGNERATDLAGP
                     AINPNDFMQFKDVETEMRSPIKLYARYLDKIYILLRFEERETDELTDEYLSENPDPNF
                     LNAVGYNNKKCWPRDARMRLMRHDVNLGRAIFWEIAGRVPSSLANLNWESSFVSIYSK
                     DNPNLLFTMCGFEVRILPNHRADEVISSGEGVWDLLEEQTKQRTAKAYLKVSQDAIDE
                     FDSKIRGILMASGSTTFTKIAAKWNTALLSLFAYFREAIVTTEPLLDILVKAETRIQN
                     RVKIGLNSKMPTRFPPAVFYTPKELGGLGMISASHILIPAADLTWSRQTETGVTHFRA
                     GMSHEDDKLVPTIFRYITTWENEFLDSQRVWSEYAAKRQEAIQQNRRLAFEELEGSWD
                     RGIPRISTLFQKDRHVLAYDRGHRARREFKKYSLERNSPFWWTNSHHDGKLWNLNAYR
                     TDVIQALGGIETILEHTLFKGTGFSSWEGLFWEKAAGFEDSMQFKKLTHAQRTGLSQI
                     PNRRFTLWWSPTINRANVYVGFLVQLDLTGIFLHGKIPTLKISLIQIFRAHLWQKIHE
                     SIVFDICQILDGELEALQIESVTKEAVHPRKSYKMNSSAADITMNSVYQWAVSRPSLL
                     HNSKDSFDATFTNKMWFDVQLRYGDYDSHDISRYVRAKFLDYTTDNVSMYPSATGVMI
                     SIDLAYNMYDAYGNWFTGLKPLVQNSMRTIMKANPALYVLRERIRKGLQIYQSNIQEP
                     FLNSSNYSELFNNDVKLFVDDTNVYRVAVHKTFEGNVATKAINGCVFTLNPKTGHLFL
                     KIIHTSVWAGQKRLSQLAKWKTAEEVSALIRSLPKEEQPKQIIVTRKAMLDPLEVHML
                     DFPNISIRPTELRLPFAASLSIDKLSDVVMKATEPQMVLFNIYDDWLERVSSYTAFSR
                     LILLLRGLKTDEEQAKIILLGDPTIPVKQHHLWPSFTDEQWITIEARMRDLILGAYGK
                     KYGVNISSLTQTEIKDLILGQNIKAPSVKRQKMAELEAARNETQADEMNAGASSVMKT
                     KTVNAQGEEIVVVTSANYENETFTSKNEWRKSAIANSLLYLKLKNIYVASDDFIEEKD
                     VFVLPRNLLKKFVEISDIRIQVAAYLYGCSSSEHPNVKEIRTIALCPQLGNNKSVTFC
                     KPPEDQVELQDLQLLGWIHTQKEDLKFMAAPEVTTHAKTFGTTFKDTIDLAVCLLPGS
                     VSLAAYNLTDEGYGWGVQNQDMVNTISEGFDPAFSEHAQLLLSERFMGNFLVPIGGFW
                     NYTFMGASFTTNMSYELRTGIPLEFYNEQHRVTHFLQFHDANGDQALEAEQEDVFA"
     gene            <200603..>201442
                     /gene="TDEL0G00980"
                     /locus_tag="TDEL_0G00980"
                     /db_xref="GeneID:11504523"
     mRNA            <200603..>201442
                     /gene="TDEL0G00980"
                     /locus_tag="TDEL_0G00980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682628.1"
                     /db_xref="GeneID:11504523"
     CDS             200603..201442
                     /gene="TDEL0G00980"
                     /locus_tag="TDEL_0G00980"
                     /note="ancestral locus Anc_5.74"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682676.1"
                     /db_xref="GeneID:11504523"
                     /db_xref="UniProtKB/TrEMBL:G8ZYJ0"
                     /translation="MDSFSDRLLRKREALLSSNDRLSRKNGVQKEVPRKSESNGLVSV
                     VHYWLRFLLRRGFTFQQILKESGVSRAFLEQTYQELSLNIPEERAPNDDEQKRIDKCT
                     GSLENNNGKPKNIEADIRQFMFRTILEVNKITASLRNPEIAEQLKDEKTRQVISKYGQ
                     HINRSLQGLFQKIEDASNSSPTQLQRVKRERADKLPEYLDRKIDNEKNQAKDKIEVSP
                     PRALATSKSSQKVCIQHPIQSMRTTNNLAARTGLRPVQTTKQPPAKLFTPYQSLIPNN
                     SKR"
     gene            <201796..>206166
                     /gene="TDEL0G00990"
                     /locus_tag="TDEL_0G00990"
                     /db_xref="GeneID:11504524"
     mRNA            <201796..>206166
                     /gene="TDEL0G00990"
                     /locus_tag="TDEL_0G00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682629.1"
                     /db_xref="GeneID:11504524"
     CDS             201796..206166
                     /gene="TDEL0G00990"
                     /locus_tag="TDEL_0G00990"
                     /inference="similar to DNA sequence:INSDC:YHR164C"
                     /note="similar to Saccharomyces cerevisiae DNA2 (YHR164C);
                     ancestral locus Anc_5.75"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682677.1"
                     /db_xref="GeneID:11504524"
                     /db_xref="GOA:G8ZYJ1"
                     /db_xref="InterPro:IPR014808"
                     /db_xref="InterPro:IPR026851"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZYJ1"
                     /translation="MPRTPEKKRPGHLLASPESGISAATKKQGTEVEKRKKRYHFAPI
                     NNLAGRNKDDLGVLRSISVSQVRNSKMTNASRQIKKTSNSKSSSTSPVRATKEAKRVA
                     ASIKEVKASRGDDVPSEEVIWRYSPTKGELSDRIGSSHHNSEDWIEFERGQDPSSTPV
                     VPKMLKNVLSFANISEPEQTEQKESLSAQIRNSTRSRGTTESLKESLRDIDDILDDME
                     GDLALKPKISKINELPSSPSRIQEQGKREVGKVEETHTPSDVSSSDGDDSLINLLTQQ
                     GSKKQDMTGMSVDVDTLDDSLLDYLDNTGKKAPEEEVEIEIENVEAMLSQSLKMAKCE
                     TPELEEYIQLASFPYRRKGVARLVLTKITEISLPKIGRQKILSCIDQDGKEGSVVVRK
                     PWVYLEFEKGDVIHIIEGANFENKRLVSDDKNPVTQLVNDNLLILNPDLLLSATAVGG
                     SIECLRRAVLQQLLEDSQGEPSIVMTIGNIVHELLQSALRYKLNHKTITIKFLEEKLD
                     CLLELFSFGILQCNENLIKIKDEIKTTHLKNIFDFVDQFVKKSNYGCYVSVSGTRKTD
                     PLSIASIIDTEENIWSPIYGLKGFLDVTVDALCKKTRSVVPLEVKTGKSKSISHEAQG
                     LIYTLLLNDRYEIPIDFYLLLYTRKNEITKYPYVLHSIKHVLMFRNQMTTKLKYRLKE
                     YRNLDPMKQNLPPLLQSSYCDSCNFKAPCMVINNLVEDGDGELSGLKNGEYELLTKHL
                     AKSHSKNAQFFKKYNDLITKEESSITCINKKLFHSQGESQDSVGSHCLSNLKVVETVN
                     DPADNTIYLHTLARAKPSGICASMLNSHLMKKDRIFISDEAGHFGIANGHIRDIAEDF
                     IIVSTRRKVLNNWVPPERSNGPPHIRSVVDDSITADSLMRTQNMVTYRINKNDIQQGL
                     SLARFSLLNLFLPPVPPGQVIADEASGQVRLAKKSEGGDERLRSILVDKVAARFESKC
                     VFSLESCGEIIPTHLNTDQKRAIEKVLQAQDFALILGMPGTGKTTVIAELIKILASAG
                     KSILLTSYTHSAVDNILLKLKDKNIKIARLGMKHRIHPDTQVYRPCYESLKTYEDYIK
                     EIESTTVVATTCLGIREINSSLRSRDFDYVILDEASQISMPVALAPLRFGEKFVMVGD
                     HYQLPPLVKNEAARIGGLEESLFKILCEDHPESVSELTIQYRMCEDIATLSNFLIYDG
                     KLKCGTADVRDRGLDVPHLSRLAKFQTSPTIQRWIEDVLDFQRKVVFLNYDSCSDIQE
                     KSSSDSITNPGELTIVQQCIDGMLECGVEAKNVGVMTLYRAQLRLLKEKLQDERHEDL
                     EILTADQFQGRDKDCIVISLVRSNLEQKSGSLLKELRRVNVAMTRAKSKLILIGSRKT
                     ISSVPEIEKFIALLQDRGWIYELSANFLQAYVFPSTSKVQASCDKKLSGNTKPKVKSI
                     DANSKILRNKPITRQAVSEL"
     gene            <206991..>209408
                     /gene="TDEL0G01000"
                     /locus_tag="TDEL_0G01000"
                     /db_xref="GeneID:11504525"
     mRNA            <206991..>209408
                     /gene="TDEL0G01000"
                     /locus_tag="TDEL_0G01000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682630.1"
                     /db_xref="GeneID:11504525"
     CDS             206991..209408
                     /gene="TDEL0G01000"
                     /locus_tag="TDEL_0G01000"
                     /inference="similar to DNA sequence:INSDC:YGR250C"
                     /note="similar to Saccharomyces cerevisiae YGR250C;
                     ancestral locus Anc_5.76"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682678.1"
                     /db_xref="GeneID:11504525"
                     /db_xref="GOA:G8ZYJ2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8ZYJ2"
                     /translation="MTGIASDKTQSANDSSDEKDKSQNQPVYTSSSTCSSPDSSGMSV
                     TGSLGAELSQVSLSCSPANLQLEQLANTNLLLIRTKFNKEAGEHSIESLIAEIESIAH
                     HYNGSLVSAANIEQYDHLPDGKRLKILEENKDIYIFENGNTEYAHSYEGEEPKHGNDW
                     KYDKVIGIQFKRSNAMKSASGKLEQLFKSRAQQIAQWSISTNEHALAQPGNLYIKGVP
                     KDMSMDQVVPMFSKFGPISSFKLIRDSVTGKSLGYGFISYPLGSHASKCIAELNGKTM
                     GSSTLFINFHIERKERERIYRDSIKESNDDEKFKGIFVGNLPLSKSSEENLSPSDVIQ
                     LFKDKLSPFFSDLAIVSYYFPKKSIKEDAHFEGDKAENGTDKRENEDVSSPKDDVISS
                     DSVSTTLSQSDDCLMKNYGFIKFKHHLQALKAIEIFNDYTWFGSNLIVNKAVQSKSQT
                     WHQRKTGGPSTMNNRSENRYHGPHNPYGYFGGHGNVYFPYMNSQGSILAGDIGPQDHE
                     VSYPLSRPMSTGSYVSSYHSFGAIPGQAPPSGLFETPSPGNSIFPLGSYGMMPSNVPF
                     GLPLPTRDQQESNLYVKHLPLSWKDDDLKEFYREYGEIISAKIITVGGSKSKSQTSQA
                     SDEVEGEDPKSLGTSRGYGFVCFKNPLDASRAILGTDGYHLTETHILHVSFAQKRAKS
                     NQGNVKNSNSPSDYDPLLESPFFHTRSLSRRASFNDHPRGQYSMKYFNPMRHPRSPAA
                     GSFPSGFVTGGAHNWQGIPILPSGPPALSSVPFVPPNPPTMSESAYSGPVFSGNESDF
                     EGAGEKN"
     gene            complement(<209613..>210809)
                     /gene="TDEL0G01010"
                     /locus_tag="TDEL_0G01010"
                     /db_xref="GeneID:11504526"
     mRNA            complement(<209613..>210809)
                     /gene="TDEL0G01010"
                     /locus_tag="TDEL_0G01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682631.1"
                     /db_xref="GeneID:11504526"
     CDS             complement(209613..210809)
                     /gene="TDEL0G01010"
                     /locus_tag="TDEL_0G01010"
                     /inference="similar to DNA sequence:INSDC:YGR249W"
                     /note="similar to Saccharomyces cerevisiae MGA1 (YGR249W);
                     ancestral locus Anc_5.77"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682679.1"
                     /db_xref="GeneID:11504526"
                     /db_xref="GOA:G8ZYJ3"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR000418"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:G8ZYJ3"
                     /translation="MHPKTFIHQLYAILQESQLQEWISWFKDDDSVFVLKPHDGGFSK
                     YVLRRYFKHGNVSSFVRQLHMYGFHKITNPQEGLGEGRSDEQGDRATTRWFFAHPLGY
                     FRKDADLASLKKIQRKSTGVGKDGRRKNVLSTVCVNYVGSKGNEEPAVPLADRRHYAS
                     LPLLPATGPLLAKQGPQYQQPLLPHIHRQEHLISKSRTISSPELIQRPGSKQVPSEGC
                     TPVPMLHFHRTSSPLNSQTNIPLPVQRNVLTNSYITPSSSAFSSTSSVTSYSMIEYHH
                     RLDNNLQILRNSLVKVADIIPSLFDSGSEIKPNYDEHIITLRRLKDELIAENNSSRIR
                     SLQSSFAGPSTSGTSPSHINSNDLPDPKIITPISEAAMNFKPKLPNDGDKHEEINLST
                     KDFTAL"
     gene            complement(<211105..>211890)
                     /gene="TDEL0G01020"
                     /locus_tag="TDEL_0G01020"
                     /db_xref="GeneID:11504527"
     mRNA            complement(<211105..>211890)
                     /gene="TDEL0G01020"
                     /locus_tag="TDEL_0G01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682632.1"
                     /db_xref="GeneID:11504527"
     CDS             complement(211105..211890)
                     /gene="TDEL0G01020"
                     /locus_tag="TDEL_0G01020"
                     /inference="similar to DNA sequence:INSDC:YGR248W,YHR163W"
                     /note="similar to Saccharomyces cerevisiae SOL4 (YGR248W)
                     and SOL3 (YHR163W); ancestral locus Anc_5.78"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682680.1"
                     /db_xref="GeneID:11504527"
                     /db_xref="GOA:G8ZYJ4"
                     /db_xref="InterPro:IPR005900"
                     /db_xref="InterPro:IPR006148"
                     /db_xref="UniProtKB/TrEMBL:G8ZYJ4"
                     /translation="MVKVYKYTEKQSLAHQVGKYILECQDKVLQNDSKAQFTVAISGG
                     SLVNVLKACLIDDKELASKVQWAKWHVYFCDERLVPLDDADSNYGAFKKAVLDPLSHH
                     GDHLNLGPTVYAINETLVNEGSHHNEKIASEYESLLPSKGFDLLLLGCGPDGHTCSLF
                     PGEKHRYLIEESQKKVAWCHDSPKPPSDRITFTFPVISQARNIAFVAEGASKQPIMQS
                     IFDNKDQQLPTALINARYSDKVCWFIDEAAFATVKDTTAVFKN"
     gene            complement(<213070..>213672)
                     /gene="TDEL0G01030"
                     /locus_tag="TDEL_0G01030"
                     /db_xref="GeneID:11504528"
     mRNA            complement(<213070..>213672)
                     /gene="TDEL0G01030"
                     /locus_tag="TDEL_0G01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682633.1"
                     /db_xref="GeneID:11504528"
     CDS             complement(213070..213672)
                     /gene="TDEL0G01030"
                     /locus_tag="TDEL_0G01030"
                     /inference="similar to DNA sequence:INSDC:YGR247W"
                     /note="similar to Saccharomyces cerevisiae CPD1 (YGR247W);
                     ancestral locus Anc_5.79"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682681.1"
                     /db_xref="GeneID:11504528"
                     /db_xref="GOA:G8ZYJ5"
                     /db_xref="InterPro:IPR009097"
                     /db_xref="InterPro:IPR012386"
                     /db_xref="UniProtKB/TrEMBL:G8ZYJ5"
                     /translation="MTIALWFCPQYGSGAYETLELLIVSLQSVFPSSPTFEPHITVTN
                     NLVCKDEDDVNRILTSCVAAMQSIRASLVKNGDSLVSFRSCSVGKKFFNKVVLDCSDN
                     RYLVSIAQIMRELYVEVDESSRSQRAATWVRDEFRPHLSLLYSDTYPISQAFLRVIQQ
                     RIEDALDVQMDGVERGSDYQLRWNFYGVPACSWGCRVLSK"
     gene            <213979..>215616
                     /gene="TDEL0G01040"
                     /locus_tag="TDEL_0G01040"
                     /db_xref="GeneID:11504529"
     mRNA            <213979..>215616
                     /gene="TDEL0G01040"
                     /locus_tag="TDEL_0G01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682634.1"
                     /db_xref="GeneID:11504529"
     CDS             213979..215616
                     /gene="TDEL0G01040"
                     /locus_tag="TDEL_0G01040"
                     /inference="similar to DNA sequence:INSDC:YGR246C"
                     /note="similar to Saccharomyces cerevisiae BRF1 (YGR246C);
                     ancestral locus Anc_5.80"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682682.1"
                     /db_xref="GeneID:11504529"
                     /db_xref="GOA:G8ZYJ6"
                     /db_xref="InterPro:IPR000812"
                     /db_xref="InterPro:IPR011665"
                     /db_xref="InterPro:IPR013137"
                     /db_xref="InterPro:IPR013150"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR023486"
                     /db_xref="InterPro:IPR029529"
                     /db_xref="UniProtKB/TrEMBL:G8ZYJ6"
                     /translation="MPVCKACKGTEFERDLSNANNDLVCKNCGVVSEDNPIVSEVTFG
                     ETSGGAAVVQGSFIGAGQTHASFGSHGGSSALESREATLNNARRKLRAVSHALNIPEY
                     ITDAAFQWYKLALANNFVQGRRSQNVIAACLYVACRKEKTHHMLIDFSSRLQVGVYSI
                     GATFLKMVKRLHITKLPLADPSLFIQHFAEKLDLGDKKIKVVRDAVKLAQRMSRDWMY
                     EGRRPAGIAGACILLACRMNNLRRTHSEIVAVSHVAEETIQERLNEFKGTKAGKLSIN
                     EFRNDETTEPGAQPPSFTRNRINEKKLKRKLGNNDVNETSEEALNRNPILTQILGEQG
                     LSSKEVLYYLKQFSQRREQVIQGMKSTHGIDDAHVHGEKKLNDEIDGYSLETDPYRPR
                     NLHLLPTTESLLSKVVDDPENLEDADDEELEALLLDDEASKMKERIWIGINGDYLLEQ
                     ESKRLKMEADAATGNTSGKRRRPNRRKKKPTDIDAAGAASMMSELKDESGLQAALKAA
                     EESGDFTAADSVKTCYKKPVFRRKSTTMQLMVYSSEL"
     gene            <215826..>218039
                     /gene="TDEL0G01050"
                     /locus_tag="TDEL_0G01050"
                     /db_xref="GeneID:11504530"
     mRNA            <215826..>218039
                     /gene="TDEL0G01050"
                     /locus_tag="TDEL_0G01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682635.1"
                     /db_xref="GeneID:11504530"
     CDS             215826..218039
                     /gene="TDEL0G01050"
                     /locus_tag="TDEL_0G01050"
                     /inference="similar to DNA sequence:INSDC:YGR245C"
                     /note="similar to Saccharomyces cerevisiae SDA1 (YGR245C);
                     ancestral locus Anc_5.81"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682683.1"
                     /db_xref="GeneID:11504530"
                     /db_xref="GOA:G8ZYJ7"
                     /db_xref="InterPro:IPR007949"
                     /db_xref="InterPro:IPR012977"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR027312"
                     /db_xref="UniProtKB/TrEMBL:G8ZYJ7"
                     /translation="MARRGRAAILPTNIILLQNLVKRDPESYHEEFLQQYAHYESLRD
                     IFMLQGLAGSDNAGGAGDSNGSSGSGTSGSTSQLMELIGFVSQVCFCFPKETANFPNE
                     LKQLVLEHHKSLPFELKEKIISSLMMLRNKGVISAEQLIQTMFPLLIAYSSQGNALTV
                     NSHARELRQMIYKNLISLLKSCNTGSKNQKLNRSTQAVCFNLLEQPDSQGIWAAKLTR
                     ELWRRGIWDDSRTVEIMTQATLHGDVKIAISGVMFFLDADKEREANFEDNSEDEDGFD
                     LDALKHKMQVNKKTGRRGKKLETAIKTYKKKSNGSAQDNGFLNFSAIHLLRDPQGFAE
                     RLFNQHLSGKNNNRFDLDQKISLMQLISRMVGTHKLMVLGLYTYFLKYLTPKQRDVTK
                     IMSACAQACHEMVPPENLQVMVRKIADEFVSDGVASEVAAAGLNTIKEICSRAPLAID
                     DTLLQDLTEYKTSKAKGVNMAAKSLVTLYREIAPEMLKKKDRGKTAAMGLQEAKREGK
                     DLKSRRPQFGVETGNVEGIAGIELLAKWKNENGNGNEDDEANWEVDEEGASEEDVEGD
                     WVTMDSDKEYDVDMSDSDKDSDLDLSDKEEETKLDPETAFRELASTRVLTPADFAKLN
                     ELRTEEGVAKLMGIKKNEELVDSTTLVGPVKYKQTREERIQKIVEGREGREKYGSRKG
                     NRDKAHSTTNREKARKKNFVMMIHKRSVQGKQKMSLRDKQKVLRQHITKQKKKGH"
     gene            <218816..>220090
                     /gene="TDEL0G01060"
                     /locus_tag="TDEL_0G01060"
                     /db_xref="GeneID:11504531"
     mRNA            <218816..>220090
                     /gene="TDEL0G01060"
                     /locus_tag="TDEL_0G01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682636.1"
                     /db_xref="GeneID:11504531"
     CDS             218816..220090
                     /gene="TDEL0G01060"
                     /locus_tag="TDEL_0G01060"
                     /inference="similar to DNA sequence:INSDC:YGR244C"
                     /note="similar to Saccharomyces cerevisiae LSC2 (YGR244C);
                     ancestral locus Anc_5.82"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682684.1"
                     /db_xref="GeneID:11504531"
                     /db_xref="GOA:G8ZYJ8"
                     /db_xref="InterPro:IPR005809"
                     /db_xref="InterPro:IPR005811"
                     /db_xref="InterPro:IPR013650"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016102"
                     /db_xref="InterPro:IPR017866"
                     /db_xref="UniProtKB/TrEMBL:G8ZYJ8"
                     /translation="MLSAGSLFSKRCGLRAVQQVRNLSIHEFRSAQLLRDYGIGTPSG
                     EAAKTADEAFRIAQQLGKKDLVVKAQALTGGRGKGHFDTGFKSGVHMCKTPEQARELA
                     GEMLQHKLITKQSGAKGKLVSAVYLVERVDAKHEAYLSILLDRKSKKPLIICSSEGGM
                     NIEEVAEKNPDAIKKFYITPSEGITDETCKAISENLGFSKEAQPEAADAVRKLYKIFS
                     ERDATQIEINPFSEVANNKDHKVMCMDAKFGFDSNASFKQEGIWKWRDLSQEDPDEVV
                     AQEYNLNFVKLQGNIGCLVNGAGLAMATMDVIKLHGGDPANFLDCGGGATPETIKKAF
                     ELILSNKSVDAIFVNIFGGIVRCDYVAQGLVQAAKELGVSVPIVARLQGTKLDEGQEI
                     IRNCGLKIHSFDELDPAAKKAVELAQAHHSKV"
     gene            complement(<220110..>220550)
                     /gene="TDEL0G01070"
                     /locus_tag="TDEL_0G01070"
                     /db_xref="GeneID:11504532"
     mRNA            complement(<220110..>220550)
                     /gene="TDEL0G01070"
                     /locus_tag="TDEL_0G01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682637.1"
                     /db_xref="GeneID:11504532"
     CDS             complement(220110..220550)
                     /gene="TDEL0G01070"
                     /locus_tag="TDEL_0G01070"
                     /inference="similar to DNA sequence:INSDC:YGR243W,YHR162W"
                     /note="similar to Saccharomyces cerevisiae YGR243W and
                     YHR162W; ancestral locus Anc_5.83"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682685.1"
                     /db_xref="GeneID:11504532"
                     /db_xref="GOA:G8ZYJ9"
                     /db_xref="InterPro:IPR005336"
                     /db_xref="UniProtKB/TrEMBL:G8ZYJ9"
                     /translation="MSALNFAFRRFWNSETGPKTVHFWAPTLKWSLVLAGLSDIKRPV
                     EKVSGAQNLSLLATALIWTRWSFVIKPKNYLLASVNFFLGCTAGYHISRIINYRIRNG
                     DNAGDVVRYIFNGENSVKQPSTAAVSSDSKKVVLHSGNANEYKH"
     gene            <220997..>222544
                     /gene="TDEL0G01080"
                     /locus_tag="TDEL_0G01080"
                     /db_xref="GeneID:11504533"
     mRNA            <220997..>222544
                     /gene="TDEL0G01080"
                     /locus_tag="TDEL_0G01080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682638.1"
                     /db_xref="GeneID:11504533"
     CDS             220997..222544
                     /gene="TDEL0G01080"
                     /locus_tag="TDEL_0G01080"
                     /inference="similar to DNA sequence:INSDC:YGR241C,YHR161C"
                     /note="similar to Saccharomyces cerevisiae YAP1802
                     (YGR241C) and YAP1801 (YHR161C); ancestral locus Anc_5.84"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682686.1"
                     /db_xref="GeneID:11504533"
                     /db_xref="GOA:G8ZYK0"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR011417"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="InterPro:IPR014712"
                     /db_xref="UniProtKB/TrEMBL:G8ZYK0"
                     /translation="MTTYMKLVKGATKIKMAPPKPKYIEPILLGTTDPAEFREIVRAL
                     DTRISDTAWTIVYKSLIVVHLMFRDGDRNVAIRYYSDHLSFFQLSEITKSAKWASGDI
                     RALERYNQYLRTRCKEYANTGIDYVRDGYSSLKSVQGKGIRTALDHVESLELQIESLI
                     RNRYSQFDLSNSLLLCAFKLLVQDLLALYNCLNEGIITLLEAFFELSHRDAERTLELY
                     KTFVDLTEDVVKYLKSGKAVGMKIPVIKHITTKLIRSLEEHLRDDQKNHSTFSNESKD
                     AAQSNASLAQKKLEQIRKQKQLLEQQLQNQQLLVSPSVPQQPYNPFGQQQDTFTFEQQ
                     VPQPTGNPFLTMNDLPQQQTGFYSANQITPAFTGAGFGGYSNEQLHPSQTGSNNPFSL
                     EPAATGNLLLQNPFTQPTFQPVQEQHTQVNPFQQSQLMSAQTAPNLMQQNYDTTGYNQ
                     QQNTGYNPFQLQQQQLQQQQLQQQQLQQQQLQQLQQLQQQQQQQQQQQLQQQQQMYNQ
                     NPNLIDI"
     gene            <223036..>225987
                     /gene="TDEL0G01090"
                     /locus_tag="TDEL_0G01090"
                     /db_xref="GeneID:11504534"
     mRNA            <223036..>225987
                     /gene="TDEL0G01090"
                     /locus_tag="TDEL_0G01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682639.1"
                     /db_xref="GeneID:11504534"
     CDS             223036..225987
                     /gene="TDEL0G01090"
                     /locus_tag="TDEL_0G01090"
                     /inference="similar to DNA sequence:INSDC:YGR240C"
                     /note="similar to Saccharomyces cerevisiae PFK1 (YGR240C);
                     ancestral locus Anc_5.85"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682687.1"
                     /db_xref="GeneID:11504534"
                     /db_xref="GOA:G8ZYK1"
                     /db_xref="InterPro:IPR000023"
                     /db_xref="InterPro:IPR009161"
                     /db_xref="InterPro:IPR015912"
                     /db_xref="InterPro:IPR022953"
                     /db_xref="UniProtKB/TrEMBL:G8ZYK1"
                     /translation="MVALQEACYGVAFASVTTNDENKFRDCIQFYHSLGFATVKDFNK
                     FKHGENLILSSGTSQDSLKEAWLEAFKLSEMDESGFRIPQQEAKNKHQSGGALIKIRL
                     VMHEPIKDTNKDACIVTYFTTELGKVIERFPNAEKVSDDLVLIKDPLGNKIGFSPLAS
                     PLDEEPTARDFFLDDSATEAGSTVQSANAEILRQTLSGQKKKKIAVMTSGGDSPGMNA
                     AVRAVVRTGIHFGCDVFAVYEGYEGLLKGGNYLRKMEWEDVRGWLSEGGTLIGTARCM
                     EFKERWGRKQAAGNLISQGIDALIVCGGDGSLTGADLFRHEWPSLVEELVKDGKFTKE
                     QVEPYKNLTMVGLVGSIDNDMAGTDSTIGAYSALERICEMVDYIDETAKSHSRAFVVE
                     VMGRHCGWLALMAGIATGADYIFIPERAVPHGKWQDELKEVCQRHRNKGRRNNTVIVA
                     EGALDDLLNPVTTEDVKNVLVDLGLDTKVTILGHVQRGGTAVAHDRWLATLQGVDSVK
                     AVLEMTPSTPSPLIGILENKIIRKPLVESVEATKSVATAIANKDFDAAISKRDTEFIE
                     LYENFLSTTVKDDGAELLPEDQRLNIGIVHVGAPSAALNAATRAATLYCISHGHKPFA
                     ILNGFSGLIQTGQMKELSWIDVENWHNLGGSEIGTNRSVAADDMGTVAYYFQKAKLDG
                     LIIIGGFEGFNSLKQLRDSRSEYPIFNIPMVLIPSTISNNVPGTEYSLGVDTCLNALV
                     RYTDEIKQSASATRRRVFVVEVQGGHSGFIASFTGLITGAVSVYTPEDKITLSTIRED
                     LALLKENFRHDKGENRNGKLVIRNEQASSVYSTELLANIISESSKDRFGVRTAIPGHV
                     QQGGFPSSKDRVVASRFAVKCVKFIEQWNKKNNIQQDKGAGDEKVLRFKFDIHGNKVS
                     TVEHEDDSAAVICVNGTNVSFKPIADLWEHETNVALRKGEEIHWSEFSRIGDILSGRL
                     KLRAEVEAASK"
     gene            <227387..>228109
                     /gene="TDEL0G01100"
                     /locus_tag="TDEL_0G01100"
                     /db_xref="GeneID:11504535"
     mRNA            <227387..>228109
                     /gene="TDEL0G01100"
                     /locus_tag="TDEL_0G01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682640.1"
                     /db_xref="GeneID:11504535"
     CDS             227387..228109
                     /gene="TDEL0G01100"
                     /locus_tag="TDEL_0G01100"
                     /inference="similar to DNA sequence:INSDC:YGR239C,YHR160C"
                     /note="similar to Saccharomyces cerevisiae PEX21 (YGR239C)
                     and PEX18 (YHR160C); ancestral locus Anc_5.86"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682688.1"
                     /db_xref="GeneID:11504535"
                     /db_xref="UniProtKB/TrEMBL:G8ZYK2"
                     /translation="MSCQSNPLQQFVGKSDRVGTAGFGARFNSQEQFPPTRSIEHSFL
                     NGQKNDGFLENKFLEVQQPSPVFPAESVSNVWLNQFSSMKLEDPLEFDNEYKKLYAGY
                     QSQQTRRNVAHVSPALHRSIYQPVMRNPVANDVHFEQEFEALERELQDDKDELLDEES
                     PLDYEFQKIASDIVNSTSNSPSPVSSKLSGSKFMGLMRDISGGLVSMRSNELRKSDGS
                     VVGNEFTPVMDNMHKTNDFDVL"
     gene            complement(<228283..>229443)
                     /gene="TDEL0G01110"
                     /locus_tag="TDEL_0G01110"
                     /db_xref="GeneID:11504536"
     mRNA            complement(<228283..>229443)
                     /gene="TDEL0G01110"
                     /locus_tag="TDEL_0G01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682641.1"
                     /db_xref="GeneID:11504536"
     CDS             complement(228283..229443)
                     /gene="TDEL0G01110"
                     /locus_tag="TDEL_0G01110"
                     /inference="similar to DNA sequence:INSDC:YHR159W"
                     /note="similar to Saccharomyces cerevisiae YHR159W;
                     ancestral locus Anc_5.87"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682689.1"
                     /db_xref="GeneID:11504536"
                     /db_xref="UniProtKB/TrEMBL:G8ZYK3"
                     /translation="MNIDDFIEATDRDLEVDTSTRSGPGSLTPPGLSSPGRSVSGGSG
                     NRRNNILEGNKTHLQQRQFSPLNFSHQDHPLKSSLRPSVNMAAAPRRSATLNKRRSLI
                     QPIVAPKTPDNHGIKSEPSTLVADRAHRQRSDSGASMRSTQAGTEPDISTLLQNLATK
                     ELELLDGKHRIEELKKQLNAEDALHQERLRELQELREQVGTHFQRNNVSNMSPTGEKH
                     RTKPKEPEEPTVYVETASNPAGSNEPPQDERHSLWSKPLAILGQFDQIIQHEVERSLH
                     WDQPASPAEDALRQETPDEGGVSRSIWNFVNDVKSGLLGIDEEVENESRPVPKKDRTV
                     RLTSGIKQFKTTNKTEADREANREANKLKFIGGGMSGDEDKQASQGVEMKEL"
     gene            <229805..>232834
                     /gene="TDEL0G01120"
                     /locus_tag="TDEL_0G01120"
                     /db_xref="GeneID:11504537"
     mRNA            <229805..>232834
                     /gene="TDEL0G01120"
                     /locus_tag="TDEL_0G01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682642.1"
                     /db_xref="GeneID:11504537"
     CDS             229805..232834
                     /gene="TDEL0G01120"
                     /locus_tag="TDEL_0G01120"
                     /inference="similar to DNA sequence:INSDC:YGR238C,YHR158C"
                     /note="similar to Saccharomyces cerevisiae KEL2 (YGR238C)
                     and KEL1 (YHR158C); ancestral locus Anc_5.88"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682690.1"
                     /db_xref="GeneID:11504537"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:G8ZYK4"
                     /translation="MAPFNFKKKKEKKEAHSESPTSTSTPSKGATSTAAFQSYFQQQR
                     QAQAGQQRPHSEPRQQQQFRVYPTPPSSQQRNVSGASTSLVQPQREYTPWNRVKLQDS
                     PFPRYRHVASSYVSDDNRIYVIGGLHDESVYGDTWIINVDDSGTQFSSKTVDISEFTP
                     PPRVGHAATLCGNAFVIFGGDTHKVNSEGLMDDDLYLFNINSFKWTIPHPVGPRPLGR
                     YGHKISIIATNQMKTKLYLFGGQFDDTFFNDLAVYDLSSFRRSDSHWEFLKPKTFVPP
                     PLANHTMVSYDHKLWIFGGDTMQGLINKVFVYDIMSNDWSLVETTGARPPPLQEHAAL
                     IYKDLMCVVGGKDEQDIYLNSIYFLNLKSCRWFKFPVFKAGIPQGRSGHSITLLKNNK
                     ILIMGGDKFDYACQGEYDLSTSETDMGRGTILYTLDLSRLGDLCPGIFDVSEPFNPTT
                     PPINDSTFAAATKSSQPQPNILTPYNAEVNQTPKATRTPLQQQLETPQSKVIQHSEED
                     EERPSFKKNEELEVPPRNINRDIRAIKKPVSPVPQLGNSEETPGPRVASLSSEHREDQ
                     VSTEDEVGVATVASSPLKGDIKYDSQVQQQVMRAPEPSNLKEAVTIKKIDEPQSPIPN
                     KEAEPANTKSEHAVTKSISRENVSKDVLAHLRSELEQLKLATESKATEASAYIKQLEG
                     EVQKLTSGASKDENGTNLVSLQSRYDILEADHNSMKDHVKEMEKLLSSRFLEVETLNK
                     IVQDQNDKIDEYEKEPSYKTELDSMKEQYASQVKQNEDLKKTLQESDSKFRQDVKNFS
                     AQLNEMISQWRSKDVVKDPEGEGSEKSLNIIGNSRHHQAVINKLQTRLDELLQSSDAL
                     QKSREELHTNYQDLKVKHSTLSEELLSKKNELEKYEDDYESILSSATNASKALEMSQQ
                     EVQKYKQANKKLKDELEELTYAHESSVGEGSNVSETRLASGSSGTSAQDSNMKFARYN
                     AKINDLKAELYIIKQERDNLKGEVLDLKKKQLVMDEE"
     gene            complement(<232901..>233428)
                     /gene="TDEL0G01130"
                     /locus_tag="TDEL_0G01130"
                     /db_xref="GeneID:11504538"
     mRNA            complement(<232901..>233428)
                     /gene="TDEL0G01130"
                     /locus_tag="TDEL_0G01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682643.1"
                     /db_xref="GeneID:11504538"
     CDS             complement(232901..233428)
                     /gene="TDEL0G01130"
                     /locus_tag="TDEL_0G01130"
                     /inference="similar to DNA sequence:INSDC:YHR157W"
                     /note="similar to Saccharomyces cerevisiae REC104
                     (YHR157W); ancestral locus Anc_5.89"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682691.1"
                     /db_xref="GeneID:11504538"
                     /db_xref="UniProtKB/TrEMBL:G8ZYK5"
                     /translation="MSLESARPGSKSVVTLSDFCNRYRISKDVRVSIGVHNEGVFTID
                     ENAFIGIRQTMDNLRQKRQRDEEWLMAGKKLRLSQESLEGNTLDARQDYDENGSGLLP
                     SDLATNYTYHHSGYEDILASEDTLLPRYRTELPFQALSSAGLPSGPPPGLPVRPAILS
                     SEDCHERNSSPPPNR"
     gene            <234096..>236321
                     /gene="TDEL0G01140"
                     /locus_tag="TDEL_0G01140"
                     /db_xref="GeneID:11504539"
     mRNA            <234096..>236321
                     /gene="TDEL0G01140"
                     /locus_tag="TDEL_0G01140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682644.1"
                     /db_xref="GeneID:11504539"
     CDS             234096..236321
                     /gene="TDEL0G01140"
                     /locus_tag="TDEL_0G01140"
                     /inference="similar to DNA sequence:INSDC:YGR237C"
                     /note="similar to Saccharomyces cerevisiae YGR237C;
                     ancestral locus Anc_5.90"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682692.1"
                     /db_xref="GeneID:11504539"
                     /db_xref="UniProtKB/TrEMBL:G8ZYK6"
                     /translation="MDTSGYVKHVSFDDLAPTLIDDQVDILKHSKKPVGFNNQFLHIP
                     PQFNPLYHVEDEEPAPKNDMFTKDHGSTSHKSQDDVRMKMMLQFMSAPDALKSSMRSQ
                     DFVDRSRSSSPRGMARNSHKLPPPPKVPSIRKMDRRPDESWDITDYDVANMGWQAEKN
                     LTRETEKNTQSNSGSSHGYTQAAFANLNELEDRLDPSSNLAKTPTKEEKNDRKKSFAG
                     MSDQELADLENFYESQSRSTSTPTIEKYDFKQQDPFFVDNFKKKGTSQIVDPLAPIYP
                     SRPVVDHRAVSVTIENAEYDQFVEDFNTRTGSRKPEESLAAIRNVNCYISGRRYTWSS
                     VDWYVENCAQDGDHLAIVTSIPFFEREVEDSTYELTRRHFVESHSDYGSFDDHDKELG
                     RVSTSSSDQGKPNASNLTAKGLRIKAIHEEAKDSCLRVLKYYASRLKGKKIKITVEMI
                     KCESPDFAVTRAAALYKPDIQIVSTVSTNLQIKFRNGKVKLPFFVMRHYAMSTAVVPY
                     EFIDPKKLGEETTNGGTVGDERKGIPKGDERLATIDNIILKTLKNPFQPDNSPKKDLS
                     SGGDSEVDSLNEYFPMSPEQKRKYDMFEKTGYVRCPPTRQNYMNTVDPSLGSEDRLTP
                     FSTGNNSRRSSRIQYDEGIYKVKSLIADSSDDDEDKPKRQGTSIRKTKSMGPITKSKS
                     KSPTLSPTTSIGRAHRTHLHTTGTKAAESASPLGERNNKKNVKHKEKKSLGSFFRKVF
                     K"
     gene            <236505..>236852
                     /gene="TDEL0G01150"
                     /locus_tag="TDEL_0G01150"
                     /db_xref="GeneID:11504540"
     mRNA            <236505..>236852
                     /gene="TDEL0G01150"
                     /locus_tag="TDEL_0G01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682645.1"
                     /db_xref="GeneID:11504540"
     CDS             236505..236852
                     /gene="TDEL0G01150"
                     /locus_tag="TDEL_0G01150"
                     /inference="similar to DNA sequence:INSDC:YGR236C"
                     /note="similar to Saccharomyces cerevisiae SPG1 (YGR236C);
                     ancestral locus Anc_5.91"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682693.1"
                     /db_xref="GeneID:11504540"
                     /db_xref="UniProtKB/TrEMBL:G8ZYK7"
                     /translation="MKLDSKIYTEAQRVARSPRLSLLMLGVICGAMVPTMYMRNHLLP
                     RFMKEDLQDVAAVTAGSGQANVPRPHMKLWPMLNAHQRRQVVLASAPSNKSSDRDQGF
                     DSDGSLMMFSSIM"
     gene            <237256..>237957
                     /gene="TDEL0G01160"
                     /locus_tag="TDEL_0G01160"
                     /db_xref="GeneID:11504541"
     mRNA            <237256..>237957
                     /gene="TDEL0G01160"
                     /locus_tag="TDEL_0G01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682646.1"
                     /db_xref="GeneID:11504541"
     CDS             237256..237957
                     /gene="TDEL0G01160"
                     /locus_tag="TDEL_0G01160"
                     /inference="similar to DNA sequence:INSDC:YGR235C"
                     /note="similar to Saccharomyces cerevisiae YGR235C;
                     ancestral locus Anc_5.92"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682694.1"
                     /db_xref="GeneID:11504541"
                     /db_xref="InterPro:IPR019166"
                     /db_xref="UniProtKB/TrEMBL:G8ZYK8"
                     /translation="MAVGLNFYREADLVEEAVIPAQEGTVVSSGAKEATLDASKQSPL
                     PHKAVSFIGNNELIDGISVRSPDYLSGFFQKLRLQLTGTVNRFTQKLDEKSSAYYKHE
                     RKLTSTIADLHSDPREELLPGFTYIAVAAMSGSVLTRNKNFLFRFAAPLLLGSACFSY
                     VLPTTFRNTAVLLHSIEADNFPDAVAKQDAIIRRTGELSRAAAHKVDGISRSIVGTVA
                     KSQHFIKEWTGLNVE"
     gene            complement(<238219..>241326)
                     /gene="TDEL0G01170"
                     /locus_tag="TDEL_0G01170"
                     /db_xref="GeneID:11504542"
     mRNA            complement(<238219..>241326)
                     /gene="TDEL0G01170"
                     /locus_tag="TDEL_0G01170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682647.1"
                     /db_xref="GeneID:11504542"
     CDS             complement(238219..241326)
                     /gene="TDEL0G01170"
                     /locus_tag="TDEL_0G01170"
                     /inference="similar to DNA sequence:INSDC:YHR154W"
                     /note="similar to Saccharomyces cerevisiae RTT107
                     (YHR154W); ancestral locus Anc_5.94"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682695.1"
                     /db_xref="GeneID:11504542"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:G8ZYK9"
                     /translation="MAVESQLFQHLNFLIVVTEARKLEEAKKTAHLLRSHACNRCEIY
                     QDYVEDDLAWQNDPKQLFVKTYGAEEMINLIISESCDFPFYHIAAFDYMIPVVTPEWV
                     STCLSTNRHHRTAVFSPDRRHIFKDYQIYVSRHCFKHSEYLFYTEIVNAMGGTCIDFL
                     SNRTTHLITKDSGDPAVAAVVGFGKVDSIKFVFPTWLVQSFKELAPASTEEHALDPKA
                     PLEVLMERSQDLWGIVDDLKFKKRSSIFEGHNFIIGLDVSLGKDLYATLIELLQANGG
                     TVIRHVDEEDIKRGAADCYIGSSVMSKEYETASEINLELGNLIWIFFMCTLERFQSAG
                     SKVIFSPFKKKLFETNELILSYSNYYGRQRFYIQRLAELLGGYSTAELSRKNSHLVSQ
                     FSWGKKFETGLRWDNCTVVNHLWLEETYRSGIKRDPQEALFQEYPVRGGLYGALGQMS
                     AEKVLSPVVQEGDAGNPEVATEGLITSFLDAGRLEREKDTPAVDLSMDRQRESSEQVF
                     EEINVLNQAPTPDLELDIRGDTPIIELPDVSLDHSIAEPGKDASIKEVVGSPHDLNPM
                     EQAKDEPINQHESKVSEAPAPEPLPLKEVTLESNETRDQELTTEKVRQQISNGDVDSQ
                     VDKPQMQVKSMNAAKGREHNEIIEAHSNSAEPLSLTPQPVNISQEHDHITPVTHKTGS
                     SRSQTPLLSLTPSQTLSSSGGNRRAAKAKAAQKLHDDIEMLNEYQRSSKRKKTGSLLP
                     QEIAQLERRKLLEQEAKRILESLFREESSSQADESVAFGRKKQLYHIEAVCTGSHETI
                     KDLDKVLLGLLGIKIHEDITTLNLKKLNTVIAPKMMRTSKFLKSFSFHPLKYALRPDF
                     LTDLLSLIHSGQVTTRQDMLLDLSNYTISEVNMELLSEKTSLPKKIFERAGIHKVNLV
                     SDVTGGVEVISSILKAHGVDEVKVVSATQMAKLDINDLAINESPEHGRKAESTDCLII
                     ITKSSQVKHFKRIVKGKCKTAMAVEWNWCISSIFGLDVDYTDQQNVIYRQDTKPDKRG
                     SSRSK"
     gene            <241915..>242475
                     /gene="TDEL0G01180"
                     /locus_tag="TDEL_0G01180"
                     /db_xref="GeneID:11504543"
     mRNA            <241915..>242475
                     /gene="TDEL0G01180"
                     /locus_tag="TDEL_0G01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682648.1"
                     /db_xref="GeneID:11504543"
     CDS             241915..242475
                     /gene="TDEL0G01180"
                     /locus_tag="TDEL_0G01180"
                     /inference="similar to DNA sequence:INSDC:YHR153C"
                     /note="similar to Saccharomyces cerevisiae SPO16
                     (YHR153C); ancestral locus Anc_5.95"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682696.1"
                     /db_xref="GeneID:11504543"
                     /db_xref="UniProtKB/TrEMBL:G8ZYL0"
                     /translation="MQVVRETLLRNPKLVKNIRSIIILDVSSDEFLQHLQDAADVNEQ
                     LMSALKELLMTLKVKYAGSKDAVLNLNISQLKYPLYHWEEALYLATEEVDFPQEIYIT
                     MQGETNRNKYSEDNRMLLKFIKTLEIGKRQAMESILEEDYELLLKKTIMTIIHQYDIT
                     EDQLELLLAETHNLAQFLGHCEEHST"
     gene            <242752..>246033
                     /gene="TDEL0G01190"
                     /locus_tag="TDEL_0G01190"
                     /db_xref="GeneID:11504544"
     mRNA            <242752..>246033
                     /gene="TDEL0G01190"
                     /locus_tag="TDEL_0G01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682649.1"
                     /db_xref="GeneID:11504544"
     CDS             242752..246033
                     /gene="TDEL0G01190"
                     /locus_tag="TDEL_0G01190"
                     /inference="similar to DNA sequence:INSDC:YGR233C"
                     /note="similar to Saccharomyces cerevisiae PHO81
                     (YGR233C); ancestral locus Anc_5.96"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682697.1"
                     /db_xref="GeneID:11504544"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8ZYL1"
                     /translation="MKFGKYLEARQLELPEYNSHFIDYKALKKLIKQLAVPLAQTSSN
                     DHLSLDDLNEETVYQRLQENKASFFFKLERELEKVNSHFLEKESDLKIICDILQTKFE
                     SYRERGQLASKKSVSYRNIHSGLRKFQRDLSNLEQYIELNRTGFAKVLKKWDKRSHSH
                     QKEFYLATVVSVQPIFTSNEASKLNDLTTALLVQLDDISKEDVMGYYASDMTRNNSNA
                     ANKFAPSSSTTSLSQTNLSAPKSEAALDIDIEIEKWYMEIVNISKLKDDHRKYSLLKE
                     FYLTKIKSAIDDAIPQSRIDKSVILNDYLTKLFLLLVGNSAVDDISLHVFYTSTRNNV
                     DLSYCDENDLVFSRRNVFHEAANCASQSRIFILREALLMITTAHPSQYSFLTKDILKN
                     LLNAQDLYLRTPLHYAAELGKLEFVQLLISSGLLDSVDVLDNQSHTPLVLAIKENHIE
                     VVRELLVNGKAAAFPQNHESSKPQFLPLIIACYHNNYEAADLILQQGDASVTDIYDAE
                     GLGTLHIVAKEGGDAQLIDLLIKHGADPDEVDNFNEWTPIFYAVQEGHADTVRELLKY
                     GARLDITDENGLGPLYYAIWETHVDVINVIRENLRTMDDKVHQRMKNPVTISRSMSPT
                     NSLQDIPDFALPPPIIPLRKYGHNFLEKKIFVKLVMKPGNASIQLQKDDEMILSSPGR
                     ITLTSNLADIVPRNIILPIADEEERDVVFQIDSLKEFSIDFEVFPAFGTRMIAKTTAM
                     PAAFNSKMVNGISSISLPLFDSRLTNVGTLSFDCQVIMPYVGRALEVTKYEPYWKSTI
                     GADVDLSKDGHQIITSSSLSGSFVSVIVYPLKDGTIVVAPLPYVTINNVNIFLSDLTK
                     NQLENLIGLKIEEIPQIDDEVSLKNILASNILAFDVLLDSIPLSIQLDIQVCFPTILE
                     MEAIPVNISPFVDINQFIDQVLNFTFEHVRKLRHSGQTLRPIVFSSCNWQACTILNWK
                     QPSFPVLLHMNDLRVVNDRFIRDTPHNLRDLAVDQSKITFNDDRSKCLHEIVSFVANN
                     NLLGIIFPYDLLMICRPLISAIRGHGLLLIGSCPTSNDAILNDNSINGILQGRELNFT
                     KSVEM"
     gene            complement(<246082..>246765)
                     /gene="TDEL0G01200"
                     /locus_tag="TDEL_0G01200"
                     /db_xref="GeneID:11504545"
     mRNA            complement(<246082..>246765)
                     /gene="TDEL0G01200"
                     /locus_tag="TDEL_0G01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682650.1"
                     /db_xref="GeneID:11504545"
     CDS             complement(246082..246765)
                     /gene="TDEL0G01200"
                     /locus_tag="TDEL_0G01200"
                     /inference="similar to DNA sequence:INSDC:YGR232W"
                     /note="similar to Saccharomyces cerevisiae NAS6 (YGR232W);
                     ancestral locus Anc_5.97"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682698.1"
                     /db_xref="GeneID:11504545"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8ZYL2"
                     /translation="MSQSLTDACMNNDLRKVQESVEDSAQNLFQRDADGRIPLHWAVS
                     FNHKEIILYILSYMKEAQLDDYPDESGWTPFHIACAVGDIDIVGELYDRMVKPDLNLQ
                     TNQGVTALHLAVSKRHINVCEFLLRHGASVRIKDKKLQLPLHRAAASGSPVLVELLCE
                     KKSPVNAVDINGWTPLFHALAEGHGDIAVMLVNKYDANDQLEDSKGLKAIDYSLNDQI
                     KKYFQNHLS"
     gene            <248098..>249027
                     /gene="TDEL0G01210"
                     /locus_tag="TDEL_0G01210"
                     /db_xref="GeneID:11504546"
     mRNA            <248098..>249027
                     /gene="TDEL0G01210"
                     /locus_tag="TDEL_0G01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682651.1"
                     /db_xref="GeneID:11504546"
     CDS             248098..249027
                     /gene="TDEL0G01210"
                     /locus_tag="TDEL_0G01210"
                     /inference="similar to DNA sequence:INSDC:YGR231C"
                     /note="similar to Saccharomyces cerevisiae PHB2 (YGR231C);
                     ancestral locus Anc_5.98"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682699.1"
                     /db_xref="GeneID:11504546"
                     /db_xref="GOA:G8ZYL3"
                     /db_xref="InterPro:IPR000163"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="UniProtKB/TrEMBL:G8ZYL3"
                     /translation="MSRSAGDFQRFARAFQQQLSKVQAGGPNGGPRGSPGRGAFAGAG
                     GLILLGGAALFLNSALFNVDGGHRAIVYSRIGGVSSRIYNEGTHVIIPWLETPVVYDV
                     RAKPRNVASLTGTKDLQMVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVL
                     KAVVAQFNASQLITQREKVSRLIRENLVRRASNFSILLDDVSITYMTFSPEFTNAVEA
                     KQIAQQDAQRAAFVVDKARQEKQGMVVKAQGEAKSAELIGEAIKKSKDYVELKRLDTA
                     REIAQILARSPNRVILDNEALLLNTVVDARFKN"
     gene            complement(<249147..>249482)
                     /gene="TDEL0G01220"
                     /locus_tag="TDEL_0G01220"
                     /db_xref="GeneID:11504547"
     mRNA            complement(<249147..>249482)
                     /gene="TDEL0G01220"
                     /locus_tag="TDEL_0G01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682652.1"
                     /db_xref="GeneID:11504547"
     CDS             complement(249147..249482)
                     /gene="TDEL0G01220"
                     /locus_tag="TDEL_0G01220"
                     /inference="similar to DNA sequence:INSDC:YGR230W,YHR152W"
                     /note="similar to Saccharomyces cerevisiae BNS1 (YGR230W)
                     and SPO12 (YHR152W); ancestral locus Anc_5.99"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682700.1"
                     /db_xref="GeneID:11504547"
                     /db_xref="InterPro:IPR007727"
                     /db_xref="UniProtKB/TrEMBL:G8ZYL4"
                     /translation="MSGGAMKDTMEKKVLQAGDEQVKSRLEMLRSKSSLHRAICKKRG
                     SGDGVAKVQKLRIRHKFASPTDSLLSPCSQKLTQHKAKLFVAKSNPTKLNFATKHQQN
                     SDEDEDEDD"
     gene            <249759..>251189
                     /gene="TDEL0G01230"
                     /locus_tag="TDEL_0G01230"
                     /db_xref="GeneID:11504548"
     mRNA            <249759..>251189
                     /gene="TDEL0G01230"
                     /locus_tag="TDEL_0G01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682653.1"
                     /db_xref="GeneID:11504548"
     CDS             249759..251189
                     /gene="TDEL0G01230"
                     /locus_tag="TDEL_0G01230"
                     /inference="similar to DNA sequence:INSDC:YGR229C"
                     /note="similar to Saccharomyces cerevisiae SMI1 (YGR229C);
                     ancestral locus Anc_5.100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682701.1"
                     /db_xref="GeneID:11504548"
                     /db_xref="GOA:G8ZYL5"
                     /db_xref="InterPro:IPR009203"
                     /db_xref="InterPro:IPR018958"
                     /db_xref="UniProtKB/TrEMBL:G8ZYL5"
                     /translation="MNVFKKKLKELVYSLSTEDHYAEYDPNADPGFNMGRRVNQGNPV
                     SASRVHLNSVDELGDEEMNIGLENGNQEINIDEFENTDKEGVSEVLLAWRHIDSWTTE
                     HNPDLNATLGDPCTHNDITHAEEDLAIAFPAAVRVSLRIHDGQEDLESMTGVSGLIYG
                     LQLMTLDQVVEMTEKWRSVAKNLSRMPQPDATMSPSTTNSAEEAKRRQFKLPHIPEQK
                     SLPPNAIQPVYAHPAWIPLLTDNAGNHVGVDLAPGPEGEYAQVIIFGRDFDTKYVVAK
                     NWGDFLLDFANDLEAGNWYLIDDNDDYFSGDGELVFRDKKSNGPVQDYLEVLKKRALI
                     KSQESTKNSENVESVSPFNTKDKTQISKTVLTDDNSTEEDIITTRDLPESELNQKTEA
                     KAPVEEQKLVKEQEDAEKDRKIEKIKEVASSVETGKASEEQVKSDEKGDSTSTSQDRS
                     NADESAQKTDDTKVESLKEEFKNVEL"
     gene            complement(<251311..>252870)
                     /gene="TDEL0G01240"
                     /locus_tag="TDEL_0G01240"
                     /db_xref="GeneID:11504549"
     mRNA            complement(<251311..>252870)
                     /gene="TDEL0G01240"
                     /locus_tag="TDEL_0G01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682654.1"
                     /db_xref="GeneID:11504549"
     CDS             complement(251311..252870)
                     /gene="TDEL0G01240"
                     /locus_tag="TDEL_0G01240"
                     /inference="similar to DNA sequence:INSDC:YGR227W"
                     /note="similar to Saccharomyces cerevisiae DIE2 (YGR227W);
                     ancestral locus Anc_5.101"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682702.1"
                     /db_xref="GeneID:11504549"
                     /db_xref="GOA:G8ZYL6"
                     /db_xref="InterPro:IPR016900"
                     /db_xref="UniProtKB/TrEMBL:G8ZYL6"
                     /translation="MSSQEPSESELVDGPPQLITPGVQRVLQREVVTGFLANLVIYPM
                     LVIYYLTTFYYISTKVVPYTFIDEQFHVGQTLKYVGGHWTHWDPKITTPPGLYVLGWL
                     NYKITSTFTSWTALTAFRLVNLIGGIVVLPVCVLRPLFLFNAIGFWPVALMCFPLLST
                     FYYLYYTDVWSTIFILQSFTFVLTQPFGAKASIWLSAICATISCTFRQTNIIWTGFIM
                     LIAVERRAMIQKQFNTNSFNNYLKLFIHSVDEFGGTVLPYMLNFVLFFIYLAWNRSIT
                     LGDKSNHSVGIHLVQLFYCFAFITFFSLPLWFSRNFLRLYRTRFFLKPLRTILEVIVI
                     MLVIRFFTVVHPFLLADNRHYTFYLFKRLIGNQRKLIKYVFMAPVYHFATFVYMEVLR
                     PSEMKFDPVTPLPIKDPIDLPIQLSHISWTALIICTFLTIVPSPLFEPRYYILPFYFW
                     RIFVTCSAEPILGELVPSKEGEEPVTIASTQRLAFEFVWFMGINIITLYIFVARPFTW
                     ASESFLQRIIW"
     gene            <253038..>254570
                     /gene="TDEL0G01250"
                     /locus_tag="TDEL_0G01250"
                     /db_xref="GeneID:11504550"
     mRNA            <253038..>254570
                     /gene="TDEL0G01250"
                     /locus_tag="TDEL_0G01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682655.1"
                     /db_xref="GeneID:11504550"
     CDS             253038..254570
                     /gene="TDEL0G01250"
                     /locus_tag="TDEL_0G01250"
                     /inference="similar to DNA sequence:INSDC:YHR151C"
                     /note="similar to Saccharomyces cerevisiae YHR151C;
                     ancestral locus Anc_5.102"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682703.1"
                     /db_xref="GeneID:11504550"
                     /db_xref="UniProtKB/TrEMBL:G8ZYL7"
                     /translation="MTSFATLFFVWMALLLRIAHASFDILPSLSGQEQMAIRSQRDLM
                     SNVTIDQLPLVGVNLRNVIFNDESVNDTESLEAFQSLMQNGVQSFRLDLQQNDSVYNL
                     ANTDIELGTFLLAFESFVNMTDDNLSANILTLHLNISNAALYGNSSSNGSVVPSSGSV
                     PNITYTLDQSMGRLRIYTPDDLRNDQLAGATYDNSGLSSSGWPTLNNFLYSKRRRVVI
                     TELSNTLNYSETPYIFDSSILHYDVRNKTLETPNTVAQLMNISSISWRYLEADFTPAE
                     IREYTNMGFSPIIANQYSKDNFTSIETILNHSVVWSWDTDQPVTTHTATPKNSDSLVA
                     YNCAVLKYTVSNHSAFWEVNNCYDKYQALCRYTERAYEWAVTEASDTYFAFDRRSESH
                     CPDDYRFALPRTPLEQFSLIMHLANTTYQNIQIWVDMNSIAVSNCWVTGGPYATCPYQ
                     KVVSRRNFVTMLTPVTVCCFFILVLVSYLNLLRVPIHSNRKNWKRLLNEVSKSELDGV
                     PS"
     gene            complement(<254626..>256227)
                     /gene="TDEL0G01260"
                     /locus_tag="TDEL_0G01260"
                     /db_xref="GeneID:11504551"
     mRNA            complement(<254626..>256227)
                     /gene="TDEL0G01260"
                     /locus_tag="TDEL_0G01260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682656.1"
                     /db_xref="GeneID:11504551"
     CDS             complement(254626..256227)
                     /gene="TDEL0G01260"
                     /locus_tag="TDEL_0G01260"
                     /inference="similar to DNA sequence:INSDC:YHR150W"
                     /note="similar to Saccharomyces cerevisiae PEX28
                     (YHR150W); ancestral locus Anc_5.103"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682704.1"
                     /db_xref="GeneID:11504551"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="UniProtKB/TrEMBL:G8ZYL8"
                     /translation="MSDSPRKRDMMKTYFSQKYDKVLDSLLVADTTAALACAAGVNSH
                     PKKIPNMEVVQGIASSLFNASIERLKVEKDGSLPSSIADTTESSDDFWKDENFRQEID
                     AESHITTMDSVEKTAVKIENKTREHFVDLFVEKLITKMIPDRLPEREHFGELSEEEKR
                     KSQTVSATVLTKNLKKLTPKMGEVFEFQDSVVRLLTWRNSSGTVTMLILCTMICYNPM
                     NLITMPLLYIAFGLMVPGYMQRHPLRRTLYPVRKVYGRSLLKDITDSGTGRAWHPPGA
                     IQEYSYGAQTNDSDSPSLEDPLSNGVEFVANLRDIQSATTATVAFSESLEKFVYGTAG
                     FKNERYSTVVFLKYIFWFCFLGIVSKFINWSLVLSFWIWYSMIKSHPKVKKMLGPFKQ
                     NAKQEVAKTKKSDGLVLDEPPEAKFVEVYEIYQQGITPRHWEFYKYSNQVFDPLDKYR
                     KLQQPPPGVFCLDEIHPPKTWTFDENSKWEVDYNVEKWATERGLKYSMDEEFLVDDSF
                     KRRRLARRVLRYASPAPKPSYKYKK"
     STS             254749..255265
                     /standard_name="Grik1"
                     /db_xref="UniSTS:546807"
     gene            complement(<257647..>258192)
                     /gene="TDEL0G01270"
                     /locus_tag="TDEL_0G01270"
                     /db_xref="GeneID:11504552"
     mRNA            complement(<257647..>258192)
                     /gene="TDEL0G01270"
                     /locus_tag="TDEL_0G01270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682657.1"
                     /db_xref="GeneID:11504552"
     CDS             complement(257647..258192)
                     /gene="TDEL0G01270"
                     /locus_tag="TDEL_0G01270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682705.1"
                     /db_xref="GeneID:11504552"
                     /db_xref="UniProtKB/TrEMBL:G8ZYL9"
                     /translation="MNHAMFLRNIFFLLALIVNIAKSYSIRYVPQHAPNNVTEAFLNC
                     LEDSLGHLDFNVTTGPIGRINMMPSTRRNFTPEERQAILHCINLASAHLHFESQSAVY
                     EDEFTLRSTDISCLRTFFDYRLQIIEGTRQTSIGNFMGLDIDLAINGYSLNCDGHFYS
                     IGHSYVTFFTPKGDTQIKYYA"
     gene            complement(<258957..>260934)
                     /gene="TDEL0G01280"
                     /locus_tag="TDEL_0G01280"
                     /db_xref="GeneID:11504553"
     mRNA            complement(join(<258957..259555,259626..>260934))
                     /gene="TDEL0G01280"
                     /locus_tag="TDEL_0G01280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682658.1"
                     /db_xref="GeneID:11504553"
     CDS             complement(join(258957..259555,259626..260934))
                     /gene="TDEL0G01280"
                     /locus_tag="TDEL_0G01280"
                     /inference="similar to DNA sequence:INSDC:YGR225W"
                     /note="similar to Saccharomyces cerevisiae AMA1 (YGR225W);
                     ancestral locus Anc_5.104"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682706.1"
                     /db_xref="GeneID:11504553"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8ZYM0"
                     /translation="MYTSDRKRPCTNGNEALAQRRLAYQSKRPCLALGGAVAAVGVDM
                     DRFIPNVTSGSAYKASPSLKSFNVRDSELLGRSPSPERLSSPGFFHDLRQTGHYEAIN
                     GEVRDSEASRVLEGSSSAFTSMMVSGTDTPKLSFEHKRHREYIADSLGFQSPQRVLQF
                     TTPGSRCDNKAGNGPHKTRHTVDQHHHYLAVDPLTTALPPSKVMAYLATSAFSRMNQS
                     FSFVSNDDGNRPARRMKSHIPYRVLDAPCLRNDFYSNLVSWSKNTDNVMVGLGCSVYM
                     WSDKHGAIPVLSHDYLNRKHDVVTCVSFCPQNLLFVIGTKQGRVLLFDQEVCLERHRE
                     EDSLTPLYEYQSSTLRGISCVQWLQKGITSSLLIGEECGDISYLIVKESLHLLEATYP
                     SQDKSEDSRRLGTPTRSQFQYSDNYQGYKLECLSKFQAQAQQVCGISLNEDQTLLAIG
                     GNDNSCTLWDVSSIQDPKLRFILPHNAAVKAVAFCPWSKSLLATGGGSKDRTIKFWHT
                     STGTLLDQIEACGQVTSLIWSTRYKQIVATFGFGDLDDPILITLYSYPKLTPLKQVHS
                     PTPLRVLSAVASPNITSICVATNDETIRFYDLWNDKEEVINEAHEPGLFGSEIMEYVE
                     GIEGGHNKMIR"
     gene            <261621..>262943
                     /gene="TDEL0G01290"
                     /locus_tag="TDEL_0G01290"
                     /db_xref="GeneID:11504554"
     mRNA            <261621..>262943
                     /gene="TDEL0G01290"
                     /locus_tag="TDEL_0G01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682659.1"
                     /db_xref="GeneID:11504554"
     CDS             261621..262943
                     /gene="TDEL0G01290"
                     /locus_tag="TDEL_0G01290"
                     /inference="similar to DNA sequence:INSDC:YGR223C"
                     /note="similar to Saccharomyces cerevisiae HSV2 (YGR223C);
                     ancestral locus Anc_5.105"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682707.1"
                     /db_xref="GeneID:11504554"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZYM1"
                     /translation="MNVRKAIVESQAGRPARFLQVAFNQDDSCFSGATEDGFMIYNTD
                     PLACKLTKRFQEADENGLSGAGGGIGYTRMLYRTNYTALVGGGKRPRYPLNKLVIWDD
                     LQQRESVILKFMSPIRQVFLSRIHIVVVLESAVEVFQFNTTPKRICPSLEISPYGIVD
                     FVVTQTRYRRESQDSMVNGASDAGSSGVNGILAFPSARSVGQVHIADLARLKRNNQNP
                     EGTQLLPTSIIKAHKSPIRFLRLNHQGTMVATCSEQGTLIRVFSVHNGSLIKEFRRGS
                     DRADIYEMSFSPKGTKLAVVSDKQTLHIFQISTTKEANEETTKNKTHALKNLVPSGWK
                     PKYLDSIWSMCSVHLKNPMLRDGDSDARLRRDRCKIGWCKYTGNDNSNAYDEEDSIVL
                     VWRISGIWEKYVMLEKESKQVYTAQETLRQDSNGSTAWEMVRESWREL"
     gene            complement(<262956..>263723)
                     /gene="TDEL0G01300"
                     /locus_tag="TDEL_0G01300"
                     /db_xref="GeneID:11504555"
     mRNA            complement(<262956..>263723)
                     /gene="TDEL0G01300"
                     /locus_tag="TDEL_0G01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682660.1"
                     /db_xref="GeneID:11504555"
     CDS             complement(262956..263723)
                     /gene="TDEL0G01300"
                     /locus_tag="TDEL_0G01300"
                     /inference="similar to DNA sequence:INSDC:YGR222W"
                     /note="similar to Saccharomyces cerevisiae PET54
                     (YGR222W); ancestral locus Anc_5.106"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682708.1"
                     /db_xref="GeneID:11504555"
                     /db_xref="UniProtKB/TrEMBL:G8ZYM2"
                     /translation="MSSKVIGSVLNRLKGGKVVGTKLEPSVRATNGATALKYRSYNAS
                     LEIEDFQSILPEKTFAVSSGTKEPVGFELIKSRDPRFFQFKDYYVLLFKDEKLLKEYY
                     QATQLARIHKVRVKFTPLPSGQRSEHVYSHYVENLEAAFESSRMYTEQYKKKRPFDQE
                     TFDLAQLQQRVRPIEERSALVWNLPPEMRSHNLMDRFWFYDIKHCFKLYWDDSIGKTL
                     YYVAFNDRNDCMKFKRNFHGVYFDDDPKWKLLVETLH"
     gene            complement(<264150..>265211)
                     /gene="TDEL0G01310"
                     /locus_tag="TDEL_0G01310"
                     /db_xref="GeneID:11504556"
     mRNA            complement(<264150..>265211)
                     /gene="TDEL0G01310"
                     /locus_tag="TDEL_0G01310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682661.1"
                     /db_xref="GeneID:11504556"
     CDS             complement(264150..265211)
                     /gene="TDEL0G01310"
                     /locus_tag="TDEL_0G01310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682709.1"
                     /db_xref="GeneID:11504556"
                     /db_xref="GOA:G8ZYM3"
                     /db_xref="InterPro:IPR002657"
                     /db_xref="InterPro:IPR004706"
                     /db_xref="UniProtKB/TrEMBL:G8ZYM3"
                     /translation="MTAVEKLGFVERFLTLWIFLSMLIGVLLGYYVPEVKDRLGSSKF
                     ADVNIPMAVGLIWMMYPILCKVRYEMLHKVMATKQVWKDIGYSVIINWLVAPLIMVIL
                     GWATLPDLVEYRSGLVLVGTARCIAMVLVWNRLAGGDEEFCAIVVAINSMLQIGLYGP
                     LSYLFVVIFSRGTHMGISMWPVVQSVLVFLGIPLGGAVFTRLVLYKISPTFYDKKFIR
                     ILAPTSLLALLFVIIIMFAMQGHEIVTNIKTVLRVIVPLLVYFTFMFFSVLAFCYYFC
                     VPYKLTVVQSFTAASNNFELAIAVAASVYGEASKEAMAATIGPLVEVPVLLAFVHVLL
                     FIKSNWYDRKTELCGCKED"
     gene            <266140..>267948
                     /gene="TDEL0G01320"
                     /locus_tag="TDEL_0G01320"
                     /db_xref="GeneID:11504557"
     mRNA            <266140..>267948
                     /gene="TDEL0G01320"
                     /locus_tag="TDEL_0G01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682662.1"
                     /db_xref="GeneID:11504557"
     CDS             266140..267948
                     /gene="TDEL0G01320"
                     /locus_tag="TDEL_0G01320"
                     /inference="similar to DNA sequence:INSDC:YGR221C,YHR149C"
                     /note="similar to Saccharomyces cerevisiae TOS2 (YGR221C)
                     and SKG6 (YHR149C); ancestral locus Anc_5.107"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682710.1"
                     /db_xref="GeneID:11504557"
                     /db_xref="UniProtKB/TrEMBL:G8ZYM4"
                     /translation="MEPTTLMEPTTVMKRSSTSSGCSGSDKSCKKHSDSNAVTVGVAV
                     AIPVGCVLILFAVILWIVYRRNKRESQDDNDPDFQGDTEYLPTNEGREYQLRSVTQEK
                     DDESYLPPNNGRFSRRRDTDPFVLPEDNGSSLRDFARQLKNEEYGPYRLASNTNSRVA
                     SQVSLPFEKNEVRISHNVGSTLSPYTSTDFNYTQSDKTPPSESCSSSNPPLEQSPVKS
                     TAGEVTRQYVQDHSGFDVEHSRADTTADRSNSVDMGNVLNQLDSSIRAELQQQSDDDH
                     VIGISPAEEENIQRMKSIYKVYLDRDGTVKQHHIDEPEDKKEEEEDETVEGPSDLHLN
                     APAESHRVASSIYSAAIPLQSYPEQQYYPVQEQNSQYYPVQDQNSQHFPVQDQNSQHY
                     PVQDQNSQQYMPQRQFPMQYAPHAMPFPQQQQYAHPQTLESIGELPSPAYLPSSSSSH
                     SLTSFRGKYKQAQFQPGVINGTAVNPMDHPEMFYTGNNGSYHSLQNSGQPAAPHQLRQ
                     SIVMTDPSQLTGGFKYRPAGSIRSASAANTRSNTMTSHMDPIYQQQQAYNSRVSGLLN
                     EEDVMQPPGVGQILPHSGGSDELRRQIGTSHNYNVS"
     gene            complement(<267996..>268547)
                     /gene="TDEL0G01330"
                     /locus_tag="TDEL_0G01330"
                     /db_xref="GeneID:11504558"
     mRNA            complement(<267996..>268547)
                     /gene="TDEL0G01330"
                     /locus_tag="TDEL_0G01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682663.1"
                     /db_xref="GeneID:11504558"
     CDS             complement(267996..268547)
                     /gene="TDEL0G01330"
                     /locus_tag="TDEL_0G01330"
                     /inference="similar to DNA sequence:INSDC:YHR148W"
                     /note="similar to Saccharomyces cerevisiae IMP3 (YHR148W);
                     ancestral locus Anc_5.108"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682711.1"
                     /db_xref="GeneID:11504558"
                     /db_xref="GOA:G8ZYM5"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="UniProtKB/TrEMBL:G8ZYM5"
                     /translation="MVRKLKYHEQKLLKKVDFLDWKQDQGHRDTQVMRTYHIQNREDY
                     HKYNRICGDIRRLANKLSLLPPTDPFRVKHEQLLLEKLYAMGILATKSKISDLENKVT
                     VSAVCRRRLPVILHRLKMAETIQDAVKFIEQGHVRVGPNLITDPAYLVTRNMEDYVTW
                     TDNSKIKKTVLRYRNQIDDFDFS"
     gene            <268772..>269416
                     /gene="TDEL0G01340"
                     /locus_tag="TDEL_0G01340"
                     /db_xref="GeneID:11504559"
     mRNA            <268772..>269416
                     /gene="TDEL0G01340"
                     /locus_tag="TDEL_0G01340"
                     /product="mitochondrial 54S ribosomal protein YmL16"
                     /transcript_id="XM_003682664.1"
                     /db_xref="GeneID:11504559"
     CDS             268772..269416
                     /gene="TDEL0G01340"
                     /locus_tag="TDEL_0G01340"
                     /inference="similar to DNA sequence:INSDC:YHR147C"
                     /note="similar to Saccharomyces cerevisiae MRPL6
                     (YHR147C); ancestral locus Anc_5.109"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL16"
                     /protein_id="XP_003682712.1"
                     /db_xref="GeneID:11504559"
                     /db_xref="GOA:G8ZYM6"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002358"
                     /db_xref="InterPro:IPR019906"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="UniProtKB/TrEMBL:G8ZYM6"
                     /translation="MSLGLKRFFSLTGALRSHIGSAAVYLTPQTKVSVQPLIVPKVIR
                     KGNKSMSLSKITTIEGPKGRIEMEIPDFVSVKLEDDNAKLTVSVVNPEEKMQRSMWGT
                     VRSHLNNHIIGVNEGHLASLKFVGTGYRAQLEQNNTFVNVKVGASVMQGLTIPEGITV
                     KSPAPTSLLIEGCNKQQVLLFAANLRKFHPPEPYKGKGIYVNSETIKLKDKKIK"
     gene            <269579..>270394
                     /gene="TDEL0G01350"
                     /locus_tag="TDEL_0G01350"
                     /db_xref="GeneID:11504560"
     mRNA            <269579..>270394
                     /gene="TDEL0G01350"
                     /locus_tag="TDEL_0G01350"
                     /product="mitochondrial 54S ribosomal protein YmL9"
                     /transcript_id="XM_003682665.1"
                     /db_xref="GeneID:11504560"
     CDS             269579..270394
                     /gene="TDEL0G01350"
                     /locus_tag="TDEL_0G01350"
                     /inference="similar to DNA sequence:INSDC:YGR220C"
                     /note="similar to Saccharomyces cerevisiae MRPL9
                     (YGR220C); ancestral locus Anc_5.110"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL9"
                     /protein_id="XP_003682713.1"
                     /db_xref="GeneID:11504560"
                     /db_xref="GOA:G8ZYM7"
                     /db_xref="InterPro:IPR000597"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR019927"
                     /db_xref="UniProtKB/TrEMBL:G8ZYM7"
                     /translation="MSKSLWPNLCKLTFVRNSSTRPVLIAPSVVNTINLEAPKINHCH
                     EQAQLRRWLPLRCGAISKKEGMMPFFDETNGKRVAATVLKLDNVEVMMHRTVEENGYI
                     ACQVGYGSKHPAKVSRQLLGHYASKYVNPKEEVSEFRIKNNAGLLPLGTLIKPSFFKA
                     GQYVDLKSISKGKGFAGVMKKYNFKGLKASHGVSIMHRHGGSYGQNQDPGRILPGKKM
                     PGHMGNKNVTIQNVQVLKVDDENGVILVKGSVAGPNGSFVKIQDSIKKPPTNA"
     gene            complement(<270498..>273767)
                     /gene="TDEL0G01360"
                     /locus_tag="TDEL_0G01360"
                     /db_xref="GeneID:11504561"
     mRNA            complement(<270498..>273767)
                     /gene="TDEL0G01360"
                     /locus_tag="TDEL_0G01360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682666.1"
                     /db_xref="GeneID:11504561"
     CDS             complement(270498..273767)
                     /gene="TDEL0G01360"
                     /locus_tag="TDEL_0G01360"
                     /inference="similar to DNA sequence:INSDC:YGR218W"
                     /note="similar to Saccharomyces cerevisiae CRM1 (YGR218W);
                     ancestral locus Anc_5.111"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682714.1"
                     /db_xref="GeneID:11504561"
                     /db_xref="GOA:G8ZYM8"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR014877"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZYM8"
                     /translation="MESPLDFTNDLDIAVLDQVVDTFYKGSGVQQKQAQEILTKFQEH
                     PDAWQRADKILQFSNNPQSKFIGLTILDKLITTKWKLLPEEQRVGIRNFVVGMIITMC
                     QDDALFHSQKNLINKSDLTLVQILKQEWPQNWPDFIPELIGSSNSSLNVCENNMIILK
                     LLSEEVFDFSAEQMTQAKSLHLKTSMSKEFEQIFKLCYQVLEQGSSTSLIVAALESLL
                     RYLHWIPYRYIYESNILELLSTKFLMSAETRAITLKCLTEVSNLEIPQDNAAIKTQTV
                     LYFQNSLQQIANNVIPVTADLRATYSTASGTDQSFLQDFAMFLTTYLTRHRTLLEDLS
                     ASDGSLRDLLLNSHQYLIQLSKIEERELFKTTLDYWHNLVAALFLEVQQLPHNEMNPL
                     MQLSMGSQSITSNSGALNPEFLKRFPLKKHIYDEICSQLRWVIIENMVRPEEVLIVEN
                     DEGEIVREFVKESDTIQLYKSEREVLVYLTHLDVIDTEEIMISKLARQIDGSEWSWHN
                     INTLCWAIGSISGTMSEETEKRFVVTVIKDLLALTEKKRGKDNKAVVASNIMYVVGQY
                     PRFLKAHWNFLRTVVLKLFEFMHETHEGVQDMACDTFIKIVQKCKYHFVIQQPRESEP
                     FIQTIIKDIQETTADLQPQQVHTFYKACGLIVSEERNVAERDRLLSDLMQLPNMAWDA
                     IVEQSSANPDLLLDSETVKIIANIIKTNVAVCTSMGADFYSQLGHIYYNMLQLYRAVS
                     SMISVQVANDGLIATKTPKVRGLRTIKKEILKLVEIYISKSRNLDDVVKVLVEPLLNA
                     VLEDYMNNVPDARDAEVLNCMTTVVHKVGHMIPQGVILILQSVFECTLNMINKDFTEY
                     PEHRVEFYKLLKAINEKSFNALLELPPAAFKLFVDSLCWAFKHNNRDVEVNGLQIALD
                     LIKNIEKLNGTPFANAFFENFYFTFVSETFYVLTDSDHKSGFSKQSLLLMRLISLVEE
                     NKIAVPIYSESDAPQGTSNQVYLNEYLANMLGSAFPHLAREQIINFLSALIKQYKDPS
                     KFNGTLRDFLVQIKEVGGDPTDYLFAEEKEKALVEQNRLDKERAAKVGGLLKPSELDD
                     D"
     gene            274228..274298
                     /gene="TDEL0Gtrna5G"
                     /locus_tag="TDEL_0Gtrna5G"
                     /db_xref="GeneID:11504562"
     tRNA            274228..274298
                     /gene="TDEL0Gtrna5G"
                     /locus_tag="TDEL_0Gtrna5G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11504562"
     gap             274315..274334
                     /estimated_length=20
     gene            <274664..>276373
                     /gene="TDEL0G01370"
                     /locus_tag="TDEL_0G01370"
                     /db_xref="GeneID:11505327"
     mRNA            <274664..>276373
                     /gene="TDEL0G01370"
                     /locus_tag="TDEL_0G01370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682667.1"
                     /db_xref="GeneID:11505327"
     CDS             274664..276373
                     /gene="TDEL0G01370"
                     /locus_tag="TDEL_0G01370"
                     /note="ancestral locus Anc_5.112"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682715.1"
                     /db_xref="GeneID:11505327"
                     /db_xref="GOA:G8ZYM9"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="UniProtKB/TrEMBL:G8ZYM9"
                     /translation="MTDDIKSAIRSGPRLSTSEGSAFELHQLSSSDVRYVRSKTGAGE
                     VNYINSATSVNDGQLLAEIGYKQELKRQFSTLQVFGVAFSIMGLLPSIASVMGGGLTG
                     GPVTLVWGWFIAAFFILLVGITMAENASAIPTAGGLYYWTYYYAPKGYKEIVSFVIGC
                     SNSLALSAGVCSISYGFALEVLAAVVISRDGDFEVTTGKTYGIFAAVVVAQGVVTCLS
                     SGLVARLQTLSIVSNVFIMILLFIALPIGAKVNRGGFNNGEFIFGTYQNFSDWNSGWQ
                     FCLAGFMPAVWTIGSFDSCVHQSEEAKDAKKSVPIGIIGSIAACWILGWLIIICLMAC
                     MDSDISKVLDTDYEIILAQIVYDCLGKNWAIAFMALIAFCQFLMGASIVTAASRQIWA
                     FARDDGLPLSKYIKKVDKKYSVPFVAIIAACVASLLLGLLCLDAAAAAALFSLAVAGN
                     NLAWSTPTFLRLTWGRDLFRPGPFYLGKLWSPIIAWIGVVYQAFIIILVMFPSARHGL
                     TPQTMNYACVIGPGLWILSWIYYMVYRKKYFHGPKSNLSDEDYNEAVGEDLIEEILSR
                     KGE"
     gene            complement(<276502..>282432)
                     /gene="TDEL0G01380"
                     /locus_tag="TDEL_0G01380"
                     /db_xref="GeneID:11504563"
     mRNA            complement(<276502..>282432)
                     /gene="TDEL0G01380"
                     /locus_tag="TDEL_0G01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682668.1"
                     /db_xref="GeneID:11504563"
     CDS             complement(276502..282432)
                     /gene="TDEL0G01380"
                     /locus_tag="TDEL_0G01380"
                     /inference="similar to DNA sequence:INSDC:YGR217W"
                     /note="similar to Saccharomyces cerevisiae CCH1 (YGR217W);
                     ancestral locus Anc_5.113"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682716.1"
                     /db_xref="GeneID:11504563"
                     /db_xref="GOA:G8ZYN0"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR005821"
                     /db_xref="InterPro:IPR027359"
                     /db_xref="UniProtKB/TrEMBL:G8ZYN0"
                     /translation="MEGSRRSLTSHFEPATGSSSHDNENSRSGEPTPTIPPSFNIIPP
                     QPDSNDHLALSDDDRDQLDENKGADSISGIFKPNGLSSRGRERPKLSLRTSSISDRGS
                     ASSSKLTGLSSNDHTTSIRMRRRSNDSRSSRGSSNNLSDHAPRSARVLSYIQADDMDE
                     FQDIQKDFQSAMDEEGRTWLPQIGSVKSNADSTHSGSEQEQSEPEDSLNDLDVSTHLR
                     GNSSTLRESNQLHNSPSKSITKNALNIFQDKQDEASTLVVELADLDDIPGRKRFQPLK
                     LYGNSLGLISPTNKIRLKLASLQLHPMYKIAYQLLLTLFTALMAFRTYQPTQLDFLYS
                     FSYWVDYTAFFLCILFTLNDTAKVIAFGLWDDSQMFAAYGKQYTTLMETFGLTKFLKF
                     LRNKYGAKIVSFIVPFQILDNEDEPAFQSKEHKGTLTNLSTTAKTKNFEIPRAFLRSS
                     WNRIDFTSTICFWMGLFLAIHEYDIKKGIRIFKTLAFLRILRLVNTDTGLSSILRGVK
                     YAIPQLINIGSMFVYFWLLFGILGVQSFRGSLRRQCVWFDQNDSNDRYQYENQFCGGF
                     LEPITKKVMPYLLNDGTYGPASKGFLCPQYSKCISNANPYNGRVSFDNIVNAMELVFV
                     VMSANTFTDLMYYTMDSDEMAASIFFVVAIFVLNIWLMNLVIAVLVTSFQLANEEFKR
                     KKLEVKTLESWPIRLATGYWRYFQVKAQRTKMPTWAKRGQLLCEKIEPIMVILIVVDL
                     AMRCRLDATVSESYTNKFIDTDTGICTMLLLESIFKLIFHIPNPWKFLIKWSYVYDLV
                     VGIAAFIITLLKKYRILGDTYYWLSIFHISRFYRVVYMFGFTSNLWKRVLGNRLMIWN
                     LSAFYFFFTFLVSIIMSVYFEGILPADEMEDQQFGMFSLPNSFLSLFIIGSTENWTSI
                     LYSLQSYATNISSSFFSSVLLIVWFILSNSVILNIFIALISETMEVKEEEKRPLQIKH
                     YLKYIYPQKIKEFTHASFLKRLQKKVFRNGSQEDSRDFKQFLMRGTAIMNIAQSMPGL
                     ADELKTDSFSIDVPQNVKARFGKLSQYFSFLHKLKMYAHNPFYKKPEVLFTEGGDESR
                     RTFLLQLNEHEDEKLDYLKRHPSFNNSYFILSPHHAFRKFCQRLVPPSVGRRTDNIRF
                     YDDDTDLYGQKVHFHRIRRDIFVVFMTIVTILLIVFSCFVTPLYRMEHKLKIWSWPTY
                     VDCAFVSIFTIEFIVKTVADGVFYTPNGYLRNPWNFIDSIVLISLWINLIAFLRNDGD
                     LSRIFKGLTALRALRCLTVSNMARNTFSLVVFDGIRKIFEASFVSLTLLFPFTVWGMN
                     LFRGKLGTCNDGSKGMGDCNSEFTNTVFNWDIMMPRVYSQPYLFFDSFGSSFRSLYEI
                     VSLEGWTDLLENLMNSTGVGTPASLFASSGNAIFLVLFNFLSMVFILNLFISFIINNH
                     AKTTGSAYFTTEEKSWLEAKKLLSQAKPRSIPSLIELSNTRRFFYGLAVEKSNFFMSF
                     LLQVVLYLHIIMLLWRSYRKPNLGIQFEDIFFMVSTTIFFLQEIFHLYGEGLRLYVRS
                     IWNKTRFAIVITSFVLTAVGFKVTNEALLFNNVKELFHLVIFLFVIPQNDMLSELVQT
                     AVASWPPILSLTFTWGILFLVYSIALNQIFGLTKLGPNTSGNINFRTVPKALIVLFRC
                     SFGEGWNYIMADLAVDIPYCYTYSGTGNDCGSELYAYLLLMSWNILSMYIFLNMFISL
                     IIGNFSYVYRRGGSKSPIGRREILKFVEAWTKYDTDGTGELEFSYLPKLMHSFDGPLS
                     FTIWEGSLTIKNLVKNYMEVNPNDPYDVQIDLDGLNKELDSIDKVKVIQRRLHYRRFT
                     QEVFHTNSYRGAIGFSSLLKLIPLYTIYNPRECLGIDEYVRHLYNLGKVDKYLDNEKN
                     FDVLNMVVTAWKYQSRQKSRGTVVSKSSTLFQTYETITNPFNSVSERSSNDFATTPLM
                     DFGVDNFLWSPKLGGRKK"
     gene            <282629..>284446
                     /gene="TDEL0G01390"
                     /locus_tag="TDEL_0G01390"
                     /db_xref="GeneID:11504564"
     mRNA            <282629..>284446
                     /gene="TDEL0G01390"
                     /locus_tag="TDEL_0G01390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682669.1"
                     /db_xref="GeneID:11504564"
     CDS             282629..284446
                     /gene="TDEL0G01390"
                     /locus_tag="TDEL_0G01390"
                     /inference="similar to DNA sequence:INSDC:YGR216C"
                     /note="similar to Saccharomyces cerevisiae GPI1 (YGR216C);
                     ancestral locus Anc_5.114"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682717.1"
                     /db_xref="GeneID:11504564"
                     /db_xref="GOA:G8ZYN1"
                     /db_xref="InterPro:IPR007720"
                     /db_xref="UniProtKB/TrEMBL:G8ZYN1"
                     /translation="MTHYVFWPQHLKLHDKKGNLEAVAITLRGTDHVVIDIVPCELLK
                     GTLLELPYSSIATKVSTEWHFKVDVYQVIEFRAPNLRILQFFSLDPISLTLPEKEIGA
                     NEKSSVNDNVCKLWDHPRYQMHDKKLRQTLSLLNLYHTHETAFREKYPKLSSHRGTLG
                     SRLWGSMKRLYRVSRLKTLVSYLGLYLTAIICQLALYTYKALNWQYLKFVNLSVMAQQ
                     IDLRCQQICYFPVQYLRINMNMTLRKALPRFRTYSEASANLRKDLPSNYYPDYIRFYN
                     TVWLFLNDMSFGLIFAAFLFEWCDSFSKILHRIITFCLYDLMKSVTISLANNPLGIKL
                     NEELARFLSDLFLWIIEFSNTMLLEPMANPETLSLLLRTVGNLGCVLGGTFALSVFVD
                     YFSILTVHVYIFYHISSKIYHWQISIMKSLFYLFTGKKRNVLRDRIDINFFQLDELLL
                     GTIFFIILVFLTPTVLAFYYSFTVFRLVTICVQIAVESVIALLNHFPLFALLLRVKDP
                     RRIPGGISIQAIEGPTVRFELKNRPLSITNMFKPYLALIDQMRHTYFSPKTIKQILAG
                     RPFVMHRIKLYKVLYSSLPTTPVEIKTLYSQLSQLLTSA"
     gene            complement(<284491..>284814)
                     /gene="TDEL0G01400"
                     /locus_tag="TDEL_0G01400"
                     /db_xref="GeneID:11504565"
     mRNA            complement(<284491..>284814)
                     /gene="TDEL0G01400"
                     /locus_tag="TDEL_0G01400"
                     /product="mitochondrial 37S ribosomal protein RSM27"
                     /transcript_id="XM_003682670.1"
                     /db_xref="GeneID:11504565"
     CDS             complement(284491..284814)
                     /gene="TDEL0G01400"
                     /locus_tag="TDEL_0G01400"
                     /inference="similar to DNA sequence:INSDC:YGR215W"
                     /note="similar to Saccharomyces cerevisiae RSM27
                     (YGR215W); ancestral locus Anc_5.115"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM27"
                     /protein_id="XP_003682718.1"
                     /db_xref="GeneID:11504565"
                     /db_xref="InterPro:IPR013219"
                     /db_xref="UniProtKB/TrEMBL:G8ZYN2"
                     /translation="MADLKNRLLKVAEISAKIFDLNFNPTNARTGSRILAKRLKGPTI
                     AGYYGDPDFLKFKHLKTLYPDFQFGDQKEEYRLSMIEARKRRGKGAPKKKKEASTGGK
                     TKKRK"
     gene            <285255..>286916
                     /gene="TDEL0G01410"
                     /locus_tag="TDEL_0G01410"
                     /db_xref="GeneID:11504566"
     mRNA            <285255..>286916
                     /gene="TDEL0G01410"
                     /locus_tag="TDEL_0G01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682671.1"
                     /db_xref="GeneID:11504566"
     CDS             285255..286916
                     /gene="TDEL0G01410"
                     /locus_tag="TDEL_0G01410"
                     /inference="similar to DNA sequence:INSDC:YGL077C"
                     /note="similar to Saccharomyces cerevisiae HNM1 (YGL077C);
                     ancestral locus Anc_6.205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682719.1"
                     /db_xref="GeneID:11504566"
                     /db_xref="GOA:G8ZYN3"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004756"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="UniProtKB/TrEMBL:G8ZYN3"
                     /translation="MVSKSLSSAYEADRTSLSEVHTRESHKGALEYGKDTMMTERGGE
                     VHLRKSFSLWSILGVGFGLTNSWFGISVSMVTGIFSGGPMMIVYGIIIVALISICVGA
                     SLGELSSAYPHAGGQFWWSLKLAPPKHKRFAAYLCGSFAYAGSVFTSASTTLSAATEV
                     VGMYALAHPDFTPKRWHVFVCFEIMHLFLTLFNCYGKSLPLISASALYISLLSFFTIT
                     VTVLACSSGKFNDAKFVFATFYNETGWKNSGIAFIVGLINPAWSFSCLDCATHMAFEV
                     EKPERVIPIAIMGTVAIGFATSFCYVISMFFSIRDLDSLMQSATGAPILDIYNQALGN
                     TSGAIFLGCMVLFTSFGCIIACHTWQARLGWSFARDKGLPFSGLLSQVNPQVGVPLNA
                     HLMSCALISLIGLLYLASSTAFNSLCTGCIAFLLLSYSIPVICLLRKKRQIKHGPFWF
                     GKLGYFFNIVLLGWAVFCIVFFSFPPALPVTKDNMNYVSVVIVGFTAYALLYWKFKGC
                     KEFSAIAEEEEELLNNDVDPNSVRDSEQSIEPEIIELGNKDSKRI"
     gene            <287165..>288703
                     /gene="TDEL0G01420"
                     /locus_tag="TDEL_0G01420"
                     /db_xref="GeneID:11504567"
     mRNA            <287165..>288703
                     /gene="TDEL0G01420"
                     /locus_tag="TDEL_0G01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682672.1"
                     /db_xref="GeneID:11504567"
     CDS             287165..288703
                     /gene="TDEL0G01420"
                     /locus_tag="TDEL_0G01420"
                     /inference="similar to DNA sequence:INSDC:YGL078C"
                     /note="similar to Saccharomyces cerevisiae DBP3 (YGL078C);
                     ancestral locus Anc_6.204"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682720.1"
                     /db_xref="GeneID:11504567"
                     /db_xref="GOA:G8ZYN4"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZYN4"
                     /translation="MTKEEIKDKKRKVEDDLTKEKKKQKKDKKQKDKKEKKEKKEKKK
                     EKKEKKEKKDKEDKEDKPVEKKFEPILAEASGPEVEAFYKENEVSVDYPTEKQIQPVL
                     SFDELSLDSKIQAAISVFPKPTPIQSVSWPYLLAGKDVIGVAETGSGKTFAFGVPAIN
                     KLVTEDGKKKGVQVLVISPTRELASQIYDNMILLIEKADLECCCVYGGVPKYEQREKL
                     KKAQVVVATPGRLLDLMQEGSVDLSNVSYLVLDEADRMLEKGFEEDIKNIIRSTNTSS
                     RQTLMFTATWPKEVRELASTFMSDPVKVSIGNRDELSANKRITQVVEVIDQFQKERKL
                     LELLKKYQSGPKKDEKVLIFALYKKEATRVERNLKYNGYNVAAIHGDLSQQQRSQALN
                     EFKTGASNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHT
                     LFTEQEKHLAGALVNVLNGANQPVPEELKKFGTHTKKKEHSAYGAFYKDVDMNKKPKK
                     ITFD"
     gene            <289014..>289826
                     /gene="TDEL0G01430"
                     /locus_tag="TDEL_0G01430"
                     /db_xref="GeneID:11504568"
     mRNA            <289014..>289826
                     /gene="TDEL0G01430"
                     /locus_tag="TDEL_0G01430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682673.1"
                     /db_xref="GeneID:11504568"
     CDS             289014..289826
                     /gene="TDEL0G01430"
                     /locus_tag="TDEL_0G01430"
                     /inference="similar to DNA sequence:INSDC:YPL196W"
                     /note="similar to Saccharomyces cerevisiae OXR1 (YPL196W);
                     ancestral locus Anc_6.203"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682721.1"
                     /db_xref="GeneID:11504568"
                     /db_xref="InterPro:IPR006571"
                     /db_xref="UniProtKB/TrEMBL:G8ZYN5"
                     /translation="MFDMKQALDKFKTALSPEAVPSRSSTPSSSSLNRSSRKTSRDRN
                     ISVNGSLLFEEDDVLPTVKLTGYLPTTKNRLIRPDMCDQLRSLMPTRVQLYTEWELLY
                     SLEQHGSSLKSLYDHVSPQSTTPMRVGYVIVIKDRKNGIFGGYTNEPFHPTENRRYYG
                     NGECFLWRLDKVPHLTICDGGKRSDSHIKQNQEEHVWQFRGYPYTGLNEFAIYCQSGF
                     LSMGAGDGHYGLWIDDGLMQGVSYPSLTFGNDVLSKEGEKFHIVALEVWRVG"
     gene            complement(<289884..>290480)
                     /gene="TDEL0G01440"
                     /locus_tag="TDEL_0G01440"
                     /db_xref="GeneID:11504569"
     mRNA            complement(<289884..>290480)
                     /gene="TDEL0G01440"
                     /locus_tag="TDEL_0G01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682674.1"
                     /db_xref="GeneID:11504569"
     CDS             complement(289884..290480)
                     /gene="TDEL0G01440"
                     /locus_tag="TDEL_0G01440"
                     /inference="similar to DNA sequence:INSDC:YGL079W"
                     /note="similar to Saccharomyces cerevisiae YGL079W;
                     ancestral locus Anc_6.202"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682722.1"
                     /db_xref="GeneID:11504569"
                     /db_xref="InterPro:IPR019371"
                     /db_xref="UniProtKB/TrEMBL:G8ZYN6"
                     /translation="MSEHQNSPDYAATRSQSPSVNSQAYAIPISEDIASQLTDESSLE
                     GSDNSEAEESSGDLFLDSMVQESSNGLFTDSQDPGPMLDVSKYIFESLVQAIESANFA
                     EAISLQTKTSAVINSESTRLKQLIETTKEQLASFKDRFERGAETSKLIRQNLQYSKDK
                     IDRLNAELGIAHPIEFNQAKEKVLERQFDCEPDGSTKS"
     gene            <290625..>293444
                     /gene="TDEL0G01450"
                     /locus_tag="TDEL_0G01450"
                     /db_xref="GeneID:11504570"
     mRNA            <290625..>293444
                     /gene="TDEL0G01450"
                     /locus_tag="TDEL_0G01450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682675.1"
                     /db_xref="GeneID:11504570"
     CDS             290625..293444
                     /gene="TDEL0G01450"
                     /locus_tag="TDEL_0G01450"
                     /inference="similar to DNA sequence:INSDC:YPL195W"
                     /note="similar to Saccharomyces cerevisiae APL5 (YPL195W);
                     ancestral locus Anc_6.201"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682723.1"
                     /db_xref="GeneID:11504570"
                     /db_xref="GOA:G8ZYN7"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017105"
                     /db_xref="UniProtKB/TrEMBL:G8ZYN7"
                     /translation="MTSLYAPTGDDVKQRLRPFGIFFEKSLKDLIKGIRSNNETPEKL
                     QHFLAQALSECREEANSPDLNLKTNAVLKLTYLEMYGFDMSWANFHILEVMSSSKLQQ
                     KRVGYLAASQSFYKDSDILMLATNLMKKDLKYGGNNDVVKVGIALSGLSTIVTPSLAA
                     DICDDLFGMLSSSKPYIRKKAVTALFKVFLQYPEALRDNFDKFAARLEDDDTSVLSAM
                     VSVICELSKKNPQPFIKLSPMLYEILVTISNNWIIIRLLKLFTNLSKVEPKLRPRLLP
                     KILELMDTTVATSVLYESINCIVKGNMLEEDDFDTAVRCLECLQTFCDSSDPNLRYIS
                     CVLFYKIGKINIAFISQFDKLVLRLLNDVDVSIRSKALELVVGIVSEENLKSIVLALL
                     KQFVDEDTIVLQSGEPNFEVANEIPIIISEPYKIKMVNTIIHICSMDNFSMLTDFEWY
                     NTVLLDLIMLSQDISEPSLGCKIGEQLRNSMVKVPSMREDTLSTIIKILSTDSVYTQI
                     AGVLKECFWSIGEYSSQVDNGDDLIQSILAKKHHFAAEIQQVVIIALLKIFTNWSNGH
                     SDLDLTRLKFIMEELLNYFQSLSYSKDFEVQERAVESSEILKLSSEALQEDGDGLPLL
                     ISEVMPSLFNSYELKPLSHGVQMQLQQNVTVDCDTPFLSTEELTEILEKNTSSETGAF
                     TEDSLESDDGKFAYNEEEADDSSSGEKQPTEDWELSKEEREVLEKRKEEERQSNPFYL
                     AREETTSKSINGDLLDFSENGDDTEQSSNTIRLSKQQIISPSVGEKAKKEKKIKKKPK
                     RRVEVLPDEVVATTQDVSNNKPSNIRVTPSSQSVSSLAPSNKKISLKTHTMLENFDFS
                     KPKDALDESNEDIGSGAQDEQDELERIRSKFANQGLVEIQPGEEDEEVVIVKKKKKSS
                     KKKNKKTSKTSSKTQEEKEDARQLA"
     gene            <293610..>295280
                     /gene="TDEL0G01460"
                     /locus_tag="TDEL_0G01460"
                     /db_xref="GeneID:11504571"
     mRNA            <293610..>295280
                     /gene="TDEL0G01460"
                     /locus_tag="TDEL_0G01460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682676.1"
                     /db_xref="GeneID:11504571"
     CDS             293610..295280
                     /gene="TDEL0G01460"
                     /locus_tag="TDEL_0G01460"
                     /inference="similar to DNA sequence:INSDC:YPL194W"
                     /note="similar to Saccharomyces cerevisiae DDC1 (YPL194W);
                     ancestral locus Anc_6.200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682724.1"
                     /db_xref="GeneID:11504571"
                     /db_xref="GOA:G8ZYN8"
                     /db_xref="InterPro:IPR026217"
                     /db_xref="UniProtKB/TrEMBL:G8ZYN8"
                     /translation="MSFRAVISDPERQQLWFRTINVLATIYKDIRLTITPTEIIAWNL
                     NSTDTTLCKVRFSSQFFEEYDFKPREIVFGASGVQTINDSHRRDHKLYSLQINGRHLT
                     TISRKPDGDAIKNFTIAINNTSTCPDTLTNRLLVHVEMESLISKEYTPQFEPIKYDPI
                     IIDLKYKRNFLDVYGSASASSTGHEEALDPKLVDIFTATRNELSNALFNDQPENNARN
                     EDKLTVADEINYMCCNQALLKNFIDDCNANVTEEFKLEISVHKLVITAFTKAIYGKNN
                     DILRNTMSLSNTISVNDLEHYCLFTTTDDTSDTAVQKKDQTKAIIFKLKDLKNFLSIG
                     STWKTTQSENLNIWFCRGGDPILIELKKNGVTLELVQVTDSNGSNITVEDHLARTVIK
                     KAISPKKRKTQAANEDLASSRISPLRNQKSTAENRRSPLKEHLDATLAENQPRKLFVT
                     DDSQETTTHRQWGRSDSNWTDDDLVSREPTEPAEEPTNPAPVRAERTGTTIEWGTRSL
                     EPEENFSTLDRKSVLKREKLKHFKALTESEEPEGLGPTQISKPKGLFD"
     gene            complement(<295342..>295722)
                     /gene="TDEL0G01470"
                     /locus_tag="TDEL_0G01470"
                     /db_xref="GeneID:11504651"
     mRNA            complement(<295342..>295722)
                     /gene="TDEL0G01470"
                     /locus_tag="TDEL_0G01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682677.1"
                     /db_xref="GeneID:11504651"
     CDS             complement(295342..295722)
                     /gene="TDEL0G01470"
                     /locus_tag="TDEL_0G01470"
                     /inference="similar to DNA sequence:INSDC:YGL080W"
                     /note="similar to Saccharomyces cerevisiae YGL080W;
                     ancestral locus Anc_6.199"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682725.1"
                     /db_xref="GeneID:11504651"
                     /db_xref="GOA:G8ZYN9"
                     /db_xref="InterPro:IPR005336"
                     /db_xref="UniProtKB/TrEMBL:G8ZYN9"
                     /translation="MSQPAQRAATRSVIQKYINKETLKYVFTTHFWGPVSNFGIPIAA
                     IYDLKKDPTVISGPMTGALVIYSAVFMKYALAVTPTNYLLFGCHLVNEAAQLGQGYRF
                     LHYNYLADEDEKKAIDEKWSMPSK"
     gene            <296239..>297114
                     /gene="TDEL0G01480"
                     /locus_tag="TDEL_0G01480"
                     /db_xref="GeneID:11504652"
     mRNA            <296239..>297114
                     /gene="TDEL0G01480"
                     /locus_tag="TDEL_0G01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682678.1"
                     /db_xref="GeneID:11504652"
     CDS             296239..297114
                     /gene="TDEL0G01480"
                     /locus_tag="TDEL_0G01480"
                     /inference="similar to DNA sequence:INSDC:YPL193W"
                     /note="similar to Saccharomyces cerevisiae RSA1 (YPL193W);
                     ancestral locus Anc_6.198"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682726.1"
                     /db_xref="GeneID:11504652"
                     /db_xref="InterPro:IPR019496"
                     /db_xref="UniProtKB/TrEMBL:G8ZYP0"
                     /translation="MNYHSYQPYGNGSRPLPRPSSSGTLSGGSTLEPVNKRARLQQSP
                     IPPIVYPPSSQPYLVQPYHVQQPYGVPMMPQPFARNQCSPEPSYREPVQAPKQQQKPV
                     EDELEEEDDDENEEEDEDKGLLDSASVPVISVPGTSITLNTMEDITKWREERKKMWLL
                     KISNNKLKHMQDMGIQEDELKGHRGPLQDAKKQKQFLQSIQSQVSRINPRSTLSVRVA
                     QREMARENSKLLDFIEKLGDSNLLTYELTESEKENCLDLTIKTIGEKGITILHHLERI
                     SQTKITVIVNHFEKF"
     gene            complement(<297092..>297451)
                     /gene="TDEL0G01490"
                     /locus_tag="TDEL_0G01490"
                     /db_xref="GeneID:11504653"
     mRNA            complement(<297092..>297451)
                     /gene="TDEL0G01490"
                     /locus_tag="TDEL_0G01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682679.1"
                     /db_xref="GeneID:11504653"
     CDS             complement(297092..297451)
                     /gene="TDEL0G01490"
                     /locus_tag="TDEL_0G01490"
                     /inference="similar to DNA sequence:INSDC:YPL192C"
                     /note="similar to Saccharomyces cerevisiae PRM3 (YPL192C);
                     ancestral locus Anc_6.197"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682727.1"
                     /db_xref="GeneID:11504653"
                     /db_xref="UniProtKB/TrEMBL:G8ZYP1"
                     /translation="MSSSEFDSDSSIDHNVKRLIRRPRDDSEKSKINANDSLAAVTVK
                     KRRPAGKVGKPSAVLRNSRPNSQNEPRRGQVRSSNINDQTRGSNSFYQGALLGSFLGA
                     TLTTVVTNLVARTFQNG"
     gene            complement(<297665..>298630)
                     /gene="TDEL0G01500"
                     /locus_tag="TDEL_0G01500"
                     /db_xref="GeneID:11504654"
     mRNA            complement(<297665..>298630)
                     /gene="TDEL0G01500"
                     /locus_tag="TDEL_0G01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682680.1"
                     /db_xref="GeneID:11504654"
     CDS             complement(297665..298630)
                     /gene="TDEL0G01500"
                     /locus_tag="TDEL_0G01500"
                     /inference="similar to DNA sequence:INSDC:YGL081W"
                     /note="similar to Saccharomyces cerevisiae YGL081W;
                     ancestral locus Anc_6.196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682728.1"
                     /db_xref="GeneID:11504654"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="UniProtKB/TrEMBL:G8ZYP2"
                     /translation="MEEVRKFKFTLEEARSERGVVKVIGRASDGKPNRRARKDNLLFD
                     EKSLSKNHAMLGLKLLDPLEPNVHIIDQFRIYVKDLGSTYGIVDLNSEESDPFVIDLK
                     NGERFGLVGLDEPISMYQRRAAKLKFQVNLQYFDARKGIFECIVRDVSFNDSPVISRP
                     SSCDDEGAELEFLSSSSSSSSSDWNFSEDFSIIRETPSEPVNDYTEEEDISSDSGDSD
                     EDEGYSVVDLLTLSQESEEWDVLESEESEDDDKHVCGRSEKRILARNKCLIINYEPRG
                     SDESLDVNRSTGILKTLMVSAMVGFLFGFLGTVVLLVGLALKEVE"
     gene            complement(<298860..>299963)
                     /gene="TDEL0G01510"
                     /locus_tag="TDEL_0G01510"
                     /db_xref="GeneID:11504655"
     mRNA            complement(<298860..>299963)
                     /gene="TDEL0G01510"
                     /locus_tag="TDEL_0G01510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682681.1"
                     /db_xref="GeneID:11504655"
     CDS             complement(298860..299963)
                     /gene="TDEL0G01510"
                     /locus_tag="TDEL_0G01510"
                     /inference="similar to DNA sequence:INSDC:YGL082W,YPL191C"
                     /note="similar to Saccharomyces cerevisiae YGL082W and
                     YPL191C; ancestral locus Anc_6.195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682729.1"
                     /db_xref="GeneID:11504655"
                     /db_xref="InterPro:IPR007518"
                     /db_xref="UniProtKB/TrEMBL:G8ZYP3"
                     /translation="MDIEFATRTIQINGSQHKILLQNNNGPCALLALANVLLLAPRQA
                     SVAQELIYLVRRSDTVYLQDLIQVLANIGIQDQNGADSDVTQLLQLLPRLHAGMNINP
                     KFNGSFGDGVEMSIFRLYNVDIVHGWIIDSSSDPVAYEHVSKYSYEEAQRVLVESYEI
                     KQKTLSTSNADQILEDANYIKSFFARSATQLTEYGLRHLREVLVEKSFAILFRNDHFS
                     AIYKNNDELFTLVTDLGFKSRTDVVWQALKSVNGSQDTFYTGNFIPTSLERTATTATA
                     NPAESFASNPFSDQNEARGPASNSLQGFQQLENDEELARRLQEEEDREAVSRMQRSHE
                     RRTKHSDGKEKKNRSKNEKKGSKKEKLKKCIIM"
     gene            complement(<300761..>302935)
                     /gene="TDEL0G01520"
                     /locus_tag="TDEL_0G01520"
                     /db_xref="GeneID:11504656"
     mRNA            complement(<300761..>302935)
                     /gene="TDEL0G01520"
                     /locus_tag="TDEL_0G01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682682.1"
                     /db_xref="GeneID:11504656"
     CDS             complement(300761..302935)
                     /gene="TDEL0G01520"
                     /locus_tag="TDEL_0G01520"
                     /inference="similar to DNA sequence:INSDC:YPL190C"
                     /note="similar to Saccharomyces cerevisiae NAB3 (YPL190C);
                     ancestral locus Anc_6.193"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682730.1"
                     /db_xref="GeneID:11504656"
                     /db_xref="GOA:G8ZYP4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8ZYP4"
                     /translation="MSDTEKAEPVNSVDPSEAEDDRTADAEGPLSNDEEQEPKEAADE
                     SEDHEDVSVDQNGSGDVNVNEENENEPEQDKEQQEANEEEVSNDADESEEEEEQEEEE
                     NDDDDEEQSSQDEDKEEADQNAQAQSEDSENSSTSEELKTTSSDPSSKDENVQHDLLQ
                     RQAQYIMDSNMLNVPEFQEATSENKITALVNMLNSNPETAMPMPVEVQAHGQPQAAPQ
                     QAYENPSSGSSRPDLDGPMSPIERERYAQYLHGENKITEMHDIPPKSRLFIGNLPLKN
                     VSKEDLFRIFSPYGHILQINIKNAFGFIQYNNPQSVRNAIQSESQEQNFGKKLILEIS
                     SSNARPQYDHGDHGTNSSSTFISSSKRPFQHEENDAADMYNDNQGYKKSKRRVPACVI
                     YVKRTADRNYANEVFNHFRRGTELDTDMIFLKPRMELRRMINEVAHDGAWGVILVNKT
                     RNVDIQTFYKGPQGETKFDEYVSISADDAVAIFNNLKPSRGSAGAMPIGAANPYAQPP
                     AAMPQQAPSQGYYGGYGMPPMQQQAPPPPQQPFVQQGYGMPMSNQGYAAPPPAPMAQP
                     YGRYQGSTPTMEPALNQPQLSSLLGGNGGGQMNQQQLLAAIQNLPPNVVSNLLSMAQQ
                     QQQQQQPQTQQQLLGLLQSMQGQQPPQQQQPAVYPPMGQPGPSMNDNYGQHSSMGSVP
                     AQHQHASPPPPLPQQQQQQQRQQTSPGNNVQSLLDSLAKLQK"
     gene            complement(<303453..>303644)
                     /gene="TDEL0G01530"
                     /locus_tag="TDEL_0G01530"
                     /db_xref="GeneID:11504657"
     mRNA            complement(<303453..>303644)
                     /gene="TDEL0G01530"
                     /locus_tag="TDEL_0G01530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682683.1"
                     /db_xref="GeneID:11504657"
     CDS             complement(303453..303644)
                     /gene="TDEL0G01530"
                     /locus_tag="TDEL_0G01530"
                     /inference="similar to DNA sequence:INSDC:YPL189C-A"
                     /note="similar to Saccharomyces cerevisiae YPL189C-A;
                     ancestral locus Anc_6.192"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682731.1"
                     /db_xref="GeneID:11504657"
                     /db_xref="UniProtKB/TrEMBL:G8ZYP5"
                     /translation="MRAATRNNVTNRLFMTTFLVAFSSVALGSVLPCPAHTLDSDSPV
                     HDDQAPQKRKPVSPNTKDI"
     gene            complement(<303940..>306300)
                     /gene="TDEL0G01540"
                     /locus_tag="TDEL_0G01540"
                     /db_xref="GeneID:11504658"
     mRNA            complement(<303940..>306300)
                     /gene="TDEL0G01540"
                     /locus_tag="TDEL_0G01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682684.1"
                     /db_xref="GeneID:11504658"
     CDS             complement(303940..306300)
                     /gene="TDEL0G01540"
                     /locus_tag="TDEL_0G01540"
                     /inference="similar to DNA sequence:INSDC:YGL083W"
                     /note="similar to Saccharomyces cerevisiae SCY1 (YGL083W);
                     ancestral locus Anc_6.191"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682732.1"
                     /db_xref="GeneID:11504658"
                     /db_xref="GOA:G8ZYP6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZYP6"
                     /translation="MFWSPKTGINSKYSFSSSPTFTCEPWSVYTGRPKSSSSSSNPAK
                     VSILIFDKKRFENYLLNYGIIRSKTSSSDKLILQDAYEVLRNQVGNLSKLKHPNILAV
                     IEPLEEHSKNFMFVTEYVTGSLESVFASGDEEANFFKGHIREEVVIQRGILEVVQALD
                     FIHNRASSVHLDIQPRSVLINENSDWKVSGLGHLMKLPQGTNTTEYFIPQYDPRAPSF
                     MHLELNYTAPEVVLDNTVSFKSDYFSLGLLIYMLYTGRGLLSAEGSSSQYKDEYTKFE
                     RRLATMSWDQVFNKLPTNLKPCIPKLMNRDIYSRYDNINEFLDSQFFQDPLIKTLNFL
                     DDLPTKTNEEKIVFLKGLEELLPQFPVTLLQRKFLTVLLGALGQQCKDKNPHGPCISK
                     EVELIIKIGSTVSQLTFQERIFPELINKAQFPIILRNATSALINNLSTLKDKVKKEDF
                     LENVAKPLVTFTFKDMEGEHALVAQETLLGNTQLIANLFDFVTMKNFLMPLISHLFTK
                     TTSLMVKIACVSSFRELIESENVDSDMICSDILPLFKAMKTRDPRIMMQSLKLFNTVP
                     QVIKDDSILVEQLLPLIWNYSMAPTLDKSQYTQYTAVINRISNAVQASHIKTLKQSNN
                     NAADADDTKKFDRLIQPAQVKREDPDTKAAKKIETPAILPTRNPQAKKPSILAPRSRP
                     NVKSTPPNPRRQVQTAPKAPKAPSQNAELDDFDDFVSAASSPTPSLQPNTQLSNSYGS
                     TSRIPQQGPTSSLPPGFSISLQPSRKPAETGPRQDTGQSNGSMSLI"
     gene            <306787..>308574
                     /gene="TDEL0G01550"
                     /locus_tag="TDEL_0G01550"
                     /db_xref="GeneID:11504659"
     mRNA            <306787..>308574
                     /gene="TDEL0G01550"
                     /locus_tag="TDEL_0G01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682685.1"
                     /db_xref="GeneID:11504659"
     CDS             306787..308574
                     /gene="TDEL0G01550"
                     /locus_tag="TDEL_0G01550"
                     /inference="similar to DNA sequence:INSDC:YGL084C,YPL189W"
                     /note="similar to Saccharomyces cerevisiae GUP1 (YGL084C)
                     and GUP2 (YPL189W); ancestral locus Anc_6.190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682733.1"
                     /db_xref="GeneID:11504659"
                     /db_xref="GOA:G8ZYP7"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="UniProtKB/TrEMBL:G8ZYP7"
                     /translation="MAKLMQDVERFLSVESLDSRLKPSNERKKQFTKDAKREESSKTS
                     GKPVILTQPSRWKTWEFRFYYLAFTIVVPLMFKAVMKASSESNINYPKYQGMLSKGWI
                     FGRKVDNSDSQYRFFRDNLPLLAGLMLLHTILKRVVLHVTKLPKLTFDFGFGLLFLYA
                     AHGVNAVRIILHLLAMYSIGHIFKNNRKLATFLSWTYGIGALFINDRFRNYPFANFLG
                     CLSFLDTGYKGIIPRWDVFFNFTLLRMLSYNMDFLERWNALSTPQSAASDNETLHSRP
                     NWSASSVASTELGQSVILDERARLVAPHPIQDYRFTNYIAYITYTPLFIAGPIITFND
                     YIYQSLHTLPSINKRQIISYALRLVICVLSMEFVLHYAYVVAISKRKAWTGDTPFQIS
                     MIGLFNLNIIWLKLLIPWRLFRLWALLDEIDTPENMIRCVDNNYSALAFWRAWHRSYN
                     KWVVRYIYIPLGGSNNRILTSLAVFSFVAIWHDIQLKLLLWGWLVVIFLLPEMFATQF
                     FNRYRSKKWYRHLCAIGGVINIWMMMIANLFGFCLGPDGTKQFLNDMFGTSEGIVFAI
                     GARWALFIAVQVMFEQREHEKRQGINLKC"
     gene            complement(<308657..>309493)
                     /gene="TDEL0G01560"
                     /locus_tag="TDEL_0G01560"
                     /db_xref="GeneID:11504660"
     mRNA            complement(<308657..>309493)
                     /gene="TDEL0G01560"
                     /locus_tag="TDEL_0G01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682686.1"
                     /db_xref="GeneID:11504660"
     CDS             complement(308657..309493)
                     /gene="TDEL0G01560"
                     /locus_tag="TDEL_0G01560"
                     /inference="similar to DNA sequence:INSDC:YGL085W"
                     /note="similar to Saccharomyces cerevisiae YGL085W;
                     ancestral locus Anc_6.189"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682734.1"
                     /db_xref="GeneID:11504660"
                     /db_xref="GOA:G8ZYP8"
                     /db_xref="InterPro:IPR016071"
                     /db_xref="UniProtKB/TrEMBL:G8ZYP8"
                     /translation="MSDNKNLTTVPSHLFLPDVILLSLVFAGTFVGARSAYCRYLKQL
                     TKVTEIPSSVYRKRWLYGKVTSVGDGDNFHFFHTPGGMLGGWGWLREVPTLPKLVVKN
                     VSTLSTKKLEPLYKRMLQRFFKRESLETAWSNHFLSLHVPYKNRRNLSTLSIRICGVD
                     APERAHFGNPAQPFSDEALIWLRYTILGRNLWIKPLSMDQYGRCVAKVNYWTWTGYKD
                     LSLEMVKRGLAVVYESKSSAEFDGAEQKYRRRERIARFQKRGLWSQKKIETPGEYKKS
                     LK"
     gene            complement(<309710..>311722)
                     /gene="TDEL0G01570"
                     /locus_tag="TDEL_0G01570"
                     /db_xref="GeneID:11504661"
     mRNA            complement(<309710..>311722)
                     /gene="TDEL0G01570"
                     /locus_tag="TDEL_0G01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682687.1"
                     /db_xref="GeneID:11504661"
     CDS             complement(309710..311722)
                     /gene="TDEL0G01570"
                     /locus_tag="TDEL_0G01570"
                     /inference="similar to DNA sequence:INSDC:YGL086W"
                     /note="similar to Saccharomyces cerevisiae MAD1 (YGL086W);
                     ancestral locus Anc_6.188"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682735.1"
                     /db_xref="GeneID:11504661"
                     /db_xref="GOA:G8ZYP9"
                     /db_xref="InterPro:IPR008672"
                     /db_xref="UniProtKB/TrEMBL:G8ZYP9"
                     /translation="MSNSAGSSPFLESPVQSPSKVNGAAEKERKLISLQYKLNTIQNE
                     FEIERLRLQQQNNSIDKKYRTTVEELEKALNDTKFLYDNNNKLEKELNEFKRKLGDIE
                     SSKDEEIQKLKLQLHTNETEAAQTISGYRSKIHKEEQENDTQRMELRNCKSLLERYKE
                     AIAVKSEEINNLQREKSEMSGEIDALRVSRLVMAHHNYSTEELQELTVINKSLQDQIQ
                     YTKELEEVNLQQANELKKLRISSESQQFWRTENGKLQNKLEQTWLLEKKLEEIQLENI
                     NLKSQLASWDIYNEDKDRPEDIVRELKLAKDTLVVLTDENEKIHLDNNNLKILNDELA
                     LERNQLLDLNKNYETSIINFKRLNHEIEQQKQLSFEECKLLRKQLDELTAFNVEAGQA
                     EKGANTEEVKNFESIVDGYKNQTEDLTEELRKLNDQLLSQEPQSKKRKLSDQLGLNYS
                     QRLNELQLNCVSLQRELQKSQNLNKILEEKVHRLTELKEKRIRILQLRDNPLLKDQFV
                     RRKQLELLKKENQDLLQELETGKEGPMDRIPRSIYESLSFDLKERDDDLVKAGKKFIR
                     LKEMFTKKSQEFIDVVNSLLGFKLEFQQEGRVKIFPCFKPERYLIADLNHNTLKSNLN
                     SDFQDWDALLHLWVEKRGQIPCFLAALTLKLWEMSSDSQASKEYPK"
     gene            <311978..>312460
                     /gene="TDEL0G01580"
                     /locus_tag="TDEL_0G01580"
                     /db_xref="GeneID:11504662"
     mRNA            join(<311978..311988,312055..>312460)
                     /gene="TDEL0G01580"
                     /locus_tag="TDEL_0G01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682688.1"
                     /db_xref="GeneID:11504662"
     CDS             join(311978..311988,312055..312460)
                     /gene="TDEL0G01580"
                     /locus_tag="TDEL_0G01580"
                     /inference="similar to DNA sequence:INSDC:YGL087C"
                     /note="similar to Saccharomyces cerevisiae MMS2 (YGL087C);
                     ancestral locus Anc_6.187"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682736.1"
                     /db_xref="GeneID:11504662"
                     /db_xref="GOA:G8ZYQ0"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:G8ZYQ0"
                     /translation="MSKVPRNFRLLEELEKGEKGLGPESCSYGLADSDDITMTNWNGT
                     ILGPPHSNHENRIYSVSIECGPNYPDEPPKIKFVSKVNVPCVDSTTGEVKSSVFHTLR
                     DWKRAYTMETLLLDLRKEMATPANKKLPQPKEGATF"
     gene            <312897..>314165
                     /gene="TDEL0G01590"
                     /locus_tag="TDEL_0G01590"
                     /db_xref="GeneID:11504663"
     mRNA            <312897..>314165
                     /gene="TDEL0G01590"
                     /locus_tag="TDEL_0G01590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682689.1"
                     /db_xref="GeneID:11504663"
     CDS             312897..314165
                     /gene="TDEL0G01590"
                     /locus_tag="TDEL_0G01590"
                     /inference="similar to DNA sequence:INSDC:YPL188W"
                     /note="similar to Saccharomyces cerevisiae POS5 (YPL188W);
                     ancestral locus Anc_6.186"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682737.1"
                     /db_xref="GeneID:11504663"
                     /db_xref="GOA:G8ZYQ1"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="InterPro:IPR017437"
                     /db_xref="InterPro:IPR017438"
                     /db_xref="UniProtKB/TrEMBL:G8ZYQ1"
                     /translation="MLLARIRLFSPLKSVRYYTSLEYPSINIRDYSKFVSIKPVSDLR
                     HSSSPDFITSPNSKLQSLIWHKPLQNVLVTKKPWTDTTREAMVRFITHLHDSYPEINV
                     IVQPDVAEEIAQDFRSTPHQNPNEPHVLFTGTEDEIVAKTDLLVTLGGDGTILRGVSM
                     FANKQVPPVLAFSLGTLGFLLPFDFQEHKTIFEQVISSRAKCLHRTRLECQVVRRGES
                     VDTHNLSTSLHAMNDIFLHRGDSPHLANLDIFIDGDFMTRTTADGIAFATPTGSTAYS
                     LSAGGSIVSPLVPCILLTPICPRSLSFRPLLLPHSSHIKVRIGSKKTQGPANTVVKLS
                     VDGIPQPDLRIGDEIHVVNEVGTIYLNGSQVPSADKKEVRERRKTIKNSGIYCVARTE
                     NDWTHGINELLGFNSSFRFTRNSKNENKDK"
     gene            <315304..>315708
                     /gene="TDEL0G01600"
                     /locus_tag="TDEL_0G01600"
                     /db_xref="GeneID:11504664"
     mRNA            <315304..>315708
                     /gene="TDEL0G01600"
                     /locus_tag="TDEL_0G01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682690.1"
                     /db_xref="GeneID:11504664"
     CDS             315304..315708
                     /gene="TDEL0G01600"
                     /locus_tag="TDEL_0G01600"
                     /inference="similar to DNA sequence:INSDC:YGL089C,YPL187W"
                     /note="similar to Saccharomyces cerevisiae MF(ALPHA)2
                     (YGL089C) and MF(ALPHA)1 (YPL187W); ancestral locus
                     Anc_6.185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682738.1"
                     /db_xref="GeneID:11504664"
                     /db_xref="GOA:G8ZYQ2"
                     /db_xref="InterPro:IPR008675"
                     /db_xref="InterPro:IPR016326"
                     /db_xref="UniProtKB/TrEMBL:G8ZYQ2"
                     /translation="MKFFNTILSTTLFTYVALAAPVESDPVNIPSEAILGYMDFTEDQ
                     DVGVVAYTNSTFSGLIFFNSSIIETKDLTKRDAEAGWMRLRLGQPLKKRDADADADAG
                     WMRLSPGKPMKKREADADAEAGWMRLRIGQPL"
     gene            complement(<315878..>316474)
                     /gene="TDEL0G01610"
                     /locus_tag="TDEL_0G01610"
                     /db_xref="GeneID:11504665"
     mRNA            complement(<315878..>316474)
                     /gene="TDEL0G01610"
                     /locus_tag="TDEL_0G01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682691.1"
                     /db_xref="GeneID:11504665"
     CDS             complement(315878..316474)
                     /gene="TDEL0G01610"
                     /locus_tag="TDEL_0G01610"
                     /inference="similar to DNA sequence:INSDC:YPL186C"
                     /note="similar to Saccharomyces cerevisiae UIP4 (YPL186C);
                     ancestral locus Anc_6.184"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682739.1"
                     /db_xref="GeneID:11504665"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:G8ZYQ3"
                     /translation="MKLAKIIYGHHADSFQNLKIAGDFSDWEPLSMERSKDGDLWEYT
                     IDLTKLPSGTEKVHFKFIDDNGNWFTDEDYAKELDSSSNENNVRLFTEEELGGKDFEI
                     DDEGPVSPAPSLEGDFSENYYEPAKMPESRERDESVGGSAVIVNHSDVEDEGTRDLQS
                     PENAETALSNRDQNPGQYKDVLARIVAFFTNLFRSWFG"
     gene            complement(<316768..>318522)
                     /gene="TDEL0G01620"
                     /locus_tag="TDEL_0G01620"
                     /db_xref="GeneID:11504666"
     mRNA            complement(<316768..>318522)
                     /gene="TDEL0G01620"
                     /locus_tag="TDEL_0G01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682692.1"
                     /db_xref="GeneID:11504666"
     CDS             complement(316768..318522)
                     /gene="TDEL0G01620"
                     /locus_tag="TDEL_0G01620"
                     /inference="similar to DNA sequence:INSDC:YPL184C"
                     /note="similar to Saccharomyces cerevisiae YPL184C;
                     ancestral locus Anc_6.183"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682740.1"
                     /db_xref="GeneID:11504666"
                     /db_xref="GOA:G8ZYQ4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8ZYQ4"
                     /translation="MRSYNNNNISHFFQTNPQYQGQLNGDEGDAGGSEFMPKASNTNH
                     STWSRNLPQRDQFFQQRYIPNELAFQMQNGMNSQNLQNGVGSTEPQLSFGLSQDYDDY
                     SIGQVSTVSSPYSRDEVLNHPTALQGNQNSLAMAAAVANAHLLLPNGQMNGPHIFTSA
                     PRKTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAI
                     LKRLHIDGRDIKIGWGKATPVDPLVTTAIASDGATRNVYIGLLNTDSDIALQVGADPN
                     DEKITEEKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVVANLAGINPYYENK
                     KIYYGKDRCAFITKTQQHNAAQYLGIQPGTDRLTQFNDSGMISNALLQQSAAAAAIAT
                     SAGGPNNLGNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAA
                     AQFYAMSSLHGITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNIDFYEDSK
                     RQEPIFTADYLRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKIKSNPLFKN
                     LKINFGKDRCGTIPHQRR"
     gene            complement(<318901..>320070)
                     /gene="TDEL0G01630"
                     /locus_tag="TDEL_0G01630"
                     /db_xref="GeneID:11504667"
     mRNA            complement(<318901..>320070)
                     /gene="TDEL0G01630"
                     /locus_tag="TDEL_0G01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682693.1"
                     /db_xref="GeneID:11504667"
     CDS             complement(318901..320070)
                     /gene="TDEL0G01630"
                     /locus_tag="TDEL_0G01630"
                     /inference="similar to DNA sequence:INSDC:YGL090W"
                     /note="similar to Saccharomyces cerevisiae LIF1 (YGL090W);
                     ancestral locus Anc_6.182"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682741.1"
                     /db_xref="GeneID:11504667"
                     /db_xref="GOA:G8ZYQ5"
                     /db_xref="InterPro:IPR015381"
                     /db_xref="UniProtKB/TrEMBL:G8ZYQ5"
                     /translation="MKVVSCIPVAFSEQEASVDDLVLCECDLREEKFPESEVDLGRLT
                     IHEIVVSEGNEIHRRRDFGCGDLQVFSGSEDEKRSLQRFVWFELVKLLTGHRIQVDSL
                     NGRVKFTRWVCDAPEGKQWNLIMELESEGIVRKIAQLGLESVSHGEVDLFQMTNMLFQ
                     SFCQSNDTVGALRARELELESSIATLTEQREILDRVLLQRDEKTRTIVVNLLNEKKKR
                     IAMLEQEVRKEHSSMNLCDISDSEVINQNVKDAVSHLISPGKRKYRATQAEKDRKKAK
                     RRLFPEPKVEPQDDFEDDFKFFGITKPREENTPSSSSTPKKPNVKQESQEDRITELDS
                     QRSDPMRDSIEDNSGAETETDTITEYKPVIKDETPEPHSDSESDTDASLHEDDSS"
     gene            <320309..>321310
                     /gene="TDEL0G01640"
                     /locus_tag="TDEL_0G01640"
                     /db_xref="GeneID:11504668"
     mRNA            <320309..>321310
                     /gene="TDEL0G01640"
                     /locus_tag="TDEL_0G01640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682694.1"
                     /db_xref="GeneID:11504668"
     CDS             320309..321310
                     /gene="TDEL0G01640"
                     /locus_tag="TDEL_0G01640"
                     /inference="similar to DNA sequence:INSDC:YGL091C"
                     /note="similar to Saccharomyces cerevisiae NBP35
                     (YGL091C); ancestral locus Anc_6.181"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682742.1"
                     /db_xref="GeneID:11504668"
                     /db_xref="GOA:G8ZYQ6"
                     /db_xref="InterPro:IPR000808"
                     /db_xref="InterPro:IPR019591"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028601"
                     /db_xref="UniProtKB/TrEMBL:G8ZYQ6"
                     /translation="MTVLDKNSGIILTEEARKPQDYELEHPKAEHCPGPESENAGKGD
                     ACDGCANQTVCESLPKGPDPDIPAIVENLSNIRHKVLVLSGKGGVGKSTFTAMLSWAL
                     SADEDIQVGAMDLDVCGPSLPQMLGCVKDIVHESNSGWTPVYVADNLATMSIQFMLPE
                     DDSAVIWRGSKKTSLIKNFLKDVDWDYLDYLIVDTPPGTSDEHISINKYMKDSGIDGA
                     LIVTTPQEVALLDVRKEIDFCRKAGIKVLGLVENMSGFVCPNCQGESQIFKPTTGGGA
                     ALCEELNIKFLGSVPLDPRIGKCCDEGESFLDSFPDSPASKAVLEVVEALRDAVGDF"
     gene            complement(<321405..>325361)
                     /gene="TDEL0G01650"
                     /locus_tag="TDEL_0G01650"
                     /db_xref="GeneID:11504669"
     mRNA            complement(<321405..>325361)
                     /gene="TDEL0G01650"
                     /locus_tag="TDEL_0G01650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682695.1"
                     /db_xref="GeneID:11504669"
     CDS             complement(321405..325361)
                     /gene="TDEL0G01650"
                     /locus_tag="TDEL_0G01650"
                     /inference="similar to DNA sequence:INSDC:YGL092W"
                     /note="similar to Saccharomyces cerevisiae NUP145
                     (YGL092W); ancestral locus Anc_6.180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682743.1"
                     /db_xref="GeneID:11504669"
                     /db_xref="GOA:G8ZYQ7"
                     /db_xref="InterPro:IPR007230"
                     /db_xref="InterPro:IPR021967"
                     /db_xref="UniProtKB/TrEMBL:G8ZYQ7"
                     /translation="MFSKNTNGASLFNNANTSTPTSTPTPANNTLQKPLKGNSIFGNT
                     DSGAAVSTPSPSGSLFGSNNNATNTQTGSNNLFGTQSNGGTTGSTSGTSKTSGFSFGQ
                     NSATTGGGGLFGRSNSAGQPSSNSIGNNASNLSKGTNLFGAASTGQNSGGLFSAGNSS
                     NATGLFGNQQSSVQPQGNRLFSSNVSSLSQSTNNVTQMNPDPYGINITNMPISVSKMP
                     ASLTAPSKDTRPRLDGPTGSTGSTASSLTSSNRRNYSVSSNSVGPLSSLPATSQSSLM
                     NKLSSRLKSTSNVLTTQGIFSPSQDRQWASQEHGASVKKSTSDLASSTSGHNSLISSE
                     SFTPFSLQKADISDMRKLKIDPNRSTVKKLKLLSGKAVETKSHDEGQKGPESITSIEK
                     KLVQNDDVNHVSKAETLANGNKLSSHEDEHDEVLEKQDFETDASGYWCSPPPEQLVTL
                     SPKELAAVPNFLIGRRGYGCITFDYDVDLTSFTEDLKNQLFGNAVVFNPNKTVEVYPD
                     ESHKPSIGCGLNVPATITLENVYPVDKKTKRQLKEGCNFDEVQVLVRRLKAMRSMDFV
                     SYNPFGGVWTFKVKHFSIWGLTNEEDAEVDEQELESRRTKSSADQHFTIPRQGRQLAQ
                     SKADSHNFIPGGFEFVKSNITAADITQNDLIDLQQANQVDMNAVLDACVDDDSLIDEK
                     PYEPDVRESDFEGMEVEPSFSISNNWVEQLKLAGSNLRSVFADTYESTRSDDNAIELL
                     FADFNDNVMMEKKIEKERRLVNFNFARFSSTCSLLMKAADRKIGVKNHILPSTALNNI
                     SIMDALFSKHLSVSTITERQAMNYPQVTENSLQFKDVANLCETSHPEYTLWELCSVLF
                     DAIALPHEVNDTTVQETLLKNERHRLLCSWIVERVKDEIDGKIQATTDALDLIFLHLL
                     KNDIPNASKIAIKSQNGHLAILIASLGSNDPRVRFLATQELERWGTGGQRVDPSISRV
                     YQLLTGNGIEASHLAKMAGMQDISWLALLGANLYYGKIDELSLEGLISIATKTIAPVE
                     DDYKSIIFKLYSAQNSADNILLQEIKRTTSVLDHSFLWYFAQIMRFNKLDNLSDYVCD
                     KLTCDFIGQLRLAQLYKEGLFAACFITNDFAAKQQIDSIVYHEISHFSSGPNEVILEK
                     LKVPSSLIFKAKALRDKYENDHLSEAQNLLKAHAFEEAEKVIVTYVGPRLIISGIKEN
                     RNDLVLLRSLLSKFPISEMQTWSKGLAVYDNYLKLKFDSTGSNEVLNPLISGLRTLFD
                     ANKGHTEILVCCNIISQEIILRVQNTHQNLDNAQKQKLLKLPLGQPERVYLKGCWT"
     gene            complement(<325654..>327900)
                     /gene="TDEL0G01660"
                     /locus_tag="TDEL_0G01660"
                     /db_xref="GeneID:11504670"
     mRNA            complement(<325654..>327900)
                     /gene="TDEL0G01660"
                     /locus_tag="TDEL_0G01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682696.1"
                     /db_xref="GeneID:11504670"
     CDS             complement(325654..327900)
                     /gene="TDEL0G01660"
                     /locus_tag="TDEL_0G01660"
                     /inference="similar to DNA sequence:INSDC:YGL093W"
                     /note="similar to Saccharomyces cerevisiae SPC105
                     (YGL093W); ancestral locus Anc_6.179"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682744.1"
                     /db_xref="GeneID:11504670"
                     /db_xref="InterPro:IPR013253"
                     /db_xref="UniProtKB/TrEMBL:G8ZYQ8"
                     /translation="MDGEVDNAADGDTNGLVKRHGATGVPAKGILKSIQQPESLPPSQ
                     TAGSQSLIAGNIQLPHRGLSKADVLDGNNTTSRIDTLSLQERSNRRVSFAPDVTLHSF
                     DFVPETRTSFREPRRKATDFVVTSTQQENSDEEDGVTSQSMDLTSPVAISTQPYMPVF
                     DQEVSMEITQLFAKHDEPQEKEETMDFTGIPVPVAKTVENVENGGNTMELTAIHDSEK
                     GPEIPATPPSSKRRKLNPEPRSPMQESSDDQDMELSMMERMSPIKLKPTEPQVETVES
                     HSLREFIDETGVSFMIDTDLIDKRRNPITFKTIQSSQREKFRINQLLYALYLDTPVLE
                     MNAFICKELLRRITQSKKQFDDLDEQVSSAQSQPLLFTEYFTSSQEMRQLMNQQLQLV
                     KSYSKLEAKKSWYEWRTQHLNGIKTVLHENLLLLEEDRAKVRKSLNRVQDLKVKAQNL
                     RNSIKKEIALLKENNTDDYQEEPSLNERVKLETLKQELASYSLNINNGQELTKKDEQL
                     KEEIERKKEQLFDLKEQLTILSQKHNMRLEKKNFTEYDVVKCRNKLQLLSIISGVEFV
                     RYQNTELTIGFPYIASSLQISVDLSNLNAGNLYSYEVIQPAETALLFKYCYRSTLRNV
                     LEMPSKHPLSLVALGAKSSIAIIKELHMLKLLFPVQLQHKEKEILLEIMDYDLRSSTK
                     AIYDVALTDFVRGFVEGESEITVKATVIENGHLLASTIPITFVKKVARILPWFDESRV
                     KISVLQSA"
     gene            <328791..>329597
                     /gene="TDEL0G01670"
                     /locus_tag="TDEL_0G01670"
                     /db_xref="GeneID:11504671"
     mRNA            <328791..>329597
                     /gene="TDEL0G01670"
                     /locus_tag="TDEL_0G01670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682697.1"
                     /db_xref="GeneID:11504671"
     CDS             328791..329597
                     /gene="TDEL0G01670"
                     /locus_tag="TDEL_0G01670"
                     /inference="similar to DNA sequence:INSDC:YHL026C"
                     /note="similar to Saccharomyces cerevisiae YHL026C;
                     ancestral locus Anc_4.24"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682745.1"
                     /db_xref="GeneID:11504671"
                     /db_xref="InterPro:IPR018852"
                     /db_xref="UniProtKB/TrEMBL:G8ZYQ9"
                     /translation="MKSEGFLGRKSWLFNFCYIFVIHGVVSGIIAGGVEFAIAYGMYH
                     KNSQPILLWGFPNTLSGDCALSLFIQVGVTWACEEILVGWDCYLENTPILPFEIELPD
                     EPGHKLFWRLFEVKHGILREDRSFRSYIRKQFVRYPNRTKLFNLFAWFVSKLIISMIT
                     AAMIWFWVWPVTMGILAGIGTKVGSHDYQFHGWAPQIMKLIYGFVLGLMSSPLAIIVI
                     LLRDNWHLKYKETANITSTTNEKGVDQASANDTSTGDTNVDEADQSTTNN"
     gene            <329761..>332181
                     /gene="TDEL0G01680"
                     /locus_tag="TDEL_0G01680"
                     /db_xref="GeneID:11504672"
     mRNA            <329761..>332181
                     /gene="TDEL0G01680"
                     /locus_tag="TDEL_0G01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682698.1"
                     /db_xref="GeneID:11504672"
     CDS             329761..332181
                     /gene="TDEL0G01680"
                     /locus_tag="TDEL_0G01680"
                     /inference="similar to DNA sequence:INSDC:YLL034C"
                     /note="similar to Saccharomyces cerevisiae RIX7 (YLL034C);
                     ancestral locus Anc_4.23"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682746.1"
                     /db_xref="GeneID:11504672"
                     /db_xref="GOA:G8ZYR0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZYR0"
                     /translation="MAKNASRKGPLKGSLDSKIEDLIYRLLEEKSLDKKRLLSAENED
                     GVDEADTLSFAKDLVVPEIFTFCQTKDLSMLRVKKVILQKSIERVLKQVIDEEAAEFD
                     GYASFKDESAELVPKDDNLVPVQDNNEFNKNITDQWAVRTGNNITDGETEATEAEAVS
                     SQAKKRVKEAGTGKSKRQKVKENRTPPSTNLESLGGMDDVIAQLMELIGLPILHPEIY
                     LSTGVEPPRGVLLHGPPGCGKTSIANALAGELQVPFISVSAPSIVSGMSGESEKKLRD
                     LFDEAKQLAPCLVFFDEIDAITPKRDGGAQREMERRIVAQLLTSMDEISMQKTDGKPV
                     IIIGATNRPDSLDSALRRAGRFDREICLNVPNEISRIHILKKMSQHLKIDGEIDFIKL
                     AKLTPGFVGADLKALITASGTCAIKRIFQEYADLSALSDSQMEVDQTGILDEKAMKNT
                     ANIIDPIPLSTIQKFIKNFPEPLNDEQLQHLTIKYEDFLKALPTIQPTAKREGFATVP
                     DVTWANVGALSKIRIELNMAIVQPIKRPELYEKVGISAPAGVLLWGPPGCGKTLLAKA
                     VANESRANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFFDELDALVPRRDT
                     TLSESSSRVVNTLLTELDGLNDRRGIFVIGATNRPDMIDPAMLRPGRLDKTLFIELPN
                     TQEKLDIIKTLKVSNGTPIADDVDLEKVIADERCRNFSGADIAALLREASVLALKRSF
                     FKTDMIHSVLDNDLDKEFEDLSVGVPQEDILVAMHDFTNALRKIKPSVSDKDRLKYDR
                     LNKKIGLE"
     gene            complement(<332297..>334168)
                     /gene="TDEL0G01690"
                     /locus_tag="TDEL_0G01690"
                     /db_xref="GeneID:11504673"
     mRNA            complement(<332297..>334168)
                     /gene="TDEL0G01690"
                     /locus_tag="TDEL_0G01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682699.1"
                     /db_xref="GeneID:11504673"
     CDS             complement(332297..334168)
                     /gene="TDEL0G01690"
                     /locus_tag="TDEL_0G01690"
                     /inference="similar to DNA sequence:INSDC:YLL035W"
                     /note="similar to Saccharomyces cerevisiae GRC3 (YLL035W);
                     ancestral locus Anc_4.22"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682747.1"
                     /db_xref="GeneID:11504673"
                     /db_xref="InterPro:IPR010655"
                     /db_xref="UniProtKB/TrEMBL:G8ZYR1"
                     /translation="MSAEVPKYTVDDSGDSDDSVSPITSVISSKEVTVSVNVAEYDDD
                     EVPYKDLRQAFKPIENDNVLLIEFSRDTVLVGLKEKQRIFISGVFKLQVVKGGIIYNN
                     IHYNASSEHFNVWHPLCNSIPGIQSSYFAGWEEACHIGGNNKTLVMEDLKDYCCVIRV
                     QNANVNGLNKAGALFPDVKYLWSPRDGARLSFTSDSCTYFFLQEGVDPFTPLLISNEW
                     SNNLESLTVAHKSSLYDTRMMVIGGKNSGKSTFLRLLLENFLYNGERQTVDDEILYLD
                     LDPGQPEYSHPDCISLSRITRTSNILGGHLGQPYFKILRQCYVGSSSPQEVPNLYLTY
                     VDELIHKLEGLDHMGTSLVNLPGWIKGFGLNIMNHIISRYKPTHIILLESKGTRRHLN
                     ELNLDLTFESQARSEYSPIVSNIAGVSSNPDELRFQAHQIRTFKTLSYFHATEKTEYG
                     LEYEFSPLLNKPPFQISYGSSGLQGIQFPEEFAGLHEDDIKTALEGTIVGLFCCKQKL
                     EGPIIDKNSFPIIQQQQQQETLYFTSLVLIHSIDVKNKYMNVFIPLFNFEKIKNNPHQ
                     KWVIVRGRSEAPLSELYPIGNPFNGERIPYISVEQRKKHEHVWKVRKNVMRRGHHLK"
     gene            complement(<334394..>335848)
                     /gene="TDEL0G01700"
                     /locus_tag="TDEL_0G01700"
                     /db_xref="GeneID:11504674"
     mRNA            complement(<334394..>335848)
                     /gene="TDEL0G01700"
                     /locus_tag="TDEL_0G01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682700.1"
                     /db_xref="GeneID:11504674"
     CDS             complement(334394..335848)
                     /gene="TDEL0G01700"
                     /locus_tag="TDEL_0G01700"
                     /inference="similar to DNA sequence:INSDC:YHL027W"
                     /note="similar to Saccharomyces cerevisiae RIM101
                     (YHL027W); ancestral locus Anc_4.21"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682748.1"
                     /db_xref="GeneID:11504674"
                     /db_xref="GOA:G8ZYR2"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8ZYR2"
                     /translation="MVLLKDILNYESEEGVSKPSNKSALPELRGLQRNDGSAKNHGNM
                     PSPASSASSNGSCNDHSDNDTYHSEGTRRSSYDEQNSTNVSTPQSEISSGSEEEHLVC
                     QWDQCGQVFNQAELLYHHLCKDHVGRRSQQNLQLNCKWGNCQAKTEKRDHITSHLRVH
                     VSLKPFKCSKCGKNFKRPQDLKKHLKIHIESHIQVKKKRGPKSGSKRVLKVSKPDEKK
                     NNVAAPSPTGSESPTNVGMPLISLQQLVANELPSYEPVYTPQLGARLQTVLPPIVSDE
                     TLLRNSVAATNAASFFSTLAHNMTNIRSVQGGYQQPFARNEMTANVSPLLGGSTMNSS
                     PRTGAFGNRNYPAVPSLPPIGAQTISHDRASVLPPLSSVPILMPRHKTFENSSHFNNQ
                     GQCFSSMQRSSGNVDSIQDDDLITKLVSLNLADENDLEDYEDTLLSAIMMKDYLFCLL
                     LEDEFETEGERDELNTGVHDHSTVKLSRYPQVVV"
     gene            complement(<336179..>337624)
                     /gene="TDEL0G01710"
                     /locus_tag="TDEL_0G01710"
                     /db_xref="GeneID:11504675"
     mRNA            complement(<336179..>337624)
                     /gene="TDEL0G01710"
                     /locus_tag="TDEL_0G01710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682701.1"
                     /db_xref="GeneID:11504675"
     CDS             complement(336179..337624)
                     /gene="TDEL0G01710"
                     /locus_tag="TDEL_0G01710"
                     /inference="similar to DNA sequence:INSDC:YHL028W"
                     /note="similar to Saccharomyces cerevisiae WSC4 (YHL028W);
                     ancestral locus Anc_4.20"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682749.1"
                     /db_xref="GeneID:11504675"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="UniProtKB/TrEMBL:G8ZYR3"
                     /translation="MFLVSLLVWLPAVHAVSFCSSENTANGNGVSWQYQSNGWCSEHC
                     AGSQYAVLKGGYCWCSETGPSRTTSLDECSDKCDGYPAESCGNDAKGLYQYLYLGQGT
                     PTISSVSSSTVATSTSSSRSSTTSTTSRSSSTISSISSTSTSSTPSSSSSSSSSTSTT
                     SSSSTTSSSSSSSTTSSSRSSSSSSISTTSSSSSSSSSSSSSSSSSSSSSSSSSSSSS
                     SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNGITTTVIYSVATR
                     TLTQTPSNSNSSNTQTTQVSQLLTTMTLVVTSSLASSTLALAPTNLNRTSDNQNKGFW
                     HSPGKVAGTFVAVGIVALAILLLIIWFFFIRPRRKQKQFEEQYGAAVLSPRGPHNPNY
                     ADSMNYPGNRSSSGSQGFVYADEKGIIDTTPRTRRNSFDDESADFANPHPIIMDQRLD
                     PHRLLSQENPSAVSLADDIDYSRKVLRVINE"
     gap             337705..337724
                     /estimated_length=20
     gene            <338783..>340567
                     /gene="TDEL0G01720"
                     /locus_tag="TDEL_0G01720"
                     /db_xref="GeneID:11504676"
     mRNA            <338783..>340567
                     /gene="TDEL0G01720"
                     /locus_tag="TDEL_0G01720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682702.1"
                     /db_xref="GeneID:11504676"
     CDS             338783..340567
                     /gene="TDEL0G01720"
                     /locus_tag="TDEL_0G01720"
                     /inference="similar to DNA sequence:INSDC:YHL029C"
                     /note="similar to Saccharomyces cerevisiae YHL029C;
                     ancestral locus Anc_4.19"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682750.1"
                     /db_xref="GeneID:11504676"
                     /db_xref="GOA:G8ZYR4"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:G8ZYR4"
                     /translation="MVDKKGSMASGHHHHVKNLKQQQRNRMLVAEMVDLVEENDHDSL
                     AFLARNCGVPPQLRHIVWPILLKYHPMCISPNIVSNVATWDPTANSYRLVDSERGHKG
                     DSSPEDSEALIMHDLRKYFHSRSNGNVNGYATTSSSEVSTLSSMDTSLLTAEDELEVL
                     EELKRAVIRFLEKWGQIFKYESGLAWIATGLAEWVPVMESSLDEGPVVLNGKKHSHSH
                     TPPFSHPSGANSLCVTPTTATAHNHLCVSYLYKEYPLPRSLRRKLPREPPFAFDQIFE
                     RLALVILHCPDSILAQKQLAFHSNSKESLSNYFPIISGGDLSYQTQVFFRVISSILPE
                     LYQPFTEESVLQSSNKRSSWLYWWIKCSGARALQRQDRARLWDILLGWRPEPNMNCIN
                     FYLNYNTKKFDHLYKRPSNKHLDFLKSVAKNDPFWFPDLDSIPLGSAKYKFDYEVLKK
                     ILLNNCNGNNADDQTNTSEDGISYSLIDPHLQLVFVYVAILQYNEFKLLEFEETEISE
                     YLNNVPMLSKADDLCYRKLYELDSLADCPSSGSQEDLHKRPGSSNMLIEVGNDAKASH
                     SFNDLLNMAGDIWRKWLWNELEDSSLEE"
     gene            <340732..>342243
                     /gene="TDEL0G01730"
                     /locus_tag="TDEL_0G01730"
                     /db_xref="GeneID:11504677"
     mRNA            <340732..>342243
                     /gene="TDEL0G01730"
                     /locus_tag="TDEL_0G01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682703.1"
                     /db_xref="GeneID:11504677"
     CDS             340732..342243
                     /gene="TDEL0G01730"
                     /locus_tag="TDEL_0G01730"
                     /inference="similar to DNA sequence:INSDC:YLL036C"
                     /note="similar to Saccharomyces cerevisiae PRP19
                     (YLL036C); ancestral locus Anc_4.18"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682751.1"
                     /db_xref="GeneID:11504677"
                     /db_xref="GOA:G8ZYR5"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013915"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZYR5"
                     /translation="MFCAISGKPTRVPVLSPSSKCVFEKQLIEEYVQQEGKDPVNDAA
                     LTVDQLIPIAQTPEQTSLANNLNSSTLNSNYSIPNLLSSLQNEWDAVMLENFKLRKQL
                     NQCTKQLSTALYQRDAAKIVATKAMAANEGLKRELAQLVSELGSTAAAEVEEPDMGLL
                     ERLRHESEAYLAKTRKIGSDFNLSVIAPFRLEKQYTVNDSLNLHRAISLRLESQQKLA
                     FQLSIASEVCSLIGPSNYRTIEVPLKDEVRYIKCTASGEQLLFAPAHGSCCIHDLVKN
                     VTYDTEVESRGVIYMSSHEEILSDHFLWASNTGRIGLTTLNGEKTFVIIEGSSDEEFF
                     TATYHKDGILFALASKSAIKIFDLSRPSELPTVFQVGEQINAEGEIKRVQFSSNGYWM
                     VVQCGDVVISFDLRKEPGTLAVNAFPLGTELWDMDVSGRNLVLLTASDDDHYKLDFYD
                     FQKSKKIWKSVNTTFDVKIEQDSKIKDFLMLFTKEGPVAVIQTSNEVILYTTQ"
     gene            <342371..>343144
                     /gene="TDEL0G01740"
                     /locus_tag="TDEL_0G01740"
                     /db_xref="GeneID:11504678"
     mRNA            <342371..>343144
                     /gene="TDEL0G01740"
                     /locus_tag="TDEL_0G01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682704.1"
                     /db_xref="GeneID:11504678"
     CDS             342371..343144
                     /gene="TDEL0G01740"
                     /locus_tag="TDEL_0G01740"
                     /inference="similar to DNA sequence:INSDC:YLL038C"
                     /note="similar to Saccharomyces cerevisiae ENT4 (YLL038C);
                     ancestral locus Anc_4.17"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682752.1"
                     /db_xref="GeneID:11504678"
                     /db_xref="InterPro:IPR001026"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:G8ZYR6"
                     /translation="MPLLDSVRTLVQSTTELKVKQATDENESSGATGTLMNEISVLTY
                     SPKTLKEIVQVVRKRLMGHGRRNSHKICIHLVKTLTLVTYLMNNGSNDFIAWVRGNMA
                     LVDCLKEFNVQDRNDEKIGQQIRAMSQDLCTLIKDDDLLENRRAEVIQFRSSISSPGR
                     KSTDNSHLKKWSSTGRASSERASHVLSMSPITPSSASEFQCTSNATRYYDRGLTSLDL
                     KRRFVRGPSTDHSTLDPLHEEEDIQAGSVPLKTSTNPFR"
     gene            <343412..>343645
                     /gene="TDEL0G01750"
                     /locus_tag="TDEL_0G01750"
                     /db_xref="GeneID:11504679"
     mRNA            <343412..>343645
                     /gene="TDEL0G01750"
                     /locus_tag="TDEL_0G01750"
                     /product="ubiquitin"
                     /transcript_id="XM_003682705.1"
                     /db_xref="GeneID:11504679"
     CDS             343412..343645
                     /gene="TDEL0G01750"
                     /locus_tag="TDEL_0G01750"
                     /inference="similar to DNA sequence:INSDC:YLL039C"
                     /note="similar to Saccharomyces cerevisiae UBI4 (YLL039C);
                     ancestral locus Anc_4.16"
                     /codon_start=1
                     /product="ubiquitin"
                     /protein_id="XP_003682753.1"
                     /db_xref="GeneID:11504679"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8ZYR7"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC"
     gene            complement(<343717..>349260)
                     /gene="TDEL0G01760"
                     /locus_tag="TDEL_0G01760"
                     /db_xref="GeneID:11504680"
     mRNA            complement(<343717..>349260)
                     /gene="TDEL0G01760"
                     /locus_tag="TDEL_0G01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682706.1"
                     /db_xref="GeneID:11504680"
     CDS             complement(343717..349260)
                     /gene="TDEL0G01760"
                     /locus_tag="TDEL_0G01760"
                     /inference="similar to DNA sequence:INSDC:YHL030W"
                     /note="similar to Saccharomyces cerevisiae ECM29
                     (YHL030W); ancestral locus Anc_4.15"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682754.1"
                     /db_xref="GeneID:11504680"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024372"
                     /db_xref="InterPro:IPR026827"
                     /db_xref="UniProtKB/TrEMBL:G8ZYR8"
                     /translation="MSSSQVSEEKERDLVAKVELRLALADSAEKFQQGLDTFVAPLLL
                     KLASPHASVRQAVFNVLKDILARLSSLRDVKVPVEKLISQAQSPAVLPNQDDGPVRLY
                     SLLLASKGIDRLDSTEARFLVPLAMRHISGLPRTASARMFHALCKLLLKWVPPLKGSK
                     EEDETREYLALDDKDDLNFLLQKFTQFFLLVPAKADPQSGIIPRGYSCPGLCSDDVSF
                     FTYEAGVSFTKEQMLRFKSAIYKFTTNGLVKDDQQLLIFLSVASTDSSDLSDSAIQHL
                     KRLDTPHEEAHFINFMIGLYTGNKTTGAPPVKHELQERILGMLSKSVLATSNSTQVSR
                     ICSIGMHSQYPKLRSLSLIFIRHVAKHNYQSLVEQQEGSMSIAPLIRNNLHEEGWPRL
                     QLGSSTPNFAATLNFRRLQYETLGDILRKDPTLLPDLSYIEFLLDSLKGDLSEFRPSI
                     QEALISLTATLPVINDASKERLKLLIRKVMADDYEIDSAETKEQKEAIMACRYVCIKF
                     CNAIYPFDNAEARMINVWGTSRNNKFDVIEEAYKGLHPYWFRVNQALNTTEFKSTSDL
                     LASKINETSFPHFKDFVSLVLKELESAARVPSSSIFKTLNVAVRFSKQCLVSEAVHGM
                     KSVVIQDEDWSVRIEKALEVDEIVQQQVYGLLVNTEGEWLTRFLHLLGNEFMTNDKGT
                     HFSSFHYHDPIFGETLLALTRYCNSNTLSSLKKLIPQFYTYLGTMAISNFENLELAAN
                     VLGVIAVNVPYSEDVKEILATLEHATESEISPSLLANSYIVPRMILKAVPETDIVLRR
                     LTEKLMSLMRLCRNNNLVIRLLSQVTKFGSLNTLDQETRNLFLSQASEYLQTKLINNS
                     VAAEVWGFLSIYKANDESFTSQLDKLWESHVSKQIDFLFSTGEALSVMAGGWHSGYLL
                     QQLDVLNISQERLQEIYDEEKLQVVMDRVLESCDSTKPSLRKASCIWLLSLVQYLKGN
                     DIILKRSSEIHLRFMRFLADRDELIQESAARGLSLTYEMGDENLKEGMIKGLLRSFTD
                     TKSANNMTAGSVAGETELFDADVLKTNDGSIRTYQDILNLSSEVGDPSLVYKFMSLSR
                     SSQLWSSKKGIAFGLGAIMSRSSLQELLLKDQATATKLIPKLFRYRFDPYPAVARSMS
                     DIWNSLITDSPAVISQYFDLILEELLTGMGNKEWRVREASTLALLQLVQSQPRDKFEA
                     SILNIWTMAFRAMDDIKESVREASTRLTTGLSQILASSINVNEGVKPEAAEEILKQIL
                     PFFLGVKGINSDAEEVRNFALKMLLDLIKNSGDATRPFAVELVYDFTLLFSAIEPQAI
                     NFLSLNANNYKIDTNAIDLYRRNSISNSPLMDAIGKLINNSDSSLMDGHVSSAIRAAK
                     NSVGLPSKXXXXXXXNFLVKKYQLALKPLSGKLLKSCMNAIDDRNQSIKVAFAIAFGY
                     IFHVTSLDKAVKYAKQLSDSYFSGDRDIKMVVGTAIESTFKYAFPEFENVASIFMPLL
                     FIASNDSEQETSTYFERIWTEASTSGSGTVKIYLDEIMKVLKLHIGSTDFSVRRTCGK
                     SISVLCDKVDHSVSQKLINNLFLITIESLSGRSWEGKEVILEALESLTTKFKDHVEQN
                     NDLRTKLSQVFDREVSRKNESYVRKAFFPYCSFFSTFPESESVQKLIEITGQLLHPAD
                     QNVADTGLEEDSGNKRMKPDSEISRKSSKQNIEREEFAIKLLKSFTNICKAVRKSKEQ
                     QFTLIKFAIEETVRLFENHFILYTWRSQAAACEIGQEITSSLDSGVDPRLEKLLLEFW
                     SKLFESNGTKEAIENVKIQTIKLGASLKKHAPGLRFQIESDLRGLSELDPTSRIENEL
                     RNIGL"
     gap             345082..345102
                     /estimated_length=21
     gene            <349483..>358797
                     /gene="TDEL0G01770"
                     /locus_tag="TDEL_0G01770"
                     /db_xref="GeneID:11504681"
     mRNA            <349483..>358797
                     /gene="TDEL0G01770"
                     /locus_tag="TDEL_0G01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682707.1"
                     /db_xref="GeneID:11504681"
     CDS             349483..358797
                     /gene="TDEL0G01770"
                     /locus_tag="TDEL_0G01770"
                     /inference="similar to DNA sequence:INSDC:YLL040C"
                     /note="similar to Saccharomyces cerevisiae VPS13
                     (YLL040C); ancestral locus Anc_4.14"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682755.1"
                     /db_xref="GeneID:11504681"
                     /db_xref="InterPro:IPR009543"
                     /db_xref="InterPro:IPR026847"
                     /db_xref="InterPro:IPR026854"
                     /db_xref="UniProtKB/TrEMBL:G8ZYR9"
                     /translation="MLESLAATLLNRVLGSYVENFDPTQLNVGIWSGNVKLRNLKLRK
                     DCLDGLNLPVDVKFGILGELVLNVPWSSLKNKPVKIVIEDCYLLCTPRDMASMHSEEQ
                     IERELRVKLHKLAEWELANQARLAAEDPNGQDAENESFMQSLMTKVVDNLQVTIKNIH
                     LRYEDMNQLFAKEACSVGITLSELSAVSTDSSWTPSFVSMTQDITHKLLTLNSLCMYW
                     NTKSATIEEEDEILDHDILISKFKNAVATGGTSIPSYQYMLKPVTGSGRLSVNKRGST
                     KERPHIELDVLFNELGFELDDAEYADILHTVSSIHLSQKTQKFKSKRPQYPVQENPKG
                     WFKYTASCVIDEINQKNEMWTWDSMKRKCDQRRLYVDLWMKKLQIGNVEEKLPDSDDE
                     EQLERLHRDLDFDTIVLFRSVAKKEYAKLRLSSRDSPSSLAGQQNKASQGWFSSWWSG
                     GSETTKESNDLLLTDEQRQELYDAIEFNQSHELETQLPKDRVTMKVTSSLKKGAFTIK
                     NKDPQAVLGQVIFENCEVEFLQRPNSSLTSFKLQEFKVEDGSPNTLYKHIISVKNIKS
                     ESVADEEGNHEPLFKVLLETNPLDESADSKVDVKLRGITVFYHVHFINEIIRFFNPPK
                     QHMDTITAIISAAEATVEGWTTQTRMGIESLLEEHRTANVTLDLQAPLIILPLNPHIW
                     DTPCAVIDAGHIALASDLVPKERIEEIKQMSPEEYEEIDESELNGLMFDRFQLYLQDT
                     QILVGPDVRSTISSLSGTSEGSQYSILSGLLLEVALDVSILPRAYNLPRARASGHLPK
                     LRLSLNDYQYKIIMQLLEKSIPTFIDFGLDDEFKEQYNVDSEESKLQLQLRKTLQALD
                     KMAPLEIAQKQVELEFDVDSIQVSLYKCVDNEAMRCKKLIDFLGGKVRLHIEKKAKEM
                     ALDLKVHSLEIVDFIEESNKEEFRNLISSGDIGPADRDLFTVDYIRTQRIVPHNKTLI
                     EVFDQDLKMNMEQLQIVLTPKSLLTLMNFALTTFTDPTTPDMPADVLRHNKENREDAP
                     QKLDMVIKMAGIVVILNDDSIKLATLVLSAGELSMFLLPERMKVNMKLGGLELTDETS
                     DTLPRDSVFRRIITMSDKELAELTYETFDPANNPHDYDSALKYTTGSMHVSFVEQSIN
                     KLVNYFYKFSKLKSLFDRARELAYDQAPSIESVNNLKMEILVKAPIVEFPKLIDPRQN
                     IHDSIKFYLGELCIQNTFSDGKASHKINHITLGIREGQLLSNFNLDDGSQQELKMVDN
                     MCLTFNVHHDPLAEVTEPEFRVKGYFDPLMTSLTELQLRYLTEISEQAAAAFNISEPT
                     SEELGEDAIYANAFINSPVEDPSSNSIGSKEAVASDPEGLKLDFSFEAPEISLTLYAD
                     TANKIELEKNGLTRLTFQDIALNAKFNKDGTGDAESHIATFAVVDIRDRKDNKHTELI
                     PKIVNKNYQFMGSVSSRKLGQGSLINISVTIDSPQAILAMDYLFALQHFFDSAFNHKP
                     AIVDIESPEYKDEKVAPNADKEGASELKIQYSLNVVNAAVVLLADPSDLNSEAVVFNV
                     GQLLLSDQNILTLSANNVGMSFSKMNSISDQKVKLLDEFSSSVVIDRRNSTPEKLLTD
                     IQVSVEPLVLSISLRDIRLAMLIFNRAMSQMNGGTIEDALPESNLSYGTFSKEFEKKL
                     SKYAPSFVSSLNTNHAKQQAERAAGCDVVLRGEKLVAEFGGMRLLLIGDVHEMPILDL
                     NVSPFQTSVKDWSTDIDALALLETYVNVFNYSRSSWEPLVESFPISLHLSKGSERDAM
                     IQFDAISRKFAEITLSSRTIAMLSQIPSTLTGDISLNSRGAQKPYRITNDTELDLDIW
                     IANEDPNNKKGLTTLRAKETIPWEFEDWRTIRENLNVDSEGSNIVASVVGSKYKTVMK
                     VDATYEGELLFVLQPAVNHVHNRMTCDLQLGEDNVKTITFRSTLVLENTTMTTIELKV
                     ETDDNKEPITYSISSSDCHSVPVESSYGSKLRLKPSTEDGEFDWSEQMISWRDLLSSS
                     IPLRCKSKTDPNRVFYIEVNGKYDGKEPLAKIYPRMRIIVSSPLVIENCLPCDLNFTL
                     YDEKQEHKKLTLLKKGSRVPVHDVSLNNFLLLAIQPLVDDAPLSKPSIVNTATRSSLK
                     PETRITTKLAGGQRFHAAIHYQSVEGTRAKILQLSAPYIILNKTGRDLYIQGDRTNIA
                     QAKVQRLGDEKFTIPKMFSFDTDGHNKNRALVRFKESDWSLPLSFDALGQSLDTVVNI
                     PNKEQESNLGVTIIEGEGEHLFSKIVEIAPRYIIQNCLDLPVEICEFGSTNVSQLDPD
                     LSTPLYQMRNVLNKQLMVKFLGPNCDWSAPFFIKDIGLTYLKVLKQDSSHMLIKIEII
                     LENATVFIRLGDANNHWPYSIRNFSDQEFIFYQRDPRVVDDYYDYDTYDELNETEYKP
                     YYYRVPPKSVMPYAWDYPAARQKKLILTARGLRREIQLAEIGNLKPMRLPAKAANEEM
                     MTVDLNVVADGPTQALVITNYNPEVSLYKLKKKKTSSSLSVNSSGEGFSVDEEDKNIH
                     MKVIVSFKGVGISLINTSLQEIMYVHASGLELRYNESDLYQSLSWKLKWLQIDNQLFG
                     SPFQNILYPAALLHTAQEIENHPVISGSLSKVKDDSHGLLYFKHATLLLQELSIQLDE
                     ELLIALLDFVKFPGAVWNSYPTEKQFSDHITLPECEDVHFAEDMYFEIFHIQPMILHI
                     SFMRSDEHNLLEGEQSRLGLERQGTMLFLIDILTMTLANVTDAPIKLNSLYMANVRVP
                     INTLLQAVQTHYGQQFFYQIHKILGSADFLGNPVGLFNTISSGVWDIFYEPYQGYMMN
                     DRPQELGIHLAKGGFSFAKKTVFGLSDSMAKFTGSMAKGLSFTQDAEFQEKRRLQQRL
                     NANKRNIFSSSAQSFANTIGSGFTGMALDPMNGAQKEGTAGFIKGLGKGLFGLPTKTA
                     IGFLDLTSNLSQGVKSTASALDAPSSMRVRLPRYVDYHEKVIKSFNLKDAQGQYWLKS
                     VDGGLFMNDNYLTHVVLPGRELAVLVSMEHIIEMNIGSQEAMWVTDYYGIQGIILQRG
                     GIHIKLKSGSEYFVPVADAAERKSMYKHIAIAVTEYNKYCEAVL"
     gene            <359841..>360623
                     /gene="TDEL0G01780"
                     /locus_tag="TDEL_0G01780"
                     /db_xref="GeneID:11504682"
     mRNA            <359841..>360623
                     /gene="TDEL0G01780"
                     /locus_tag="TDEL_0G01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682708.1"
                     /db_xref="GeneID:11504682"
     CDS             359841..360623
                     /gene="TDEL0G01780"
                     /locus_tag="TDEL_0G01780"
                     /inference="similar to DNA sequence:INSDC:YLL041C"
                     /note="similar to Saccharomyces cerevisiae SDH2 (YLL041C);
                     ancestral locus Anc_4.13"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682756.1"
                     /db_xref="GeneID:11504682"
                     /db_xref="GOA:G8ZYS0"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR004489"
                     /db_xref="InterPro:IPR006058"
                     /db_xref="InterPro:IPR009051"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="InterPro:IPR025192"
                     /db_xref="UniProtKB/TrEMBL:G8ZYS0"
                     /translation="MNGLVKQRVAGGILRRGLATASQTPRLKTFKIYRWNPDKPAEKP
                     RLQSFQVDLDDCGPMVLDALLKIKDQQDSSLTLRRSCREGICGSCAMNIGGRNTLACL
                     CKIDQDHKKETKIYPLPHMYIIKDLVPDLTNFYQQYKSIQPYLQRSTFPADGKEVLQS
                     VADRKKLDGLYECILCACCSTACPSYWWNQEQYLGPAVLMQAYRWLVDSRDQAGAIRK
                     NMLQNSMSLYRCHTIMNCTRTCPKGLNPGLAIAEIKKAIATD"
     gene            <360751..>361224
                     /gene="TDEL0G01790"
                     /locus_tag="TDEL_0G01790"
                     /db_xref="GeneID:11504683"
     mRNA            <360751..>361224
                     /gene="TDEL0G01790"
                     /locus_tag="TDEL_0G01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682709.1"
                     /db_xref="GeneID:11504683"
     CDS             360751..361224
                     /gene="TDEL0G01790"
                     /locus_tag="TDEL_0G01790"
                     /inference="similar to DNA sequence:INSDC:YLL042C"
                     /note="similar to Saccharomyces cerevisiae ATG10
                     (YLL042C); ancestral locus Anc_4.12"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682757.1"
                     /db_xref="GeneID:11504683"
                     /db_xref="InterPro:IPR007135"
                     /db_xref="UniProtKB/TrEMBL:G8ZYS1"
                     /translation="MISYQRYCDQLHQLYDSKTLQNQIVVQVVRLLDDSILLQTAVPS
                     TAKDLSHLELKITYSQVYQEPLLLLRVWRKDQSQEDESDFVSLWFPQDVSALLGIDKS
                     FQLELDAVVSPTSHLQETWYSIHPCDTAEIVGDQAKYADGYLNRWLSVFLFSWLI"
     gene            <361298..>361978
                     /gene="TDEL0G01800"
                     /locus_tag="TDEL_0G01800"
                     /db_xref="GeneID:11504684"
     mRNA            <361298..>361978
                     /gene="TDEL0G01800"
                     /locus_tag="TDEL_0G01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682710.1"
                     /db_xref="GeneID:11504684"
     CDS             361298..361978
                     /gene="TDEL0G01800"
                     /locus_tag="TDEL_0G01800"
                     /inference="similar to DNA sequence:INSDC:YHL031C"
                     /note="similar to Saccharomyces cerevisiae GOS1 (YHL031C);
                     ancestral locus Anc_4.11"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682758.1"
                     /db_xref="GeneID:11504684"
                     /db_xref="GOA:G8ZYS2"
                     /db_xref="InterPro:IPR023601"
                     /db_xref="UniProtKB/TrEMBL:G8ZYS2"
                     /translation="MSNPQSFVTVRSQAISLESQAESLLSRYSSFAQTTSSEATGKEK
                     NLDKLLEENISKRREVIESLTHICDENPNISASKLSQVQRHKEVLQEHWKNFRNIRSS
                     IQQERNRLNLLFSVKNDIAQQQDDLEAGANLGNNEDEYFQNETRRVDQSHNIIDRLLT
                     QAWETRDQFGAQSSVLQSANNRISATLQRIPGINQLIGKIGTRRRKNAIILATVIVIC
                     MLLLFFTW"
     gene            complement(<362017..>363948)
                     /gene="TDEL0G01810"
                     /locus_tag="TDEL_0G01810"
                     /db_xref="GeneID:11504685"
     mRNA            complement(<362017..>363948)
                     /gene="TDEL0G01810"
                     /locus_tag="TDEL_0G01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682711.1"
                     /db_xref="GeneID:11504685"
     CDS             complement(362017..363948)
                     /gene="TDEL0G01810"
                     /locus_tag="TDEL_0G01810"
                     /inference="similar to DNA sequence:INSDC:YLL043W"
                     /note="similar to Saccharomyces cerevisiae FPS1 (YLL043W);
                     ancestral locus Anc_4.10"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682759.1"
                     /db_xref="GeneID:11504685"
                     /db_xref="GOA:G8ZYS3"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR022357"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="UniProtKB/TrEMBL:G8ZYS3"
                     /translation="MNDFLADPESRPVDMKKSTDDPHFTEQRSRSSTNHSHKSSNSND
                     EYDYEMQSYWPRPSFSRGQSRTSYIPQYSTYNGGQFPMHHVVPNTQMAMSSSADTSGG
                     ANGHLPGTENSKSELRPRATTVSSNFVNLGEFFRNNDDMESHHTSDHRSHRGSTSNKS
                     NTDHSYSNEDNESDPRNVPMMVRPKTLYQNPQTPTVLPSTYHPINKWSTVKHSYLKEF
                     LAEFMGTMIMVGFGSAVCCQVFAAGKIQQNQFDDALSLLTNASGELVETAKTFKYLVT
                     SVNGGTFDDVAFGWAGAVVMGYFCAGGSAISGAHLNPSITVANYIFRGFPSKKIPYYI
                     AGQLTGGFVGALIIFIFYKKVLQEAYTEWWTSESVASMFCVFPKPYLSSTRQFVSEFV
                     CTAMLQASTFALTDPYTCLSSDIFPLLLFVQIYVINASLSYQTGSAMNMARDLGPRLA
                     LYAVGFERSVLWSSHKHFFWVPIVAPLVGSMTGALVYDVCIYQGHESPVNWPLSVYKD
                     MILRAWIRRPGWKKRNRGRATSDLSDFSYDDDDDDDNNNDQDNDSQNRLAPPRTRTRS
                     TGSDTEDQPRQKGVQFKSMQGRAKRFYGGVPTILEDEDSIATASLGGAASESVALSDE
                     SSTEGNNEVDDGEHDRKTR"
     gene            <364972..>367068
                     /gene="TDEL0G01820"
                     /locus_tag="TDEL_0G01820"
                     /db_xref="GeneID:11504686"
     mRNA            <364972..>367068
                     /gene="TDEL0G01820"
                     /locus_tag="TDEL_0G01820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682712.1"
                     /db_xref="GeneID:11504686"
     CDS             364972..367068
                     /gene="TDEL0G01820"
                     /locus_tag="TDEL_0G01820"
                     /inference="similar to DNA sequence:INSDC:YHL032C"
                     /note="similar to Saccharomyces cerevisiae GUT1 (YHL032C);
                     ancestral locus Anc_4.9"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682760.1"
                     /db_xref="GeneID:11504686"
                     /db_xref="GOA:G8ZYS4"
                     /db_xref="InterPro:IPR005999"
                     /db_xref="InterPro:IPR018483"
                     /db_xref="InterPro:IPR018484"
                     /db_xref="InterPro:IPR018485"
                     /db_xref="UniProtKB/TrEMBL:G8ZYS4"
                     /translation="MFRCYIRSLRGLAIRRPVWKRSIYTVKSEYTLPEMTADENPKLT
                     VDEVIPLIAAIDVGTTSSRAILFNRLGQEVAKHQIEYSTSASKEKYAASGKRRRFSVD
                     ESNQPIFSAEGIAIEENEFLEIEDLIIKAGHPTLRFPKPGWVECNPLNILDNVVECFA
                     KTLAFTYHVNAQRIPDGLPPYQVHCIGIASMRETTLVWSKKTGMPIVDYGIVWNDTRN
                     AAIVTEKRNSTPEDEQTRLRNKTGLPLYSTYFSCSKLRWLLDNEPKVKEAYGSGDLMF
                     GTVDSWLIYHLTKSHAFVSDVTNASRTGFMNLDTLDYDDELLDYWGIDKNKINLPRIV
                     SSAEYYGDFHVPQVTKDHIPLADWKILSDFSHRTPRIPLQGCLGDQSASLVGQLAFKP
                     GSAKCTYGTGCFLLYNTGSTKLISQHGALTTFGYWFPHLADEEARKPHFALEGSVAVA
                     GAVVQWLRDNLRLIPKAEDIGPLASRVPDSGGVVFVPAFSGLFAPYWDPEARATIMGM
                     SQFTTASHIARAAVEGVCFQARAILKAMSSDALGTKDRDFLEEVSAGTYEKSLLSTLA
                     VDGGMSRSDEVMQIQANILGPCVKVRRSPTHECTALGAAIAAEMAFKDPKDRLMWKDL
                     KDVKKYIFYNGVEKDEECPLELQPDLKIFTSTSNNTERRKKWRIWEEAVKRSRGWLSS
                     LESMEDEDDEKGTDGK"
     gene            <367354..>368121
                     /gene="TDEL0G01830"
                     /locus_tag="TDEL_0G01830"
                     /db_xref="GeneID:11504687"
     mRNA            <367354..>368121
                     /gene="TDEL0G01830"
                     /locus_tag="TDEL_0G01830"
                     /product="60S ribosomal protein L8"
                     /transcript_id="XM_003682713.1"
                     /db_xref="GeneID:11504687"
     CDS             367354..368121
                     /gene="TDEL0G01830"
                     /locus_tag="TDEL_0G01830"
                     /inference="similar to DNA sequence:INSDC:YHL033C,YLL045C"
                     /note="similar to Saccharomyces cerevisiae RPL8A (YHL033C)
                     and RPL8B (YLL045C); ancestral locus Anc_4.8"
                     /codon_start=1
                     /product="60S ribosomal protein L8"
                     /protein_id="XP_003682761.1"
                     /db_xref="GeneID:11504687"
                     /db_xref="GOA:G8ZYS5"
                     /db_xref="InterPro:IPR001921"
                     /db_xref="InterPro:IPR004037"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR018492"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:G8ZYS5"
                     /translation="MAPVKKVAPAPFASKASKSSKPKNPLTNSAPKSFGIGQDIQPKR
                     NLSRYVKWPEYVRLQRQKKILSIRLKVPPAIAQFQYTLDRNSAAETFKLFNKYRPETA
                     AEKKERLTKEAAAIAEGKTRQEASPKPYAVKFGLNHVVSLIENKKAKLVLIANDVDPI
                     ELVVFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVRDEDEATLAKIISTV
                     NANFAVKYDEVKKHWGGGIMGNKAQAKLDKKAKTASA"
     gene            <368805..>369605
                     /gene="TDEL0G01840"
                     /locus_tag="TDEL_0G01840"
                     /db_xref="GeneID:11504688"
     mRNA            <368805..>369605
                     /gene="TDEL0G01840"
                     /locus_tag="TDEL_0G01840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682714.1"
                     /db_xref="GeneID:11504688"
     CDS             368805..369605
                     /gene="TDEL0G01840"
                     /locus_tag="TDEL_0G01840"
                     /inference="similar to DNA sequence:INSDC:YHL034C,YLL046C"
                     /note="similar to Saccharomyces cerevisiae SBP1 (YHL034C)
                     and RNP1 (YLL046C); ancestral locus Anc_4.7"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682762.1"
                     /db_xref="GeneID:11504688"
                     /db_xref="GOA:G8ZYS6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8ZYS6"
                     /translation="MSIEETKPVETTTETTFVDPETTVFVGNVSKECTEDDLKDIFAG
                     EFGSVEVEIPSGRTRDGRSFYNRYAFVKFPQKIDVEAIKEKYDKQVVKERGIYIRKAL
                     TQEERDAERQERIRSRRGGRGGAKFANNRGAAVPAPPRKDKTPLEEMERSKDTIYVNN
                     IPYYATKEQLAEFFGTQPELVVLPMRRMRDTNTKRVFFSKKMNRGIAFITFANFENGD
                     DINKKVESFQGKTLQERPIVVDVAAVRPPREEREQPEHDETAQEPAQE"
     gene            <369839..>374767
                     /gene="TDEL0G01850"
                     /locus_tag="TDEL_0G01850"
                     /db_xref="GeneID:11504689"
     mRNA            <369839..>374767
                     /gene="TDEL0G01850"
                     /locus_tag="TDEL_0G01850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682715.1"
                     /db_xref="GeneID:11504689"
     CDS             369839..374767
                     /gene="TDEL0G01850"
                     /locus_tag="TDEL_0G01850"
                     /inference="similar to DNA sequence:INSDC:YHL035C,YLL048C"
                     /note="similar to Saccharomyces cerevisiae VMR1 (YHL035C)
                     and YBT1 (YLL048C); ancestral locus Anc_4.6"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682763.1"
                     /db_xref="GeneID:11504689"
                     /db_xref="GOA:G8ZYS7"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZYS7"
                     /translation="MQAVNASESEPCRFWIYDDVTKCGRVRYINYYFPLTLTVFTVGF
                     LLYNVLSHYYYYDKLHLKKLSVVDELTNGASGDDSEDKPLLSNGKKHSQYTESQMTPE
                     ELMEKHFSVEKLKFVNTKGEPHGKVEIVRRGFIEKSRTIVEFLLVLSQLIFHVFVALN
                     YTGIYNEFPLSSSVMGVVQWAFLFFVVSIRLLNINQSIKWINKYPGNIWSISFVSYMF
                     LFLSNLLPYRSIFIGHIKKNVIKNYYLSQTYIDLVLFLLLFLSPQGNKNSVIYMTDST
                     ITPSPEPVSSIASFISWSWINKFVWTAHKSTIEFKDVWGLSLEDYSIFVVKKFRRYTG
                     RFSKNRGFTVNLLSFFSKYLALQGFWAFIESIISFIPTLLLKRILEYVEDRDSAPANL
                     AWFYVFGMFLCRILVAVCQGQALFLVRRVCIRMKAIIISEIYTKALKRKISANSAKQS
                     SDEVDPQKLNEQEQINGDEESTTSANLGAIINLMAVDAFKVSEICAYLHAFVEAVVMA
                     LVAFVLLYHLLGFAAIVGAALIVAMMPLNFKLATWLGHLQKETLSVTDKRIQKLNEAF
                     QAIRIIKFFSWENNFEKDIRDVRETELKFLMKRSLVWAGSSFVWYITPTIVTSCAFWF
                     YIYIQGEVLTTPIAFTALSLFSLLRTPLDQLSDMLSFVIQSKVSLDRVQEFLEEKDTE
                     KYNQLSTAKDKKKIGFENATITWDAERPDFKLKNLNIDFKVGKLNVIIGPTGSGKTSL
                     LMALLGEMHLVSGKIIVPSLDPRQELPIEADGMTNSMAYCSQAAWLLNDTVKNNILFN
                     SPYNEGRYEAVVEACGLKRDFSILSAGDLTEIGERGITLSGGQKQRISLARSLYSNAR
                     HVLLDDCLSAVDSHTASWIYDNCITGPLMEGRTCILVSHNTALTLRNAELVVTMENGQ
                     VKNQGEPLSLLHSGLLGEDELVKSSILSRHNSSVNLKSKSTTSIRNLSKGKELAKSKK
                     TDEERAKDGKLIKDETKAEGVVSADVYKWYLRIFGGWKMLSILIAAFVIAQGISIGQT
                     WWVRSWVSNNFSTKIIALGQNIAVSTSRAISHVGNFVTSFSFMQHNFDEESRAKIHST
                     FYYLSLYFLIGVIQSVLSALKTVLSFVAGINASRKIFNLLLSKVMHAKLRFFDSTPIG
                     RIMNRFSKDMEAADQELTPFIEGAFYSLVQCVSTVVLITFITPQFLFVAILVAVLYYF
                     VGYFYLTGSRELKRLESISRSPIYQHFSETLVGVTTIRAFGDESRFMRENLQKIDENN
                     RPFFYLWVANRWLSFRIDMIGALVIFGAGIFVLLNIDHIDSGKAGISLTYAITFTEGA
                     LWLVRLYSNVEMNMNSVERLKEYMDVEQEPYDQSILTPPVEWPQQGRIEVNDLSLRYA
                     PNLPKVIKNVSFTVDPRSKVGIVGRTGAGKSTIITALFRFLDPETGNIKIDNVDITSI
                     DLQRLRRSITIIPQDPTLFTGTIKSNLDPYDEYTDQQIFEALKRVNLVTQEELDRRPT
                     SESSSVSSENINKFLDLSSEISEGGGNISQGQRQLVCLARSLLRSPKIILLDEATASI
                     DYASDAKIQETIRKEFGGNTILTIAHRLRSVIDYDKILVMDAGEVKEFDHPYSLLLNK
                     NSLLYSMCEQSGELESLIESAKQAFVEKLNSK"
     gene            complement(<374829..>376436)
                     /gene="TDEL0G01860"
                     /locus_tag="TDEL_0G01860"
                     /db_xref="GeneID:11504690"
     mRNA            complement(<374829..>376436)
                     /gene="TDEL0G01860"
                     /locus_tag="TDEL_0G01860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682716.1"
                     /db_xref="GeneID:11504690"
     CDS             complement(374829..376436)
                     /gene="TDEL0G01860"
                     /locus_tag="TDEL_0G01860"
                     /inference="similar to DNA sequence:INSDC:YHL036W"
                     /note="similar to Saccharomyces cerevisiae MUP3 (YHL036W);
                     ancestral locus Anc_4.5"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682764.1"
                     /db_xref="GeneID:11504690"
                     /db_xref="GOA:G8ZYS8"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR019931"
                     /db_xref="UniProtKB/TrEMBL:G8ZYS8"
                     /translation="MSESFKLVTRKDHDLEQGEPEELGYGSFSSMEIDRAGILVDAFV
                     EVPQGRHLGLFSTMVLFVSRMVGSGIFATPSSIFVNCGGNVLIYFGVWLLAALLSFAG
                     LFLFLEFGSWLPRSGGRKNFLEQTYTKPKLMMSVTFAAYTVLTGFTMSNAIVFGKYFL
                     SAIGYQSISDHSNLSKYISIAAVVTGVTIHGLSVKAGVRIQNFLGGLKFVLIAIMCVL
                     GLYSVFFYNSPIEEASSIPIYAFQDEAMATTSSLATAFINAFFCFTGWDSVHAVASEI
                     KNPVRTLKIAGPASLAVCFICYSMMNLAYLKVLTYEEIKQAGPLVGSMLFAKLFGPHL
                     GAKLLSSSVALSTASNILVVLYGVSRMNQEVFREGYLPFSIPLASNKPWNSPLPALLV
                     CGTLSVLWLTLLPAEGASYDYLVSMEGYGNQFFLLLVAVGIFIYRRKRKDEVPDTKAP
                     SIGVIALILVSTYLLAAPFLGDQVSNSISILPPYQITALSLIIVCFLFWLVKFFLLPR
                     MFGYVHKQRIITLSDGLVVTKWVKCYL"
     gene            <377068..>378864
                     /gene="TDEL0G01870"
                     /locus_tag="TDEL_0G01870"
                     /db_xref="GeneID:11504691"
     mRNA            <377068..>378864
                     /gene="TDEL0G01870"
                     /locus_tag="TDEL_0G01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682717.1"
                     /db_xref="GeneID:11504691"
     CDS             377068..378864
                     /gene="TDEL0G01870"
                     /locus_tag="TDEL_0G01870"
                     /inference="similar to DNA sequence:INSDC:YHL038C"
                     /note="similar to Saccharomyces cerevisiae CBP2 (YHL038C);
                     ancestral locus Anc_4.4"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682765.1"
                     /db_xref="GeneID:11504691"
                     /db_xref="UniProtKB/TrEMBL:G8ZYS9"
                     /translation="MSSINWRALFFGTFRRQPTSNNYRYKHASPKIKRAVLNNFTKEL
                     ENKELQEIVVQIDRQLYSAPVNKLREIIFRDATGPSRAIIKTIRSDPTRSSKTLRNVA
                     ISSWQNIAPIFAHPLNPISEFKAKGTASSFEYTCSISLTSKGGQEKLSNVSWPDPLFS
                     NSCQGLGVLKENFEPLSGTKFLNPSDGRTLDFFIVDELPKGCNAIGLFPAYEPSHKRH
                     FSGLQLCAAVIRHKPCTQEQRSAVEARITSSPQSDKNLGDLNALSLSETDFRSLKGLM
                     DASSKSQSLWSHARDHDRTCPGDIIRCTLMSRKVDTNQLLDEFGKHFILYSLVSQALR
                     IRQTVDKSITYKPSELSPIDQYVLQKLHELNELDTPASVSEMIQYKQDFDDFLTILSS
                     YHFSIVAEMKSSSQNYFRDGDKTPRAVTVFRVLHEILRNSKPFKMFYPNLSEYATRAL
                     PQSSLSNESLPLSNDEEELNVGAKALIMFKNITEFESEMYYDRLTTARPLEIEPMASL
                     KTWKIVILAKDPLPQAIERALVFNSRVYTQCVTDLAQATLIKFATCKVRKMIDEDTFL
                     FLYQLQRPPKVDRDQMVDDILGKLETAVAERV"
     gene            complement(<378869..>379141)
                     /gene="TDEL0G01880"
                     /locus_tag="TDEL_0G01880"
                     /db_xref="GeneID:11504692"
     mRNA            complement(<378869..>379141)
                     /gene="TDEL0G01880"
                     /locus_tag="TDEL_0G01880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682718.1"
                     /db_xref="GeneID:11504692"
     CDS             complement(378869..379141)
                     /gene="TDEL0G01880"
                     /locus_tag="TDEL_0G01880"
                     /inference="similar to DNA sequence:INSDC:YLL049W"
                     /note="similar to Saccharomyces cerevisiae LDB18
                     (YLL049W); ancestral locus Anc_4.3"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682766.1"
                     /db_xref="GeneID:11504692"
                     /db_xref="UniProtKB/TrEMBL:G8ZYT0"
                     /translation="MRQSHRFCRDLQKLDIVYEDLVQMESLEKVSPVQIYRIQELPKL
                     LEACSGLLVRSLALAQRFIAWNVRSNEFLSGLDHKMKELEGKIDAM"
     gene            <379596..>380090
                     /gene="TDEL0G01890"
                     /locus_tag="TDEL_0G01890"
                     /db_xref="GeneID:11504693"
     mRNA            join(<379596..379609,379673..>380090)
                     /gene="TDEL0G01890"
                     /locus_tag="TDEL_0G01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682719.1"
                     /db_xref="GeneID:11504693"
     CDS             join(379596..379609,379673..380090)
                     /gene="TDEL0G01890"
                     /locus_tag="TDEL_0G01890"
                     /inference="similar to DNA sequence:INSDC:YLL050C"
                     /note="similar to Saccharomyces cerevisiae COF1 (YLL050C);
                     ancestral locus Anc_4.2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682767.1"
                     /db_xref="GeneID:11504693"
                     /db_xref="GOA:G8ZYT1"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR017904"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:G8ZYT1"
                     /translation="MSRSGVAVADESLQAFNDLKLGKKYKFVLFALNDDKTSIVVKET
                     STDASYDAFLEKLPENDCLYAVYDFEYEINGNEGKRSKIVFYTWSPDTAPVRSKMVYA
                     SSKDALRRALNGVSTDIQGTDFSEVSYETVLEKVSRGAGSH"
     gene            complement(<380166..>381887)
                     /gene="TDEL0G01900"
                     /locus_tag="TDEL_0G01900"
                     /db_xref="GeneID:11504694"
     mRNA            complement(<380166..>381887)
                     /gene="TDEL0G01900"
                     /locus_tag="TDEL_0G01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682720.1"
                     /db_xref="GeneID:11504694"
     CDS             complement(380166..381887)
                     /gene="TDEL0G01900"
                     /locus_tag="TDEL_0G01900"
                     /inference="similar to DNA sequence:INSDC:YHL039W"
                     /note="similar to Saccharomyces cerevisiae YHL039W;
                     ancestral locus Anc_4.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682768.1"
                     /db_xref="GeneID:11504694"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:G8ZYT2"
                     /translation="MTNLDQLKTCVEWCKDHGAIIDDRLEFKVTQAAGVTAIAKSVIK
                     TTEPLISVPANLLITKELAEKEFGSASGAVSSENPNALVQLFTAKMKFDPSARPFHKP
                     YFDILPTKLDQPYFWKLQEVELLKGTDIYLLMKQNLRKIVKEWHVLLDQLKLKPEDGE
                     LYEQSEAQDFDILKYICEYREQHKSISWKSFVGYLWATGIFTSRAFPKLILEEKCSSI
                     NEAFLYPLVDLLNHKNDTKVKWTFTNDNVCFVSQEIMKEGEEVFNNYGEKSNEDLLLS
                     YGFVQDQNPYDLTRLTLRLTKEMIDEALNAELGFSEKNKVADDCVQFQITAVEPLPSS
                     MVNFFGYLCKLGSEADVTLRSFLEGQDQLHSILMQKLDFFRTHSKIDSAKYKTCNSKV
                     LQVIRKYFNSEKTLFNTSLEALQKTQKEVLTKNSSMITSFKTIFKRDKQFANSLLLTF
                     GVTKYDDLLTKNCMKEALFLWIVRVANMDSYPQKFDFSVPQFIYDSFQEVSGSIVIER
                     NNVSDFMDFYKKLFPGLSNKIPEVFSPGNWGIRQFIVADTVMDRLVWTRKLTQEPFFI
                     VRVPFKL"
     gene            complement(<382065..>383471)
                     /gene="TDEL0G01910"
                     /locus_tag="TDEL_0G01910"
                     /db_xref="GeneID:11504695"
     mRNA            complement(<382065..>383471)
                     /gene="TDEL0G01910"
                     /locus_tag="TDEL_0G01910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682721.1"
                     /db_xref="GeneID:11504695"
     CDS             complement(382065..383471)
                     /gene="TDEL0G01910"
                     /locus_tag="TDEL_0G01910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682769.1"
                     /db_xref="GeneID:11504695"
                     /db_xref="GOA:G8ZYT3"
                     /db_xref="InterPro:IPR007312"
                     /db_xref="UniProtKB/TrEMBL:G8ZYT3"
                     /translation="MKFVQLAATVAATAASVAKGAEVSSSSKSRVPRTYSTVSPEPTD
                     IAKAASNATTNHFTSDVDGAAFKRLVVVWLENTDYDKAAGDSDMQWLSEQGITLDNYW
                     GVTHPSEPNYMASVGGDYFALDDDRFISLPANVSTVVDLLETKDITWGEYQENLPYTG
                     FQGFNYSDQTTFQNNYVRKHNPLMLYESVTNNQTRLGNIKNFTLFQEDLEKETLPQFI
                     HITPNMLNDGHDTTIRYAANWTRSFLEPLLSNDYFMKDTLIVLTFDENDTYSVKNQVF
                     TVLLGGAIPDELKGTTDSTYYDQYTLISTPEANWDLPCLGRNDVDANVFEFVANKTNV
                     SNKVVDTTFKVNNATYVGYLLDDTIPLPAPNVSAINMNGQPVLKAIQEKWGSVYSEQI
                     SESYFTSTTTTVSGSYTISNAIVTASSHASANSTSQNSSNSSNSSKSYSGSSVGAAVA
                     LSALPLGGLLGVAVAFLL"
     gene            <384028..>386022
                     /gene="TDEL0G01920"
                     /locus_tag="TDEL_0G01920"
                     /db_xref="GeneID:11504696"
     mRNA            <384028..>386022
                     /gene="TDEL0G01920"
                     /locus_tag="TDEL_0G01920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682722.1"
                     /db_xref="GeneID:11504696"
     CDS             384028..386022
                     /gene="TDEL0G01920"
                     /locus_tag="TDEL_0G01920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682770.1"
                     /db_xref="GeneID:11504696"
                     /db_xref="GOA:G8ZYT4"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="UniProtKB/TrEMBL:G8ZYT4"
                     /translation="MRVEEEIPMATLDDEGDLEVQGGGRNEKEKKFLGRLKLALLVII
                     PLLVFSFTFKELSRANKLGFITEPMLSTFTKKSEQSNDESWRLDTGKNYTMDVKYWLS
                     EKKPAERHYYMNISKLVEKTPDGIARNLTVVNGQYPGPLVEANAGDKLIIHVDNQMDD
                     EPVTIHCHGLFFSKQNSFQDGAAYMNQCPIPPSGNYTYEIDLDDTQAGTYWYHSHFGG
                     QYADGLFGPLVIHSQEEYSAMNLSYDKDIVLMVNDYYHDSASNYLPDYLGPDNENTEP
                     DPDNGLIQGQNKFDYVEATYLVPNGRNISDVSYTPVNVSLIDLDPDSTYRVRLINAGF
                     FLTFEFEIDSHKLEIVEADGTLVDPIEVDSIAVSLAERYSFILKPQDEKKDLGNYWMR
                     ARFNQYCAKVENDNFNPDVRAIVSYKNSEDVSNLQVPDSSWDNGGGDVRCNEFDQSLL
                     HTANITSVPMASNGSRLPDEKIHMEISFLIGAYQLTRGYLNGHTYESYNNGSTMYQLA
                     FAANNNTIKNLDVQDLATSNSNQYMLNFNNKGTVVDFVINNYDDGNHPFHLHGHKFYV
                     LAIGNAGYFSEDYYNEDSDVLNFKNPVLRDTVNIPGYGWGVLRFVIDSPGVWPFHCHI
                     GWHIESGLMMQINSLQSEYSEWDNYPQQWYDHCQYWQDQL"
     gene            <386281..>386571
                     /gene="TDEL0G01930"
                     /locus_tag="TDEL_0G01930"
                     /db_xref="GeneID:11504697"
     mRNA            <386281..>386571
                     /gene="TDEL0G01930"
                     /locus_tag="TDEL_0G01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682723.1"
                     /db_xref="GeneID:11504697"
     CDS             386281..386571
                     /gene="TDEL0G01930"
                     /locus_tag="TDEL_0G01930"
                     /inference="similar to DNA sequence:INSDC:YJL184W"
                     /note="similar to Saccharomyces cerevisiae GON7 (YJL184W);
                     ancestral locus Anc_1.154"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682771.1"
                     /db_xref="GeneID:11504697"
                     /db_xref="InterPro:IPR014849"
                     /db_xref="UniProtKB/TrEMBL:G8ZYT5"
                     /translation="MLHPTATYSLPDIEPTRFVVNPAEARFQTTDGKTTGASPHVLNA
                     GQVDRDKPSEPRRTATGEMTPLGQLRANLTGLQDDINEFLTHRMELAKGKKD"
     gene            <386795..>388264
                     /gene="TDEL0G01940"
                     /locus_tag="TDEL_0G01940"
                     /db_xref="GeneID:11504698"
     mRNA            <386795..>388264
                     /gene="TDEL0G01940"
                     /locus_tag="TDEL_0G01940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682724.1"
                     /db_xref="GeneID:11504698"
     CDS             386795..388264
                     /gene="TDEL0G01940"
                     /locus_tag="TDEL_0G01940"
                     /inference="similar to DNA sequence:INSDC:YCR028C"
                     /note="similar to Saccharomyces cerevisiae FEN2 (YCR028C);
                     ancestral locus Anc_1.155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682772.1"
                     /db_xref="GeneID:11504698"
                     /db_xref="GOA:G8ZYT6"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G8ZYT6"
                     /translation="MGEHCDDEQVVVKKLVNKRYLLFKIDLFVLSFVCLQYWINYVDR
                     VGFVNAYISGMKEDLQFKNNDINVANTCFTVGYILGMIPNNLILLVAPPRVWLSFCTF
                     AWGLLTLGMFKVTSFEQCCAIRFFQALFESCTFSGTHLILGSWYKESELPIRSAIFTS
                     SGLIGSMFSGFMQVAIHDSLNGVRGLEGWRWLFIIDFSITMPIALYGFLFFPGVPEHS
                     SGKSRFSMTKYFFSEQELQYARRRLPARDESTRLDWSVVPRVLKRWHWWFFSFVWVLG
                     GENLSLASNSTFALWLKDQQYSLSHRNNFPSGIFAVGVVSTMLSAVYLYKVARSRHWH
                     VATFIAVIMCIVAIMIRANPIKPSVMFTAQYLGGVAYAGQAVFFAWANIVCHDDLQER
                     AIVLASMNMFSGAVNAWWSILFFAATTVPHFEKGSYALLATSISSGLVSVWIRKLQNR
                     DSSRKQKLSYIDANDMLDEDDDDDDDDDEYDDQIAQNHS"
     gene            <388463..>389728
                     /gene="TDEL0G01950"
                     /locus_tag="TDEL_0G01950"
                     /db_xref="GeneID:11504699"
     mRNA            <388463..>389728
                     /gene="TDEL0G01950"
                     /locus_tag="TDEL_0G01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682725.1"
                     /db_xref="GeneID:11504699"
     CDS             388463..389728
                     /gene="TDEL0G01950"
                     /locus_tag="TDEL_0G01950"
                     /inference="similar to DNA sequence:INSDC:YJL183W"
                     /note="similar to Saccharomyces cerevisiae MNN11
                     (YJL183W); ancestral locus Anc_1.156"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682773.1"
                     /db_xref="GeneID:11504699"
                     /db_xref="GOA:G8ZYT7"
                     /db_xref="InterPro:IPR008630"
                     /db_xref="UniProtKB/TrEMBL:G8ZYT7"
                     /translation="MTFKPKSKFKSGSRTSKNWLSRFLKMCGFPTRLGPFSRLQGRLI
                     VIISGMLLSLYLLSNLFTFGHVARRTYPVEHGHYINEIPASSSLIYPAIEHAPVLKEI
                     GVRGLFTLRTDVEGRSSYILNPSDKPLSDDEKKKTSDQILLVKKSFLDHGKLVYRKSV
                     ATPEIVIVTLLDFESFDLDTIVSVVQNRVDYAQRHKYGVYMRWIQEFTPLLENQELQA
                     SQEFIKPLIMRAAIHAFPQAKYVFFVDQHSLIMNLDLTLQQHLLDPSVLDMALLKNVP
                     VTPNSNIKTYQHFNVETTRIIIPQSPSGQLDLSSIVVSTDLYGKAFLEYMIDPLFRSY
                     DWEGFSSSVAHFLQWHPQFLGKTALVIQKLIAAPFDVSKPLDQATSDDTLDAVHYSPG
                     DFVVSLKGCKLRGTCAADIAFYYNSIQKN"
     gene            <390007..>392556
                     /gene="TDEL0G01960"
                     /locus_tag="TDEL_0G01960"
                     /db_xref="GeneID:11504700"
     mRNA            <390007..>392556
                     /gene="TDEL0G01960"
                     /locus_tag="TDEL_0G01960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682726.1"
                     /db_xref="GeneID:11504700"
     CDS             390007..392556
                     /gene="TDEL0G01960"
                     /locus_tag="TDEL_0G01960"
                     /inference="similar to DNA sequence:INSDC:YJL181W,YJR030C"
                     /note="similar to Saccharomyces cerevisiae YJL181W and
                     YJR030C; ancestral locus Anc_1.157"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682774.1"
                     /db_xref="GeneID:11504700"
                     /db_xref="UniProtKB/TrEMBL:G8ZYT8"
                     /translation="MTSGQGCRYSGRDLLETLKRLNGLCSALKQNRTSSLDPMAQFCV
                     QTDGMARNLQFLIEKHLKLQLDDISALQRSFSDVQILNSYNEVLLTSTKLIFSVETPF
                     FRLGKRPEFAVHLVKLYTILTGFQGSLGVRATQLSSVIHAFEYQFNQSFNIANCNVLR
                     LDQVHDLLSHSFDLVSPPLIDINDVTKRDYFRLSMNKYNVDHQLVEILQFSSGELAIF
                     KVNFGEIPNLGAPPSQQLTTLAQGNYNILNLGRTLLFPILRECDLEIINNLSSGTELK
                     TTTGNGICLKLQCVDPVQWESHWKICFKRLFDKSDVILLTPRSYSSASLAKSSHVFQS
                     FKLKHSKLEELRPASNTGLPLKIPQPALAAEEDKESVQKSPPQVVRSGLRRSKPLRRP
                     LSVLMGINEEEEKKRLMKAPISPDKQLTPPSYEDLESFNCEKLLELDKTIQMEMSPVS
                     MGSAVMQQVKSASQHSSLDQIAPTLGQDIELGDEESVLSLDEEDSLSDSGSTFNPSAD
                     FYKPTLYRRKSTSLLSLFSSKNKKKLVVDTAAANASVTSVTSSRSNTPSSAKSGLPTC
                     ATTKDFELLPRTIDLNNDLAIFESENIKASLWDGRQWMKFGADSLKVSILKSDEDKTV
                     MVLYERKDESKCIFAAHISPKWKCSKAAAQDLQIVIPTQNFIVSILPPGSNTINMRSS
                     AAEKLKNSLQHCIKGNLPSFIPSSQTAATLSSVPSTFSSRGVTRSSTALSELANFKNK
                     PDAVDSHLLLPSVKVKIHKKVGEKGWQAQKIGFIDIFSQEYKGSAIAVKFEYFGGNEE
                     TEKPLTFCSHINGVHRIGRTGLLVASEGEERLLEFMNNIVAGQVYKLIKPF"
     gene            complement(<392617..>393573)
                     /gene="TDEL0G01970"
                     /locus_tag="TDEL_0G01970"
                     /db_xref="GeneID:11504701"
     mRNA            complement(<392617..>393573)
                     /gene="TDEL0G01970"
                     /locus_tag="TDEL_0G01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682727.1"
                     /db_xref="GeneID:11504701"
     CDS             complement(392617..393573)
                     /gene="TDEL0G01970"
                     /locus_tag="TDEL_0G01970"
                     /inference="similar to DNA sequence:INSDC:YJL180C"
                     /note="similar to Saccharomyces cerevisiae ATP12
                     (YJL180C); ancestral locus Anc_1.158"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682775.1"
                     /db_xref="GeneID:11504701"
                     /db_xref="GOA:G8ZYT9"
                     /db_xref="InterPro:IPR011419"
                     /db_xref="InterPro:IPR023335"
                     /db_xref="UniProtKB/TrEMBL:G8ZYT9"
                     /translation="MLRLFTRYNTAARPGLSLRPLATQASPLGVDGSTENNLKTETNR
                     LAKTGEKFWEKVSLKDDGSQFLVQLDSKTVLTPLGNALAVDKRRSLLAMLLKKEWTNL
                     PSLAIKTHALPLTSLVSRCIDLENVNKPDSDPEMRAKIGGDREHIANDLLRYLDTDTL
                     LVFCPQAEFEGALRKAQDERYLPIIASVEKFLGQYSTSPIKLRVLDADVDGLRGNSQT
                     NETRKAAKKFLESLSLWDLAIFEKTVLTTKSFICGVLLLQNKALDKSAEGLTSTMESV
                     AQAATLEIIHQTDRWGEVEDTHDVDKRDVRRNIHAAGIVAYK"
     gene            <393688..>394029
                     /gene="TDEL0G01980"
                     /locus_tag="TDEL_0G01980"
                     /db_xref="GeneID:11504702"
     mRNA            <393688..>394029
                     /gene="TDEL0G01980"
                     /locus_tag="TDEL_0G01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682728.1"
                     /db_xref="GeneID:11504702"
     CDS             393688..394029
                     /gene="TDEL0G01980"
                     /locus_tag="TDEL_0G01980"
                     /inference="similar to DNA sequence:INSDC:YJL179W"
                     /note="similar to Saccharomyces cerevisiae PFD1 (YJL179W);
                     ancestral locus Anc_1.159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682776.1"
                     /db_xref="GeneID:11504702"
                     /db_xref="GOA:G8ZYU0"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="UniProtKB/TrEMBL:G8ZYU0"
                     /translation="MSNLPIIQELTTNLRSSKAQLQSVEQQLALLERQEKLAKVVTEE
                     LKSYGTDKVWRSCGKAFVLQDKSKYVDDLKHDETVVKEQTKTLEIRKNYLETTVEKIV
                     DNLRLAAGNQK"
     gene            complement(<394070..>394873)
                     /gene="TDEL0G01990"
                     /locus_tag="TDEL_0G01990"
                     /db_xref="GeneID:11504703"
     mRNA            complement(<394070..>394873)
                     /gene="TDEL0G01990"
                     /locus_tag="TDEL_0G01990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682729.1"
                     /db_xref="GeneID:11504703"
     CDS             complement(394070..394873)
                     /gene="TDEL0G01990"
                     /locus_tag="TDEL_0G01990"
                     /inference="similar to DNA sequence:INSDC:YJL178C"
                     /note="similar to Saccharomyces cerevisiae ATG27
                     (YJL178C); ancestral locus Anc_1.160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682777.1"
                     /db_xref="GeneID:11504703"
                     /db_xref="InterPro:IPR018939"
                     /db_xref="UniProtKB/TrEMBL:G8ZYU1"
                     /translation="MILKTVIIATLLNLGLVNGLECGKHDILKKYRLNPGAITGSVER
                     DTPPSKTKEEWWFDPCEDSGVTVPSGCDEKDTLCGVTYVTLPGKDALLTQAIDFSREI
                     NNAVEEIDGKLRVSLLGSKWGADTFNAQIDFECDTNMKNDEITSNTWQDKQIRLNVKG
                     PSGCLKDDNGGNDDKAPSGKHPQDDKKDKKKGTSWFTWLLTYAMLFTLIYLIVTAYVN
                     TRGGSYQDFREEFIERLMQLVTSLPAFVKEVTSKIFGGSSSHRGGYSAV"
     gene            <395517..>396071
                     /gene="TDEL0G02000"
                     /locus_tag="TDEL_0G02000"
                     /db_xref="GeneID:11504704"
     mRNA            <395517..>396071
                     /gene="TDEL0G02000"
                     /locus_tag="TDEL_0G02000"
                     /product="60S ribosomal protein L17"
                     /transcript_id="XM_003682730.1"
                     /db_xref="GeneID:11504704"
     CDS             395517..396071
                     /gene="TDEL0G02000"
                     /locus_tag="TDEL_0G02000"
                     /inference="similar to DNA sequence:INSDC:YJL177W,YKL180W"
                     /note="similar to Saccharomyces cerevisiae RPL17B
                     (YJL177W) and RPL17A (YKL180W); ancestral locus Anc_1.161"
                     /codon_start=1
                     /product="60S ribosomal protein L17"
                     /protein_id="XP_003682778.1"
                     /db_xref="GeneID:11504704"
                     /db_xref="GOA:G8ZYU2"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005721"
                     /db_xref="InterPro:IPR018260"
                     /db_xref="UniProtKB/TrEMBL:G8ZYU2"
                     /translation="MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELQRA
                     QKYLGQVLEHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAANA
                     EAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVVTEKEENVEKA
                     AEKKVVRLSSRQRGRIAAQKRIAA"
     gene            complement(<396217..>398130)
                     /gene="TDEL0G02010"
                     /locus_tag="TDEL_0G02010"
                     /db_xref="GeneID:11504705"
     mRNA            complement(<396217..>398130)
                     /gene="TDEL0G02010"
                     /locus_tag="TDEL_0G02010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682731.1"
                     /db_xref="GeneID:11504705"
     CDS             complement(396217..398130)
                     /gene="TDEL0G02010"
                     /locus_tag="TDEL_0G02010"
                     /inference="similar to DNA sequence:INSDC:YKL179C"
                     /note="similar to Saccharomyces cerevisiae COY1 (YKL179C);
                     ancestral locus Anc_1.162"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682779.1"
                     /db_xref="GeneID:11504705"
                     /db_xref="GOA:G8ZYU3"
                     /db_xref="InterPro:IPR012955"
                     /db_xref="UniProtKB/TrEMBL:G8ZYU3"
                     /translation="MDLSVYEHALELWSKADLTTLQKQLDKDVIDMKEKETQFLDSRK
                     NLASETKIFKKLASEEKLANVNKIIKHYQQEIDSLTKRSKSSEVILLDLYGKLAEAPD
                     PKPLLQNSLQKLGKTDDSKALREQIELLEDKLAKYADYENLKSRLLDLEQNSAVTLVK
                     RLTAKEQEVNSRWEEKQRNWEERESKLMSQLEKLEKGVSNEGKDQTSGNVTEHNLLEQ
                     ELETAQSRNFELEKRNEELNVALTKATSNAEQELQLQSRDTKIKQLESENALLSATSE
                     HEHQSHKKIEKQLTEQLAALQAETDSYKSEIKSIRMKLDNYSDYVQLKEELSALKRIE
                     FGTDQDDEENGDDNAQNKVESGIISANKKLQSNLAELRGKLADREEENISLQKQLVEL
                     KERVTKTEALNQKLEEDLDKVEEVDQKFNDTASMMSGATRQINNRSGRLSPTSSIAGI
                     PEESEMPTNFGNNTILPIITKQRDRLRGRNTELEKQLRQLGTDKNKLKSEMTKLKTDN
                     TKLYERIRYLSRYSGNTGDASVADVDTEAQYSQIYEDSINPLNTLKKKELEYYKRNRL
                     SLWEKLFLSFARIILANKVTRMAFLLYCIGIHGLILMMSVYVINLSGYMTPEVGIVQS
                     STGSSRLVQNHNV"
     gene            complement(<398365..>400131)
                     /gene="TDEL0G02020"
                     /locus_tag="TDEL_0G02020"
                     /db_xref="GeneID:11504706"
     mRNA            complement(<398365..>400131)
                     /gene="TDEL0G02020"
                     /locus_tag="TDEL_0G02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682732.1"
                     /db_xref="GeneID:11504706"
     CDS             complement(398365..400131)
                     /gene="TDEL0G02020"
                     /locus_tag="TDEL_0G02020"
                     /inference="similar to DNA sequence:INSDC:YJL176C"
                     /note="similar to Saccharomyces cerevisiae SWI3 (YJL176C);
                     ancestral locus Anc_1.163"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682780.1"
                     /db_xref="GeneID:11504706"
                     /db_xref="GOA:G8ZYU4"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:G8ZYU4"
                     /translation="MESPSLFEPEANANSEANGENSVSESVETTEKPIDSSVEVEKKE
                     ESDEKLFGDEDEAMSESEDPENTENMEKPDTAVREEPRIDEEPVKQEENELVIPQSHE
                     IVIPNYARWFDLRKIHLIEKQSLPEFFTNRVASKTPQVYVKYRNFMVNAYRLNPNEYF
                     GVTAARRNVCGDAAAIYRVHKFLMKWGLINYQVDAKLLPKNVEPPFTGEFSTRHDAPR
                     GLFPFESYKPSVQLPDMAKLKKMMDTNNDNSALHKYLHERKRKMSNQAEPDEKPDETD
                     VKQESEVNGVEDQESSPNPVKRAKVLEDTSVQWTREELQKLLKGLQEYGSDWYKVAKE
                     IDNKTPEQCILKFLQLPIEDRFLHGDKDNSDLGPLKYAPHLPYSKSENPVMSTIAFLV
                     GLVDPKVVQQMTGRALKAMEDLDNKKTESSAEETKEGSEIALASLGVRSHIFATNEER
                     QLNAIANELVEVQLAKTEVKLKFLDKIEKALELDKKALQRQQEDALVKRLAFAKHSRT
                     VYEKLEKSMELFDDKDKLANHLSEIKQLLANPPKMSIGSAFGVPNDDAASPSQEKTGA
                     KSEHEVKPVSIEAPQFYRYWSA"
     gene            <400520..>401362
                     /gene="TDEL0G02030"
                     /locus_tag="TDEL_0G02030"
                     /db_xref="GeneID:11504707"
     mRNA            <400520..>401362
                     /gene="TDEL0G02030"
                     /locus_tag="TDEL_0G02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682733.1"
                     /db_xref="GeneID:11504707"
     CDS             400520..401362
                     /gene="TDEL0G02030"
                     /locus_tag="TDEL_0G02030"
                     /inference="similar to DNA sequence:INSDC:YJL174W"
                     /note="similar to Saccharomyces cerevisiae KRE9 (YJL174W);
                     ancestral locus Anc_1.164"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682781.1"
                     /db_xref="GeneID:11504707"
                     /db_xref="GOA:G8ZYU5"
                     /db_xref="InterPro:IPR008659"
                     /db_xref="InterPro:IPR018466"
                     /db_xref="UniProtKB/TrEMBL:G8ZYU5"
                     /translation="MLLSIHSLLLTVITLLAGFVAGDAQVVKPKANSEFSGSSGTISI
                     EIQWMDNNAYPPFDKIDHFLFQLQNGPNSNIQKVKVLKDNVSPDDVEQGDDGTYSYTV
                     EFDSSITGDGQYYIQVFSALDADNKQYTINYSPRFELTDMKGTTTVTFTDTTQPVGQT
                     RAQTGTTAASVDTRSFTLQYTQQTGISRFAPMQMQPVTKITATTWTRRFATSAVTYYS
                     SLINSLQQETTLTPGWSYTLPSGMNMATPAPYPSDNGGWKDPKERQSLSTRKINLRKR
                     AFIK"
     gene            complement(<401409..>401759)
                     /gene="TDEL0G02040"
                     /locus_tag="TDEL_0G02040"
                     /db_xref="GeneID:11504708"
     mRNA            complement(<401409..>401759)
                     /gene="TDEL0G02040"
                     /locus_tag="TDEL_0G02040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682734.1"
                     /db_xref="GeneID:11504708"
     CDS             complement(401409..401759)
                     /gene="TDEL0G02040"
                     /locus_tag="TDEL_0G02040"
                     /inference="similar to DNA sequence:INSDC:YJL173C"
                     /note="similar to Saccharomyces cerevisiae RFA3 (YJL173C);
                     ancestral locus Anc_1.165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682782.1"
                     /db_xref="GeneID:11504708"
                     /db_xref="GOA:G8ZYU6"
                     /db_xref="InterPro:IPR013970"
                     /db_xref="UniProtKB/TrEMBL:G8ZYU6"
                     /translation="MASETPRIDPREIAQNLHPVFRLIAQVKSHPSENTLVLSSPTDG
                     GEMITLTNVRVSMNKQFESGSWHEFVCRSSDSGDTEFLVLDAVPCVLKENEQISIEGI
                     VTLQQLSKKFPEIY"
     gene            <402073..>403788
                     /gene="TDEL0G02050"
                     /locus_tag="TDEL_0G02050"
                     /db_xref="GeneID:11504709"
     mRNA            <402073..>403788
                     /gene="TDEL0G02050"
                     /locus_tag="TDEL_0G02050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682735.1"
                     /db_xref="GeneID:11504709"
     CDS             402073..403788
                     /gene="TDEL0G02050"
                     /locus_tag="TDEL_0G02050"
                     /inference="similar to DNA sequence:INSDC:YJL172W"
                     /note="similar to Saccharomyces cerevisiae CPS1 (YJL172W);
                     ancestral locus Anc_1.166"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682783.1"
                     /db_xref="GeneID:11504709"
                     /db_xref="GOA:G8ZYU7"
                     /db_xref="InterPro:IPR001261"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017141"
                     /db_xref="UniProtKB/TrEMBL:G8ZYU7"
                     /translation="MAIRLEDKSLESGRKCSGLKRHWKLLAALGSVLALGTILTGETS
                     TNSLAEKSSRCGKVEPLVPNFNRSLDLILHDPEFKKFSIEKLSKAIQIPTEIKDVNPQ
                     PADDPEYYAEFYKFHGFLEKTFPLVHKNLKVEKVNELGLLYTWQGSEEDLKPVLFMAH
                     QDVVPVNRVTWDSWEYPPFSGHYDEETDIIWGRGSNDCKNLLIAELEAIEQLLDDDYK
                     PKRTILLSFGFDEESSGLLGAQTLAPFIEKRYGKDSIFSIIDEGFGIAPVDKGVYVAS
                     PINAEKGYVDVIVTVNGKGGHSSVPPEHTTIGVAADLVTVLEDHPFDPDFQIDNPIFS
                     LLTCAAEHSNKVPRHLRNHIIKAPKSKLSSKLLQKALMKDSRFRDLIRTTRAVDIFNG
                     GIKANALPEVTSFLINHRVEIHSSVEATVDQDLQYAEQIAKKYGYGLHHNGEFIIPAT
                     ELGYIDIKVVKSLEPAPVSPSSGPVWEILAGTIQNVFENGVFVNQDDAELYVSTALMS
                     GNTDTRYYWNLTKNIYRFTASIADGTVLKTIHSVNEHVNADSHLSAIAFIYNYIVNVD
                     EYAKQ"
     gene            complement(<403884..>405287)
                     /gene="TDEL0G02060"
                     /locus_tag="TDEL_0G02060"
                     /db_xref="GeneID:11504710"
     mRNA            complement(<403884..>405287)
                     /gene="TDEL0G02060"
                     /locus_tag="TDEL_0G02060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682736.1"
                     /db_xref="GeneID:11504710"
     CDS             complement(403884..405287)
                     /gene="TDEL0G02060"
                     /locus_tag="TDEL_0G02060"
                     /inference="similar to DNA sequence:INSDC:YKL178C"
                     /note="similar to Saccharomyces cerevisiae STE3 (YKL178C);
                     ancestral locus Anc_1.167"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682784.1"
                     /db_xref="GeneID:11504710"
                     /db_xref="GOA:G8ZYU8"
                     /db_xref="InterPro:IPR001499"
                     /db_xref="UniProtKB/TrEMBL:G8ZYU8"
                     /translation="MSYQSTILGLFSIAVLLLIPPMAWHTQSKNVPAMILIIWLLVMD
                     ISFIVSAAIWSGDDFMTRWDGKGWCDIVTKLQVGASVGISCAVSSIAYNLHAVLKADS
                     VLLEATSCRKICRDLAMCLVPPVVVMGLSYFAQTYRFGIARYNGCINLMSPTWATTVF
                     YTMWPFLASLVGAVYASMVLFIFFKKRKDVGDILHCTNSRLNLTRFARLLIFCSVVIL
                     IMLPLSIYGVVGDVKHYNGHYSFKETHLKALWNIIPKYDAGKTLATLWLYLAMSYLVF
                     FIFGLGADALHMYANFLRYIKLGFIVDFINNSIQKNKEGKINKLLGKISTSEFSSDSS
                     GEKTSGYYTSTTPQSKANFVLDYKTPYDTKRNERRRERKLFGRSKVRNLYTPEEENTD
                     VVNTFMPFFSEQTVDEDSVSLDGLSQLSLSKTNGLQCDLERNDGLAEYNPHTFETQSS
                     LDDSKTDTYTLSPISNR"
     gene            complement(<405683..>406870)
                     /gene="TDEL0G02070"
                     /locus_tag="TDEL_0G02070"
                     /db_xref="GeneID:11504711"
     mRNA            complement(<405683..>406870)
                     /gene="TDEL0G02070"
                     /locus_tag="TDEL_0G02070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682737.1"
                     /db_xref="GeneID:11504711"
     CDS             complement(405683..406870)
                     /gene="TDEL0G02070"
                     /locus_tag="TDEL_0G02070"
                     /inference="similar to DNA sequence:INSDC:YJL171C"
                     /note="similar to Saccharomyces cerevisiae YJL171C;
                     ancestral locus Anc_1.168"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682785.1"
                     /db_xref="GeneID:11504711"
                     /db_xref="InterPro:IPR018805"
                     /db_xref="InterPro:IPR018807"
                     /db_xref="UniProtKB/TrEMBL:G8ZYU9"
                     /translation="MLVPVCLVSIVSALLQVANAEVQAYDKIDFSNVGFAGTFTPVKK
                     FSKIDSDDCSCEVADKQWFSGTNAPVSDYLSVHFRGPLKLNQFAFYDSPSFVISDSDS
                     SSDWTRRAYYNSTSQTGENVTFLTGAGDDSKCLGKALTYADSDGTSKASSATLLKDDN
                     EITSDQEFVIFSNVSCPKSGLNKDCGVYRSGIPAYYGFGGVTKMFLFDFEMPRESQAN
                     SSSFSYYDMPAIWLLNDHIPRTSQYPTNANCSCWASGCGEFDIFEVMNGTERDHFYST
                     FHTFQGIEILGTGIQSYGYIPRDTESSMKGGVIFDSAGNVVTFLSNSTTFDSSLTHSD
                     IDTIFSKISTDETYSSALMTISATAPSTSAKSSGFSISTKTNGLWYYLFTLFTALTQV
                     FMI"
     gene            complement(<407217..>407828)
                     /gene="TDEL0G02080"
                     /locus_tag="TDEL_0G02080"
                     /db_xref="GeneID:11504712"
     mRNA            complement(<407217..>407828)
                     /gene="TDEL0G02080"
                     /locus_tag="TDEL_0G02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682738.1"
                     /db_xref="GeneID:11504712"
     CDS             complement(407217..407828)
                     /gene="TDEL0G02080"
                     /locus_tag="TDEL_0G02080"
                     /inference="similar to DNA sequence:INSDC:YJL170C"
                     /note="similar to Saccharomyces cerevisiae ASG7 (YJL170C);
                     ancestral locus Anc_1.169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682786.1"
                     /db_xref="GeneID:11504712"
                     /db_xref="UniProtKB/TrEMBL:G8ZYV0"
                     /translation="MFSTASTNIQKMLGDRHNLAKNDHNNQRMMAPSLEDENNYYICE
                     CHSCNIGTKYRGWIPRGFFAGFFIPLLWFCNLVIYLYTQWHLNHEPTHAQIALEELPS
                     NHEFQSRINASNITLDKSTIEEIDRVNEKTTVLDDPKDHKDCPKYNLQDYRNQFLRQV
                     ASDIIESHGVKRDHYKKWTQWSLLGIVTYSVTTVLAVIAYKPR"
     gene            complement(<408090..>410153)
                     /gene="TDEL0G02090"
                     /locus_tag="TDEL_0G02090"
                     /db_xref="GeneID:11504713"
     mRNA            complement(<408090..>410153)
                     /gene="TDEL0G02090"
                     /locus_tag="TDEL_0G02090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682739.1"
                     /db_xref="GeneID:11504713"
     CDS             complement(408090..410153)
                     /gene="TDEL0G02090"
                     /locus_tag="TDEL_0G02090"
                     /inference="similar to DNA sequence:INSDC:YJL168C"
                     /note="similar to Saccharomyces cerevisiae SET2 (YJL168C);
                     ancestral locus Anc_1.170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682787.1"
                     /db_xref="GeneID:11504713"
                     /db_xref="GOA:G8ZYV1"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR003616"
                     /db_xref="InterPro:IPR006560"
                     /db_xref="InterPro:IPR013257"
                     /db_xref="InterPro:IPR025788"
                     /db_xref="UniProtKB/TrEMBL:G8ZYV1"
                     /translation="MTSRSISPPKSVPPEPARKIFDTFEDKTEEALASFVSLNECLYA
                     SKRLGSAKNNEFMECDCFEDFSEGVNRACDEDSDCINRLTLIECVNGLCGSCGDDCQN
                     QRFQKRQYADIAVFQTEMKGYGVRAETDIEAHQFIYEYMGEVIEEEEFRERLVEYDQK
                     KLKHFYFMMLQNGEFIDATMKGSLARFCNHSCNPNAYVNKWVVAGKLKMGIFANRKIL
                     KGEEITFDYNVDRYGATAQKCYCDEPNCIGFLGGKTQTDAASLLPQNIADALGVSSAM
                     EKKWIKMKKSQGLKIEKAVDNNFNIEFVESVQPAGCESPHDVTKVMSVLLQVDDQLIA
                     QKLFNRLYEIQDETLHHQVIKLHGYTCMLKLLKMFEGDLEVEKRIVDFLIALPKTTKN
                     GITSSQIDKEILRLQDKQKPLAEECEKLLAKWNDFETYKRIDKKDIKEASNRKVDLRR
                     IRLPPGWEVVHENGKPMYYNAQKKTKLHTPPTGSSKTFNEKPYSKWDGPTRRNGVNGT
                     KRPRLDDEEYERHKQKRMDMEKEAIEKVKEEELRALKDKLEMENQKKNDLMKIIEEAN
                     RQRELEREESRKAEKEKEDRKLKKKKQSQTNHVEHKWNKFFASLVPNLLRKYEHDKQI
                     SHDSAKQCARDIVKILTSKELKKDVTRSPPDEPTKEKRAKVKQFTQSYMEKILQKKKS
                     RSHKH"
     gene            complement(<410340..>412652)
                     /gene="TDEL0G02100"
                     /locus_tag="TDEL_0G02100"
                     /db_xref="GeneID:11504714"
     mRNA            complement(<410340..>412652)
                     /gene="TDEL0G02100"
                     /locus_tag="TDEL_0G02100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682740.1"
                     /db_xref="GeneID:11504714"
     CDS             complement(410340..412652)
                     /gene="TDEL0G02100"
                     /locus_tag="TDEL_0G02100"
                     /inference="similar to DNA sequence:INSDC:YKL176C"
                     /note="similar to Saccharomyces cerevisiae LST4 (YKL176C);
                     ancestral locus Anc_1.171"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682788.1"
                     /db_xref="GeneID:11504714"
                     /db_xref="UniProtKB/TrEMBL:G8ZYV2"
                     /translation="MLGDLLRRASPYNGVHSKPASLIGDVYSSPAHSNTTITGENDIP
                     VKVPAFLTYDEEFGSSLPCPTTSPPMLDHVSDALRYKLFASKSVPYSLPFQSTVLSSY
                     AFRVLVAEETGHMMHRNHYNVVFDYSTAKSPSMDQIRPNELKEYIFGSPVRSSDSSQG
                     NKFRTIPNSELVMVTRTFFFEARTNNRLAVSLCVPHILLPVISEIWPNISRWFDQCQE
                     ITLSMLRANLLSRHGHRLSCEGYLPQNLKSVFPTECDSIVTLLRNNLIPCFRSTSEIP
                     RLFLCPESSYFFVETWFKDVFNWMEIKDGPRLKFLPALLAKIICDFQDPTAAKETTRI
                     VTMSGNMVVANKLIFIISGLLKPRFKGSIEIESRTELSDDCSDNHKKHSIKKETGSHE
                     KSSVDLSKYLSTKNAWEIPRDHSLGSKVSLSSDESLAYVIQPSSLKSVSNSVQCLSSS
                     LSSQHGSSYGSWFNKRGNGSQATLNSPSVKTDNWDNLSTTNGNVPGVMPKTASNSSLH
                     QIYLRGSGITPGPSPSISELEEYPWFGTGSSPRLENNQPLHPVGKHSLSGVPLGELNI
                     KRDCQRLCQDDLLDSAFERICKPDKHDLDGKEFEIIPGDSRHAAYLQLDVDYESAHKE
                     RPTELLPKYTTYLAHFNHWFHLQAFPVAPDSESQVVLAMRRDLQARNNTRSLLISLRS
                     REIKELSIMRNESAPTGRSHHGIVQKTKKIFNNGKCGNVSTRLLNCISFVSESIRRAM
                     LLHEDTEIAPQQRNEEMMMIFQSLLYYSTS"
     gene            <413626..>415119
                     /gene="TDEL0G02110"
                     /locus_tag="TDEL_0G02110"
                     /db_xref="GeneID:11504715"
     mRNA            <413626..>415119
                     /gene="TDEL0G02110"
                     /locus_tag="TDEL_0G02110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682741.1"
                     /db_xref="GeneID:11504715"
     CDS             413626..415119
                     /gene="TDEL0G02110"
                     /locus_tag="TDEL_0G02110"
                     /inference="similar to DNA sequence:INSDC:YKL175W"
                     /note="similar to Saccharomyces cerevisiae ZRT3 (YKL175W);
                     ancestral locus Anc_1.172"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682789.1"
                     /db_xref="GeneID:11504715"
                     /db_xref="GOA:G8ZYV3"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="UniProtKB/TrEMBL:G8ZYV3"
                     /translation="MSEQDELPRWLLYSLISSLLCVCGALCVPLISYAFRNSANTKLV
                     NYGLSLSAGSMMTTALYKMLPPSDPDEDNGPTIFFGVLIGMCLSLFLNYLLHARASES
                     LVHCAHDSEPHQESQRHSSHTHQAADEDQGPVVLDPHPDSEHIAEQTAAALDVVGEQT
                     ALLRGSKSKEHLLKSKQTLLDLLSTVDNAQMGDCCDLTACVPMTKGESFTCIAPKMKL
                     RKSTTSMANSNNSQREPLDQVANVDSQGLACLEHEIGYDFENLPVYRENFHSHRRHSH
                     HSHDPISADNYISDDHDSIESSINNDSIAHAKSHHHHHHHLETPFSKLLSIGLQTCIV
                     ITLHKFPEGFIIYYTNQSSEVSKALGFSIFLSLSIHNFVEGFSMTLPFYAAFENKFLA
                     LLITSVLGGCSQPLGALIGYLIFKDRKGDNSSKPHMDAYLSITAGFLLVIGLQMFQTG
                     IGFSQGHHHHEGEGDKEIKENHTSVNTCLKWCCIGVLLILASGLFKS"
     gene            complement(<415216..>416997)
                     /gene="TDEL0G02120"
                     /locus_tag="TDEL_0G02120"
                     /db_xref="GeneID:11504716"
     mRNA            complement(<415216..>416997)
                     /gene="TDEL0G02120"
                     /locus_tag="TDEL_0G02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682742.1"
                     /db_xref="GeneID:11504716"
     CDS             complement(415216..416997)
                     /gene="TDEL0G02120"
                     /locus_tag="TDEL_0G02120"
                     /inference="similar to DNA sequence:INSDC:YKL174C"
                     /note="similar to Saccharomyces cerevisiae TPO5 (YKL174C);
                     ancestral locus Anc_1.173"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682790.1"
                     /db_xref="GeneID:11504716"
                     /db_xref="GOA:G8ZYV4"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:G8ZYV4"
                     /translation="MAHEYRLLPDGFRQNIAHLAPNEILDNLHTIIHENSTDVPEVVE
                     HFEYEQQLDKSLLSRSSVVGLGFGLMSPVLGMCTSMGIGLVNGGPFTIMFGFPICGFF
                     SFLCASSLGEVVSKYPIELHGASAMIAPKSIKPMCSWFTGWLMLLGNWFMSIGVTFAG
                     AQLIISLVNIGDRDVIADGRLGIYTVLVYYGVVTVVGVVNLKYARYVEAINKVCIYWI
                     IYAVLFIDVLLLLFHRQKFRSLPYALFHFDNTLSGYSSAFLSFIIGFQQSNFTLQGFS
                     MLPALADEVQVPEKDIPRGMSSAVLISTLIGMIFLLPIMLILPDVDGLFENTKVLPIV
                     DVFTHSTNSKFVSVFLILLILGNLFFSGIGSITTSSRAVYSFSRDCAIPNHQLWTYVD
                     PTSESKVPKYSILLSMGVSYILGLLPLFSTAAFNAFIGCAVLCLCSATLIPLVLVLLT
                     RRRILRDAPVKIKYKLGWIANVGSVIWLPLSMVSVCMPPQIPVTPKTMNYALVVFIAC
                     FAGIIVLYFKWGKYNFKLPLVDKQIEDTSTMFELDNRTFPQKSQLLLSTDTNKSEPQS
                     PSGPFDDSCREDKQEEYDLGDVKKVDF"
     gene            <417378..>420275
                     /gene="TDEL0G02130"
                     /locus_tag="TDEL_0G02130"
                     /db_xref="GeneID:11504717"
     mRNA            <417378..>420275
                     /gene="TDEL0G02130"
                     /locus_tag="TDEL_0G02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682743.1"
                     /db_xref="GeneID:11504717"
     CDS             417378..420275
                     /gene="TDEL0G02130"
                     /locus_tag="TDEL_0G02130"
                     /inference="similar to DNA sequence:INSDC:YKL173W"
                     /note="similar to Saccharomyces cerevisiae SNU114
                     (YKL173W); ancestral locus Anc_1.174"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682791.1"
                     /db_xref="GeneID:11504717"
                     /db_xref="GOA:G8ZYV5"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZYV5"
                     /translation="MSDDELYDEFGNFLGGESVKREDEEGLVLHAARSEQVGENLEEL
                     PSVSTSLIKTDLQSAYGDEVEVLVETQDTQAVDEPLVEVQADHTKAPGDSIFIQLKKN
                     VPTTVYDRDYMLGLLKIPERIRNVAVIGPFNSGKTSLVDLFVIESHKNLPHLTTNIRE
                     GWKQLRYMDSTRIEVERGVSMKLNGITFLSTDLEDKSFAINLVDAPGHVNFIDQVAVA
                     LAASDCAIICIDVVEGVTSPVENLIKQCQKSSVEPLFVLNKIDRLILELKLPPADAYL
                     KIKQVIEQINSFARGRYSPELNNIIFASAKLGFTFTIEQFVQYQYSGKLPLSQLNEFS
                     KRLWGDFSFKNGKLERSASSSTAMSSSFVQFILLPIYKLFTHTLSSERDALNETLLQN
                     FSVQLDPELLNSDPLPLLKRVLSTVFRDQSGLVQSLSRCGDSSIASQRKHMSLTNIRL
                     DDPTGPLVAHAVQTIDYGGTEWSLVRIYSGKIVSGALIRVVDANDAQTDTTDASDNQQ
                     GNVVDYPQATVKEIALLGGRYVFPVTQATSGQLVLVKGLSESYIKSATLAMDSFPRIP
                     FLAPLDYITEPVFRVVIEPLQPKELPKLLNGLNKISRFYPGVVVKVEESGEHVILGFG
                     ELYLDSLLYDLRSNYAGMEIKLSSPLTVFSESCDGESFAAIPATTGDGSLSICISAEP
                     MDENLLKDLMKGKIENSIIEDHKALAKLLRSEYGWDSLAARNVWSFQGNNVLIDDTLP
                     DETDKDLLNAFKQQIKQGFGWAIREGPLAEEPIHGVQFKLLNAEGFQGLGIGGQLIPI
                     VKKACSIAIMTASPILLEPIFEVDIIFQSVLLPIIEELFKKRRGGRIYRCDKIVATPL
                     SEVRAQIPVIESVGFETDLRLATRGGAMCQLHFWNKIWRKVPGDVMDKDAPIPKLKPA
                     PINSLSRDFVMKTRRRKGISNDGFMSNDGPTLEKYIDSETYKQLKDNGLVQ"
     gene            complement(<420388..>421566)
                     /gene="TDEL0G02140"
                     /locus_tag="TDEL_0G02140"
                     /db_xref="GeneID:11504718"
     mRNA            complement(<420388..>421566)
                     /gene="TDEL0G02140"
                     /locus_tag="TDEL_0G02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682744.1"
                     /db_xref="GeneID:11504718"
     CDS             complement(420388..421566)
                     /gene="TDEL0G02140"
                     /locus_tag="TDEL_0G02140"
                     /inference="similar to DNA sequence:INSDC:YNL035C"
                     /note="similar to Saccharomyces cerevisiae YNL035C;
                     ancestral locus Anc_2.283"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682792.1"
                     /db_xref="GeneID:11504718"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZYV6"
                     /translation="MASYSNLHTQDFGSDNWCLGLQPFYNHHLLTSLSNGEVHHIDWV
                     TGKSVRVDQAGNSSINKLKIIDSNFNEGSSYAVASNDSVNILDVRSRDKLASLKNDKN
                     APFLSLDSRHGMLACGTELSGVDAELHIYDVRNWSTPIRSFVDSHHDDVTDIRFHPSD
                     RNVLLSGSTDGYTNVYDLKQQEEDDALHQVINYASIHSCGWLSPKRIFTLSHMETLAM
                     HELNDKSDELREPQPLDFGDIREKWGCSYVVDLYPGYVAVGSSQERSSFLKLMALENE
                     QIETEKSLVIPSAHGEEVVRDVLIPPQNCNMLYSCGEDGTVKIWKTKDTGFHIEPGFW
                     DYSKKMDVFSEEATTPEAIPAALGNGVVYEQEVEPPKKKEKKKGKQKSHAKSRRYKPY
                     "
     gene            complement(421896..421969)
                     /gene="TDEL0Gtrna5I"
                     /locus_tag="TDEL_0Gtrna5I"
                     /db_xref="GeneID:11504719"
     tRNA            complement(421896..421969)
                     /gene="TDEL0Gtrna5I"
                     /locus_tag="TDEL_0Gtrna5I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:11504719"
     gene            <422718..>424703
                     /gene="TDEL0G02150"
                     /locus_tag="TDEL_0G02150"
                     /db_xref="GeneID:11505328"
     mRNA            <422718..>424703
                     /gene="TDEL0G02150"
                     /locus_tag="TDEL_0G02150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682745.1"
                     /db_xref="GeneID:11505328"
     CDS             422718..424703
                     /gene="TDEL0G02150"
                     /locus_tag="TDEL_0G02150"
                     /inference="similar to DNA sequence:INSDC:YIL095W,YNL020C"
                     /note="similar to Saccharomyces cerevisiae PRK1 (YIL095W)
                     and ARK1 (YNL020C); ancestral locus Anc_2.284"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682793.1"
                     /db_xref="GeneID:11505328"
                     /db_xref="GOA:G8ZYV7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8ZYV7"
                     /translation="MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPA
                     DAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGS
                     YEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDI
                     KIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLY
                     RGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIR
                     RMLMENPDQRPNVCQVLEDVSRMQGIQCPVRNFYLLRAMEQQQQSTQNQLRYSRTQPV
                     LNVPIISQPVGFPMHQISGAPLGSSTSHIVPSNSVPILAARPRSAGSNGTGRSFQTPS
                     TSSLSAKSSQTFHRAASRSPVSTHLSTSPVRHGRGNISQIVESNRTSFDRPRYVDSVT
                     QTSDTEEEPLKVASKSSVSLPARESHAVADKSSVVRSSSLRSKSTSSERPAVAPKQQV
                     AVPHTKLEHIYAAKIPTGRQSLRQESEIEIPLTSVRSREAKESIQRRVRDLLNSSEDL
                     PLSKSEPKKDEPKRGQLSKTHHDEKPSVKEKSKQKVRPRAPPKPAHLRPKPPPKPAFL
                     SGKKMVDTEPSEAGKAVIDAKVESLERDLRKEVTGTL"
     gene            complement(<424838..>426982)
                     /gene="TDEL0G02160"
                     /locus_tag="TDEL_0G02160"
                     /db_xref="GeneID:11504720"
     mRNA            complement(<424838..>426982)
                     /gene="TDEL0G02160"
                     /locus_tag="TDEL_0G02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682746.1"
                     /db_xref="GeneID:11504720"
     CDS             complement(424838..426982)
                     /gene="TDEL0G02160"
                     /locus_tag="TDEL_0G02160"
                     /inference="similar to DNA sequence:INSDC:YNL021W"
                     /note="similar to Saccharomyces cerevisiae HDA1 (YNL021W);
                     ancestral locus Anc_2.285"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682794.1"
                     /db_xref="GeneID:11504720"
                     /db_xref="GOA:G8ZYV8"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR017321"
                     /db_xref="InterPro:IPR019154"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:G8ZYV8"
                     /translation="MTISMDCDIVKPENDTTLQVKRKMEEQNDGLDPKKSQLARTQNG
                     AAGKRVIVPACAPNLHYTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVY
                     KILAENGLINDPTLSGIDEIGDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKRE
                     ELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPE
                     APGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLH
                     RFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREF
                     QPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGNLCVALEGGYNLDAIA
                     ISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYWKCFQRKFGNAGCNF
                     SEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLEIPDDSVLCSPEVFQQS
                     TIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYGVIDVNIPQSLF
                     EQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLGHRDTRATVK
                     AVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWADNESKKPRKKFGRVLR
                     CDTDGLNSNMEERFEEATDFILDLFEEWSDSE"
     gene            <427274..>428728
                     /gene="TDEL0G02170"
                     /locus_tag="TDEL_0G02170"
                     /db_xref="GeneID:11504721"
     mRNA            <427274..>428728
                     /gene="TDEL0G02170"
                     /locus_tag="TDEL_0G02170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682747.1"
                     /db_xref="GeneID:11504721"
     CDS             427274..428728
                     /gene="TDEL0G02170"
                     /locus_tag="TDEL_0G02170"
                     /inference="similar to DNA sequence:INSDC:YNL022C"
                     /note="similar to Saccharomyces cerevisiae YNL022C;
                     ancestral locus Anc_2.286"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682795.1"
                     /db_xref="GeneID:11504721"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZYV9"
                     /translation="MNFYRDATWVLEYVEQEDEKGRLSGSMQTLVLKSCQRYKLKSDP
                     KHLYAVVDSCWRYKALLEKIMKRSKIYDDIPKKKGKPIYSRLTLLLMCHDLLISKQKR
                     IQMGKLPIKEYVLKHKTRLNSELVKLKLKLKVKSLSEIVDKEDSSNDVTPVRWIRINP
                     LRCPKNDVEPVLKELIKKFPQRVSHWSDITSGTLYYDEFVPNLFGVHPRDKITSHELY
                     RQGKIIIQDRSSCFPAHILNPGKNDVVIDACAAPGNKTTHVAAHILPEYTREQTPKIY
                     AFEKDPARANILKKMTSVAGCGQTVEIHVGDFTKLAVPANFKDVTGLIVDPSCSGSGI
                     FGRKSVDSHNVAKKKTETDSEIPDEEEKMVGDDVANRLSKLASFQFQVVKHAMSMPNA
                     KKIVYSTCSIHAEENERVVIDLLLDRNIKEWGWKVASREEVIPKWPRRGKVKEFEQVF
                     RDDPVKCNELADGCIRALPQEDGGIGFFAVCFKR"
     gene            complement(<428789..>429898)
                     /gene="TDEL0G02180"
                     /locus_tag="TDEL_0G02180"
                     /db_xref="GeneID:11504722"
     mRNA            complement(<428789..>429898)
                     /gene="TDEL0G02180"
                     /locus_tag="TDEL_0G02180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682748.1"
                     /db_xref="GeneID:11504722"
     CDS             complement(428789..429898)
                     /gene="TDEL0G02180"
                     /locus_tag="TDEL_0G02180"
                     /inference="similar to DNA sequence:INSDC:YIL094C"
                     /note="similar to Saccharomyces cerevisiae LYS12
                     (YIL094C); ancestral locus Anc_2.287"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682796.1"
                     /db_xref="GeneID:11504722"
                     /db_xref="GOA:G8ZYW0"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:G8ZYW0"
                     /translation="MLRSAIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVL
                     ENLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVE
                     GYSSPIVALRKELGLYANVRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKAT
                     GTRVAEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREI
                     CKDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVG
                     SLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDI
                     YRAVDANLREDKVKTPDLGGNSTTQQVVEDILSKL"
     gene            <430157..>432967
                     /gene="TDEL0G02190"
                     /locus_tag="TDEL_0G02190"
                     /db_xref="GeneID:11504723"
     mRNA            <430157..>432967
                     /gene="TDEL0G02190"
                     /locus_tag="TDEL_0G02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682749.1"
                     /db_xref="GeneID:11504723"
     CDS             430157..432967
                     /gene="TDEL0G02190"
                     /locus_tag="TDEL_0G02190"
                     /inference="similar to DNA sequence:INSDC:YNL023C"
                     /note="similar to Saccharomyces cerevisiae FAP1 (YNL023C);
                     ancestral locus Anc_2.288"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682797.1"
                     /db_xref="GeneID:11504723"
                     /db_xref="GOA:G8ZYW1"
                     /db_xref="InterPro:IPR000967"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="UniProtKB/TrEMBL:G8ZYW1"
                     /translation="MVVEELNQHSLVLEFSEDDSDFSSESCSVHEVRDEHDMAYYERA
                     VQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTEKTLDRVWKC
                     PNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQCHLGPH
                     PDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCERLCHSG
                     ICGPCPAVLNAKSNKLKIRCYCGLEHRDSFKCKDVRVASDLSKDGKGDSWIGAFGCSG
                     IRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCTS
                     PIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQP
                     RCDTKCESLMSCRRHRCTERCCCGRPFAERRRKTPLSSRELMDESSVESEHICLKDCN
                     LTLSCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIR
                     VIQNAYKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTC
                     GKPLDNCPHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLS
                     VKIKCECEVKESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDN
                     PSRSKTASLENLAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKT
                     SLHFKPMRPAQRHFIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSL
                     PIYQFFKENEKEKKAQRFEAQTTTEFVNFIPKEEPQLERAKNNAFKLKNVSTGTTKED
                     LERIFADHLKPTLVKNPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCK
                     ESFIGDGIELCHIDLKVLQESE"
     gene            complement(<433032..>433817)
                     /gene="TDEL0G02200"
                     /locus_tag="TDEL_0G02200"
                     /db_xref="GeneID:11504724"
     mRNA            complement(<433032..>433817)
                     /gene="TDEL0G02200"
                     /locus_tag="TDEL_0G02200"
                     /product="mitochondrial 37S ribosomal protein RSM25"
                     /transcript_id="XM_003682750.1"
                     /db_xref="GeneID:11504724"
     CDS             complement(433032..433817)
                     /gene="TDEL0G02200"
                     /locus_tag="TDEL_0G02200"
                     /inference="similar to DNA sequence:INSDC:YIL093C"
                     /note="similar to Saccharomyces cerevisiae RSM25
                     (YIL093C); ancestral locus Anc_2.290"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM25"
                     /protein_id="XP_003682798.1"
                     /db_xref="GeneID:11504724"
                     /db_xref="GOA:G8ZYW2"
                     /db_xref="InterPro:IPR016939"
                     /db_xref="InterPro:IPR019520"
                     /db_xref="UniProtKB/TrEMBL:G8ZYW2"
                     /translation="MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTR
                     EPRLINPSNMKKLAHLKDHADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQL
                     REVFYKQHPWELSRPKVLVENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGK
                     SLTEAYDQARFEFYRLRMQQEVEQQVAQEESEMFGSIYGPSAIDFGVQQEQKFIDIWK
                     QKAIEETDLLAARRANPSEAWAAGEEQPDKKDLEDQDIEEIVL"
     gene            <434303..>434521
                     /gene="TDEL0G02210"
                     /locus_tag="TDEL_0G02210"
                     /db_xref="GeneID:11504725"
     mRNA            <434303..>434521
                     /gene="TDEL0G02210"
                     /locus_tag="TDEL_0G02210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682751.1"
                     /db_xref="GeneID:11504725"
     CDS             434303..434521
                     /gene="TDEL0G02210"
                     /locus_tag="TDEL_0G02210"
                     /inference="similar to DNA sequence:INSDC:YNL024C-A"
                     /note="similar to Saccharomyces cerevisiae YNL024C-A;
                     ancestral locus Anc_2.291"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682799.1"
                     /db_xref="GeneID:11504725"
                     /db_xref="InterPro:IPR009653"
                     /db_xref="UniProtKB/TrEMBL:G8ZYW3"
                     /translation="MSALFNFKSLLQVILLLLCSCTYVHAQWPSLLDRYKDHGVFGAF
                     WKMARVGERASPYVSVACILMAINQFNS"
     gene            complement(<434650..>436782)
                     /gene="TDEL0G02220"
                     /locus_tag="TDEL_0G02220"
                     /db_xref="GeneID:11504726"
     mRNA            complement(<434650..>436782)
                     /gene="TDEL0G02220"
                     /locus_tag="TDEL_0G02220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682752.1"
                     /db_xref="GeneID:11504726"
     CDS             complement(434650..436782)
                     /gene="TDEL0G02220"
                     /locus_tag="TDEL_0G02220"
                     /inference="similar to DNA sequence:INSDC:YIL091C"
                     /note="similar to Saccharomyces cerevisiae YIL091C;
                     ancestral locus Anc_2.292"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682800.1"
                     /db_xref="GeneID:11504726"
                     /db_xref="GOA:G8ZYW4"
                     /db_xref="InterPro:IPR010678"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZYW4"
                     /translation="MVKDKSNGDEARRNGTLKRGRKELRSIRRPQRNKAHEEPEHLNE
                     SSEGEVKNHHNGMQHNEEIANVEEDEENKRRKVYGALLTILNSEHPKPKPKQEVTVQS
                     RKEDSESDVEEDERDEVEQLEDNLARVDENPSEDDLSEDADEESDDEQDTFDSHFNQV
                     PENVVDKLDAAFKERQLKYKSAKVPIGENESMVYSKPLLLEDQSKKLEIPSRHESLKS
                     YVFKQRLKIQNDLEHENLTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVL
                     NHVYKTRDKILKNNQRISDNPDADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGI
                     DQIDKKGKFRDQFFEESLPPSSKPKSFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQ
                     SDIIICSPLGIQLILENTDKKKRQDDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLN
                     LIPQEQHDTDFGRVRLWYINEQAKLFRQTMIFTKYVSPTANALINNKCQNMTGRWKNH
                     HFIEPNQSSIGKLGLKVRQIFQRIDLGAASILEESDFRFKFFTSVIIPSIIKSTGYED
                     GILVYIPDYADFIRVRNYMKEKTTIIFGDINEYSNQKQLNSNRALFQQGRAKVLLYTE
                     RLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIAKSAALGTTDLNISTVRTIYSKL
                     DGISLERIVGTKRAAILTHGQNEVYEFK"
     gene            <437121..>438587
                     /gene="TDEL0G02230"
                     /locus_tag="TDEL_0G02230"
                     /db_xref="GeneID:11504727"
     mRNA            <437121..>438587
                     /gene="TDEL0G02230"
                     /locus_tag="TDEL_0G02230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682753.1"
                     /db_xref="GeneID:11504727"
     CDS             437121..438587
                     /gene="TDEL0G02230"
                     /locus_tag="TDEL_0G02230"
                     /inference="similar to DNA sequence:INSDC:YIL090W"
                     /note="similar to Saccharomyces cerevisiae ICE2 (YIL090W);
                     ancestral locus Anc_2.293"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682801.1"
                     /db_xref="GeneID:11504727"
                     /db_xref="InterPro:IPR013635"
                     /db_xref="UniProtKB/TrEMBL:G8ZYW5"
                     /translation="MTTISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFT
                     VTLFNLYLITTTLSMVAQSYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTK
                     VLEDGSQPEQSLVNVLRNNVFSNHSSWMLYYYYYRYVVQPWQSVLTHSTAFFALSEGF
                     FTVLGIQAIGETNRWLLDEMNSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQ
                     TASLLGFTLSIVCGIGLFGIVSKNGSVIESSLFFAYIVRCIYEISPKLATTATDEILE
                     VIKVAWQKHQKNLSTTNNLLSYYQDVVLKNAEMVWESIVLRTKNSDATTFTAIQPLNK
                     LWHAFTPIWKFFKGFVLSVPSSIGGVFQVTLKLASESVSPAIVLNLCFRVLVFYSATR
                     IIPALQRKNTRELRKSRRIMNVLYWYSPCILIAMYTHLILQYSGELNSDLCLWGCSEK
                     WFGSGQPKIEINTWVFWNWCNIFWTVLIYGSELIGGKR"
     gene            <439498..>440493
                     /gene="TDEL0G02240"
                     /locus_tag="TDEL_0G02240"
                     /db_xref="GeneID:11504728"
     mRNA            <439498..>440493
                     /gene="TDEL0G02240"
                     /locus_tag="TDEL_0G02240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682754.1"
                     /db_xref="GeneID:11504728"
     CDS             439498..440493
                     /gene="TDEL0G02240"
                     /locus_tag="TDEL_0G02240"
                     /inference="similar to DNA sequence:INSDC:YNL025C"
                     /note="similar to Saccharomyces cerevisiae SSN8 (YNL025C);
                     ancestral locus Anc_2.294"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682802.1"
                     /db_xref="GeneID:11504728"
                     /db_xref="GOA:G8ZYW6"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015429"
                     /db_xref="InterPro:IPR023598"
                     /db_xref="UniProtKB/TrEMBL:G8ZYW6"
                     /translation="MSGSYWSSTQRYQWQYTKESLAKERQKLWLLECQLFPQGLNIVM
                     DSKQGGFDQPTTKNIPITHKDLHYDKDYNLRIYCYFLIMKLGRRLNIRQCALATAHIY
                     LSRFLLKVSIREINLYLLVTTCVYLACKVEECPQYIRTLVSEARSLWPEFVPPDPTKV
                     TEFEFYLIEELQSYLIVHHPYKSMEQIVNVLKEPPFELRLSQDELQNCWSLINDSYIN
                     DVHLMYPPHVIAVACLFITICIRGRTVKSSLSNVGNKGDNVMDTDPILTQVVKQQEIV
                     NRFVAESQVDLEEVMNTVQELITLYDHWDKYHEPWIKFLLHTLYLRTSVPNTAMS"
     gene            441110..441181
                     /gene="TDEL0Gtrna5E"
                     /locus_tag="TDEL_0Gtrna5E"
                     /db_xref="GeneID:11504729"
     tRNA            441110..441181
                     /gene="TDEL0Gtrna5E"
                     /locus_tag="TDEL_0Gtrna5E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAG"
                     /db_xref="GeneID:11504729"
     gene            complement(<441289..>442692)
                     /gene="TDEL0G02250"
                     /locus_tag="TDEL_0G02250"
                     /db_xref="GeneID:11505326"
     mRNA            complement(<441289..>442692)
                     /gene="TDEL0G02250"
                     /locus_tag="TDEL_0G02250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682755.1"
                     /db_xref="GeneID:11505326"
     CDS             complement(441289..442692)
                     /gene="TDEL0G02250"
                     /locus_tag="TDEL_0G02250"
                     /inference="similar to DNA sequence:INSDC:YIL088C"
                     /note="similar to Saccharomyces cerevisiae AVT7 (YIL088C);
                     ancestral locus Anc_2.295"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682803.1"
                     /db_xref="GeneID:11505326"
                     /db_xref="GOA:G8ZYW7"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:G8ZYW7"
                     /translation="MDPTGTPASSTVNLVKTIIGAGLLAIPFAFRNDGVVIGALLTLI
                     AAVTSGFGLFILAKCSKTLINPRNSSFFTLCMLTYPSLSPLFDLAMIVQCFGVGLSYL
                     VLIGDLFPGLFGGEPRFWILLSSLIIVPLCCLKKLDSLRYSSIIGLFALAYLSLLIVT
                     YFAHDTLLTHDYKSYRGEVCWFKVYDFKGLLSTFSIIVFAYTGSMNLFSIINELKENS
                     MANITSVINTSITISTAVFLAVGICGYLTFGSNTLGNIMLNYDPDSTWVYVGKLCLGS
                     MVMLSFPLLFHPCRIAINNLVVWSEIHFKKDPIMPSQQAQARSRPGEGSPIRLSIQDE
                     DNESLAGFDNDIESVDGDDTQVIRGNNVETTPFPNSRFYAISAILLILMYSLALKVKS
                     FAFVLALVGATGSTSISFILPGLFGYKLIGTDSLAVGQSISPRDRFYKRCSVLLVWYG
                     LSVMALSFYVTLAYGTD"
     gene            <442799..>443560
                     /gene="TDEL0G02260"
                     /locus_tag="TDEL_0G02260"
                     /db_xref="GeneID:11504809"
     mRNA            <442799..>443560
                     /gene="TDEL0G02260"
                     /locus_tag="TDEL_0G02260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682756.1"
                     /db_xref="GeneID:11504809"
     CDS             442799..443560
                     /gene="TDEL0G02260"
                     /locus_tag="TDEL_0G02260"
                     /inference="similar to DNA sequence:INSDC:YNL032W"
                     /note="similar to Saccharomyces cerevisiae SIW14
                     (YNL032W); ancestral locus Anc_2.296"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682804.1"
                     /db_xref="GeneID:11504809"
                     /db_xref="GOA:G8ZYW8"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020428"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G8ZYW8"
                     /translation="MVLGNGSHKEGVSSRIDNVIENEAEIVRLIQQDGRLRDTGNGGD
                     IHSIINEDSELREEFEEILQRFHEKQKPESTCESPLSLPMEQEVVPPENFSHVAGEIY
                     RSSFPRVENFTFLQHRLRLKSILVLIPEAYPPENEEFLKQAGIQLFQVGMSGNKEPFV
                     NIPSDLLTQALEIVLNPKNQPILIHCNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRF
                     AFPKARALDQQFIEMYDDQEIISTANSRDWLPIQW"
     gene            complement(<443569..>444027)
                     /gene="TDEL0G02270"
                     /locus_tag="TDEL_0G02270"
                     /db_xref="GeneID:11504810"
     mRNA            complement(<443569..>444027)
                     /gene="TDEL0G02270"
                     /locus_tag="TDEL_0G02270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682757.1"
                     /db_xref="GeneID:11504810"
     CDS             complement(443569..444027)
                     /gene="TDEL0G02270"
                     /locus_tag="TDEL_0G02270"
                     /inference="similar to DNA sequence:INSDC:YIL087C"
                     /note="similar to Saccharomyces cerevisiae YIL087C;
                     ancestral locus Anc_2.297"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682805.1"
                     /db_xref="GeneID:11504810"
                     /db_xref="InterPro:IPR019419"
                     /db_xref="UniProtKB/TrEMBL:G8ZYW9"
                     /translation="MENPQETTGLLDESPAWHNLYQYTMTAYPAALNSALLLATPAIS
                     PALESPQSVAGRTGLLTALQRPRYLGPSNRTALLFGAAQALGAWMIYDGDLESGSGFL
                     GAWSALYMIVGGRGSVKALRYGRVWPLLVTTLTGANAYLYGRRFITNGFT"
     gene            complement(<444169..>444579)
                     /gene="TDEL0G02280"
                     /locus_tag="TDEL_0G02280"
                     /db_xref="GeneID:11504811"
     mRNA            complement(<444169..>444579)
                     /gene="TDEL0G02280"
                     /locus_tag="TDEL_0G02280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682758.1"
                     /db_xref="GeneID:11504811"
     CDS             complement(444169..444579)
                     /gene="TDEL0G02280"
                     /locus_tag="TDEL_0G02280"
                     /inference="similar to DNA sequence:INSDC:YNL031C"
                     /note="similar to Saccharomyces cerevisiae HHT2 (YNL031C);
                     ancestral locus Anc_2.298"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682806.1"
                     /db_xref="GeneID:11504811"
                     /db_xref="GOA:G8ZTR9"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G8ZTR9"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
     gene            <444898..>445209
                     /gene="TDEL0G02290"
                     /locus_tag="TDEL_0G02290"
                     /db_xref="GeneID:11504812"
     mRNA            <444898..>445209
                     /gene="TDEL0G02290"
                     /locus_tag="TDEL_0G02290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682759.1"
                     /db_xref="GeneID:11504812"
     CDS             444898..445209
                     /gene="TDEL0G02290"
                     /locus_tag="TDEL_0G02290"
                     /inference="similar to DNA sequence:INSDC:YNL030W"
                     /note="similar to Saccharomyces cerevisiae HHF2 (YNL030W);
                     ancestral locus Anc_2.299"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682807.1"
                     /db_xref="GeneID:11504812"
                     /db_xref="GOA:G8ZYX1"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR019809"
                     /db_xref="UniProtKB/TrEMBL:G8ZYX1"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEEVRAVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            complement(<445264..>446784)
                     /gene="TDEL0G02300"
                     /locus_tag="TDEL_0G02300"
                     /db_xref="GeneID:11504813"
     mRNA            complement(<445264..>446784)
                     /gene="TDEL0G02300"
                     /locus_tag="TDEL_0G02300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682760.1"
                     /db_xref="GeneID:11504813"
     CDS             complement(445264..446784)
                     /gene="TDEL0G02300"
                     /locus_tag="TDEL_0G02300"
                     /inference="similar to DNA sequence:INSDC:YIL085C,YNL029C"
                     /note="similar to Saccharomyces cerevisiae KTR7 (YIL085C)
                     and KTR5 (YNL029C); ancestral locus Anc_2.300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682808.1"
                     /db_xref="GeneID:11504813"
                     /db_xref="GOA:G8ZYX2"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8ZYX2"
                     /translation="MLRVSIKFRRLRDRLMRCNAITLCIVLAIVTVTVVIRGLTNGDE
                     DDWFKFSNEDISAPSDSVFFEGCIDTHEYLRDDQYQKMNASFVMLTRNEELNDVIKSV
                     RSIEEHFNQWFQYPYVFLNDVPFSEEFQTRLRSESRASMEFGTLNKLDWEFPEKIRES
                     FAFQHALNDQGDRGIMYGSEESYHKMCRFYSGLFYKHPLVQKFEWYWRLEPDVEFFCD
                     ITYDPFLEMARTNKKYGFTVILPELYWTVANLFRYTRSFIRQNELKVGSLWNLFTENY
                     QILETEDSLLASRVNCDDDVEPRLSEKVAIDHMLDTGNPEDEMGLRYLIGRSKAKAPI
                     QPDKFDDQEYNLCHFWSNFEIARVDVFNNELYNSYFQYLEEQGGFWRERWGDAPVHSL
                     GLGMLLDIEDVHYFRDIGYRHSTIQHCPKNNLHGQLPYTPAEKRFSRHSWNSPSEGFE
                     TGTGCRCRCDRRKSDIEDTAFHCMDRWTELLLTDREPPINALEVEQRIKFDYLHSN"
     gene            complement(<446902..>447935)
                     /gene="TDEL0G02310"
                     /locus_tag="TDEL_0G02310"
                     /db_xref="GeneID:11504814"
     mRNA            complement(join(<446902..447845,447908..>447935))
                     /gene="TDEL0G02310"
                     /locus_tag="TDEL_0G02310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682761.1"
                     /db_xref="GeneID:11504814"
     CDS             complement(join(446902..447845,447908..447935))
                     /gene="TDEL0G02310"
                     /locus_tag="TDEL_0G02310"
                     /inference="similar to DNA sequence:INSDC:YIL084C"
                     /note="similar to Saccharomyces cerevisiae SDS3 (YIL084C);
                     ancestral locus Anc_2.301"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682809.1"
                     /db_xref="GeneID:11504814"
                     /db_xref="InterPro:IPR013907"
                     /db_xref="UniProtKB/TrEMBL:G8ZYX3"
                     /translation="MSQKQLNQELSRKDKRRHNIESKVGKIQHSFVIDKDIHYKNRLT
                     ALQTNLTTLHQGNNWSYLRKLRDLEESRDLELVRLRLFEEYRVSRSSIEFQEDIETAR
                     QEHERLVKLCKEKLYETIEQKIKQLQEDRLLMDVANAHSYAMDYNRTKYQKYTRSHTT
                     SGWESSSNELNRDSPSESATDTGTERRSLRKRAATKGANGPSRLANPIEESDFQTNSS
                     TSALPLTNGNGPSRQPTTDMRTDATSDADLFQNVSDYGDLQALLFGEKDQDKANDKKK
                     HRTSQRYTAKAAPPLQSLNPDEVTEDIAFIRQLSGQPPAPFKSRIIE"
     gene            <448079..>449302
                     /gene="TDEL0G02320"
                     /locus_tag="TDEL_0G02320"
                     /db_xref="GeneID:11504815"
     mRNA            <448079..>449302
                     /gene="TDEL0G02320"
                     /locus_tag="TDEL_0G02320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682762.1"
                     /db_xref="GeneID:11504815"
     CDS             448079..449302
                     /gene="TDEL0G02320"
                     /locus_tag="TDEL_0G02320"
                     /inference="similar to DNA sequence:INSDC:YML005W"
                     /note="similar to Saccharomyces cerevisiae TRM12
                     (YML005W); ancestral locus Anc_2.302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682810.1"
                     /db_xref="GeneID:11504815"
                     /db_xref="GOA:G8ZYX4"
                     /db_xref="InterPro:IPR003402"
                     /db_xref="InterPro:IPR026274"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZYX4"
                     /translation="MPYEILVDDPKLIKTIKNQLEADRCFVKPVYSCGDYRVLRTSIT
                     DCTDPRLEGFTTRKYELKEVAEQGIVGFTQRFLERHAVENINELLKCLPLRYTVYTPL
                     LLFNFSKQRSFKHPAWVSFFRDEGEEVKNSYFSDLLRTLFPKEVTHVAINMPIIETDV
                     MRRPFNISPLYGELISPQLHTNDRLWDHPQPSDFDGTVWCHVTQNGIKQFWAPMFTMF
                     SRGNIKEKKRVLDTFVEIQDNDVVDLYAGIGYFTLSYLKRGARNVFCFELNPWSVEAL
                     RRGLEANNFEQDRCHIYNESNEWSTQRLKEHSSKLRVRHINLGLLPSSKPGWPLALAI
                     ISLQQSLPIVTLHIHENVHINALNDNTFISQALSELKTHNGSYEYSAIHLEKIKTFAP
                     DVWHVCLDVDVHTTL"
     gene            <449585..>451105
                     /gene="TDEL0G02330"
                     /locus_tag="TDEL_0G02330"
                     /db_xref="GeneID:11504816"
     mRNA            <449585..>451105
                     /gene="TDEL0G02330"
                     /locus_tag="TDEL_0G02330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682763.1"
                     /db_xref="GeneID:11504816"
     CDS             449585..451105
                     /gene="TDEL0G02330"
                     /locus_tag="TDEL_0G02330"
                     /inference="similar to DNA sequence:INSDC:YNL027W"
                     /note="similar to Saccharomyces cerevisiae CRZ1 (YNL027W);
                     ancestral locus Anc_2.303"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682811.1"
                     /db_xref="GeneID:11504816"
                     /db_xref="GOA:G8ZYX5"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8ZYX5"
                     /translation="MSNAHGDIAANDPDKGGESHEGLGRNGRKKLEVNIPDLSSFGFE
                     MGSQDDYMKEYSQSGDGQTVFRRQLDAGNEVLFSPSSSSSQRQVVTPTLKVEHHDDDV
                     WANLMASSSVNVEELKAQSNSQQRSFLNILPTDHDAGDPYKSDLEAEYASPSYHTPGV
                     YAPDPAISPAMSYLTTGDDELDDLLSVHSGTSAQSIALPMSASGYKHVTNVDELDDLL
                     AQSSGQFDDELNEYVPASNKFQQSPSQLPPVISVQEFQEQPSTNFGGPMSSPTLDEQS
                     FQEAAQRLDATLLCPKDTDTSHEEMRNGRIARRRASHGSRASSRSSVRSRSMSPDEKA
                     RSLSEDSARLLLMADLQPNTPKEYAKSESVSPLGDGETLQNLSGNTKRRLSQKNPAMF
                     ACELCDKRFTRPYNLKSHLRTHTNERPFICSSCGKAFARQHDRKRHEDLHTGKKRYVC
                     GGHLKDGTAWGCGKKFARSDALGRHFKTESGRKCILPLYEEASREKRPLDLKDLTE"
     gene            <451314..>452798
                     /gene="TDEL0G02340"
                     /locus_tag="TDEL_0G02340"
                     /db_xref="GeneID:11504817"
     mRNA            <451314..>452798
                     /gene="TDEL0G02340"
                     /locus_tag="TDEL_0G02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682764.1"
                     /db_xref="GeneID:11504817"
     CDS             451314..452798
                     /gene="TDEL0G02340"
                     /locus_tag="TDEL_0G02340"
                     /inference="similar to DNA sequence:INSDC:YNL026W"
                     /note="similar to Saccharomyces cerevisiae SAM50
                     (YNL026W); ancestral locus Anc_2.304"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682812.1"
                     /db_xref="GeneID:11504817"
                     /db_xref="GOA:G8ZYX6"
                     /db_xref="InterPro:IPR000184"
                     /db_xref="UniProtKB/TrEMBL:G8ZYX6"
                     /translation="MEDIHESSLDERVIELSNSPSKDSQNESLPEQVEQLNYVKELFD
                     KNARSPVNVSAVLVSDCHSVRPEVLQKYMDATILQAANFKQLYEQADTLNLKLIQHGL
                     AENVSQSLDSRGSLRLPMINRHYPSLIYRSQDIPTDMSIIDIISRVNIVPIKRFTAKT
                     GTNIGNGEGDGYLQFQLRNMFGGGEQLKLDITKGTKTHSSYLLDYGQPVTPWWMLNSL
                     LIKNSRQVGNNNSIDLLIRGFRTNLRSNFQEKGAMNHELFYEAEWRTSKVSSLTASDT
                     LLFQAGDDIKCSLGHTLAIDNRDNPIAPSRGSLLKLTNELAIGQFWKGQIEVSQNNSW
                     LKDDFLGSCCTLRSGYIQNLSSSRKPINTFDKFHNGGANDIRSFHIMGLGPKDLYDSI
                     GGDAFVAYGVSFFSRLPIKRWSHSNFRLHWFFNGGKLINHNNAPFTNILEQLASEHST
                     SVGFGILLRHQVARFELNFTLPLTCHSGDALRKGFQYGIGISFL"
     gene            complement(<452889..>453980)
                     /gene="TDEL0G02350"
                     /locus_tag="TDEL_0G02350"
                     /db_xref="GeneID:11504818"
     mRNA            complement(<452889..>453980)
                     /gene="TDEL0G02350"
                     /locus_tag="TDEL_0G02350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682765.1"
                     /db_xref="GeneID:11504818"
     CDS             complement(452889..453980)
                     /gene="TDEL0G02350"
                     /locus_tag="TDEL_0G02350"
                     /inference="similar to DNA sequence:INSDC:YIL083C"
                     /note="similar to Saccharomyces cerevisiae YIL083C;
                     ancestral locus Anc_2.305"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682813.1"
                     /db_xref="GeneID:11504818"
                     /db_xref="InterPro:IPR007085"
                     /db_xref="UniProtKB/TrEMBL:G8ZYX7"
                     /translation="MTPNPSRINDDHKRHKIHSSITEISHAIDRSISEAVFPIAQTSD
                     EDRYFLTNPRPPYLDDLIHEAQAFINLQHSLKRERIVLVTSGGTTVPLENNTVRFIDN
                     FSAGTRGASSAEQFLANGYSVIFLHREFSLTPYNRSFTHNVDVNFLDYIDSNGCIKPE
                     YMQNVLEKKELYEKYTIQEKKLLLLPFTTVNQYLWSLKSIAKLLNSTGSLFYLAAAVS
                     DFFVPYSRLPQHKIQSRDYGGETPAQDCNSTTTPDGKLIVNLDPVPKFLRRLVEAWAR
                     QAMIVSFKLETDNAILIKKATQALDRYNHQLVIGNLLQTRNKEVVFVSQENRKGDWVK
                     LNDSHSVIEEMIIPEVIKYHNNWIKSQEN"
     gene            454265..454338
                     /gene="TDEL0Gtrna6I"
                     /locus_tag="TDEL_0Gtrna6I"
                     /db_xref="GeneID:11504819"
     tRNA            454265..454338
                     /gene="TDEL0Gtrna6I"
                     /locus_tag="TDEL_0Gtrna6I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:11504819"
     gene            <454633..>455841
                     /gene="TDEL0G02360"
                     /locus_tag="TDEL_0G02360"
                     /db_xref="GeneID:11505331"
     mRNA            <454633..>455841
                     /gene="TDEL0G02360"
                     /locus_tag="TDEL_0G02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682766.1"
                     /db_xref="GeneID:11505331"
     CDS             454633..455841
                     /gene="TDEL0G02360"
                     /locus_tag="TDEL_0G02360"
                     /inference="similar to DNA sequence:INSDC:YNL016W"
                     /note="similar to Saccharomyces cerevisiae PUB1 (YNL016W);
                     ancestral locus Anc_2.306"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682814.1"
                     /db_xref="GeneID:11505331"
                     /db_xref="GOA:G8ZYX8"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8ZYX8"
                     /translation="MSEQENLEQNPTVESEVPASETISEEPSVVPANAIKGGRETSDK
                     VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ
                     TLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQ
                     GHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASKRENNNNNN
                     RRNVNGPRNNGFRHNNGGFPGSRGMPMPPPNSMSLPMGVVPPPQALGNPNGPSVPPPV
                     NPQAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIK
                     YDTHEQAAVCIVALANFPFQGRNLRTGWGKERTSFVPMSQQQPPQQPQQPQQQEEAVP
                     PVDMTEENAQ"
     gene            <456393..>458636
                     /gene="TDEL0G02370"
                     /locus_tag="TDEL_0G02370"
                     /db_xref="GeneID:11504820"
     mRNA            <456393..>458636
                     /gene="TDEL0G02370"
                     /locus_tag="TDEL_0G02370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682767.1"
                     /db_xref="GeneID:11504820"
     CDS             456393..458636
                     /gene="TDEL0G02370"
                     /locus_tag="TDEL_0G02370"
                     /inference="similar to DNA sequence:INSDC:YDL122W"
                     /note="similar to Saccharomyces cerevisiae UBP1 (YDL122W);
                     ancestral locus Anc_2.307"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682815.1"
                     /db_xref="GeneID:11504820"
                     /db_xref="GOA:G8ZYX9"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G8ZYX9"
                     /translation="MSFILETLQRKIISFIIEPLNRNTNSEVPITTAIILVSTAFFFI
                     KYKSFIMNNLSHIGDMTRNFNPTNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCF
                     MNSVIQSLASSAELMKFLDDEIAKKEEIDETELLQDEEKPTSVEPDTIERKVKGKSYG
                     KAKKHANRKLANGVSDEEKTPDVTFSLALREMLNKLNTKYYKERPCFKTNKLLKSMTK
                     SPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKPSEATPIPNAELPKNAVIGQAH
                     LDKVGDVYLPSDQIDPNLVLTNEGKQLYTPFRLVTPLDGITAERIGCLQCGENGGIRY
                     SVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGVSCNRCALEAVRDHLLEQLKQY
                     ENKGDSIPEKLLQAFKARVEELNVSLSKPMVSDEDYKRLHTENMTRKCSKSKQILFLR
                     PPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNLSPWCCDVDEINLDARLPMSKKQ
                     EQVQESSEDENLGGEYYAKLHQTYEKEFEDSDEEVEQDGDRYVNRDVSEYDPLNGEID
                     SVSSYSDNEDAHHSSEEFLEEVDALGNTVTKKVAKLQSHFGDEDGVEVEIKENGAEEL
                     SSSESEGEQEDGIMPPPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYR
                     GCWWRISDETVYVVEEAEVLSTSGVFMLFYEYDYDEATGKMREDLESDLEDENQEEDE
                     KLDGEIE"
     gene            complement(<458672..>459088)
                     /gene="TDEL0G02380"
                     /locus_tag="TDEL_0G02380"
                     /db_xref="GeneID:11504821"
     mRNA            complement(<458672..>459088)
                     /gene="TDEL0G02380"
                     /locus_tag="TDEL_0G02380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682768.1"
                     /db_xref="GeneID:11504821"
     CDS             complement(458672..459088)
                     /gene="TDEL0G02380"
                     /locus_tag="TDEL_0G02380"
                     /inference="similar to DNA sequence:INSDC:YDL121C"
                     /note="similar to Saccharomyces cerevisiae YDL121C;
                     ancestral locus Anc_2.308"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682816.1"
                     /db_xref="GeneID:11504821"
                     /db_xref="UniProtKB/TrEMBL:G8ZYY0"
                     /translation="MDLYAFLVVFALVLLFVVLLPTVSGIGSFSVNKSGRKVTSTSKK
                     EKGKKPFKFELKKDADVERTETGLSTAHKTGKLEIDPRTGLKRRVIGKYDENPNNYDY
                     DLDELVNEDRIEEEKAQAQRLKQFQGSTEKAYEELV"
     gene            <459220..>459705
                     /gene="TDEL0G02390"
                     /locus_tag="TDEL_0G02390"
                     /db_xref="GeneID:11504822"
     mRNA            <459220..>459705
                     /gene="TDEL0G02390"
                     /locus_tag="TDEL_0G02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682769.1"
                     /db_xref="GeneID:11504822"
     CDS             459220..459705
                     /gene="TDEL0G02390"
                     /locus_tag="TDEL_0G02390"
                     /inference="similar to DNA sequence:INSDC:YDL120W"
                     /note="similar to Saccharomyces cerevisiae YFH1 (YDL120W);
                     ancestral locus Anc_2.309"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682817.1"
                     /db_xref="GeneID:11504822"
                     /db_xref="GOA:G8ZYY1"
                     /db_xref="InterPro:IPR002908"
                     /db_xref="InterPro:IPR017789"
                     /db_xref="InterPro:IPR020895"
                     /db_xref="UniProtKB/TrEMBL:G8ZYY1"
                     /translation="MLRRITSTILTRTVTRAVTPTICLSMPQLTLRPAIRYYSIESTD
                     GHAIPQEVLKMTAGEYHQAADTFLETLLDELEAISDDLPDVVPDVELTQGVMTLEVTP
                     VGTYVINKQPPNKQIWLSSPISGPNRFDLCKGEWVSLRDGSRLLDILNGELQQATGHS
                     L"
     gene            <460300..>460533
                     /gene="TDEL0G02400"
                     /locus_tag="TDEL_0G02400"
                     /db_xref="GeneID:11504823"
     mRNA            <460300..>460533
                     /gene="TDEL0G02400"
                     /locus_tag="TDEL_0G02400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682770.1"
                     /db_xref="GeneID:11504823"
     CDS             460300..460533
                     /gene="TDEL0G02400"
                     /locus_tag="TDEL_0G02400"
                     /inference="similar to DNA sequence:INSDC:YNL015W"
                     /note="similar to Saccharomyces cerevisiae PBI2 (YNL015W);
                     ancestral locus Anc_2.310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682818.1"
                     /db_xref="GeneID:11504823"
                     /db_xref="InterPro:IPR009020"
                     /db_xref="InterPro:IPR010259"
                     /db_xref="UniProtKB/TrEMBL:G8ZYY2"
                     /translation="MAGKSFIVTLKESAPDAQVAQFKRSINELGGAITHEFSLIKGYT
                     VKLPEELHINKLKEGFNPIIANVEEDKEVHTQN"
     gene            <460647..>463856
                     /gene="TDEL0G02410"
                     /locus_tag="TDEL_0G02410"
                     /db_xref="GeneID:11504824"
     mRNA            <460647..>463856
                     /gene="TDEL0G02410"
                     /locus_tag="TDEL_0G02410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682771.1"
                     /db_xref="GeneID:11504824"
     CDS             460647..463856
                     /gene="TDEL0G02410"
                     /locus_tag="TDEL_0G02410"
                     /inference="similar to DNA sequence:INSDC:YGL156W"
                     /note="similar to Saccharomyces cerevisiae AMS1 (YGL156W);
                     ancestral locus Anc_2.311"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682819.1"
                     /db_xref="GeneID:11504824"
                     /db_xref="GOA:G8ZYY3"
                     /db_xref="InterPro:IPR000602"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR011330"
                     /db_xref="InterPro:IPR011682"
                     /db_xref="InterPro:IPR015341"
                     /db_xref="InterPro:IPR027291"
                     /db_xref="InterPro:IPR028995"
                     /db_xref="UniProtKB/TrEMBL:G8ZYY3"
                     /translation="MFDPQFKPVQGIYEARLRQFLDEGDYKELNLPRFYDKGRLELDQ
                     DRVKVWWYQVEFEPGSSPVAPDKRPSWESVIKADREGKLKFREARKGQAFGPSWSTTW
                     FKVELKVPKEWRDSQEQLVFQWDCENEGIIIDPETLIPKTAFSGSERTEYLLPAIQDG
                     HHYFYIEAGNNGMFGCGNGSQINPPDDNRIFTLRIADLVRPDWEARALRIDFWMLGDA
                     ARELPDDSWQKHRARDLGNRVMNMFDSEDRSSVKKCRDFLRDEYFDQYNDSEKVYDKG
                     DLGVLTNVFGMGNCHIDTAWLWPFAETRRKIVRSWSSQCTLMDSYPEYQFVASQAQQF
                     KWLLQEHPSFFKDVLTPKVQQSQFFPIGGSWVENDTNIPSGESLARQFLLGQRFFLKH
                     FGLKSSIFWLPDTFGYSSQVPQICCLSGIDKFLTQKLSWNNINSFPHSTFNWAGIDGS
                     QLLTHMPPGNTYTALAHFGDVLRTAKQNKSAEFYGSGLMLYGIGDGGGGPTTEMLEKM
                     RRIRSLSNRNGNVIPKLQVGNTVDEFYEDIMQKTDRGKRLPTWSGELYFEFHRGTYTS
                     QAQTKKLMRFSEIKLHDLEWLASKASLLFPDQYEYPVNDINQLWEDVLLCQFHDVLPG
                     SCIEMVYKYEAVPMLKAVVDKCDELINDVLKVLQGNSGDKLIKKQTIAWPQSSVTDAQ
                     AAHEVTLDEKDDHFILSNGELTTRINSKTGTIQSIVDSKSGTEFLDLEHGRNKLGANQ
                     FVIFDDKPLSWQAWDTELYSVNQYKYLDKPKSVKIGEHTKDICTVEVVVVVSENCKIK
                     SNISLRTVKPNTMNESTIDIVTVVENWDATNKFLKVEFPVNVRNEFASYETQFGITKR
                     PTHYNTSWDVAKFEVCHHKFADYSEFSKGVSILNDCKYGFSTHGNLMRLSLLRSPKAP
                     DAHADMGTHEIRYSIYPHKGQLSSKTVKLGLELNFKNQYHVSSKIAKKFDDLIGIEGD
                     DNIVLSNLKRGEEDQELKSNYALQPLDKTTLIVRVYESLGGESNAALLTCLPIKKVDK
                     IDNLEMKSIESLTFKSFDKITKVPIKLKPFEIASYRLTV"
     gene            <464006..>465091
                     /gene="TDEL0G02420"
                     /locus_tag="TDEL_0G02420"
                     /db_xref="GeneID:11504825"
     mRNA            <464006..>465091
                     /gene="TDEL0G02420"
                     /locus_tag="TDEL_0G02420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682772.1"
                     /db_xref="GeneID:11504825"
     CDS             464006..465091
                     /gene="TDEL0G02420"
                     /locus_tag="TDEL_0G02420"
                     /inference="similar to DNA sequence:INSDC:YGL155W"
                     /note="similar to Saccharomyces cerevisiae CDC43
                     (YGL155W); ancestral locus Anc_2.312"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682820.1"
                     /db_xref="GeneID:11504825"
                     /db_xref="GOA:G8ZYY4"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="UniProtKB/TrEMBL:G8ZYY4"
                     /translation="MISQLDNRKHVKFLKRHLELLPSSHQEHDPNKMAIIFYSIMGLA
                     ALKIDVCKEYKANLHWLHKHYRTIRSPDSQETISGFTGSFSMLISSVNCLSLPNTLFA
                     ILTCRTLKDEEFFHEIIDPKGVASFVGRCQDPEVGSFTSTLDYKRLIPSPVDTGDLRF
                     CYIAVAILQLIGFTNEGELKEFIDVEKLIQYILAQQCADGGFGSYGEPHAGYTSCALS
                     ALSLLGKLDRLSDCFKERTISWLVSRQVSNQGCMRFQEGNDCFDSEDHGGFQGRENKF
                     ADTCYVFWCLNSLRLLTPDGCELPIQPDLAEDFLINRTQNNVIGGFSKNDQDDPDLYH
                     TCLGIAALAMLDGSFDGVLFIPKGITV"
     gene            complement(<465147..>466040)
                     /gene="TDEL0G02430"
                     /locus_tag="TDEL_0G02430"
                     /db_xref="GeneID:11504826"
     mRNA            complement(<465147..>466040)
                     /gene="TDEL0G02430"
                     /locus_tag="TDEL_0G02430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682773.1"
                     /db_xref="GeneID:11504826"
     CDS             complement(465147..466040)
                     /gene="TDEL0G02430"
                     /locus_tag="TDEL_0G02430"
                     /inference="similar to DNA sequence:INSDC:YDL119C"
                     /note="similar to Saccharomyces cerevisiae YDL119C;
                     ancestral locus Anc_2.313"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682821.1"
                     /db_xref="GeneID:11504826"
                     /db_xref="GOA:G8ZYY5"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8ZYY5"
                     /translation="MSERPTKTSSHLIGGFVGGLSSAITLQPLDLLKTRLQQSKDITL
                     WSAIKQADGIRSLWRGTLTSAIRTSIGSALYLSSLNMMRTALASNKKSGPILSKSSRL
                     PQLSMYENLLAGAVARGMVGYITMPVTVLKVRYESTLYKYTSIREATRDIYSKEGIRG
                     FFRGFGPTCMRDAPYSGLYVLLYEKSKVLIPKILPEAMIQHDSTGSFTTYTSTTINAL
                     SAISSASLATAVTAPFDTIKTRMQLEPSKFTSFSKTLLLIVKQENAMQLFSGLSMRLS
                     RKALSAGIAWGIYEELVKRFM"
     gene            complement(<466234..>467064)
                     /gene="TDEL0G02440"
                     /locus_tag="TDEL_0G02440"
                     /db_xref="GeneID:11504827"
     mRNA            complement(<466234..>467064)
                     /gene="TDEL0G02440"
                     /locus_tag="TDEL_0G02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682774.1"
                     /db_xref="GeneID:11504827"
     CDS             complement(466234..467064)
                     /gene="TDEL0G02440"
                     /locus_tag="TDEL_0G02440"
                     /inference="similar to DNA sequence:INSDC:YGL154C"
                     /note="similar to Saccharomyces cerevisiae LYS5 (YGL154C);
                     ancestral locus Anc_2.314"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682822.1"
                     /db_xref="GeneID:11504827"
                     /db_xref="GOA:G8ZYY6"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="UniProtKB/TrEMBL:G8ZYY6"
                     /translation="MEDLLSSVELNQDWEGLIVVDVDHANLSDDFTFETAMRYLSLTH
                     QVKIRQRKTEKARRIALCNRLLQLFGCSVIGDIPFEEVQFEYGSHGKPYLKNSPAISF
                     SMSNGEQYVVQFILLQKCTGRLDVGIDVAAKSDYIGHDDVEVFRDIFSEREYNHFKAC
                     GNELKPSLFAYYWSLKECYTKYTGLGLNCDLSRIDCGEVDVPVMSARLQCKMDEDSIL
                     FHSTWVEPDCEEIITVCRQDSGQVRWLQNGPRVYRISLLDILSFFEKTPKRSPKHSIE
                     "
     gene            <467216..>468241
                     /gene="TDEL0G02450"
                     /locus_tag="TDEL_0G02450"
                     /db_xref="GeneID:11504828"
     mRNA            <467216..>468241
                     /gene="TDEL0G02450"
                     /locus_tag="TDEL_0G02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682775.1"
                     /db_xref="GeneID:11504828"
     CDS             467216..468241
                     /gene="TDEL0G02450"
                     /locus_tag="TDEL_0G02450"
                     /inference="similar to DNA sequence:INSDC:YGL153W"
                     /note="similar to Saccharomyces cerevisiae PEX14
                     (YGL153W); ancestral locus Anc_2.315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682823.1"
                     /db_xref="GeneID:11504828"
                     /db_xref="GOA:G8ZYY7"
                     /db_xref="InterPro:IPR006785"
                     /db_xref="InterPro:IPR025655"
                     /db_xref="UniProtKB/TrEMBL:G8ZYY7"
                     /translation="MSEVKDDRRQLFDSAVSFLSDDSVKNAPLTKKIEFLQSKGLTQE
                     EVELALKEAQNPRRQPNLSYKELSGASGAPREDIMYEAVPPPIPRRDWKDYFIMATAT
                     AGLFYGVYELTRRYVVPNILPEAKSKLEQDKEEIQSYFDKVDKVLNAIEQEQEKVRNK
                     DDEKLEELEATIYQLRTCLDQTTKSRDKMEDEFKMLKLEMINLQTTIDKYILNNKNVK
                     ELEKINTEVNSLKSLISATMAEDASGASTESLGLKSPLAKNLVPGAKDIPSAAEILAK
                     LNMGKKDSDSSIPAWKKAREESVGSAGLSIPEWQKKSLNEVVVPNWQENLETAEMEEE
                     NKNNESN"
     gene            <468544..>471777
                     /gene="TDEL0G02460"
                     /locus_tag="TDEL_0G02460"
                     /db_xref="GeneID:11504829"
     mRNA            <468544..>471777
                     /gene="TDEL0G02460"
                     /locus_tag="TDEL_0G02460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682776.1"
                     /db_xref="GeneID:11504829"
     CDS             468544..471777
                     /gene="TDEL0G02460"
                     /locus_tag="TDEL_0G02460"
                     /inference="similar to DNA sequence:INSDC:YGL151W"
                     /note="similar to Saccharomyces cerevisiae NUT1 (YGL151W);
                     ancestral locus Anc_2.316"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682824.1"
                     /db_xref="GeneID:11504829"
                     /db_xref="GOA:G8ZYY8"
                     /db_xref="InterPro:IPR014801"
                     /db_xref="UniProtKB/TrEMBL:G8ZYY8"
                     /translation="MEGESVYKLALRCAEREIASADFLNLYKEFYNEKVSANVENDDS
                     PEEKSKITEVCNRLATDLLQLLNSQRQLLLADYVAEVLFVNYNSELVNAVLPQIYSVD
                     NPTMLLHFFSQSCAFFAKLSDSLIADDISKDAPKCIIPSVLNADPQRMDDTLIVAVCK
                     FLQFVLKNVSGSITIESDSLRESCYALMSRLSKLNKLLHRKVSQTIDSKIEFKNAKNN
                     LTKDSVQEYGSSPSISSPQFIASPFSTSKVPSSKASTVKYQDMKLLRFYKNIWLNNKI
                     KNWEPIDAGFLSRYASIAPSIFQDATIPFPTVDAQLTDLIETSFTCFAQFVSNKQYHQ
                     SNSNLNLLERQWIIFIVTQIPLLILENSTGNSQVITNALGSLDDKVVKAIRTYYSEKD
                     DAKNRNEDLFDDYPSASLDIRHEFIKSLVKLGLQPATAINEYLREDQVIDTKSLPVRD
                     DLTVNNSQGGEEVITDIKQFVSSSLDSLEPELVGIQSNEHIDGLQQVLRNFENVPPTK
                     QKVLSHVFVELLEEATNKFDFNRIGKICLLLSFNFSHSLTAILTFMTPVRICEILMKF
                     IDVLWDGCVEVKRKELADSEFETMNMFSSFTWSLLMLIVISQNYDISLIDVALQSSEL
                     TTESSFTIPFVSKLPEIPDIYFKDQTKAVDPNMHTESHQMVENWLRDLFVNGSISDSL
                     LQSVDTKQLASLIPFIFKQILLALEVEAIDDISNLVGGFEYFLQPFMLIGLIKIVYWL
                     EQYLYSLRSDMINESLLEKVFTLLNTIFNPTSLNEDSRSFHSAVLRLNAVRLLRVLRK
                     FRVQSQSNYGIYSSEASGHPKLESLIKSFTTVLQVSPNYNLDPRDINSENAFSQKQLG
                     YGSMLILNENPINKIMTNQINSFWNLHSSTYYNLDYLEEIIDLVTPRNFLIDVFRTLE
                     YKLSTYGVPGVRNKMSPAESEHVLNYLFYFLALYDVKSQDDATKLLSLMEKSEIPSTA
                     KEAQLKSEPAPKQEAMPDDDFDMLFGENDTSTHGGDEEVQVTNVERNCKFNGTAAYHR
                     GSFGLLLHELKVDYDSALAARDITKEARDKLDRYHEKYIHMLRTCVF"
     gene            complement(<471936..>476171)
                     /gene="TDEL0G02470"
                     /locus_tag="TDEL_0G02470"
                     /db_xref="GeneID:11504830"
     mRNA            complement(<471936..>476171)
                     /gene="TDEL0G02470"
                     /locus_tag="TDEL_0G02470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682777.1"
                     /db_xref="GeneID:11504830"
     CDS             complement(471936..476171)
                     /gene="TDEL0G02470"
                     /locus_tag="TDEL_0G02470"
                     /inference="similar to DNA sequence:INSDC:YGL150C"
                     /note="similar to Saccharomyces cerevisiae INO80
                     (YGL150C); ancestral locus Anc_2.317"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682825.1"
                     /db_xref="GeneID:11504830"
                     /db_xref="GOA:G8ZYY9"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR020838"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZYY9"
                     /translation="MSLASLLNKEDTQVSEPGGIKMNGNNSNDEVVKDKFVKEMNEKF
                     RSLSQRDLLEHVYQDWKFINFQEFELISEWNNQSKEWANRDGGFEKLYNKMEGIKEEW
                     EQYDLYKRDRLSVMQKLDLVNGTSETVAAETKVKPVRSKPRRPVKPVAAPVTPPPQVA
                     VTPRRRKRQREEADHAVEVSPLKNEVEQSERIEPETLEQEHVEEHEEEHDTEEQQEDE
                     QDDVESVRDPDEDEVRLDDEDFSADEQVEPVAAEADVPVSFDDDENDKDFSPDDDIKN
                     ITSSKKDKSVSMESERSRIVRELVKMCNKNRNVEKKKRRFTNANVLEYNPLDNKLIVK
                     VTLKQFHVKQLKRLINEAKRIAAMEEAAKNQIDNPELEGLSPASKKRKLLANGGFDEN
                     SSLTSSPTKHGLPTYGLKMTAKEARAIQRHYDNTLFTIWKDMARKDSAKVARLVQQIQ
                     SIRAANFRKTSSLCAREARKWQFRNFKQVKDFQTRARRGIREMSNFWKKNEREERDLK
                     KKAEKEAMEQARKEEEARENKRQAKKLNFLLTQTELYSHFIGRKIKTNELEGNMSDHQ
                     LNPAAMMEAMSNGNGHGNIDLDNTEANKNDFHSIDFDNEDDEQLRIKAAQNASNALAE
                     TRAKTKEFDDDANGEELNFQNPTSLGKISIEQPKMLACTLKEYQLKGLNWLANLYDQG
                     INGILADEMGLGKTVQSISVLAHLAEKYNIWGPFLVVTPASTLHNWVNEIAKFVPQFK
                     ILPYWGNANDRKVLRRFWDRKNFRYGKDSPFHVMITSYQMVVSDVGYLQKMKWQYMIL
                     DEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNSMQELWALLHFIMPSLFDSHDEF
                     NEWFSRDIESHAEANTKLNQQQLRRLHMILKPFMLRRVKKNVQSELGDKIEIDVLCDL
                     TQRQAKLYQVLKSQVSSAYDAIENAAGSDEAASDQSLINTVMQFRKVCNHPDLFERAD
                     ITSPFGFVDFGQTAGYLKNDELTDVIYSTKNPIKFHLPRLIYDDLIAPNYESNHANFT
                     KVLNHTMSIFSPVNNRELCTILALLTGLGPESFSKIAQKDFMQRVLEAARDKKASIED
                     LSLVYDKNDLNNTRFSVCVPNKTKYLQNLANVTTGGVLESLLNVQGTVYYEQYFNSLH
                     PGSHPVATATPVSIEVLGSSQMANKVERELFDPTVSQAFSEISASTQYNMNVGKHIPV
                     DQFPTSGLYPGPLNKYFSSNITMPSMDRFITESAKLRRLDELLVQLKKEGHRVLIYFQ
                     MTRMMDLMEEYLTYRRYKHIRLDGSSKLEDRRDLVHDWQTIPDLFVFLLSTRAGGLGI
                     NLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLVKGTIEERMRDRAKQK
                     EHVQQVVMEGKTQDKKVQTVEAGGEEAQTKLKQ"
     gene            <477054..>478184
                     /gene="TDEL0G02480"
                     /locus_tag="TDEL_0G02480"
                     /db_xref="GeneID:11504831"
     mRNA            <477054..>478184
                     /gene="TDEL0G02480"
                     /locus_tag="TDEL_0G02480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682778.1"
                     /db_xref="GeneID:11504831"
     CDS             477054..478184
                     /gene="TDEL0G02480"
                     /locus_tag="TDEL_0G02480"
                     /inference="similar to DNA sequence:INSDC:YGL148W"
                     /note="similar to Saccharomyces cerevisiae ARO2 (YGL148W);
                     ancestral locus Anc_2.318"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682826.1"
                     /db_xref="GeneID:11504831"
                     /db_xref="GOA:G8ZYZ0"
                     /db_xref="InterPro:IPR000453"
                     /db_xref="InterPro:IPR020541"
                     /db_xref="UniProtKB/TrEMBL:G8ZYZ0"
                     /translation="MSTFGQIFRVTTYGESHCKSVGCIVDGVPPGMSLTEQDIQPQLS
                     RRRPGQSKLSTPRNEKDKVEIQSGVEFNKTLGTPIAMLIRNEDQRPHDYNDMDNYPRP
                     SHADFTYLEKYNLKASSGGGRASARETIGRVAAGGIAEKFLKQVSNVEIVGFVSQIGS
                     VKMDRDPFDPKFHHLLNTITREKVDSIGFIRCPDVNLAGAMVQEIEKYRGNKDSIGGV
                     VTCVVRNLPTGLGEPCFDKLEALLAHAMLSIPASKGFEIGSGFQGVSVPGSKHNDMFY
                     FDEETQRLRTKTNLSGGIQGGISNGENIYFSVAFKSVATISQEQETCTYDGKPGVLAA
                     KGRHDPAVTPRAIPIVEAMTALVLTDALLIQKSRDFAKSITH"
     gene            <478524..>481076
                     /gene="TDEL0G02490"
                     /locus_tag="TDEL_0G02490"
                     /db_xref="GeneID:11504832"
     mRNA            <478524..>481076
                     /gene="TDEL0G02490"
                     /locus_tag="TDEL_0G02490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682779.1"
                     /db_xref="GeneID:11504832"
     CDS             478524..481076
                     /gene="TDEL0G02490"
                     /locus_tag="TDEL_0G02490"
                     /inference="similar to DNA sequence:INSDC:YDL117W"
                     /note="similar to Saccharomyces cerevisiae CYK3 (YDL117W);
                     ancestral locus Anc_2.319"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682827.1"
                     /db_xref="GeneID:11504832"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR002931"
                     /db_xref="UniProtKB/TrEMBL:G8ZYZ1"
                     /translation="MSVSIPLAPPFKVKARYGWSGQTKGDLGFLEGDVMEVTRITGDW
                     FYGKLLRNKKCSGYFPNNFVNVLEEQLNKSTLAESPEVVNTPSKVIIPPIPARSRGKS
                     SVSSTPSDSKQSYRKRVSRVYEQQSHSAPNLPQDVAVSRTSYPKSRTTTERTRRSREC
                     YSINDSLPPLPPIPSMQKTEKLTQRVPKSYSSSDLPSSANSNNLYRDNQSFYDGYYPS
                     KRSSLTEESNSSGLFSNSRYWGTSAASSEDSFALMSDFSATSAGSFARHRFAQSFTDS
                     LERSQSPSINNSAQMGNGKKGGIFRRIMTKTTSGNNSEMHSPTPSGQYPKLPDIKNLN
                     ISATRDDARDWLAVKTHLNRSRSLTKYEKHPRYMRALDQNRDLVLHPQDAIYNGLNTN
                     EVTCHGQAGLIDIELSESNFDYIDKMTRKRCVKDGSMRLTNWAQTTFSARYSTTLEKL
                     RGIYIFCTETFELIDDHGSTDFSKKPKNLDTVLYQKYCTPYQLLCLFKALTNALGIRC
                     ESVFGFLKTPTANNHEFKYNHCWLRVLVNKEWRFIDVILGNISNPVHEFVNNRKITKA
                     DDDYFLVEPLRFIYTHIPQKDSEQHIVPSIDRLSALYLPLVFPSFFNNGLKLYKYSTA
                     LAFLEDSEIFECSLEVPSDVEVFASMVIPTPDPGKSHEYRKMELALVQVKRHKSDNSR
                     RIAVVKAVLPPGSNKGTLYIHSGLRGTQTSVANVHPLSMMVPLTHSGSEMKYEFTARK
                     PSESVQKAEMYIVEPQNRFLFLHNEYDFEVIQHPFDSVIYSPTALTKNRPQPMAIKSP
                     SGKIYELQKNDPHFAYGTWKATISLKETGVWTGLVTADSGVGWCVFAEWLCI"
     gene            <481320..>483497
                     /gene="TDEL0G02500"
                     /locus_tag="TDEL_0G02500"
                     /db_xref="GeneID:11504833"
     mRNA            <481320..>483497
                     /gene="TDEL0G02500"
                     /locus_tag="TDEL_0G02500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682780.1"
                     /db_xref="GeneID:11504833"
     CDS             481320..483497
                     /gene="TDEL0G02500"
                     /locus_tag="TDEL_0G02500"
                     /inference="similar to DNA sequence:INSDC:YDL116W"
                     /note="similar to Saccharomyces cerevisiae NUP84
                     (YDL116W); ancestral locus Anc_2.320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682828.1"
                     /db_xref="GeneID:11504833"
                     /db_xref="GOA:G8ZYZ2"
                     /db_xref="InterPro:IPR007252"
                     /db_xref="UniProtKB/TrEMBL:G8ZYZ2"
                     /translation="MEVEKAIDESNGYYVEFANALKDFMVGEFDEVNSSDPFDIVREY
                     RSIAGRYAAETLNSNTESSSDWELEAKLWHLFELLLSFRTSDQELEITEVRHYNSDAV
                     FEKQLLHENRELYQIWIIIVWIQDNMREPERPSRLPASKWSNTMISGGIKSSDLDYPL
                     REKKAEIDPRDKEEDSIFFKYIYELLIAGKVEEALEECKLSDNLTISMILCGMQLYVN
                     PRVDTQLREDFESQQGIKKHALWRRTVYSLSQNTELNYYERAIYSFLAGDIPPEEVMN
                     ISSWDSGLLVYLNQILQIEVENYLNSENKISKDELIFSLPSHPNDSQTVLNRLSLAYP
                     QESEHPIRVLIGGIILNTLEPVLNSAVKLLMEMVQGQTAENDLAEKPYLLRIVTHMSI
                     LLDIISPGLVSKRNKSKLITAYISIMKLHELYDVIPVYIDFLDSEEIVDAYSFVLSTL
                     EDPDVRKKQIEIANFLRLPTSNILRKTTERIFAETEEEYTPRDEVSVTFDVPPVDKHL
                     IFGVEWLIQGKLYVDAVDSVIALSRRFLINGKIKSLEYFINGNSLDDLLKNYELEVIY
                     QRNHDDEKESKKKEIQEYQRLIRELKKFEEWKDTVSKLNSESNVPSLIEKFQQYSRGT
                     FDLIKHFFVELSEHEDHPDREIYYEIRSLYTPYLIIELHKELVEAAMLLKIPTFIREA
                     LGFANLVANETDKIYLLFQSSGKLKEYLRLVAQTATLSGDNFV"
     gene            complement(<483647..>484222)
                     /gene="TDEL0G02510"
                     /locus_tag="TDEL_0G02510"
                     /db_xref="GeneID:11504834"
     mRNA            complement(<483647..>484222)
                     /gene="TDEL0G02510"
                     /locus_tag="TDEL_0G02510"
                     /product="60S ribosomal protein L9"
                     /transcript_id="XM_003682781.1"
                     /db_xref="GeneID:11504834"
     CDS             complement(483647..484222)
                     /gene="TDEL0G02510"
                     /locus_tag="TDEL_0G02510"
                     /inference="similar to DNA sequence:INSDC:YGL147C"
                     /note="similar to Saccharomyces cerevisiae RPL9A
                     (YGL147C); ancestral locus Anc_2.321"
                     /codon_start=1
                     /product="60S ribosomal protein L9"
                     /protein_id="XP_003682829.1"
                     /db_xref="GeneID:11504834"
                     /db_xref="GOA:G8ZYZ3"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002359"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="UniProtKB/TrEMBL:G8ZYZ3"
                     /translation="MKYVQTEQFVEVPQGVNVNIRSRVVKVTGPRGTLVKNLKHIDVT
                     FTKINERQIKVAVHNGDRKHVAALRTVKSLVDNLITGVTKGYKYKMRYVYAHFPINVN
                     VVEKDGKKFIEIRNFLGDKKVRLVPVREGVTIEFSTNQKDEVVLSGNSVEDVSQNAAD
                     IQQICRVRNKDIRKFLDGIYVSEKGVIEEAQ"
     gene            complement(<484488..>485464)
                     /gene="TDEL0G02520"
                     /locus_tag="TDEL_0G02520"
                     /db_xref="GeneID:11504835"
     mRNA            complement(join(<484488..485344,485401..>485464))
                     /gene="TDEL0G02520"
                     /locus_tag="TDEL_0G02520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682782.1"
                     /db_xref="GeneID:11504835"
     CDS             complement(join(484488..485344,485401..485464))
                     /gene="TDEL0G02520"
                     /locus_tag="TDEL_0G02520"
                     /inference="similar to DNA sequence:INSDC:YDL115C"
                     /note="similar to Saccharomyces cerevisiae IWR1 (YDL115C);
                     ancestral locus Anc_2.322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682830.1"
                     /db_xref="GeneID:11504835"
                     /db_xref="InterPro:IPR013883"
                     /db_xref="UniProtKB/TrEMBL:G8ZYZ4"
                     /translation="METPAFIRVKRRRDEDSVQRLLIDEGRKIKRGRFLFKLTRTVDH
                     ENYESSKEEPTPLLKLAEERRHFVLEQKKRRRSSDDHGPKESSTTEQDALPAEISEMI
                     QNHLKLNETTQENSQRKRKPSKKHFAGKILTIPSLDYVYDIYHLEKVPEKEFDSYKDA
                     NDVGFVKIIDSNIDLIPDEESDSIDKVRSDDEDSNEESYYQNDYPEDEDDDRSILFGG
                     EEDATEAQDTTLEGQTDSFNALFDLLGDNHNVLGSLNSGNFVDLDEDYNDTIEGAPYY
                     DEDPEDPDEDPLKAHRDRIFGQLQRMIDDN"
     gene            <485827..>486717
                     /gene="TDEL0G02530"
                     /locus_tag="TDEL_0G02530"
                     /db_xref="GeneID:11504836"
     mRNA            <485827..>486717
                     /gene="TDEL0G02530"
                     /locus_tag="TDEL_0G02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682783.1"
                     /db_xref="GeneID:11504836"
     CDS             485827..486717
                     /gene="TDEL0G02530"
                     /locus_tag="TDEL_0G02530"
                     /inference="similar to DNA sequence:INSDC:YDL114W"
                     /note="similar to Saccharomyces cerevisiae YDL114W;
                     ancestral locus Anc_2.323"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682831.1"
                     /db_xref="GeneID:11504836"
                     /db_xref="GOA:G8ZYZ5"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZYZ5"
                     /translation="MKLSSLGRGASFSEHASPFSRYITDLRFWTTPENSPFAAGTIAI
                     VTGGSRGLGLELVHQLVLQKVKIIIIDVIPPTARFSDSDRVLYYYCDITDYETVKSLQ
                     KLIKKEHGIVTMLFNNAGITRIDSLQNTPDNEIKKIIDVNFIAAYIMINIFLPDMLEI
                     GHGYIINIASVLGEITPARLTSYGASKGGLIAVHKSLTKNLCKRKKGSGTIRTLLVCP
                     GKINTSMFAKVKTPSKFLAPDIDPRKLAYHIVTAISCNMTSTLRFPYYANIVPFFKQL
                     NWPYIRALKKSSGMDRVTVV"
     STS             486476..487363
                     /standard_name="D1S3696"
                     /db_xref="UniSTS:474274"
     gene            complement(<486849..>488963)
                     /gene="TDEL0G02540"
                     /locus_tag="TDEL_0G02540"
                     /db_xref="GeneID:11504837"
     mRNA            complement(<486849..>488963)
                     /gene="TDEL0G02540"
                     /locus_tag="TDEL_0G02540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682784.1"
                     /db_xref="GeneID:11504837"
     CDS             complement(486849..488963)
                     /gene="TDEL0G02540"
                     /locus_tag="TDEL_0G02540"
                     /inference="similar to DNA sequence:INSDC:YDL113C"
                     /note="similar to Saccharomyces cerevisiae ATG20
                     (YDL113C); ancestral locus Anc_2.324"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682832.1"
                     /db_xref="GeneID:11504837"
                     /db_xref="GOA:G8ZYZ6"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR015404"
                     /db_xref="UniProtKB/TrEMBL:G8ZYZ6"
                     /translation="MVVGKTRNSYAVLEEDNPTVEQQQDGESKRKEEELPNETKDAFN
                     AEEQENIDSGKNTPENSKNHNPESPTATDESSTTDKEPESIPLDCSKDSEFEKNSIPD
                     SQQRNESLEDASVEMDSTDEVSGRNDDDLRDSSVDPAMVHTAITEKDNPFMQVPNDES
                     GGIILESSQPNSKLMVNPNDAYEDDIDDLLPLKHGSAGNNHNSSGEDSIDVRRHSSAG
                     TIQHKGGTGEYSNTDKVQILEANKLSEGQGRTYIGYTIKYKGNMVRRRYSDFESLRNV
                     LVKLFPMSLIPPIPEKQSIKTYGKAIATSKPSYLLPSEGTGSVDLSLSVINGSVNNSD
                     ERLIRHRIRMLTGFLNKLLQNAEITRTSIISDFLDPNNSNWSDFIASSATFSSLPKSP
                     LQCNPLDPTTTTRIHACLPIPYSASQSLLHKDGPAPSAETKDGFQGIEKDYKRYESIL
                     SDGFYKYSRRITKNMYDLKHSMKDLSEAYAQFASNQGQGADLAEDFSHISDAFDESAV
                     QLESTVGRFYYNVNEPLSECVHMAGSARDLIKFRKLKRIQLEMIKKALASKKSQLEKL
                     EEHEKELQKIDADIDQEMSKSQRVNLQHPQPKTYSGRLLNKFNKLASMVKETVNYQDP
                     DLETSMSTLKTEIQQLEESLEVAESDMKVITTVIRDQKLKEFSQEREEELSEILRNYS
                     KYLREYAQRNLEIWREVKSTQT"
     gene            <489221..>493405
                     /gene="TDEL0G02550"
                     /locus_tag="TDEL_0G02550"
                     /db_xref="GeneID:11504838"
     mRNA            <489221..>493405
                     /gene="TDEL0G02550"
                     /locus_tag="TDEL_0G02550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682785.1"
                     /db_xref="GeneID:11504838"
     CDS             489221..493405
                     /gene="TDEL0G02550"
                     /locus_tag="TDEL_0G02550"
                     /inference="similar to DNA sequence:INSDC:YDL112W"
                     /note="similar to Saccharomyces cerevisiae TRM3 (YDL112W);
                     ancestral locus Anc_2.325"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682833.1"
                     /db_xref="GeneID:11504838"
                     /db_xref="GOA:G8ZYZ7"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:G8ZYZ7"
                     /translation="MSSGTVVSRYLPHEARVLLLTELVDEGRFNDVVELLDSTGLEIP
                     YEMGKNIFEVIKTRMLDVSENQWQDLSQDAEMRTLAQVTCKMDVVREMVEQWIGSQLV
                     DYIKNIGDNDFSQEMMCDFPRPQEECEAVVLLAFLELVYLFSSKTHKSKLDGIIMLLL
                     GCEDEIVTSKCSKLMRWHINDIIERCKADQIFDRNTWDLIDRVLSGDSDCPWKQRNGL
                     SFLLRFLVASDPTPALEKFIQRDEYWMHVRAALSQKVHEYRKLGISVLQLTVKKISTW
                     PESFYTSLISWDPLHGSKFVQSWKEFMTLYEIVSLDTALNQIEAASGGILKLLDEGAF
                     LNPSWGLILFSTGLRASMESVRKYMVSLLFQVRDKSVFATDLTTLRAIFLPSIMEAHF
                     FNSDGADCPYGEHLANFISAIITESAEQADVVVEAMLETLVDQGGSFDPARIYISLGI
                     LNSLRKKNARLLNANHLELITKLFEFENEDAVFETTIQTIYLKFLLHVSPSVTPIEWA
                     ECIVSHIKRNQGSYEFFSPMAGLFEDFALTYFGPDAGRQLLGRGQTYELIAIILWKYD
                     DVPVTRDLLIEVARSGENVPVYTENATEYLAALLNGKEVNYECTHLFVDYPGFSTNTW
                     KSIDLKPLYESVTQEFSGDKLKFFVEVYKKIFKNTIDSFELSWPQLKDLYELIKERTS
                     SCTLVDFKTKDDLYGVYFDLLSLCLKINPLKDRDEVNEFISMLENNVRNDNGNFKGDQ
                     GTSELCAYFLTTYVSNEESQEAWSYVYRIFGLLTTIWDSFSAERLVLKQRDLHLSTIN
                     GLFHPSVLLFSSFPSKEGKKLADKQHEYSRKIVKQAYSRRSMLPLMGQNIKYFMHLHG
                     KQLQQNDDYWWLIDTMIAIFTCTQTTVNIFQIKTVIATLFDKKIGAYHSGSSGLYERT
                     YGIEESSAKIDVITALLQSSDHFKDRFVSETINRTNLLVAKKKTDGVEEIQRLLEWQL
                     ILLCVSTQEKANLVDTAARFVLPNLVEEISPIIRIYMEWLISLSLSENYGQQDACNLE
                     DKIFSLMDDHARPIVVVSAERIIYLVLKAHKFMKATGFTSLLSKFTSKVVPNATSNKP
                     LVRHFSNSLMLDFWPSFQETFKDTTLKGIIKGLFDKAESTKMSGRYRAGDANFWDINA
                     DLTLIGIFGGVMKKTIDHDLPFISEKKFKQYLPSTNLFPVGQDESSLWLLKRSTNRYA
                     ANMADMSSESTQLQTKSGAWETLMDIDSDTPDKNVTRSDLIVVSSLVDKPPNLGGICR
                     LCDVLGVGLLAVQDIRVKNHPQFKNVAVTADRWMPMAEVSIQGIADFMQEKKKEGYVL
                     IGLEQTDNSVKLDTHYKFPKKSLILLGTEAHGIPGDLLSQLDLCLEIQQFGVIRSMNI
                     QTATAVIVHSYTIQHM"
     gene            complement(<493410..>494207)
                     /gene="TDEL0G02560"
                     /locus_tag="TDEL_0G02560"
                     /db_xref="GeneID:11504839"
     mRNA            complement(<493410..>494207)
                     /gene="TDEL0G02560"
                     /locus_tag="TDEL_0G02560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682786.1"
                     /db_xref="GeneID:11504839"
     CDS             complement(493410..494207)
                     /gene="TDEL0G02560"
                     /locus_tag="TDEL_0G02560"
                     /inference="similar to DNA sequence:INSDC:YDL111C"
                     /note="similar to Saccharomyces cerevisiae RRP42
                     (YDL111C); ancestral locus Anc_2.326"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682834.1"
                     /db_xref="GeneID:11504839"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:G8ZYZ8"
                     /translation="MGLSVTEKLYLYDSLTSNPVVRPDGRKPHQFRPIEVFTDFLPSA
                     NGSSRIIASDGSECIVSIKAKVIDHTVEDELIHVEIDIAGQRDDSPQVETMTSLLNNV
                     LEPRGGIDVSKLRLTKRYSFKIFIDVLLLSSASHPVSLISMAIHSALNSTCLPKLVSS
                     FDDLEVEELPTFHDYDLVRLELSAPVVFVAAIVGDSILMDAAAAESEVSNNGLIITWS
                     NGKAISPIRTVALNDSDVKGFDPKILQKAITMVEEYAPDVLRALNNA"
     gene            complement(<494328..>495104)
                     /gene="TDEL0G02570"
                     /locus_tag="TDEL_0G02570"
                     /db_xref="GeneID:11504840"
     mRNA            complement(<494328..>495104)
                     /gene="TDEL0G02570"
                     /locus_tag="TDEL_0G02570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682787.1"
                     /db_xref="GeneID:11504840"
     CDS             complement(494328..495104)
                     /gene="TDEL0G02570"
                     /locus_tag="TDEL_0G02570"
                     /inference="similar to DNA sequence:INSDC:YGL146C"
                     /note="similar to Saccharomyces cerevisiae YGL146C;
                     ancestral locus Anc_2.327"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682835.1"
                     /db_xref="GeneID:11504840"
                     /db_xref="UniProtKB/TrEMBL:G8ZYZ9"
                     /translation="MNVLIVLAVIVSVVRASLALNDHLSFVLPAIKGADARTRADGGQ
                     FCFELESPFAETGSELLFVVDVVCGLPQHTDVHRFGGTNVQRGKQSLDMAIYNAENGD
                     LIRSKRNLPVGTSVIEVNPFGSRRFKFCFVNLSYDSSWRFLDVQMSLTVKVATYRSLQ
                     GRRRKSLLFHEMAIDTMQEMDHCAKKLLTVTETRENSELLRLERQRRDFNEEVFTWLL
                     YGEAAFTVAVVSSQIWVGSHFMHQFRDRARDLRRNRKLSH"
     gene            complement(<495211..>495567)
                     /gene="TDEL0G02580"
                     /locus_tag="TDEL_0G02580"
                     /db_xref="GeneID:11504841"
     mRNA            complement(<495211..>495567)
                     /gene="TDEL0G02580"
                     /locus_tag="TDEL_0G02580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682788.1"
                     /db_xref="GeneID:11504841"
     CDS             complement(495211..495567)
                     /gene="TDEL0G02580"
                     /locus_tag="TDEL_0G02580"
                     /inference="similar to DNA sequence:INSDC:YDL110C"
                     /note="similar to Saccharomyces cerevisiae TMA17
                     (YDL110C); ancestral locus Anc_2.328"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682836.1"
                     /db_xref="GeneID:11504841"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ00"
                     /translation="MSAGGIKRPVQIEEFKTAIGDMSSEELAHLKQEIENCSSHLNRS
                     NARLNKYIAKLEGRHKPGEDDEEDEELQNIEEGDLQLYHDSLHENEILLKNYNERLEA
                     LHQENLYRSSGRKAAG"
     gene            <496016..>497950
                     /gene="TDEL0G02590"
                     /locus_tag="TDEL_0G02590"
                     /db_xref="GeneID:11504842"
     mRNA            <496016..>497950
                     /gene="TDEL0G02590"
                     /locus_tag="TDEL_0G02590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682789.1"
                     /db_xref="GeneID:11504842"
     CDS             496016..497950
                     /gene="TDEL0G02590"
                     /locus_tag="TDEL_0G02590"
                     /inference="similar to DNA sequence:INSDC:YGL145W"
                     /note="similar to Saccharomyces cerevisiae TIP20
                     (YGL145W); ancestral locus Anc_2.329"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682837.1"
                     /db_xref="GeneID:11504842"
                     /db_xref="InterPro:IPR007528"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ01"
                     /translation="MLAGVEDLFEIDQKIAGIEEERKKLAKQLERARVFEERALEVAK
                     RNNELVDEIVHKATSLANVQSLREKYGDLKVLRQLESFYLEQEAQEKAQERLKALDQE
                     LDSTNEVSLEKLKYWYDELVDIDSSGPVYTRFEEICQQEAHILSEEFKKTLLETKWDT
                     QTFVPVAIDTMRQASTDLYHLGQFIFGGKPRLWNFECIANNFKIRFTYHFHKDTFKLE
                     TYFNFLNDYLQENLHKAISIFHDEGLSKQFVLEQFIDHVLAPIRDKVRANLMRDDRSI
                     IITLISQILNTDRNLSHKFHYHGDGLISLISPEIWDLWLSHQAGIATRQYQQITANPK
                     EMAQSASDFLKLLNRAFETLTPFYEIEAPSLRRYKLLSCSQIFIGLTSTYMDYLVSVD
                     ALDKQHTDEEELYQTLVKLQNFSTVYKRIFELSQEYIMISLTDIVNEKEGKNYQSLFQ
                     SVLTEYRKIIDDVTQPTMVHRIQKLLKESLRNYFKIGSWSSQNQQSSNTSAEVVNAIK
                     LMSRIILGLDSLDIPLEVSLAIKNDLLNIIVNYFIESILKLNRFNRIGLNQFRLDFHA
                     LKESLNLPDTAVSSQEIVITELLAILDLKYDTNHSEFFETSYIKRAEYNELRTLLSIK
                     KLKDSEIQDALYRVAYGNVI"
     gene            complement(<498005..>500029)
                     /gene="TDEL0G02600"
                     /locus_tag="TDEL_0G02600"
                     /db_xref="GeneID:11504843"
     mRNA            complement(<498005..>500029)
                     /gene="TDEL0G02600"
                     /locus_tag="TDEL_0G02600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682790.1"
                     /db_xref="GeneID:11504843"
     CDS             complement(498005..500029)
                     /gene="TDEL0G02600"
                     /locus_tag="TDEL_0G02600"
                     /inference="similar to DNA sequence:INSDC:YDL109C,YGL144C"
                     /note="similar to Saccharomyces cerevisiae YDL109C and
                     ROG1 (YGL144C); ancestral locus Anc_2.330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682838.1"
                     /db_xref="GeneID:11504843"
                     /db_xref="GOA:G8ZZ02"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="InterPro:IPR016445"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ02"
                     /translation="MTETIEPQVLFNYKSAVGIGEVERYVISYDLYEGNEIPSDISLD
                     SLWLKVKNIESLSYRAAYLAGPFILYCDVRTKDYHHSQKIIASVDQPRFEPTLQAQQS
                     CIAELSVHQIKPQYVWIVDIISQILFTTNTQVSFEIVLGNCKEALIDNVASGIPSNLD
                     VSKITITRLTTLDLWNLPAEINLHQKKKKHLVMLTHGLHSNVSADMAYMMEQIYKSQE
                     NYPHEQIVVKGYTGNTCQTERGVKYLGTKLAEYIIKEVYDESMTKISFIAHSLGGLVQ
                     VFAIAYIMVRYPWFFKKVTPVNFIAIASPFLGIVTDNPAYINLLLSYGVIGKAGQDLS
                     LVKDAAYGKPLLSLLPGDPVKGVMARFKRRTLYINAVNDGIVPLYTASMLFLDYDDVL
                     KELRKVEDEEGLKAEPSNIDIPQGNFLSRTVVSPFTKVIGLLAPQKFPSKNSTIPKIS
                     FMESAVSLLIPPLPDISFILDPNSRDPVIIHDKVYTEDDIPQEPAEDEGTFEASTNIL
                     LSSFTADRGKSGKSQMVEESIARHWHKGLSWRKVVVALKPDAHNNIIVRRRFANAYGW
                     PVLDHLISVHFNGDDKELVGDDDLPVSAERNRTKIDLEEPDKNVEWITKADNPTIFDE
                     GPTGMISTVGDMLGTFFKDRLSSFVNAEPISTNKESRLLSYEDTNGEIQS"
     gene            complement(<500222..>501433)
                     /gene="TDEL0G02610"
                     /locus_tag="TDEL_0G02610"
                     /db_xref="GeneID:11504844"
     mRNA            complement(<500222..>501433)
                     /gene="TDEL0G02610"
                     /locus_tag="TDEL_0G02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682791.1"
                     /db_xref="GeneID:11504844"
     CDS             complement(500222..501433)
                     /gene="TDEL0G02610"
                     /locus_tag="TDEL_0G02610"
                     /inference="similar to DNA sequence:INSDC:YGL143C"
                     /note="similar to Saccharomyces cerevisiae MRF1 (YGL143C);
                     ancestral locus Anc_2.331"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682839.1"
                     /db_xref="GeneID:11504844"
                     /db_xref="GOA:G8ZZ03"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="InterPro:IPR005139"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ03"
                     /translation="MSISYTIRMLTRRSLPSYGLIARRWSSTVPESGLKLKELHPSLL
                     KRVEKYVEELHGLERMLSDGGSFNDTNQKLYAKVSYIKDIRDRYLEQLESLKELQEII
                     DEDPSLRDDAQSEYEKLVPELTETSNELLRKLIPPHEFADKACILELRPGVGGIEAMI
                     FAQDLLNMYAGYAQNKKWKFHLISKSENQSGSGIVDAILSIDEPGSYNRLRHEAGVHR
                     VQRIPATETKGRTHTSTAAVVVLPQMGEESEKASDAYERSFKPDEIRIDVMRASGKGG
                     QHVNTTDSAVRITHFPSGIVVSMQDERSQHKNKAKAFAILRARLAEKERQEKEEKERS
                     VRKDQVTTTDRSDKIRTYNFPQNRITDHRCGYNIHDIEGIMSGERLDHLIDAMEEYDA
                     DAKAKELLEEA"
     gene            <501589..>502566
                     /gene="TDEL0G02620"
                     /locus_tag="TDEL_0G02620"
                     /db_xref="GeneID:11504845"
     mRNA            join(<501589..501613,501677..>502566)
                     /gene="TDEL0G02620"
                     /locus_tag="TDEL_0G02620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682792.1"
                     /db_xref="GeneID:11504845"
     CDS             join(501589..501613,501677..502566)
                     /gene="TDEL0G02620"
                     /locus_tag="TDEL_0G02620"
                     /inference="similar to DNA sequence:INSDC:YDL108W"
                     /note="similar to Saccharomyces cerevisiae KIN28
                     (YDL108W); ancestral locus Anc_2.332"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682840.1"
                     /db_xref="GeneID:11504845"
                     /db_xref="GOA:G8ZZ04"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ04"
                     /translation="MSQVEYTKERKVGEGTYAVVYLGTKQSSGRKIAVKEIKTSEFKD
                     GLDMSAIREVKYLQEIQHENVIELIDIFLAYDNLNLVLEFLPSDLEKVIKDRSILFTP
                     ADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPEGIIKVADFGLARTFPSAQEIL
                     TSNVVTRWYRAPELLFGAKHYTSAVDIWSAGVIFAELMLRIPYLPGQNDVDQIEVTFR
                     ALGTPTDADWPDVSFFSAYNKLQIYPPPSREELRRRFIAASENALSFLCGMLTMNPQK
                     RWNAVECLESDYFKEAPAPSDPFSIKIS"
     gene            complement(<502637..>503860)
                     /gene="TDEL0G02630"
                     /locus_tag="TDEL_0G02630"
                     /db_xref="GeneID:11504846"
     mRNA            complement(<502637..>503860)
                     /gene="TDEL0G02630"
                     /locus_tag="TDEL_0G02630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682793.1"
                     /db_xref="GeneID:11504846"
     CDS             complement(502637..503860)
                     /gene="TDEL0G02630"
                     /locus_tag="TDEL_0G02630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682841.1"
                     /db_xref="GeneID:11504846"
                     /db_xref="GOA:G8ZZ05"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ05"
                     /translation="MFKLQRLSLLRFSRWQGLKKFSRSAINSAPDYSHVVIGGGVVGQ
                     AIAAELAKVPSNSVLLLEKNDRFGTETSSHNSEVIHAGIYYPADSLKTKLCIEGKNII
                     YNELDWLKTGVSWKKCGKWVVAQTDYEESINEALYRKCKDELDVDVELISSQDTSRKE
                     PSIRVGKSAVSSPSTGIINSHSLMDYLLGTIQQNDGDTVTGSEVIGLEYKDGAGYTVT
                     TKERFPGEDEVAEITAENVINSAGLYADHVSNMLLPKDRHKRLYFAKGNYFKLKSGGF
                     PSVSRLIYPVPPEDGKSLGTHLTIDMNGQILFGPDLEYVESRTNYTTNSQNIPAAFEA
                     ISRYYPHIQVSDLEVASCGIRPKLCGPDSYQFKDYYIKEEEGFPGFVNLLGIESPGLT
                     SSIAIGRYVKRIYHD"
     gene            <504079..>505212
                     /gene="TDEL0G02640"
                     /locus_tag="TDEL_0G02640"
                     /db_xref="GeneID:11504847"
     mRNA            <504079..>505212
                     /gene="TDEL0G02640"
                     /locus_tag="TDEL_0G02640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682794.1"
                     /db_xref="GeneID:11504847"
     CDS             504079..505212
                     /gene="TDEL0G02640"
                     /locus_tag="TDEL_0G02640"
                     /inference="similar to DNA sequence:INSDC:YDL107W"
                     /note="similar to Saccharomyces cerevisiae MSS2 (YDL107W);
                     ancestral locus Anc_2.333"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682842.1"
                     /db_xref="GeneID:11504847"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ06"
                     /translation="MRYRSIYCFARRYTSTRSQVLRPSFNEIFPQKRMVNRILFELDS
                     RLSFGKLYPLFELAYNNVDSEDIPVTSGITASDVMVMKKVLEKVRSRTKSVNRHLLKL
                     ENVLLDKAAEMGNNDAVSLLAFNVLKNPSKNTSDDVLHAKLLIKDLYKRKHHLTMKLT
                     GDLALKAGDNSQAETYYRRFLELESDTFLAGEVYGQLGQFSFHKTDLIPAERYFLKSI
                     QYSPLEYSVHSYFYLAQIYMNSDPLKARTLMENCATQGYKESFKALGFLEMNYFENLY
                     KAQEWFKLGMELFELECFIGYFDCCALLGEWALANKCFKSLEKIAENNSHYKSLVKQF
                     VEARHDKVKRALAYSPGPFPKREVVQNASKKAPQISKENKWNL"
     gene            complement(<505215..>507002)
                     /gene="TDEL0G02650"
                     /locus_tag="TDEL_0G02650"
                     /db_xref="GeneID:11504848"
     mRNA            complement(<505215..>507002)
                     /gene="TDEL0G02650"
                     /locus_tag="TDEL_0G02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682795.1"
                     /db_xref="GeneID:11504848"
     CDS             complement(505215..507002)
                     /gene="TDEL0G02650"
                     /locus_tag="TDEL_0G02650"
                     /inference="similar to DNA sequence:INSDC:YGL142C"
                     /note="similar to Saccharomyces cerevisiae GPI10
                     (YGL142C); ancestral locus Anc_2.334"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682843.1"
                     /db_xref="GeneID:11504848"
                     /db_xref="GOA:G8ZZ07"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ07"
                     /translation="MSAKNGERPTVSTFKILLIFRIINAITTRTFFQADEFWQALEPA
                     HLKAFGYGKLTWEWEHGLRSYAFPLLFELTYRLVYLVSSFFRVLIDACTTPIARYLLS
                     KGCSETHVKDLLKIFYELPEVLEYHGVIYAPKLVMAFIAAVGEYYTIQLVQKLYLLSL
                     DKSKDSKASRLSKIKKFALVLTLTNFFNSFIITRTFINSFEMVLTCVALFYWDWTGGE
                     CIQGFDFTKSLLIGIFTCLQRPSNAVIWMTLGGFLICRLVQQQKYDRLAYLLRKLFTV
                     FTLTVLLNCIIDYYFYGELVFPIFRFLKFNFTSPLSNFYGVSPWHFHITQSVPITLGL
                     STPLFVYGLFAPSSKRKYSSVFIDPMLQIKFIIFAVLLSLSYLPHKEFRFIYPLQPFF
                     TSIASLGLSKLADSYNPKSKMVRELVWGFPFISIFAALFLNTFNEAGVVSVTKFLHEI
                     PTVQSVGFIMPCHSTPWQSYLHRNDIKDLWAISCDPPLHLLNDPDAYNKLPHYMDESD
                     YLYENIPSFIHKNFPPVCQKNESEDTKSYSHQWPEYLVIFEHLKYGYFASLLEDSPYV
                     EVYRGFNSFFHWDSRRQGDVLVYKILIEN"
     gene            <507120..>509870
                     /gene="TDEL0G02660"
                     /locus_tag="TDEL_0G02660"
                     /db_xref="GeneID:11504849"
     mRNA            <507120..>509870
                     /gene="TDEL0G02660"
                     /locus_tag="TDEL_0G02660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682796.1"
                     /db_xref="GeneID:11504849"
     CDS             507120..509870
                     /gene="TDEL0G02660"
                     /locus_tag="TDEL_0G02660"
                     /inference="similar to DNA sequence:INSDC:YGL141W"
                     /note="similar to Saccharomyces cerevisiae HUL5 (YGL141W);
                     ancestral locus Anc_2.335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682844.1"
                     /db_xref="GeneID:11504849"
                     /db_xref="GOA:G8ZZ08"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ08"
                     /translation="MFNFTGQSRRRNVNLGNKSATTKQDLLLKAQQERQRRAKDRQNE
                     AACKVIQCYIRRHLLIKDVIRNFTVTMNHEQVFHLILVFGGRLVDHLEHQSLAEILYD
                     SKDVLRNYPGYLGNKKLCSMISRYMDDFLIERTIECLNFSFPVEQDYVNSLISFIRNT
                     QTLSYNSTSHICEVLLKWGLNQSIYLDPLFEIRSEEAKEPSTLYGFYQAINSYGILPS
                     TGSHSSVILENLAYIYSHTTQKQPVEICLAACFKNMVYLPQNSEMQYYVTQLYEKRFV
                     DRLANLLEQGNVPDVTIESLISFINCAPTDTLRDSVMITLLSRPSFLKKLYSDVSQTA
                     FDKNDFQSSASFSIFVRLLEMYLLVSTDHELLSESSGFTVNDLVAFSTRLKDFVFNNL
                     WNLTAESRPKILDDTLPLLRKIYLRDSRLHFCRQRKEVDYWSSDNSDFLQVSPFKYIE
                     DYEGLYREYADRRDDTYNDHEDQDATYEASSIKFRILTRLMSTYKSSVSTRQFKKLEI
                     LIKAPFFIPFEQRVDLFYMFIALDKQRLHLDDNSAMMSMLMPWGANNGIGRQSATISR
                     ENMLEDACNAFNSIGERFKAKLAVTFVNEFGPEAGIDGGGITKEFLTSVAEEGFSNTR
                     HELFQTNDQHELYPTTAVNSQKLRYLWFLGKILGKCLYDHVLIDVTFADFFLKKMLNP
                     SSRFTSSFDDLHSLDAILYSNLVKLLSMTAEQLEELDLSFEINSPNGTGSVVELIPNG
                     SKVKVRKDNVLLYIIKVADFKLNKTLYRQTQNFHGGMSMIIAPHWMEMFNSVELQMLI
                     SGGGKDIDLVDLKNNTEYGGFLENDKTINDFWTILQEFKPEERLNFIKFVTSVPRAPL
                     QGFQSLEPKFGIRNAGRDLERLPTASTCVNLLKLPDYQDKELLRDKLLYSINSGARFD
                     LS"
     gene            <510213..>511856
                     /gene="TDEL0G02670"
                     /locus_tag="TDEL_0G02670"
                     /db_xref="GeneID:11504850"
     mRNA            <510213..>511856
                     /gene="TDEL0G02670"
                     /locus_tag="TDEL_0G02670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682797.1"
                     /db_xref="GeneID:11504850"
     CDS             510213..511856
                     /gene="TDEL0G02670"
                     /locus_tag="TDEL_0G02670"
                     /inference="similar to DNA sequence:INSDC:YMR171C"
                     /note="similar to Saccharomyces cerevisiae YMR171C;
                     ancestral locus Anc_2.336"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682845.1"
                     /db_xref="GeneID:11504850"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR027713"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ09"
                     /translation="MISHEIALWVLPILSASPQVSGYVIRRDSQTLQGTTDSGYNVQK
                     GESGFDKYPDGYGEDELDMDIMIFSLISMALLYVFICLIYVIIKFVVRKLMTDNTRIS
                     LLDDDENSRPRRITEQLNARWPSALDDENSVRDKLAKLSPEEQFYYKQGEEYIKQNPP
                     LLVPHESPASGHIEDPVMDESTRQYINDEGAFAWEFQPDSNLPNDTVIVENKTEVTFL
                     NYNYEASVMTNLPIPRINRVYYCEFKIFEVNTNAESSHGPHQLEDNEVISLGLSTCPY
                     PYFRLPGKHHHSIAYDSNGSRRFNDSFELDPVLRTLFPRLQKGDVVGIGYRSNSGTVF
                     FTRNGKKLKEDTAGGHIKGWKFKYLYPIVGANIPCKIHVNFGTYGFVYIEANVKKWGY
                     AKSNGMKLPPPSYEEYGQDTLLESGCEDEGSDNETSSSINDGDIVDSHGELLPPPPGF
                     EYSTSPNDQNLAMHEEIDLHSLPAEPPSYSDDETFLKIKSDAPRVGNSFHQGTDEDDA
                     GGYTDDEEDEDEEHNCIEGGSRSRQNINGNTLANQFIQD"
     gene            complement(<512112..>513647)
                     /gene="TDEL0G02680"
                     /locus_tag="TDEL_0G02680"
                     /db_xref="GeneID:11504851"
     mRNA            complement(<512112..>513647)
                     /gene="TDEL0G02680"
                     /locus_tag="TDEL_0G02680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682798.1"
                     /db_xref="GeneID:11504851"
     CDS             complement(512112..513647)
                     /gene="TDEL0G02680"
                     /locus_tag="TDEL_0G02680"
                     /inference="similar to DNA sequence:INSDC:YDL106C"
                     /note="similar to Saccharomyces cerevisiae PHO2 (YDL106C);
                     ancestral locus Anc_2.337"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682846.1"
                     /db_xref="GeneID:11504851"
                     /db_xref="GOA:G8ZZ10"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017970"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ10"
                     /translation="MSDFHHYDDNFASHFNSEEFGLLSPEQQEQHLHREGNSERTRSV
                     SMNGENDITNGGIIPEGSYDEGHNDSSREVGTSAANGSPNLDNKKGSKPKRTRATGEA
                     LDFLKKEFEANPNPTSQRRKKISELTGLPEKNVRIWFQNRRAKLRKSGQAKGGMGELA
                     DTATGMMTYDASEECPAYFDKIPLNINNNYYFIDICSITVGSWNRMKSGALRRENLPT
                     IRDLSNLSPISINQIMSNATDMMVLISKKNFEINYFFSAMANNTKILFRIFFAINSVV
                     NCSLTLEASDIMDSGSRKENDDEHESNDDLGNRGGNGDDGSSDNGAGSIGELKVTVSR
                     PPNFAVYFLDSTDQGINNQWSICEDFSEGRQVNDAFIGGSNMPHSLKGSQSSLKFMNS
                     LIVDYNSTNQILPPPPMNSQNQGIVEPQPVTLQPPSQTFFDQYDAANDILSLNRDTSG
                     INVGANRDTTHMNDDKVDSDTHNDNGTHTANLLSLPQDSQIPNIPDFFKNPSELHDEH
                     RWL"
     gene            <514487..>516001
                     /gene="TDEL0G02690"
                     /locus_tag="TDEL_0G02690"
                     /db_xref="GeneID:11504852"
     mRNA            <514487..>516001
                     /gene="TDEL0G02690"
                     /locus_tag="TDEL_0G02690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682799.1"
                     /db_xref="GeneID:11504852"
     CDS             514487..516001
                     /gene="TDEL0G02690"
                     /locus_tag="TDEL_0G02690"
                     /inference="similar to DNA sequence:INSDC:YMR169C"
                     /note="similar to Saccharomyces cerevisiae ALD3 (YMR169C);
                     ancestral locus Anc_2.339"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682847.1"
                     /db_xref="GeneID:11504852"
                     /db_xref="GOA:G8ZZ11"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ11"
                     /translation="MSLTETITIPQVGFTYNLPIGLFINNEYVASADGKKIDTINPST
                     GEKITSFYAASEKDVDKAVKAARNAYENVWSKMPAEERGFLLYKLADLIERDKSKLAA
                     LETLDAGKPYHSNALNDLDQIIQLTRYFAGSADKYTKGQNIPLTHDKYALTFKVPYGV
                     VGQVVPWNYPLAMASWKIQGCLAAGNTIVIKPAENTSISLLYMAQLFVEAGFPPGVLN
                     VIPGLGSVAGTALASHQDVDKIAFTGSTQVGQKIMELAGKSNLKAVTLECGGKSPAVV
                     FDDAKLNNAVEWVANGIYYNSGQNCTANSRIYVQETIYDEFLAKFRTYIKDNWTFGDK
                     LDPFDEKCTLGPVISEAQYKKIRAYLDHGANEEKLNSEKLSEFPTKSKGYFIPPTFFT
                     DVPSSSKLSQEEIFGPAAVIAKFRDYDEAIKLANNTNYGLASAVFSENIRTTNKFVRD
                     IKAGTVWVNSSNDEEISVPFGGFKMSGVGRELGESGVDAYTQLKSAHINLADYN"
     gene            <516198..>518042
                     /gene="TDEL0G02700"
                     /locus_tag="TDEL_0G02700"
                     /db_xref="GeneID:11504853"
     mRNA            <516198..>518042
                     /gene="TDEL0G02700"
                     /locus_tag="TDEL_0G02700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682800.1"
                     /db_xref="GeneID:11504853"
     CDS             516198..518042
                     /gene="TDEL0G02700"
                     /locus_tag="TDEL_0G02700"
                     /inference="similar to DNA sequence:INSDC:YMR168C"
                     /note="similar to Saccharomyces cerevisiae CEP3 (YMR168C);
                     ancestral locus Anc_2.340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682848.1"
                     /db_xref="GeneID:11504853"
                     /db_xref="GOA:G8ZZ12"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ12"
                     /translation="MPLSGVQKSKHPCSVCAKRKVKCDRLIPCTNCVKRGLEKDCLEK
                     PAGGQSDAIDDFLPRILRFWQKYEYWVGDIALSKSANFDTTEKQIDLQEELKECEYWC
                     NFLSREQSFALLDYSIERLGVLYFGCVSDISELYLILEMYWYRREHKNEKDVVLTVDA
                     HYSDALVWSIFCLAVHYMPSKTLHTIFPILPQHELFKPLDHGYDFEDRFQRNLSRCFE
                     RCTTTLLLMTNFTANSDIRLIQIYLILSSTMYPHRRNNSSDSLLLQSFHTAKIKHVND
                     FKPLISDSAALRLTKVTCEKMWYRLCTCDYLQSSPNKPITFHTELSSLLQHAAYLEDL
                     PTTDVYQSEDSFEVFYWKVLSLDRDLDQYLTKELKPPLKTLDAVQRQVEIFSRKLSSP
                     EESTSLDSEFARFLISYLVDGVSWKLHKMFFIYYGISASLGKSIHFAKSLIALVIKNM
                     KLQKELFNRHPIVIWSLARVALFYRFLEMFDSSAEVQDINLDVSDILHYLPKGFTPHL
                     NELIYLLERLQMLKDMWEYTGDAELRKTFSHPVFRILQSDIDTVSQQYTERPSMISGS
                     GPLRTQKVSSNLEKDTGNISDSYSSLIERFQEQCQFDIQVLASLENFV"
     gene            complement(<518016..>520208)
                     /gene="TDEL0G02710"
                     /locus_tag="TDEL_0G02710"
                     /db_xref="GeneID:11504854"
     mRNA            complement(<518016..>520208)
                     /gene="TDEL0G02710"
                     /locus_tag="TDEL_0G02710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682801.1"
                     /db_xref="GeneID:11504854"
     CDS             complement(518016..520208)
                     /gene="TDEL0G02710"
                     /locus_tag="TDEL_0G02710"
                     /inference="similar to DNA sequence:INSDC:YMR167W"
                     /note="similar to Saccharomyces cerevisiae MLH1 (YMR167W);
                     ancestral locus Anc_2.341"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682849.1"
                     /db_xref="GeneID:11504854"
                     /db_xref="GOA:G8ZZ13"
                     /db_xref="InterPro:IPR002099"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR011186"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ13"
                     /translation="MVSSIRPLDESVVNKIAAGEIIISPMNALKEMMENSIDAGATAL
                     DILVRDGGMNLLQVTDNGSGINKEDMPLLCERFTTSKLTKFEDLESIATYGFRGEALA
                     SISHIARVTVTTKTVEDKCAWRVSYAEGRIIGEPKPVAGKDGTVILVEDLFYNMPSRL
                     QALRSPSEEYAKILDVVGRYSVHCDHVAFSCKKFGDSQFSSTVRADSSTEERIRVVFG
                     NAVARSLLHFEMKPLEELDITRVTGKVSNLDFTFKKSTTPVFFINNRLVTCNPLARAL
                     RQIYANHLPKGSKPFIYLSIQINPQVLDVNVHPTKREVRFLHQDEIIEKIAHELNDVL
                     SNIDSSRSFKASTILTGKSLNSTQRTSSRASSAISKSSQPQIRGYALNAPTIVKRHEN
                     KLVRTDASQAKITTFLNPGQSQAASQQTAEEQILEYPELTDNKQPTGSAAEDTQVHSS
                     QVAAHNDKALNYQNSAQERVDVNLSSVKRLREAVDNSAHRDLTDIFANLIFVGVVDPE
                     RRLASIQHDLKLFLVDYGAICYELFYQICLTDFANYGKIIVESESDDDLKLVNILSGF
                     EHLTKDFALTIVQKLWDMREMLAEYFAIDFTAHTEAPNLEEIKLKSIPLLLKGYTPPF
                     AKLPFFIYRLGTKVNWDNEEPCLDGIMRQISLLYIPEVIELVDTSNEDVLKEERIHFV
                     TRSEEMSSALENVLFPCIKRRFLAPHNLLKDVIEIANLPGLYKVFERC"
     gene            <520758..>521924
                     /gene="TDEL0G02720"
                     /locus_tag="TDEL_0G02720"
                     /db_xref="GeneID:11504855"
     mRNA            <520758..>521924
                     /gene="TDEL0G02720"
                     /locus_tag="TDEL_0G02720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682802.1"
                     /db_xref="GeneID:11504855"
     CDS             520758..521924
                     /gene="TDEL0G02720"
                     /locus_tag="TDEL_0G02720"
                     /inference="similar to DNA sequence:INSDC:YDL105W"
                     /note="similar to Saccharomyces cerevisiae NSE4 (YDL105W);
                     ancestral locus Anc_2.342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682850.1"
                     /db_xref="GeneID:11504855"
                     /db_xref="GOA:G8ZZ14"
                     /db_xref="InterPro:IPR014854"
                     /db_xref="InterPro:IPR027786"
                     /db_xref="InterPro:IPR029225"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ14"
                     /translation="MPPMPPRGTKRPHEDDTEGTADGDRLMDGERRGEAVEFEVLQAY
                     RTFEDEMSKEKAKAARTGDIHIAIKSLDEVDSLFSKVSGSKNNGLLAHDARAIVSISE
                     LAQMSVRNLKFDDSRSLVNLEDVLNCCKRYMLGSFFSLNGITESVSPSAQALEHTDTA
                     DSERERTPVDGEENTPVDDGSDRLKLSSKRKSYLQQFATYEEFHQFNWFKMGSLFDIV
                     SRNVAIVDHLSGPLSLQRKERAPITRRARQLDGNSEVETASKVSAESLATEELTTPVL
                     VRECYKKVKQKKGHDPINLFKLVIDPFSYAKSVENLFYTSFLIKEGHLVMQEDDEGFP
                     SVRVKESLPADPDARKLEALKRRNTAQNHIIFQLDMPTWKSLIDIYGITSAFLD"
     gene            complement(<521962..>523128)
                     /gene="TDEL0G02730"
                     /locus_tag="TDEL_0G02730"
                     /db_xref="GeneID:11504856"
     mRNA            complement(<521962..>523128)
                     /gene="TDEL0G02730"
                     /locus_tag="TDEL_0G02730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682803.1"
                     /db_xref="GeneID:11504856"
     CDS             complement(521962..523128)
                     /gene="TDEL0G02730"
                     /locus_tag="TDEL_0G02730"
                     /inference="similar to DNA sequence:INSDC:YDL104C"
                     /note="similar to Saccharomyces cerevisiae QRI7 (YDL104C);
                     ancestral locus Anc_2.343"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682851.1"
                     /db_xref="GeneID:11504856"
                     /db_xref="GOA:G8ZZ15"
                     /db_xref="InterPro:IPR000905"
                     /db_xref="InterPro:IPR017860"
                     /db_xref="InterPro:IPR017861"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ15"
                     /translation="MTLRPVRWPVRAINPFSRLQRSYKVLAIETSCDDTCVAVLDRKN
                     SKTAPEVLVHLKNTLDSSSQGGIVPTKAHLHHQLKIGGLTQRALQLSNFPKIDLICVT
                     RGPGMPGSLSGGLDFAKGLSVAWQKPLLGMHHMLGHLLVPRMETNGERPSYPFLSLLV
                     SGGHTTVVLSQSITDHEIICDSMDIAVGDSLDKCGRELGIKGTMIAKEMEKFIDEDPS
                     CAHDTEIQMVMPNPLKNKHNRVDLQAFSFAPFLTAVRNNLKQPIENYTIKQIRSMAYQ
                     TQEAIFNHIMTRLSKVIALNRDKLIGVRHLVCSGGVGANKRLRHLLETKLCPNFETFH
                     YPPLDLCTDNAVMIGWAGIELYESKKFSTELEVSPIRKWPLSELLTVPGWTTVD"
     gene            <523615..>524700
                     /gene="TDEL0G02740"
                     /locus_tag="TDEL_0G02740"
                     /db_xref="GeneID:11504857"
     mRNA            <523615..>524700
                     /gene="TDEL0G02740"
                     /locus_tag="TDEL_0G02740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682804.1"
                     /db_xref="GeneID:11504857"
     CDS             523615..524700
                     /gene="TDEL0G02740"
                     /locus_tag="TDEL_0G02740"
                     /inference="similar to DNA sequence:INSDC:YMR166C"
                     /note="similar to Saccharomyces cerevisiae YMR166C;
                     ancestral locus Anc_2.344"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682852.1"
                     /db_xref="GeneID:11504857"
                     /db_xref="GOA:G8ZZ16"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ16"
                     /translation="MWQFTSSIPVVHKHNDHAHAKPAITNAYGATGSGDDKGKESEFE
                     DAETNSSIFHCAVAGGLGGAIGDTAMHSLDTVKTRQQGAPSAGKYKNMLTAYRTIFAQ
                     EGVRRGLYGGYGAAMLGSFPSAAIFFSTYEYSKRKMIDDWQVNETATHLTAGFLGDLV
                     SSIVYVPSEVLKTRLQLQGRYNNPFFDSGYNYKNLRDTISTIVKTEGVGALLFGYKAT
                     LARDLPFSALQFAFYEKFRQWAFAIEGKDIGADDLSVAGEIYTGASAGGLAGIITTPL
                     DVIKTRVQTQQPSSADVSSAKPLKLSGSLFGSLRTVYTSEGFFGFFSGVGPRFVWTSI
                     QSSIMLLLYQMTLRSLNNSFSKVEKLK"
     STS             524224..525904
                     /standard_name="AI429574"
                     /db_xref="UniSTS:160383"
     gene            <525110..>527512
                     /gene="TDEL0G02750"
                     /locus_tag="TDEL_0G02750"
                     /db_xref="GeneID:11504858"
     mRNA            <525110..>527512
                     /gene="TDEL0G02750"
                     /locus_tag="TDEL_0G02750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682805.1"
                     /db_xref="GeneID:11504858"
     CDS             525110..527512
                     /gene="TDEL0G02750"
                     /locus_tag="TDEL_0G02750"
                     /inference="similar to DNA sequence:INSDC:YMR165C"
                     /note="similar to Saccharomyces cerevisiae PAH1 (YMR165C);
                     ancestral locus Anc_2.345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682853.1"
                     /db_xref="GeneID:11504858"
                     /db_xref="InterPro:IPR007651"
                     /db_xref="InterPro:IPR013209"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ17"
                     /translation="MQYVGRAIDSVSKTWSSINPATLSGAIDVIVVDHPDGTLACSPF
                     HVRFGKFQILKPSQKKVEVIVNGKSTNIPMKLGDSGEAYFVFQTSSDFHGIPNDLLAS
                     PVVSATSSPSQSPHSSSTRLDSDTANEAGKSEDKKVLEEPDFLDINDAGSTEDRTHST
                     ISSNSNSPTPVSRTKMFQEKLNKRLTQIHIPSTLENNGDLLLDIEGYKPNKDMMHDTD
                     NQLKQLLQDELGNESDISNFVKEDGKGNIRIVNPYEHDHLTPPGSPLLLTDESSSNMD
                     SRPETADSTTVSSDVESHNESQEPVGTSCGQQYIKTLRLSSDQLKCLDLKYGENDLTF
                     SVDQGRAVVTSKLFVWRWDIPIVISDIDGTITKSDALGHVMTMIGKDWTHSGVAKLFT
                     EIYRNNYNVLYLTARSAGQADSTRSYLRSIVQNGNKLPLGPVILSPDRTMAALRREVI
                     LKKPEVFKIACLNDIRSLYFRPQEKPNNSNDGRGEDEEEEDPDERPTPFFAGFGNRIT
                     DALSYRTVGIPSSRIFTINPDGEVHMELLELAGYKSSYVFINELVDHFFPPVVRSDDE
                     MGSITSMTPGSPANNTLDLDGNADSNILMRKKQEKKFTDVNFWREPILDIDDLSDISQ
                     SDDENNTSNKGPENLTNAFKGKASEDSTKKNESRRFSLIGRSAPDRTDDVGTLHVRQN
                     ADENAYGKNFSTPKKNRRPSSKEEIGKQIYLELGSPLTSPRLNHIDSRDLDDHLKNFS
                     ISRPAPAIAGVSKVNVMDDNHSVTSDETSAHQPDHITNRNDEGEEDDSMDDEFDEDDF
                     ID"
     gene            <527906..>528520
                     /gene="TDEL0G02760"
                     /locus_tag="TDEL_0G02760"
                     /db_xref="GeneID:11504859"
     mRNA            <527906..>528520
                     /gene="TDEL0G02760"
                     /locus_tag="TDEL_0G02760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682806.1"
                     /db_xref="GeneID:11504859"
     CDS             527906..528520
                     /gene="TDEL0G02760"
                     /locus_tag="TDEL_0G02760"
                     /inference="similar to DNA sequence:INSDC:YMR164C"
                     /note="similar to Saccharomyces cerevisiae MSS11
                     (YMR164C); ancestral locus Anc_2.346"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682854.1"
                     /db_xref="GeneID:11504859"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ18"
                     /translation="MNDLKDGQDEVKVVVSDAMAKNSRQLLNAHVYNYLIVNERFDTA
                     RQFLLEADVPVFEERNRSNEERVRRKQELNGDLLPAKMLMDCKETFLYEWWESFDSLQ
                     KFVDNTPSETFKSRNSLSEPIVPLAAPNNMSTYNMMGMRTPQGPPPSSMPRNTGSMPH
                     QVPSVSNNASPSFIPNGPYANFEVNEDGTPNFYSQDNAVFSRQR"
     gene            529075..529148
                     /gene="TDEL0Gtrna7V"
                     /locus_tag="TDEL_0Gtrna7V"
                     /db_xref="GeneID:11504860"
     tRNA            529075..529148
                     /gene="TDEL0Gtrna7V"
                     /locus_tag="TDEL_0Gtrna7V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:11504860"
     gene            <529379..>531505
                     /gene="TDEL0G02770"
                     /locus_tag="TDEL_0G02770"
                     /db_xref="GeneID:11505334"
     mRNA            <529379..>531505
                     /gene="TDEL0G02770"
                     /locus_tag="TDEL_0G02770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682807.1"
                     /db_xref="GeneID:11505334"
     CDS             529379..531505
                     /gene="TDEL0G02770"
                     /locus_tag="TDEL_0G02770"
                     /inference="similar to DNA sequence:INSDC:YMR163C"
                     /note="similar to Saccharomyces cerevisiae INP2 (YMR163C);
                     ancestral locus Anc_2.347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682855.1"
                     /db_xref="GeneID:11505334"
                     /db_xref="GOA:G8ZZ19"
                     /db_xref="InterPro:IPR026235"
                     /db_xref="InterPro:IPR026859"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ19"
                     /translation="MREEVKEPSIQFPGLQIFSSWKVGSPSGRGLQRIPSKPAFNSQF
                     LPSEETLATVSHNDSPLAPHASWIKFPERKSTELHDYSPTVVGSDCFERYEVAEKTQV
                     TDFWTRITDGIFKDLFCDSDGQFHEEFQYTVISSDFLNDPEGFRFSFTGKKSIMDFHK
                     PLEVRQPWTTMPTKYGRLTISLPGKFILQRTFDYSATIFSALKVLKGIHRLKTRKVNC
                     KRILATVLIALYLVVQQGNFHAQYTRYKALVSLKATLKALQELSVLCHKYHIKLKELS
                     IYKPLTKSLPNCGPDSTILKIKDLLSSCLDLLFYKLKDMTQNLVLLCSTTSLAKYCEI
                     YNLEMSDLFHYFNEPAIEVEEKAKRVLTAKKFMLCTLLSFNYENDTCNAPITNFLMKA
                     FPDYEYNYEKLSPVKNINKYREVTENMQQLKDLVIPLTASLINHKSILFSTVETPPDS
                     ADAINDNYNINGPCKNRQLYMTLHSLRKLENTLIASEEEEVSQKTKEVVKCQLQQILS
                     AWQSYDTTKPDKRQPQISSPNPGFSLNILRRRSSLQGHKAVGDEKPRLRGKVDFEQVD
                     ETHSDIEYDSDNEHPKHDVTLGVCYEKVHADSVLTANDNIARKNQELRELSDEELRRK
                     LDEGILKLAVENKQGREKLRTQKSFELLKRLKKNKTTKSNRHTSILSVDDSLDGKSRP
                     LYQAKFSSEDSIPVLYELEELLENRQ"
     gene            complement(<531606..>533033)
                     /gene="TDEL0G02780"
                     /locus_tag="TDEL_0G02780"
                     /db_xref="GeneID:11504861"
     mRNA            complement(<531606..>533033)
                     /gene="TDEL0G02780"
                     /locus_tag="TDEL_0G02780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682808.1"
                     /db_xref="GeneID:11504861"
     CDS             complement(531606..533033)
                     /gene="TDEL0G02780"
                     /locus_tag="TDEL_0G02780"
                     /inference="similar to DNA sequence:INSDC:YDL103C"
                     /note="similar to Saccharomyces cerevisiae QRI1 (YDL103C);
                     ancestral locus Anc_2.348"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682856.1"
                     /db_xref="GeneID:11504861"
                     /db_xref="GOA:G8ZZ20"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ20"
                     /translation="MEVRKLYEQAGQGQLFDHWESLSPSDQQALVQNLSSVASKNDPK
                     KLVSDCQQAISLSKTMANQGGSIEPLPASSYQSVIGDEKAKQEYWQLGLDAIIKGEVG
                     VILMAGGQGTRLGSSQPKGCYDIGLPSGKSLFQIQAEKILRLQTLTRTSHLIPWYIMT
                     SKPTRTDTEEFFKKHDFFGLKASQVTFFNQGTLPAFDLNGEKLLLASPTELVESPDGN
                     GGLYRALRDNKLLQDFAIKGIKHVYMYCVDNVLSKVADPVFIGFAIKHKFELATKAVR
                     KRDAHESVGLIATRQGKPCVIEYSEISKELAEARDADGLLQFRAANIVNHYYSVDLLH
                     RELDNWCTKIPYHIAKKKISFFNAETVETVKVTIPNGIKLEQFIFDVFPTVPLNKFGC
                     LEVERREEFAPLKNGRGSSNDNAETSRKAYLDLGTSRLKKAGATVKDGVEVEVSGKIS
                     YSGENLSQFKDHIFDKPNQILENCH"
     gene            <533320..>538224
                     /gene="TDEL0G02790"
                     /locus_tag="TDEL_0G02790"
                     /db_xref="GeneID:11504862"
     mRNA            <533320..>538224
                     /gene="TDEL0G02790"
                     /locus_tag="TDEL_0G02790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682809.1"
                     /db_xref="GeneID:11504862"
     CDS             533320..538224
                     /gene="TDEL0G02790"
                     /locus_tag="TDEL_0G02790"
                     /inference="similar to DNA sequence:INSDC:YMR162C"
                     /note="similar to Saccharomyces cerevisiae DNF3 (YMR162C);
                     ancestral locus Anc_2.349"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682857.1"
                     /db_xref="GeneID:11504862"
                     /db_xref="GOA:G8ZZ21"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ21"
                     /translation="MANAAGRRRRAGSLRTQMFNKHLYNKFTRSQEQHIELREISEGS
                     GNIDEANETTSIEELELEEEYNEEDEIGTPSLWNRFLDIVLNRTRTLRSKDGRHIPIT
                     LDHTTVEYLTYSCPNNDLLMDERLDKPYCDNQITSSRYTVFSFFPRQLYAQFSRLANS
                     YFFLVAILQMIPGWSTTGTYTTIIPLCVFMGISMAREAWDDFKRHRLDKEENEKLVSV
                     LTKTPLNNDALKEDDFSLNPQITGLGSVPDEIDSAARSTTSQGPLYTQFNNFQLLADR
                     HRVSIEKRQWKNIRVGDFVLLKQDDWVPADLLLLASDGSNSECFVETMALDGETNLKS
                     RQPHLELSKLTCAASGLANINARVTIEDPNIDLYNFEGNLELHGHQNDSFIKFPLSTD
                     NVIYRGSILRNTHNAVGMVIFTGEETKIRMNALKNPRIKAPKLQRKINMIVAFMVFVV
                     ATVSLFSYLGHVLDNKKFLNDGQAWYLMNQDAGVAATIMSFIIMYNTMIPLSLYVTME
                     IIKVIQSKLMEWDIDMYHAETNTPCESRTATILEELGQVSYIFGDKTGTLTDNKMIFR
                     KFSFCGSSWVHNVSSEDNLLNKQQSNISETNLDVVSYDGGELLDNLRHEEVQAGPSSV
                     NVGNSARRSVDYKGNSAATYTGRPSMRSLRGERSFSSEASSTARKRGGPPALKSSFDL
                     IKYIQKHPDELFSQKAKFFILSLALCHSCLAKKSDGSTQEDDAVEYQSSSPDELALVT
                     AARDLGYIVLGRNAKFLTIKSYPNGFDAEPQTDDYEILNYIDFNSQRKRMSVLVRMAD
                     HPDKVLLICKGADSIILERLRNRDFAYQKLDEINTNTKERKDAEAELIIQKRLSLERM
                     AATDDVISNRLRPSVSSNPRESLSLKAVRKSMSKKGNNHQDPEMQIESIDQFLDNIKR
                     TDDEIEDVIAHSRQSLHKQQLEKYSSRVSTDNGYRKAEIDFLRTSPTQTHFSSPDKTD
                     MDQYIGSDELIQSEEYVLERTLQAIDEFSTEGLRTLLYAYKWIDSSEYAGWEERYHLA
                     KTSLTDRKAKIDRIGAEIEDDLSLLGTTAIEDKLQEGVGESIEKIRRAGIKMWMLTGD
                     KRETAINIGYSCKLIYDYSTVVVFSTNEENMIAKMNAVTQEIDSGNVAHCVLVIDGAT
                     VALFESNPNLMSVFIELCTKTDSVICCRASPSQKALMVSNIRNTDKSLVTLAIGDGAN
                     DIAMIQSADIGVGIAGKEGLQASRSSDYSIGQFRFLIKLLFVHGRYNYIRTSKFVLCT
                     FYKEVSFYLTQLIYQRYTMFSGTSLYESWSLSMFNTLFTSLPVLCIGMFEKDLKPATL
                     LTVPELYSTGRTYQSFNFIVFFQWIIMGACNAVIVTFLNVTIWGETALTDNTLYPLGI
                     INYTALTFLINIKCQFVETHNRNWLAFASVAISCLGWLLWCCLLPRVRKNDPIYDVED
                     GLYQYFGDDITFYCSILVLTVLPVMIDIIYKTVKVMIWPTDTDIFAQLEKKSGIRKKL
                     EFGAYNEMKQGWTWERDPGTFQAYKDRVFPRSRASSRASSKNEGTSGGRSPSNTLSAS
                     DSDGTNTGQNEAENLSYDYDKYEMLPSGKLIKRKDLEPRPSQESSTKIATLIPKRLRF
                     SLRSDSEDDADVRAIIEQRMQDLE"
     gene            complement(<538403..>539080)
                     /gene="TDEL0G02800"
                     /locus_tag="TDEL_0G02800"
                     /db_xref="GeneID:11504863"
     mRNA            complement(<538403..>539080)
                     /gene="TDEL0G02800"
                     /locus_tag="TDEL_0G02800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682810.1"
                     /db_xref="GeneID:11504863"
     CDS             complement(538403..539080)
                     /gene="TDEL0G02800"
                     /locus_tag="TDEL_0G02800"
                     /inference="similar to DNA sequence:INSDC:YMR161W"
                     /note="similar to Saccharomyces cerevisiae HLJ1 (YMR161W);
                     ancestral locus Anc_2.350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682858.1"
                     /db_xref="GeneID:11504863"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ22"
                     /translation="MSSGSYTEDQEKIALEVLSKDRQAFYEVLQIERSASDNEIKKSY
                     RKLAIKLHPDKNPHPRASEAFKVINRAFEVLSDEEKRRLYDRLGRDPDDRNMPSASSS
                     GFRTASAGFPAGFENSFYSRRAATRDPGEDIFDFLFNMGGGGPFGHPFGGNAFGGHPF
                     MDGGATSFTFGPGGFKVHTNAPRRARQQQRQAEQDVQPDLYQSLRVLLPLLLLFLVPL
                     LERLLFG"
     gene            <540540..>543824
                     /gene="TDEL0G02810"
                     /locus_tag="TDEL_0G02810"
                     /db_xref="GeneID:11504864"
     mRNA            <540540..>543824
                     /gene="TDEL0G02810"
                     /locus_tag="TDEL_0G02810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682811.1"
                     /db_xref="GeneID:11504864"
     CDS             540540..543824
                     /gene="TDEL0G02810"
                     /locus_tag="TDEL_0G02810"
                     /inference="similar to DNA sequence:INSDC:YDL102W"
                     /note="similar to Saccharomyces cerevisiae POL3 (YDL102W);
                     ancestral locus Anc_2.351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682859.1"
                     /db_xref="GeneID:11504864"
                     /db_xref="GOA:G8ZZ23"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR025687"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ23"
                     /translation="MASDLKRPGEEDVTPDAPVMEKKLRLQSMDHGVGSEPVSTLEII
                     PTEDYRKYKDQRYKIKGDELHGTQMTTEFEEELSQMEHEFAATQEHDVMYAREPLPED
                     FSSKAYDISFQQLDAEQSTLTGFKDENTSTIVRFFGVTNDGHSILCNVTGFKHYLYVP
                     APNAGEALDPHQLDDFVKYLRENYDNAVDKIELVPKQSIWGYSGDSKLPFYKIYVTHP
                     NFVNKLRTAFEKGHLSYKSWFGTGTTTYDNIAYTLRLMIDCGIVGMSWITLPKNKYQL
                     IPENERVSSCQIEVRINYRDLVAHPAEGEWSHSGPLRILSFDIECAGRVGVFPEPQHD
                     PVIQIANVMSIAGAKKPFVRNVFTVGSCAAITGSQVFPHDSEEDMLKHWRDFVVAADP
                     DVIIGYNTSNFDFPYLIDRAKALKIETFPYFGRLKFVKQEVKEAIFSSKAYGTRESKN
                     VNIDGRLQLDLLQFVQREYKLRSYTLNAVSAHFLGEQKEDVHYSIITSLQNGDSETRR
                     RLAVYCLKDAYLPLRLMEKLMALVNYTEMARVTGVPFSYLLSRGQQIKVVSQLFRKCM
                     EIETVIPNMQSQGSDEQYEGATVIEPIRGYYDIPIATLDFNSLYPSIMMAHNLCYTTL
                     CNKATVDRMKLKQEEDYIITPNGDYFVTSKLRRGILPIILDELISARKRAKKDLKNEK
                     DPFKRDVLNGRQLALKISANSVYGFTGATVGKLPCLAISSSVTSFGREMIMLTKKSVE
                     EKYCVKNGFKHDAVVVYGDTDSVMVKFGTNDLKEAMDLGAEAAAYVSTLFKHPINLEF
                     EKAYFPFLLINKKRYAGLFWTSPEKYDKLDQKGLASVRRDSCPLVSIVMNKVLKRILI
                     QRDVDGALAFVKKTIDDILHNRADISKLIISKTLAPNYTNPQPHAVLTERMKKRDGVG
                     PNVGDRVDYVIMGGNDKLYNRAEDPLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIG
                     EKQANAMFVVKSIKINTGEMKGGLMGFIKKVDSCKSCRSPLRSGEGPLCSKCSVRSGE
                     LYIKALYNVRDLEEKFARLWTQCQRCAGTLHNEVLCSNKNCDIFYMRVKMKKELQESV
                     DQLSKW"
     gene            complement(<543911..>545476)
                     /gene="TDEL0G02820"
                     /locus_tag="TDEL_0G02820"
                     /db_xref="GeneID:11504865"
     mRNA            complement(join(<543911..545377,545450..>545476))
                     /gene="TDEL0G02820"
                     /locus_tag="TDEL_0G02820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682812.1"
                     /db_xref="GeneID:11504865"
     CDS             complement(join(543911..545377,545450..545476))
                     /gene="TDEL0G02820"
                     /locus_tag="TDEL_0G02820"
                     /inference="similar to DNA sequence:INSDC:YDL101C"
                     /note="similar to Saccharomyces cerevisiae DUN1 (YDL101C);
                     ancestral locus Anc_2.352"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682860.1"
                     /db_xref="GeneID:11504865"
                     /db_xref="GOA:G8ZZ24"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ24"
                     /translation="MDSSFSSKRGYPDQNTTTSKRVNTSQVALARLVNLIPGKDKNFE
                     LVEKPVITVGRSRQCDIMLNESDISTVHCEFYLIQMDVDGVKRTLLNIVDKSRNGTFI
                     NGSRLVKKDKILKNGDRLVLGKSCSFLFKYIFEDDERNVSIEQPKSDSVFEKPKVGFS
                     NSQSTLRRLTRPRPQSVFDNYVVGKELGVGHYATVKEGINKKTEQIVAIKIFHPQLND
                     DQKKNKQFKEETDILMRVKHSNIVKLLDSYVETVSKSQIQKYLVLEKIDDGELFDRIL
                     RKTSLRQDETKALFKQILTGLQYLHGMNIIHRDIKPENILLNITKRSDPKELQKGPWD
                     ADEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLRKTDYSSKVDMWSAGVLL
                     YVCLCGFPPFSDTLGPPSLKEQIAQGIFAFYSPYWDEIDDSVLHLISHLLVVNPTNRY
                     SVEDTIRHPWFDSDVLNKASSHDIKRQEVSPSKSLKTYSELSQIEGL"
     gene            complement(<546686..>548995)
                     /gene="TDEL0G02830"
                     /locus_tag="TDEL_0G02830"
                     /db_xref="GeneID:11504866"
     mRNA            complement(<546686..>548995)
                     /gene="TDEL0G02830"
                     /locus_tag="TDEL_0G02830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682813.1"
                     /db_xref="GeneID:11504866"
     CDS             complement(546686..548995)
                     /gene="TDEL0G02830"
                     /locus_tag="TDEL_0G02830"
                     /inference="similar to DNA sequence:INSDC:YMR160W"
                     /note="similar to Saccharomyces cerevisiae YMR160W;
                     ancestral locus Anc_2.353"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682861.1"
                     /db_xref="GeneID:11504866"
                     /db_xref="UniProtKB/TrEMBL:G8ZXN3"
                     /translation="MNESNEASKLTGWWSWWASRNPGEQQVTLQQDTTLSSAQAESTA
                     APDSPNSIQPTVGTPQASANDTGEEVPISDNVNGSWYNSIVSKVSSIGILNSRNDDLN
                     IAAGSHYSQLTESQIKRLGEDAIQKVAQRTNTWCWFENLTRINDDTKRWSERSGVISV
                     HGTGSEHCILPLRKYPIPDKNPGYNIYLRDSLIIPSSSPLEVLHTQSLPSKVAMTVKN
                     YYNFPNERHLYLKKNTDGILRSKKVLIISVVGNLPEKYEKQSLGEQRSAYYLSRKLAQ
                     SIEHEVPSSIFSLSLECPLDSKDIETVFTESTALLNNWKHIFAEVSSIFFVSVYHSVP
                     LAISLAKHILENHQSLQFDATIPVGLLAIESNLQGYRFWDHSSDAINVDEQNYQKMQQ
                     AKEKQLFQGVGKNEREILSNIRHYRKLDSKESKRVQHDLDWLLYHWSSFRLNLFGRIY
                     DNFMTATQKLAVNYSHPKIIRNLWCDGRYLGHDLKHLDKLGVPDVDIKTPNFECAIQV
                     PQNRLFEITLLNDILLALNLGHTKFVPILKLLSPYFISRSFNEYTVSPNLRKQTQSEL
                     KSWLQDMDVKWRTTNSSNQPHDELPETVSSVHKFLEFALYHDTRNPELVKFHSDIYDD
                     DMVYKNFIENTLKTRSPLIEKHLALLSDHSGPQSILNTVNQYDLVWKFHEFVSDYATL
                     YNLPRQHYPPELTFSISLDYSHWQPSYADPTMFHRNNQEAINRLKQIWVSYQDWDPPT
                     RGLKQLKNILSVLSLYSEASQLLQDIVGK"
     gene            <549141..>549539
                     /gene="TDEL0G02840"
                     /locus_tag="TDEL_0G02840"
                     /db_xref="GeneID:11504867"
     mRNA            <549141..>549539
                     /gene="TDEL0G02840"
                     /locus_tag="TDEL_0G02840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682814.1"
                     /db_xref="GeneID:11504867"
     CDS             549141..549539
                     /gene="TDEL0G02840"
                     /locus_tag="TDEL_0G02840"
                     /inference="similar to DNA sequence:INSDC:YMR159C"
                     /note="similar to Saccharomyces cerevisiae ATG16
                     (YMR159C); ancestral locus Anc_2.354"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682862.1"
                     /db_xref="GeneID:11504867"
                     /db_xref="InterPro:IPR013923"
                     /db_xref="UniProtKB/TrEMBL:G8ZXN4"
                     /translation="MDKRLIERLAKRDEIEGRYAELFQKVSLTDQNLKKGDASRDTDS
                     TRDLLNSTIARLRKELKDKDTNVNRLKEVIEVKKQDSEKLNNEIISLTIENNLTSKRF
                     ADLEEEHDKLVKRWVARVQQDVDKLNAGFD"
     gene            549959..550031
                     /gene="TDEL0Gtrna2M"
                     /locus_tag="TDEL_0Gtrna2M"
                     /db_xref="GeneID:11504868"
     tRNA            549959..550031
                     /gene="TDEL0Gtrna2M"
                     /locus_tag="TDEL_0Gtrna2M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:11504868"
     gene            complement(<550159..>551220)
                     /gene="TDEL0G02850"
                     /locus_tag="TDEL_0G02850"
                     /db_xref="GeneID:11505323"
     mRNA            complement(<550159..>551220)
                     /gene="TDEL0G02850"
                     /locus_tag="TDEL_0G02850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682815.1"
                     /db_xref="GeneID:11505323"
     CDS             complement(550159..551220)
                     /gene="TDEL0G02850"
                     /locus_tag="TDEL_0G02850"
                     /inference="similar to DNA sequence:INSDC:YDL100C"
                     /note="similar to Saccharomyces cerevisiae GET3 (YDL100C);
                     ancestral locus Anc_2.355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682863.1"
                     /db_xref="GeneID:11505323"
                     /db_xref="GOA:G8ZXN5"
                     /db_xref="InterPro:IPR016300"
                     /db_xref="InterPro:IPR025723"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027542"
                     /db_xref="UniProtKB/TrEMBL:G8ZXN5"
                     /translation="MDLLTEPNLHSLITSSTHKWIFVGGKGGVGKTTSSCSIAIQMAL
                     AQPQKQYLLISTDPAHNLSDAFGEKFGKDTRKVTGMNNLSCMEIDPSAALKDMNDMAV
                     SRANQNGGSEEDGLGGLLQGGALADLTGSIPGIDEALSFMEVMKHIRNQEKGEGETYD
                     TVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITGKLGPMLNSLAGAGNIDVAGKLNQL
                     KENVETIKQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFA
                     DDDKEYNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLTNLKKFSQFLN
                     KEYDPIADGSIIYDLEEKN"
     gene            <551435..>552292
                     /gene="TDEL0G02860"
                     /locus_tag="TDEL_0G02860"
                     /db_xref="GeneID:11504869"
     mRNA            <551435..>552292
                     /gene="TDEL0G02860"
                     /locus_tag="TDEL_0G02860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682816.1"
                     /db_xref="GeneID:11504869"
     CDS             551435..552292
                     /gene="TDEL0G02860"
                     /locus_tag="TDEL_0G02860"
                     /inference="similar to DNA sequence:INSDC:YDL099W"
                     /note="similar to Saccharomyces cerevisiae BUG1 (YDL099W);
                     ancestral locus Anc_2.356"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682864.1"
                     /db_xref="GeneID:11504869"
                     /db_xref="UniProtKB/TrEMBL:G8ZXN6"
                     /translation="MSDQEDTRAKQLEEARKRVEELKKKSKKDKKKKKQAKNTEETKE
                     VSESEYLDKEATAELPEVTSAVEEEKTVEEDKAVEEEKAINEAEIQTADKADEAAELE
                     APSIAVLNSSVELAAAKESSNDASQLFDNDANDESDFMDTIKKQKEAEEIQRLKTELE
                     ATTAECKKLKFINMEHETTIEDLQSEVKHLQKQLQNNQQELQTALQNLTEAQSKLTLQ
                     QANDSAPLQFAQFPGSTNQKAVGDTYQEPSNEHYKPEVDRAALNKWRCWNVDMTSWRS
                     IGSGPIVEF"
     gene            complement(<552361..>552828)
                     /gene="TDEL0G02870"
                     /locus_tag="TDEL_0G02870"
                     /db_xref="GeneID:11504870"
     mRNA            complement(<552361..>552828)
                     /gene="TDEL0G02870"
                     /locus_tag="TDEL_0G02870"
                     /product="mitochondrial 37S ribosomal protein MRPS8"
                     /transcript_id="XM_003682817.1"
                     /db_xref="GeneID:11504870"
     CDS             complement(552361..552828)
                     /gene="TDEL0G02870"
                     /locus_tag="TDEL_0G02870"
                     /inference="similar to DNA sequence:INSDC:YMR158W"
                     /note="similar to Saccharomyces cerevisiae MRPS8
                     (YMR158W); ancestral locus Anc_2.357"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS8"
                     /protein_id="XP_003682865.1"
                     /db_xref="GeneID:11504870"
                     /db_xref="GOA:G8ZXN7"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="UniProtKB/TrEMBL:G8ZXN7"
                     /translation="MSLVKLANTCAHIQNCSRVRSTLTSIPYTKLHLQFAYNLYRHGF
                     ISSLQKGSTKGPDEVTVEITPDNISTRRLWIGLKYRENKPILSSCRLISKPSARVYLS
                     HNDMRKLCSGVTVRLIKPLQPGELILVQTRDSVVEINEAVAKKFDGQVLCRIK"
     gene            <553008..>553718
                     /gene="TDEL0G02880"
                     /locus_tag="TDEL_0G02880"
                     /db_xref="GeneID:11504871"
     mRNA            <553008..>553718
                     /gene="TDEL0G02880"
                     /locus_tag="TDEL_0G02880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682818.1"
                     /db_xref="GeneID:11504871"
     CDS             553008..553718
                     /gene="TDEL0G02880"
                     /locus_tag="TDEL_0G02880"
                     /inference="similar to DNA sequence:INSDC:YMR157C"
                     /note="similar to Saccharomyces cerevisiae YMR157C;
                     ancestral locus Anc_2.358"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682866.1"
                     /db_xref="GeneID:11504871"
                     /db_xref="UniProtKB/TrEMBL:G8ZXN8"
                     /translation="MLGVKAFARIRVLRASFFGLPKVGRRGVGSGIRWYASPAGYKKG
                     EDAPGFKKIFLVALVGTLMFVQAANSLDKNKPKTSFSEEEFENVMNGLKRRVAMFPAG
                     TLNVKFLPSSSESILKTIKAGPAAVIDPIEAVEHFRQQKDGIYEALLNDLKSKYGSDY
                     TKKLPSGMLVMLIGKYMKEKCSMNDEVVIVNFPDTIKDAIKFENEVCTVSKVLVPKID
                     TDSEVCRYYETVHKVKPL"
     gene            complement(<553764..>554321)
                     /gene="TDEL0G02890"
                     /locus_tag="TDEL_0G02890"
                     /db_xref="GeneID:11504872"
     mRNA            complement(<553764..>554321)
                     /gene="TDEL0G02890"
                     /locus_tag="TDEL_0G02890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682819.1"
                     /db_xref="GeneID:11504872"
     CDS             complement(553764..554321)
                     /gene="TDEL0G02890"
                     /locus_tag="TDEL_0G02890"
                     /inference="similar to DNA sequence:INSDC:YDL098C"
                     /note="similar to Saccharomyces cerevisiae SNU23
                     (YDL098C); ancestral locus Anc_2.359"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682867.1"
                     /db_xref="GeneID:11504872"
                     /db_xref="GOA:G8ZXN9"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8ZXN9"
                     /translation="MSSFGRRTWDRKEYAELAKQGQQTYEQSLRSSLTDVQLQQLKDK
                     YTDHHALMQGTMSGLNQNTLVTGVSSYKKGKQFGFYCELCNMTFKDNLQYIDHLNHKT
                     HEVKFEAVFDEPLVNDTRDNDDLRTEEFESFYIETVKHFVNDHQPKEKRVHKPRGKRP
                     KTTPSQDSSDISKMMGFGSFGGVKR"
     gene            <554413..>555168
                     /gene="TDEL0G02900"
                     /locus_tag="TDEL_0G02900"
                     /db_xref="GeneID:11504873"
     mRNA            <554413..>555168
                     /gene="TDEL0G02900"
                     /locus_tag="TDEL_0G02900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682820.1"
                     /db_xref="GeneID:11504873"
     CDS             554413..555168
                     /gene="TDEL0G02900"
                     /locus_tag="TDEL_0G02900"
                     /inference="similar to DNA sequence:INSDC:YMR156C"
                     /note="similar to Saccharomyces cerevisiae TPP1 (YMR156C);
                     ancestral locus Anc_2.360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682868.1"
                     /db_xref="GeneID:11504873"
                     /db_xref="InterPro:IPR006551"
                     /db_xref="InterPro:IPR013954"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G8ZXP0"
                     /translation="MSHKLTVLPYLIKFTPKACNTLNAPPTSLNIYAFDLDHTLIEPL
                     TPGSKFSRAADDWKFMSFTPGKSTFQKLIEIVREDPLAQIVIFSNQGGVVAVPPSSKS
                     CTKYTEKIKLILRKLSESTDGDKLSERLWVYASPKRPASMSLGKSKPKSKQPMITKYT
                     KSTKLTFDIDKITNDIDVKQYELFDVMRKPEIGMKDQFEQDLKSHFEVLPDVTWCYYC
                     GDAAGRPKDFSDSDKEFAHKLGISFKTPEELFT"
     gene            complement(<555197..>556474)
                     /gene="TDEL0G02910"
                     /locus_tag="TDEL_0G02910"
                     /db_xref="GeneID:11504874"
     mRNA            complement(<555197..>556474)
                     /gene="TDEL0G02910"
                     /locus_tag="TDEL_0G02910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682821.1"
                     /db_xref="GeneID:11504874"
     CDS             complement(555197..556474)
                     /gene="TDEL0G02910"
                     /locus_tag="TDEL_0G02910"
                     /inference="similar to DNA sequence:INSDC:YDL097C"
                     /note="similar to Saccharomyces cerevisiae RPN6 (YDL097C);
                     ancestral locus Anc_2.361"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682869.1"
                     /db_xref="GeneID:11504874"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="UniProtKB/TrEMBL:G8ZXP1"
                     /translation="MTELQKARDLVREKKYADAEKVYLELLRGAENETKEASTKSKNE
                     QEVCLLELGDLYVVTNDKAKLRDFIPQSTEYMMQFAKSKTAKVLKALIEDFEKVPDSY
                     DDQIYVCQKSIEFAKKEKRVFLQHSLSIKLATLYYLKKQYKDSLDLNKELLREFKKLD
                     DKPSLVDIHLLESKVYHKLRNLAKAKASLTAARTAANSIYCSTATIAELDLMSGILHC
                     EDKDYKTAFSYFYESFENFHNLSTHNSYEKACLVLKYMLLSKIMLNLIDEVKTILNAK
                     YTKETYQSRGIEAMKQVAKAYNSRSLLDFNAAMRQYKEEIMGDELIRSHFNALYDTLL
                     ESNLCKIIEPFECVEISHISKMIGLDLQQIEGKLSQMILDKVFFGVLDQGNGWLYIYE
                     TPHQDATYDCALELIGELDNVVDQLYEKASALY"
     gene            <556753..>559245
                     /gene="TDEL0G02920"
                     /locus_tag="TDEL_0G02920"
                     /db_xref="GeneID:11504875"
     mRNA            <556753..>559245
                     /gene="TDEL0G02920"
                     /locus_tag="TDEL_0G02920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682822.1"
                     /db_xref="GeneID:11504875"
     CDS             556753..559245
                     /gene="TDEL0G02920"
                     /locus_tag="TDEL_0G02920"
                     /inference="similar to DNA sequence:INSDC:YDL095W"
                     /note="similar to Saccharomyces cerevisiae PMT1 (YDL095W);
                     ancestral locus Anc_2.362"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682870.1"
                     /db_xref="GeneID:11504875"
                     /db_xref="GOA:G8ZXP2"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027004"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:G8ZXP2"
                     /translation="MSVKDEKRTSGVENDPMQPLEVKQGPVRPFVVSEPPKTLAAARS
                     TRSLKERLVVIGLAIFTVAIRLHDLSWPNQVIFDEVHFGGFASEYIKKDFFFDVHPPL
                     AKMIFAWIASLAGFTGDFEFKNIGDIYPSTTPYVLMRSWAATCGCLTVILLYFTLRAS
                     GVRMWVALASAVCFAVENSFVTISRYILLDAPLMLFIAGAVYAFKKYEVFPTDTYQSL
                     KYLVLTGVFLGFAASAKWVGFFTIAWVGLLCAFRLWFFIGDLTKPIRSTVKVAVIKGT
                     VLLGVPLIIYTMIFYIHFQTLTHDTAGSGFYSSEFRSTLEGNHIPSDILAEVGVGSTV
                     TLHHLNTRGGYLHSHLHEYPAGSKQQQITLYPHLDGNNEWLISLYNQTDAPLTSFENL
                     PDGTKIRLLHKVTSRRLHSHDHKPPVSENSDWQKEVSGYGFEGFDGDANDDWIIEIDK
                     DLSKPGPARDHVRALETKFRLKHAITGCYLFSHEVKLPKWGFDQQEVTCAHSGKPELL
                     LWYIEGNTNDLLPEDAERISYKPSSFLKKFLETNERMWTINKNLVDTHVYESMPSSWP
                     FLLRGIGYWTGEHRHVYLLGNAVLWWSVSSFIALFAMIIMFELGSWQVGKPILQDSDV
                     VNFHIQVSEYLLGFAVHIAPSFLMKRQLFLHHYLPAYYFGILAFGQALEAFVSYIFRR
                     AKTIGYAFILVFVASSIFFFKFYSPLTYGTAWTKDLCEKSQLLSGWDYTCDSYLNTYE
                     DYKNLNSTSVVAETAETIVNEPAVTSYANIEEVKESEELVEVDDFESLMNEPGEKKFL
                     DQNGNPLSPEEVQKLVEEQGGRIQKVQERSHD"
     gene            complement(<559519..>561396)
                     /gene="TDEL0G02930"
                     /locus_tag="TDEL_0G02930"
                     /db_xref="GeneID:11504876"
     mRNA            complement(<559519..>561396)
                     /gene="TDEL0G02930"
                     /locus_tag="TDEL_0G02930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682823.1"
                     /db_xref="GeneID:11504876"
     CDS             complement(559519..561396)
                     /gene="TDEL0G02930"
                     /locus_tag="TDEL_0G02930"
                     /inference="similar to DNA sequence:INSDC:YMR155W"
                     /note="similar to Saccharomyces cerevisiae YMR155W;
                     ancestral locus Anc_2.363"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682871.1"
                     /db_xref="GeneID:11504876"
                     /db_xref="InterPro:IPR010658"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G8ZXP3"
                     /translation="MGPAAPKRSALVWCFIGSNIVALGAGTPYLYSFYAPQLLRKCQL
                     PVSQLSTLPLSLNIGSALLGFLAGMVIDRNVKASCLIGAISTFCAYSILDYCYANESS
                     NLWLLCLGLALVGFGSVSGFYAAVKCCTTNFPHHRGTAGAFPVALYALAGMLFSYICA
                     KYFGEDIDKVFKFLAVVCSSMIFAGCLMLQILITPSQNRPKRKKSAVARVSRSSGPSR
                     DASQPIAIQGDSQSSQSNVYANGDRDGRSQSSSSSLASSFQSAFSGKRSASFLWSKEL
                     TGSLSFWGWGKVRDEEATESLPSSAGTLSHSRGPSYSSVILPSQGQRRESIPNKNRKD
                     SFIREDTGVTSNVLNLNPAKDSEETEEALEDREPSFWRDNHIVQTIRRPRFIAYFLVL
                     ATLQGIGQTYIYSVGFIVRTQIASTPGGQESFNAEKIQSLQVSIISLLSFSGRLCAGP
                     VSDLLIKKFKAQRLWNIVMAAALMIWASAQTLTPSNNSLKLFTSSAPANIKNISVCSA
                     MFGFAFGILFGTFPSIIADSFGTAGFSTIWGLSTSGGLITVKIFNAIFGADLGNNTQP
                     DRPYCEKGAGCYSHTFHIIMVCASVVMLATVGIITVTHHHHKRRKRLLNGELTLPRFT
                     T"
     gene            <561819..>562223
                     /gene="TDEL0G02940"
                     /locus_tag="TDEL_0G02940"
                     /db_xref="GeneID:11504877"
     mRNA            <561819..>562223
                     /gene="TDEL0G02940"
                     /locus_tag="TDEL_0G02940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682824.1"
                     /db_xref="GeneID:11504877"
     CDS             561819..562223
                     /gene="TDEL0G02940"
                     /locus_tag="TDEL_0G02940"
                     /inference="similar to DNA sequence:INSDC:YDL092W"
                     /note="similar to Saccharomyces cerevisiae SRP14
                     (YDL092W); ancestral locus Anc_2.364"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682872.1"
                     /db_xref="GeneID:11504877"
                     /db_xref="GOA:G8ZXP4"
                     /db_xref="InterPro:IPR003210"
                     /db_xref="InterPro:IPR009018"
                     /db_xref="UniProtKB/TrEMBL:G8ZXP4"
                     /translation="MVNEGCLSNEDFLSKVSEFFKNENEQVVHLTAKRLVTHDPVEGN
                     AEFDSVGNPLYDVSRKAQSIEVEKCSNEVYPILIRMWYGKRKCSTIVKTETLDKFWQD
                     YSSVVKGSMKGLIKKKKKKTKASGIKSKKERK"
     gene            complement(<562278..>563573)
                     /gene="TDEL0G02950"
                     /locus_tag="TDEL_0G02950"
                     /db_xref="GeneID:11504878"
     mRNA            complement(<562278..>563573)
                     /gene="TDEL0G02950"
                     /locus_tag="TDEL_0G02950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682825.1"
                     /db_xref="GeneID:11504878"
     CDS             complement(562278..563573)
                     /gene="TDEL0G02950"
                     /locus_tag="TDEL_0G02950"
                     /inference="similar to DNA sequence:INSDC:YDL091C"
                     /note="similar to Saccharomyces cerevisiae UBX3 (YDL091C);
                     ancestral locus Anc_2.365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682873.1"
                     /db_xref="GeneID:11504878"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR006577"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8ZXP5"
                     /translation="MDLIRRILHGGEPSFTPIPGEFASEGESANEGRTTHSSESQRLI
                     SRKRFFGLVLQTPFVLLYYVMNLIILLLSLVSPLCAIGGYYKKRHRRPTDPKSRLNNL
                     MECLNGESQRTFKQNVTEEGDATYSFGSLYNLENGSLSQDILQGSYTELLTACSEQCK
                     FAIIYLHDPLLDNSMEYVNNVLCSERFTTMIKKYQILLWFSDVTTSEGLQVANALRVR
                     QFPFLGVLCLKAEKKIEVIGRMEGDLNSYGPNHLDNILSKGYSRLIQVRQQRQNIALQ
                     RIIREQQDSRFEESLSVDRQRERERQAQMARETAQQERERQRKQWLLWKKTQLHPEPS
                     NGADACRVAIRLEDGGRIVRKFDASLTIDEIYAYVELYNEGLLDSAETSNGPPQAYDH
                     SYNFLLITPVPRRELSPTTIIRDESGLYPSGNIVMETLA"
     gene            complement(<563739..>564992)
                     /gene="TDEL0G02960"
                     /locus_tag="TDEL_0G02960"
                     /db_xref="GeneID:11504879"
     mRNA            complement(<563739..>564992)
                     /gene="TDEL0G02960"
                     /locus_tag="TDEL_0G02960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682826.1"
                     /db_xref="GeneID:11504879"
     CDS             complement(563739..564992)
                     /gene="TDEL0G02960"
                     /locus_tag="TDEL_0G02960"
                     /inference="similar to DNA sequence:INSDC:YDL090C"
                     /note="similar to Saccharomyces cerevisiae RAM1 (YDL090C);
                     ancestral locus Anc_2.366"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682874.1"
                     /db_xref="GeneID:11504879"
                     /db_xref="GOA:G8ZXP6"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR026872"
                     /db_xref="UniProtKB/TrEMBL:G8ZXP6"
                     /translation="MGTSATRIQYLRRNLLGRKREVVTRVISTEDEGDQNEIISIMKE
                     VETDTSIARDEVIEKCQALYEEAQTIPELHRDAHKKFLDASFTNDLPPQMAALDASQP
                     WLLYWTANSLRVLNEKYLTKEYQFRICEKLFAISPTGGPFGGGVGQLPHLASTYAAIN
                     ALALCENGEDYWDMVDEKAIYDWLISLKQENGGFKTCLGVGEVDTRGVYCALSVASML
                     GIMTDELTEGVVDFLVDCQSSEGGFGGCPHEDEAHGGYTFCAVASLHILDAIDRINIP
                     NLAKWCSQRQLDPERGLSGRSNKLVDGCYSFWVGGTAAVMELYGLDHLINKSSLRDYI
                     LYCCQNGSRPGLRDKPGTHPDLYHTNYILLGLALCENSFNLSDNGKAVQCKPLPVTAP
                     SHLSSINPIYGLPTKNVQKFISHFV"
     gene            <565141..>567243
                     /gene="TDEL0G02970"
                     /locus_tag="TDEL_0G02970"
                     /db_xref="GeneID:11504880"
     mRNA            <565141..>567243
                     /gene="TDEL0G02970"
                     /locus_tag="TDEL_0G02970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682827.1"
                     /db_xref="GeneID:11504880"
     CDS             565141..567243
                     /gene="TDEL0G02970"
                     /locus_tag="TDEL_0G02970"
                     /inference="similar to DNA sequence:INSDC:YMR154C"
                     /note="similar to Saccharomyces cerevisiae RIM13
                     (YMR154C); ancestral locus Anc_2.367"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682875.1"
                     /db_xref="GeneID:11504880"
                     /db_xref="GOA:G8ZXP7"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="UniProtKB/TrEMBL:G8ZXP7"
                     /translation="MDNWRLLNDLRKSVYCGKGGNHREKLEELVYLASKSNDEDLLKS
                     ALLLEKEIESVSTKQKILWLTSTVNGNFYPPLEVDLAGPVPWEGTHLLEPGSKNMESK
                     YPNRAPLKVEETSELLQCKDIDDCSFIATLICMRVENVDRPRVRQIAKNLYVVELHFN
                     GSKRLVTVDTSKIPTDTDGKQLSMHSSDIVDKIVELAYLQVKAQSYETSGSNCAVDAF
                     RLVGFLPEILDARDCDVKQLIRYFQSGLCLIALGTGPGVSKASEFLVGNHDYPVVAVG
                     KTSECLVIQDPLNPALHFEVNGDNLRRHYEQVYISWCHSKLFAYKTSLHFFYNGENCN
                     RFNSIVDKPTFILDNHSKIKEPVQILLETHLEGSCNSTSGTAYLKQLREDVLLDNSST
                     PDGATNIRLQLSKYELSPGQKIRLFCHSSKSSTFSIHAFSNSQQLTIMREAKRLEVSS
                     IEFEPNFSATTDSCDYFRNPTMMLRVESPISQEISVHLQLMSESPKDMINLQVYALND
                     HTLKRPMVTLARYEGQKCDIRDLALISNTSYKVVCSSYATPISSKFKLLATPSISSSH
                     ARITFNQIYQEFGGLPYHVEKTLEWSEDTNRIKVRLLSKNNNRCFIRIVPQVLPPLLS
                     IRCNVYDGETHQQICKTNDFLKPGLAGVVIDQLEIVDCSDIVLLIEKDDPKIQGKVLA
                     SLPFKLLIGSQSKLSLKD"
     gene            <567606..>569117
                     /gene="TDEL0G02980"
                     /locus_tag="TDEL_0G02980"
                     /db_xref="GeneID:11504881"
     mRNA            <567606..>569117
                     /gene="TDEL0G02980"
                     /locus_tag="TDEL_0G02980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682828.1"
                     /db_xref="GeneID:11504881"
     CDS             567606..569117
                     /gene="TDEL0G02980"
                     /locus_tag="TDEL_0G02980"
                     /inference="similar to DNA sequence:INSDC:YDL089W"
                     /note="similar to Saccharomyces cerevisiae YDL089W;
                     ancestral locus Anc_2.368"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682876.1"
                     /db_xref="GeneID:11504881"
                     /db_xref="InterPro:IPR018819"
                     /db_xref="UniProtKB/TrEMBL:G8ZXP8"
                     /translation="MNAVHFSNKDELDISNEKTSYLQDAISMLTNSPSDWYMVLNERI
                     ALIDWDNKARKWAQLLGHLLTFLFYAIRLLQDNLIKPNNYKFTSKKDAFDLSKSDKLK
                     EYEFLSRYATSLEDRPRSAETLYLDLLSGLSKVLDSSIILLIFFNLCLTYRFFWGCFR
                     TYYLFNVKERPPSENVTKHSLSGLNDGYLENIYNGSLWSMLKVFFSKNINEEEPGDEG
                     FYYTLAKWAPSNFITNIFISFCPSCLIFLMLTDVSFSTALAVVIHQLVLCFTVLHRFQ
                     SRIKDDSIINKATMAEFEEKVVKPLTCKKFQDVQVDATPYGNGFVRFLPATSCSRSHI
                     FKSHTLNGEAVTERFNTRTQEFEDMAEICAPHNILIKPPRLRSYHSPGECQRCHVRKD
                     ARIMCCNQSNGASPTRRTTPPGFYSPCVSSTSDMSYSQCRDERSSHRMNSQRSPCQSQ
                     NCFSSNYSRKKSRSPLRQSVLVSKHTKNSEPSDESHQCMSSRSSSKSPRHGSS"
     gene            complement(<569179..>570639)
                     /gene="TDEL0G02990"
                     /locus_tag="TDEL_0G02990"
                     /db_xref="GeneID:11504882"
     mRNA            complement(<569179..>570639)
                     /gene="TDEL0G02990"
                     /locus_tag="TDEL_0G02990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682829.1"
                     /db_xref="GeneID:11504882"
     CDS             complement(569179..570639)
                     /gene="TDEL0G02990"
                     /locus_tag="TDEL_0G02990"
                     /inference="similar to DNA sequence:INSDC:YDL088C,YMR153W"
                     /note="similar to Saccharomyces cerevisiae ASM4 (YDL088C)
                     and NUP53 (YMR153W); ancestral locus Anc_2.369"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682877.1"
                     /db_xref="GeneID:11504882"
                     /db_xref="InterPro:IPR007846"
                     /db_xref="UniProtKB/TrEMBL:G8ZXP9"
                     /translation="MFGTQLQSNIGSDRFSNVSITLNQQQQQQQPNQANTHQQQFQTA
                     SQPAQQVLFPQGPQNGYNVTQKDPEWFNNPRKRAIPQAIVKRTSKRSPSVDSNQTVSD
                     SNTSTQRSGFNSMSFGSKKDIRGVSSSQTINKGTDHNQGILSSNEAPPTVSLHDWQRE
                     DEFGALVPLASQINSNAGVSLPNDTNTAFSGPEPATIRKSGFQPNAFDKNGHVGSSLH
                     NSLENDNDNESTPQQTTMVNESAVIVFGYPESISNLIITHFSKFGNILEDFEVLRSSS
                     GINAATLRLRGRKGDSAALERKYPIFTGDGWVKLTYDSSSAALRALQENGQVFGGCLI
                     GCVPYNKNVVEQLASCKIAKADDIGELNFSVKPSTLTDSKTNFDTLASQKGSINGGAN
                     ESFNLTNEFNRFAENSATPALGANGLLEHPSITYSTRRLHIKDGKSLFAHNGSVSNHN
                     FLQSLEMKMRQQEENNKQQAGLLHKVNNWLFGWNDL"
     gene            complement(<570843..>571928)
                     /gene="TDEL0G03000"
                     /locus_tag="TDEL_0G03000"
                     /db_xref="GeneID:11504883"
     mRNA            complement(<570843..>571928)
                     /gene="TDEL0G03000"
                     /locus_tag="TDEL_0G03000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682830.1"
                     /db_xref="GeneID:11504883"
     CDS             complement(570843..571928)
                     /gene="TDEL0G03000"
                     /locus_tag="TDEL_0G03000"
                     /inference="similar to DNA sequence:INSDC:YMR152W"
                     /note="similar to Saccharomyces cerevisiae YIM1 (YMR152W);
                     ancestral locus Anc_2.373"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682878.1"
                     /db_xref="GeneID:11504883"
                     /db_xref="GOA:G8ZXQ0"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZXQ0"
                     /translation="MVTSRAVTFINNSTPATLVKKEIDLDKCHDENQIVIQVYAASLN
                     PVDLLLHSFAYKYVVGSSMKTYSRDYSGVIVKRGSNVDPKWKVGDKVNGMFKHLYGDQ
                     GTLSDYLVLDPSQQVAIVHSTAPPDSKYNEFVVSAAWPLVFGTAYTALFNFGQKLGPD
                     SKILVIGASTSVSYALLKIAKEVLGVKTMVGVCSSKSVDYNKKLGYDYLATYDQGPIP
                     ESVGKILVGELNNEKFDLIFDSVGGSDFFPIIDRFLKPKSQNSYYLSIAGDNKIKYSE
                     PSLRDAISPWTILRRLNPFKSFNYGLFLVDSQSEYMELGAKMIKEGTYEPLIDSVYPL
                     EEFQQAIEKQKSNTAKGKIVLKIKGDL"
     gene            complement(<572099..>573559)
                     /gene="TDEL0G03010"
                     /locus_tag="TDEL_0G03010"
                     /db_xref="GeneID:11504884"
     mRNA            complement(<572099..>573559)
                     /gene="TDEL0G03010"
                     /locus_tag="TDEL_0G03010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682831.1"
                     /db_xref="GeneID:11504884"
     CDS             complement(572099..573559)
                     /gene="TDEL0G03010"
                     /locus_tag="TDEL_0G03010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682879.1"
                     /db_xref="GeneID:11504884"
                     /db_xref="InterPro:IPR001959"
                     /db_xref="InterPro:IPR010095"
                     /db_xref="InterPro:IPR021027"
                     /db_xref="UniProtKB/TrEMBL:G8ZXQ1"
                     /translation="MTTCTQYQAKKRKRSNSKTTKPYWNEDAAHISQQWGLNTILPTA
                     AKNLSQKITSDSWFSVVKHPQVPVINDSLNLPLSSGVKEENTRARKIKVYPTNSQRET
                     LKKWFRCQRYIYNRALKLHRDGMAMTIKGLRQTLLNRDTIILEPQEQWLNDYSYDLKD
                     EALCDLVKNYSYNMAKYKQTGMPLKLRFKSKKTPIQTLSVLEKHWNKRTKSFWSEVFS
                     LSNFRGTEPLPEELPGDSRVQRTRNNKFYLVVPLAGEEIARKSPAEKFIFIDPRVRTF
                     LTGYDSKQTVVEMGKDAVVRIEKLKRRRRQFQSKLAKLRKHKKRQNHRKALHRLDEKI
                     QHIVRDMHKKTASYLCKNYENIFLPKLNYHQCTRLTRKTRSSMATIAHCCFHDRLTMK
                     AEQFHSTSVHEVEEDYTSKTCSSCGNLKDDLGSNKIYSCSSCSSVFDRDFNAAKNIML
                     KYICEHLMASGGSSITSASSGGNGGFAMMGPGPFVR"
     gene            complement(<574673..>575410)
                     /gene="TDEL0G03020"
                     /locus_tag="TDEL_0G03020"
                     /db_xref="GeneID:11504885"
     mRNA            complement(<574673..>575410)
                     /gene="TDEL0G03020"
                     /locus_tag="TDEL_0G03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682832.1"
                     /db_xref="GeneID:11504885"
     CDS             complement(574673..575410)
                     /gene="TDEL0G03020"
                     /locus_tag="TDEL_0G03020"
                     /inference="similar to DNA sequence:INSDC:YDL087C"
                     /note="similar to Saccharomyces cerevisiae LUC7 (YDL087C);
                     ancestral locus Anc_2.370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682880.1"
                     /db_xref="GeneID:11504885"
                     /db_xref="GOA:G8ZXQ2"
                     /db_xref="InterPro:IPR004882"
                     /db_xref="UniProtKB/TrEMBL:G8ZXQ2"
                     /translation="MGTPAAEQKKLLEQLMGKESHYGRRSDSKYNNYRKDLGLHDPRL
                     CKSYLVGECPYDLFQGTKQTLGRCPQIHSAKFKLQYEKEKKRGVSFPDFDREYYAILA
                     KFVNDCNGQIALALKKLEHTPEEREKIRQVTTELDTVDSRIGLMIQEIDSLLKANEVS
                     QAMVQSIKLQALQEKRQEVRKKVRNMTENVGQSAQQKLQVCEVCGAYLSRLDTDRRLA
                     DHFLGKIHMGYVKMREDYDVMKKRLKR"
     gene            <575851..>576732
                     /gene="TDEL0G03030"
                     /locus_tag="TDEL_0G03030"
                     /db_xref="GeneID:11504886"
     mRNA            <575851..>576732
                     /gene="TDEL0G03030"
                     /locus_tag="TDEL_0G03030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682833.1"
                     /db_xref="GeneID:11504886"
     CDS             575851..576732
                     /gene="TDEL0G03030"
                     /locus_tag="TDEL_0G03030"
                     /inference="similar to DNA sequence:INSDC:YPL033C"
                     /note="similar to Saccharomyces cerevisiae YPL033C;
                     ancestral locus Anc_2.371"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682881.1"
                     /db_xref="GeneID:11504886"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZXQ3"
                     /translation="MLSNALYNAANALYGTFGAGKRLDEKSGAVLIIGGSSDGLGIEL
                     CSTLAIDDKVYIINIDSRDMELILNFKDAAVVAKYYRFIPCRDLSNADLVLEALNQVK
                     NLKLPITLFINNVQVGFRTIYSNNFSIGYRGIPRLQQFASANVTNIMIATKFFLNEIV
                     PQTEKSTHGNVNFYIVNLTTVLTLDAPEYGMEYVSSKAALNQFHDGLTSELAVKSTRK
                     RIKTLLIYLPHAPNGHAWEMMSTDLCEQVVECLKMGRRGCAMLRAEDETASGDLHGKI
                     RNGYRYRAGGLKSKWTT"
     gene            <576834..>577427
                     /gene="TDEL0G03040"
                     /locus_tag="TDEL_0G03040"
                     /db_xref="GeneID:11504887"
     mRNA            <576834..>577427
                     /gene="TDEL0G03040"
                     /locus_tag="TDEL_0G03040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682834.1"
                     /db_xref="GeneID:11504887"
     CDS             576834..577427
                     /gene="TDEL0G03040"
                     /locus_tag="TDEL_0G03040"
                     /inference="similar to DNA sequence:INSDC:YMR150C"
                     /note="similar to Saccharomyces cerevisiae IMP1 (YMR150C);
                     ancestral locus Anc_2.374"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682882.1"
                     /db_xref="GeneID:11504887"
                     /db_xref="GOA:G8ZXQ4"
                     /db_xref="InterPro:IPR000223"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019756"
                     /db_xref="InterPro:IPR019757"
                     /db_xref="InterPro:IPR019759"
                     /db_xref="InterPro:IPR026730"
                     /db_xref="InterPro:IPR028360"
                     /db_xref="UniProtKB/TrEMBL:G8ZXQ4"
                     /translation="MNGLRAWTSTISYAVRAVCFVHIVHTHIYEFTETRGESMLPTLA
                     ATNDYVHAIKKHKDGKGCQIGDCIVAVKPSDPDHRVCKRITGMPGDIILVDPSMRSNV
                     YGTEPTVRSIEELDGSVEDYDENFDSFIKVPKGHVWVTGDNLSHSLDSRTYNALPMGL
                     IRGKIVAANDFNEKFWGGSKGNFWAFRKIENTYIDEE"
     gene            complement(<577448..>578281)
                     /gene="TDEL0G03050"
                     /locus_tag="TDEL_0G03050"
                     /db_xref="GeneID:11504967"
     mRNA            complement(<577448..>578281)
                     /gene="TDEL0G03050"
                     /locus_tag="TDEL_0G03050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682835.1"
                     /db_xref="GeneID:11504967"
     CDS             complement(577448..578281)
                     /gene="TDEL0G03050"
                     /locus_tag="TDEL_0G03050"
                     /inference="similar to DNA sequence:INSDC:YMR149W"
                     /note="similar to Saccharomyces cerevisiae SWP1 (YMR149W);
                     ancestral locus Anc_2.375"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682883.1"
                     /db_xref="GeneID:11504967"
                     /db_xref="GOA:G8ZXQ5"
                     /db_xref="InterPro:IPR008814"
                     /db_xref="UniProtKB/TrEMBL:G8ZXQ5"
                     /translation="MQLMRHLFALCALVYSCLALQAKNVHLTFPGSQRRGILLGDIES
                     QTQKLEEPVQVNAQDESLELNFAVSPAEKPEQVELLVGLPERGLEVVYEPKITDNKEL
                     IMYRFSIDVSKIPKALLHYSKDDEEPISVSMILASPESDNVFVPVFDMSLTFNDEVEY
                     TEPVRYEAKPEIRHVFNPEPKTVPWPLAQVFVFIISLVVFGLVIALMSSGALNFGNLP
                     LNFNIVYFFAFIGSIIGFEYIFIQYYIGKSIFETLLAALYLGFPALWVGTKFLRIFKC
                     T"
     gene            complement(<578378..>578770)
                     /gene="TDEL0G03060"
                     /locus_tag="TDEL_0G03060"
                     /db_xref="GeneID:11504968"
     mRNA            complement(<578378..>578770)
                     /gene="TDEL0G03060"
                     /locus_tag="TDEL_0G03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682836.1"
                     /db_xref="GeneID:11504968"
     CDS             complement(578378..578770)
                     /gene="TDEL0G03060"
                     /locus_tag="TDEL_0G03060"
                     /inference="similar to DNA sequence:INSDC:YMR148W"
                     /note="similar to Saccharomyces cerevisiae YMR148W;
                     ancestral locus Anc_2.376"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682884.1"
                     /db_xref="GeneID:11504968"
                     /db_xref="UniProtKB/TrEMBL:G8ZXQ6"
                     /translation="MISLSSLYFLVYFLAFLFVGVVASVFIIPLLTVSFIFASCVVIF
                     GFLSDITFKFAQLIYFKTDHRLKSTLNKMGQHTRKSETDLRPQVMKNYASARIRTGSQ
                     QGTGSTSGTGTTVLSSPFDGRTGVRVTS"
     gene            complement(<579117..>579530)
                     /gene="TDEL0G03070"
                     /locus_tag="TDEL_0G03070"
                     /db_xref="GeneID:11504969"
     mRNA            complement(<579117..>579530)
                     /gene="TDEL0G03070"
                     /locus_tag="TDEL_0G03070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682837.1"
                     /db_xref="GeneID:11504969"
     CDS             complement(579117..579530)
                     /gene="TDEL0G03070"
                     /locus_tag="TDEL_0G03070"
                     /inference="similar to DNA sequence:INSDC:YMR147W"
                     /note="similar to Saccharomyces cerevisiae YMR147W;
                     ancestral locus Anc_2.377"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682885.1"
                     /db_xref="GeneID:11504969"
                     /db_xref="UniProtKB/TrEMBL:G8ZXQ7"
                     /translation="MAAVVNLRPRFRERHNSRVWHTFHRSNGKSAGGSGTLAALPDPG
                     LEPIKEAPSDSPLHHFTPETAPESVPEEPIVLESAPVAAIEYEPGRKWGYKILYVLDA
                     LDKLQSKMFEYIWVSILYVNILFPRLTTRYVQLRS"
     gene            complement(<579741..>580157)
                     /gene="TDEL0G03080"
                     /locus_tag="TDEL_0G03080"
                     /db_xref="GeneID:11504970"
     mRNA            complement(<579741..>580157)
                     /gene="TDEL0G03080"
                     /locus_tag="TDEL_0G03080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682838.1"
                     /db_xref="GeneID:11504970"
     CDS             complement(579741..580157)
                     /gene="TDEL0G03080"
                     /locus_tag="TDEL_0G03080"
                     /inference="similar to DNA sequence:INSDC:YPL034W"
                     /note="similar to Saccharomyces cerevisiae YPL034W;
                     ancestral locus Anc_2.378"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682886.1"
                     /db_xref="GeneID:11504970"
                     /db_xref="UniProtKB/TrEMBL:G8ZXQ8"
                     /translation="MTTKSKVSTRLLEWENSCKHPVLNLTPDRVATLCSRNSATGLSR
                     LLSKLFLTPSKPTITTKNLQTYHNGGFWVPTGELPAIEHAIHRHLWQRYGQGLIYCHG
                     CDPSGKKRHREWFRVPVCDLPWLLTTLDRFCQGLIR"
     gene            <580533..>581354
                     /gene="TDEL0G03090"
                     /locus_tag="TDEL_0G03090"
                     /db_xref="GeneID:11504971"
     mRNA            <580533..>581354
                     /gene="TDEL0G03090"
                     /locus_tag="TDEL_0G03090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682839.1"
                     /db_xref="GeneID:11504971"
     CDS             580533..581354
                     /gene="TDEL0G03090"
                     /locus_tag="TDEL_0G03090"
                     /inference="similar to DNA sequence:INSDC:YDL086W"
                     /note="similar to Saccharomyces cerevisiae YDL086W;
                     ancestral locus Anc_2.379"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682887.1"
                     /db_xref="GeneID:11504971"
                     /db_xref="GOA:G8ZXQ9"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8ZXQ9"
                     /translation="MLITETYHDVETSNGTTLRIYVFTPKLSGYPNAKFPGVIVYSEI
                     YQVTGPVRRFAQRIASEGYVVVAPAIYHDFMGPEPLNYDTEGTDKGNEYKIKKTLESY
                     DEDNRLCCDLLHTLPHFDNTKIGATGMCLGGHLAFRALLDKRVSCATCFFPTDIHSRT
                     LGLNTNDDTLERVSHEASRDQELVLIFGTLDTHVPNAGRDLIRCTLREQCVQTTFLEL
                     NAAQHAFIRDESSKGRYDAAITQSCLGFMFEQFNRKLKTNLGDFVNDNENVEHVC"
     gene            <582165..>583205
                     /gene="TDEL0G03100"
                     /locus_tag="TDEL_0G03100"
                     /db_xref="GeneID:11504972"
     mRNA            <582165..>583205
                     /gene="TDEL0G03100"
                     /locus_tag="TDEL_0G03100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682840.1"
                     /db_xref="GeneID:11504972"
     CDS             582165..583205
                     /gene="TDEL0G03100"
                     /locus_tag="TDEL_0G03100"
                     /inference="similar to DNA sequence:INSDC:YMR146C"
                     /note="similar to Saccharomyces cerevisiae TIF34
                     (YMR146C); ancestral locus Anc_2.380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682888.1"
                     /db_xref="GeneID:11504972"
                     /db_xref="GOA:G8ZXR0"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR027525"
                     /db_xref="UniProtKB/TrEMBL:G8ZXR0"
                     /translation="MRPIMLVGHERPLTQVKYNKQGDLVFTCSKDNVASVWYSINGER
                     LGTLEGHTGSIWSIDVDQYTQCCVTGSADYSIKLWTVCDGQTVHTWKSPVPVKRVEFS
                     PCGNYILAVLDDVMKYIGSINIYQVKRDPETGAVIECIDEPVHCIETHEGLAAATVAG
                     WSTEGSYILAGHKDGQVSKYNTKNYEFEGSIPLHTSNVSDVQFSPDRTYFITSSRDSN
                     AFIVDVDTLRVLKQYEADCPLNSACLTPLKEFVILGGGQAARDVTTTSAREGKFEARF
                     YHKIFMEEIGRVKGHFGPLNYVAVSPQGTSYTSGSEDGFVRIHHFEKSYFDFKYEVEK
                     AAEAKEHMQVAA"
     gene            complement(<583238..>583429)
                     /gene="TDEL0G03110"
                     /locus_tag="TDEL_0G03110"
                     /db_xref="GeneID:11504973"
     mRNA            complement(<583238..>583429)
                     /gene="TDEL0G03110"
                     /locus_tag="TDEL_0G03110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682841.1"
                     /db_xref="GeneID:11504973"
     CDS             complement(583238..583429)
                     /gene="TDEL0G03110"
                     /locus_tag="TDEL_0G03110"
                     /inference="similar to DNA sequence:INSDC:YDL085C-A"
                     /note="similar to Saccharomyces cerevisiae YDL085C-A;
                     ancestral locus Anc_2.381"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682889.1"
                     /db_xref="GeneID:11504973"
                     /db_xref="InterPro:IPR007513"
                     /db_xref="UniProtKB/TrEMBL:G8ZXR1"
                     /translation="MARGNQRELARQKNLKKQQENSKNGKKAGDPKKRMESDAEILRK
                     KQQAADERKALEQQKVDKK"
     gene            <583605..>585221
                     /gene="TDEL0G03120"
                     /locus_tag="TDEL_0G03120"
                     /db_xref="GeneID:11504974"
     mRNA            <583605..>585221
                     /gene="TDEL0G03120"
                     /locus_tag="TDEL_0G03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682842.1"
                     /db_xref="GeneID:11504974"
     CDS             583605..585221
                     /gene="TDEL0G03120"
                     /locus_tag="TDEL_0G03120"
                     /inference="similar to DNA sequence:INSDC:YDL085W,YMR145C"
                     /note="similar to Saccharomyces cerevisiae NDE2 (YDL085W)
                     and NDE1 (YMR145C); ancestral locus Anc_2.382"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682890.1"
                     /db_xref="GeneID:11504974"
                     /db_xref="GOA:G8ZXR2"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:G8ZXR2"
                     /translation="MLAQTARLLGQGTRANSARLFTQSTRVLQQQQPAAAASVSRSSL
                     FKRAGKAFLKLTLFTGLAGTAYVSYQLYREKNPAPQQPQAATFPNGSPRKTLVILGSG
                     WGAVSLLKNLDTTLYNVVVVSPRNYFLFTPLLPSTPVGTIELKSIVEPVRSIARRAPG
                     EVHYYEAEALDVDPVNKTVKIKSVNTEHEYQLDMKYDYLVNGVGAQPTTFGIPGVVEN
                     SSFLKEISDAQEIRMKIMTSIEKAASLAPTDPERSRLLSFVVVGGGPTGVEFAAELRD
                     YVDQDLAKWMPELSKEINVTLVEALPNILNMFDKSLVDYAQDLFKQDRIDLKLKTMVK
                     NVDKTHITAKCGDDLTKVPYGVLVWATGNAPREVSKNLMEKLEEQNSRRGLLIDEKLQ
                     LIGAQGSIFALGDCTFYPGLFPTAQVAHQEGEYLAKVFKKLHKIDQTKWELAQDNTND
                     PKAQSKLNRLESQIQPFHYEHMGALAYIGSEKAIADLAVGESKYRSAGSFTFLFWKSA
                     YLAMCMSFRNRILIAMDWTKVYFLGRDSSV"
     gene            <585728..>587467
                     /gene="TDEL0G03130"
                     /locus_tag="TDEL_0G03130"
                     /db_xref="GeneID:11504975"
     mRNA            <585728..>587467
                     /gene="TDEL0G03130"
                     /locus_tag="TDEL_0G03130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682843.1"
                     /db_xref="GeneID:11504975"
     CDS             585728..587467
                     /gene="TDEL0G03130"
                     /locus_tag="TDEL_0G03130"
                     /note="ancestral locus Anc_2.383"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682891.1"
                     /db_xref="GeneID:11504975"
                     /db_xref="UniProtKB/TrEMBL:G8ZXR3"
                     /translation="MGPSFISTNEGSPDTYNDERSTTPGGKKRSSNSTTDPSLTAAAA
                     AAVASIQDVWSENFSEPLPTNKEERIQQALEFMRNEKHAHAADKNIKKHSLRQIALFF
                     QVPKSTLYDRLKNKVTLTIDEKISVNGGPALANSYSVSSRAHSQQMKISLEKEELLLI
                     QTHNLCHAQGNTLNLTHIRDFITSLVDGVSLGKKWVHNFTRRHDNSLIYGTLSSRFNV
                     RMVNSKNCRCNFEYLWRCFVPLLQENIKSLPQDEPFYYITKTCVHQPSMSSIFTCFQI
                     SPANLSIKVYGKPHLVIFPDYFGKSCLQRDTPMGNGPENEAIDHEGLRDEESALDLKV
                     NKQEKLQKQHKIDKLNEAFTKLYANVCIKNQTDSSLPPLVIFEGFNERYNWDPLICKD
                     IVHLGRFLAVPWKQQIFQQSIAKQLINLVDNVARGSSILGVQLSEMDLALDHVELDLT
                     DFSAELNQLLQMPTEATPPSEETQEPPQDSDLNVFTSSLRSPPPQDHDVENNFLSKAT
                     QEHHQEKEQRQQPIETAASANIFENSTLSQLQDVIHLIDTNESELYNELAEPSSKATL
                     MDIFTKIKGILPQ"
     gene            <587922..>589256
                     /gene="TDEL0G03140"
                     /locus_tag="TDEL_0G03140"
                     /db_xref="GeneID:11504976"
     mRNA            <587922..>589256
                     /gene="TDEL0G03140"
                     /locus_tag="TDEL_0G03140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682844.1"
                     /db_xref="GeneID:11504976"
     CDS             587922..589256
                     /gene="TDEL0G03140"
                     /locus_tag="TDEL_0G03140"
                     /inference="similar to DNA sequence:INSDC:YDL084W"
                     /note="similar to Saccharomyces cerevisiae SUB2 (YDL084W);
                     ancestral locus Anc_2.384"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682892.1"
                     /db_xref="GeneID:11504976"
                     /db_xref="GOA:G8ZXR4"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZXR4"
                     /translation="MSHEGEEDLLEYSDNEQEIQVDSKEAASAEVAKETDAEATGEAN
                     NADNDKKGSYVGIHSTGFKDFLLEPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLC
                     QAKSGLGKTAVFVLSTLQQLDPVPGEVSVVVICNARELAYQIRNEYLRFSKYMPDVKT
                     AVFYGGTPIAKDAELLKNKETAPHIVVATPGRLKALVRDKLIDLSHVKNFVIDECDKV
                     LEELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTL
                     HGLQQYYIKLEEREKNRKLAKLLDDLEFNQVIIFVRSTSRANELTKLLNASNFPALTV
                     HGHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYDLTTEADQYLHRV
                     GRAGRFGTKGLAISFVSTKEDEEVLTKIQERFDVKIAEFPEEGIDPSTYLNN"
     gene            complement(<589489..>590448)
                     /gene="TDEL0G03150"
                     /locus_tag="TDEL_0G03150"
                     /db_xref="GeneID:11504977"
     mRNA            complement(<589489..>590448)
                     /gene="TDEL0G03150"
                     /locus_tag="TDEL_0G03150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682845.1"
                     /db_xref="GeneID:11504977"
     CDS             complement(589489..590448)
                     /gene="TDEL0G03150"
                     /locus_tag="TDEL_0G03150"
                     /inference="similar to DNA sequence:INSDC:YMR144W"
                     /note="similar to Saccharomyces cerevisiae YMR144W;
                     ancestral locus Anc_2.385"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682893.1"
                     /db_xref="GeneID:11504977"
                     /db_xref="UniProtKB/TrEMBL:G8ZXR5"
                     /translation="MVGEDTVRDTTISAQSSMRYDDSELRSDEMRSDELNKAISSAKS
                     LIRQLNSRLVKSPIDERTVDNLEDSGLSFNKSSLETPSRDLDDHEYDEKQVVTEEKII
                     DTISSLVKVLDDSTRQIQQLKLKNMLLRSNSNDIQSTYEVEENLKKQQYERMKCQFLA
                     ENQQLVENLRIKEGKVAKYKSRIVEKNRQINKLTRILNEGSGTESSSSQTPGSTSKEP
                     ARNVPSNNYKEKASDMLKTLGILASQVLNEEVDDDSGNQTIPQAADNTTDPEIVHAPI
                     LGGQLSRAPLGGRKGSDTPKDAPIELPEMRSFRTLNGVIRNSG"
     gene            complement(<590863..>591493)
                     /gene="TDEL0G03160"
                     /locus_tag="TDEL_0G03160"
                     /db_xref="GeneID:11504978"
     mRNA            complement(join(<590863..591270,591470..>591493))
                     /gene="TDEL0G03160"
                     /locus_tag="TDEL_0G03160"
                     /product="40S ribosomal protein S16"
                     /transcript_id="XM_003682846.1"
                     /db_xref="GeneID:11504978"
     CDS             complement(join(590863..591270,591470..591493))
                     /gene="TDEL0G03160"
                     /locus_tag="TDEL_0G03160"
                     /inference="similar to DNA sequence:INSDC:YDL083C,YMR143W"
                     /note="similar to Saccharomyces cerevisiae RPS16B
                     (YDL083C) and RPS16A (YMR143W); ancestral locus Anc_2.386"
                     /codon_start=1
                     /product="40S ribosomal protein S16"
                     /protein_id="XP_003682894.1"
                     /db_xref="GeneID:11504978"
                     /db_xref="GOA:G8ZXR6"
                     /db_xref="InterPro:IPR000754"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020574"
                     /db_xref="UniProtKB/TrEMBL:G8ZXR6"
                     /translation="MSAVPSVQTFGKKKTATAVAHVKAGKGLIKVNGSPITLVEPEIL
                     RFKVYEPLVLVGLDKFANIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSK
                     NELKKAFTSYDRTLLIADSRRSEPKKFGGKGARSRFQKSYR"
     gene            <592227..>592948
                     /gene="TDEL0G03170"
                     /locus_tag="TDEL_0G03170"
                     /db_xref="GeneID:11504979"
     mRNA            join(<592227..592230,592356..>592948)
                     /gene="TDEL0G03170"
                     /locus_tag="TDEL_0G03170"
                     /product="60S ribosomal protein L13"
                     /transcript_id="XM_003682847.1"
                     /db_xref="GeneID:11504979"
     CDS             join(592227..592230,592356..592948)
                     /gene="TDEL0G03170"
                     /locus_tag="TDEL_0G03170"
                     /inference="similar to DNA sequence:INSDC:YDL082W,YMR142C"
                     /note="similar to Saccharomyces cerevisiae RPL13A
                     (YDL082W) and RPL13B (YMR142C); ancestral locus Anc_2.387"
                     /codon_start=1
                     /product="60S ribosomal protein L13"
                     /protein_id="XP_003682895.1"
                     /db_xref="GeneID:11504979"
                     /db_xref="GOA:G8ZXR7"
                     /db_xref="InterPro:IPR001380"
                     /db_xref="InterPro:IPR018256"
                     /db_xref="UniProtKB/TrEMBL:G8ZXR7"
                     /translation="MAISKNLPILKNHFRKNWQERVRVHFDQAGKKVSRRNARASKAA
                     KIAPRPLDLLRPVVRAPTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQ
                     NRNQEIFDTNVQRLKEFQSKIIVFPRNGKAEAEQVISTAASFPIEQPVVDVETRAVED
                     QGESAFRTLRLARSDKKYKGIREKRAREKAEAEAEKKK"
     gene            complement(<593161..>593481)
                     /gene="TDEL0G03180"
                     /locus_tag="TDEL_0G03180"
                     /db_xref="GeneID:11504980"
     mRNA            complement(<593161..>593481)
                     /gene="TDEL0G03180"
                     /locus_tag="TDEL_0G03180"
                     /product="60S acidic ribosomal protein P1"
                     /transcript_id="XM_003682848.1"
                     /db_xref="GeneID:11504980"
     CDS             complement(593161..593481)
                     /gene="TDEL0G03180"
                     /locus_tag="TDEL_0G03180"
                     /inference="similar to DNA sequence:INSDC:YDL081C"
                     /note="similar to Saccharomyces cerevisiae RPP1A
                     (YDL081C); ancestral locus Anc_2.388"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P1"
                     /protein_id="XP_003682896.1"
                     /db_xref="GeneID:11504980"
                     /db_xref="GOA:G8ZXR8"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:G8ZXR8"
                     /translation="MSTESALSYAALILADADIEITSEKLLTLTEAAKVQVEGIWADI
                     FTKALDGQNLKDLLVNFSAGASAPAAAVGGAAAGAAAGEAEEEKEEEAKEESDDDMGF
                     GLFD"
     gene            complement(<593854..>595287)
                     /gene="TDEL0G03190"
                     /locus_tag="TDEL_0G03190"
                     /db_xref="GeneID:11504981"
     mRNA            complement(<593854..>595287)
                     /gene="TDEL0G03190"
                     /locus_tag="TDEL_0G03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682849.1"
                     /db_xref="GeneID:11504981"
     CDS             complement(593854..595287)
                     /gene="TDEL0G03190"
                     /locus_tag="TDEL_0G03190"
                     /inference="similar to DNA sequence:INSDC:YMR140W"
                     /note="similar to Saccharomyces cerevisiae SIP5 (YMR140W);
                     ancestral locus Anc_2.389"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682897.1"
                     /db_xref="GeneID:11504981"
                     /db_xref="UniProtKB/TrEMBL:G8ZXR9"
                     /translation="MGNAPGKLGDGTSGPGETGNYRTSSGRSMSASSAGTGNRIPPWN
                     AEYNVRSRRGASLVGNILSTSGRSRADSVGGSQPSKRKSTKEREQAKETHAKQLVVKF
                     DETVDGGFLAPYGCYGFEKLDYDADVVRSLIIDRKLAPFYTPLQDFDESWTKEELIKI
                     VDGLPLHASFDENLEKYEDVAVGNLKKTNFDELIDKTLSKREQRRMRSKIFKARLYRK
                     RIIWQEIENENFLEQKLESKKPNSTSKNNSFLASDDLKYSLYKNGAECPICFLYYPEP
                     LNYSNCCLQPICTECFVQIKRAEPHFPHDEVDPTQPVTNDDEKDPNLLTSDPPNCAYC
                     ATPNFAVTYEAKADRRVGIGGMKPSTYKLPKEPSNNDIEPSAERRGSRTQNNADVVAS
                     DMIRPDWKAKLDKERARLARRSANATAIHVSNRLIDPDHPSRRGSNYDSSSNRDVQDL
                     EEEMLARAIRLSIADEEVRNQKKSNSR"
     gene            complement(<595491..>596900)
                     /gene="TDEL0G03200"
                     /locus_tag="TDEL_0G03200"
                     /db_xref="GeneID:11504982"
     mRNA            complement(<595491..>596900)
                     /gene="TDEL0G03200"
                     /locus_tag="TDEL_0G03200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682850.1"
                     /db_xref="GeneID:11504982"
     CDS             complement(595491..596900)
                     /gene="TDEL0G03200"
                     /locus_tag="TDEL_0G03200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682898.1"
                     /db_xref="GeneID:11504982"
                     /db_xref="GOA:G8ZXS0"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8ZXS0"
                     /translation="MTVTPVKSQVFQGYVGKEKAFAKNGKGIFMTIEKNGKEYRDVID
                     AVSGAAVASLGWGDPDVPEIVSEALKKHTYSYPGLVANEAAEKLAKFYIDNSPPGAFA
                     SALWTCSGSESNENALKIIRQYWLEKGQPKKTKVISRECSYHGFTLGAISIGNTPRGA
                     PFKDLMINQEEVCLKMPRCWPYRDMKEGETEEEYSQRLLDVLEKMILDNDPETVSAVI
                     VETLPGSSIGTPVPSKGYLKGIRDLCNKYDVVFMLDEVMCGTGRANPNGKLNCWENFL
                     APEDGPDIQTVGKTLGSGYVTIAGVLISPKILDAYVNGSGLILGAQTYHSHAFNCGTA
                     LGIQQKILQNGLTKNVFENGNLLGKKLQEALLDDPNNFVGDVRGLGGFWTIEFVKDKK
                     TKEPFPPEKKVGPRFSDIALENGFNIMGVSGADNYGGNWDIALFGPSFIITKEEVDLL
                     VERVVSAVHALTKQLRAEA"
     gene            complement(<597217..>599037)
                     /gene="TDEL0G03210"
                     /locus_tag="TDEL_0G03210"
                     /db_xref="GeneID:11504983"
     mRNA            complement(<597217..>599037)
                     /gene="TDEL0G03210"
                     /locus_tag="TDEL_0G03210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682851.1"
                     /db_xref="GeneID:11504983"
     CDS             complement(597217..599037)
                     /gene="TDEL0G03210"
                     /locus_tag="TDEL_0G03210"
                     /inference="similar to DNA sequence:INSDC:YDL080C"
                     /note="similar to Saccharomyces cerevisiae THI3 (YDL080C);
                     ancestral locus Anc_2.390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682899.1"
                     /db_xref="GeneID:11504983"
                     /db_xref="GOA:G8ZXS1"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G8ZXS1"
                     /translation="MNYTDSNGLPDSISIAEYLFHRLKQLHIETIFGLPGAFNATLLD
                     KLNEIPGLRWAGNTNELNAAYAADGYSRLKGLGCIITTFGVGELSAINGVAGSFAEHV
                     GLLHVVGMPPTSAQTKQLLLHHTLGNGDYKVFHRMASEVTCYSTVINDKDLCGDEVDD
                     CIAKAWTLQKPVYMGIPVNLVDTSVNSQRLNTALNLNLPSNDEQTENELVKQILQQLY
                     KSKNPVIIADACVTRHRIVPETVELCQRTNFPIFATPMSKGAIDETLPNFGGVFMGSI
                     SSPEVREVVNFADFLIVIGCMLSDFSTSSFHFNYKTKECVLLYPTSVKFKHAIYPDLR
                     IKSLMANLLRNLNESKIKYQSQPTPQMIIPRSELPSRHSLRHEWVWNQMSHWFQEGDI
                     IITETGTSAFGINQTHFPHSSRGISQALWGSVGYTLGACLGASFAANEMARDQVTAVP
                     HRVILFVGDGAFQLTVQEVSTMIRWGLTPYIFVMNNQGYSVDRFLHHRSNASYYDIQT
                     WEYLRLIPLFGARHYETRKIVTVGDFLEMIHDPLFATNDKIRMLEIMLPPMDVPQALM
                     DRWLTEQENKKRAAEESDGYTPNSEASSKKFCSDDISPAN"
     gene            complement(<600259..>601350)
                     /gene="TDEL0G03220"
                     /locus_tag="TDEL_0G03220"
                     /db_xref="GeneID:11504984"
     mRNA            complement(<600259..>601350)
                     /gene="TDEL0G03220"
                     /locus_tag="TDEL_0G03220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682852.1"
                     /db_xref="GeneID:11504984"
     CDS             complement(600259..601350)
                     /gene="TDEL0G03220"
                     /locus_tag="TDEL_0G03220"
                     /inference="similar to DNA sequence:INSDC:YDL079C,YMR139W"
                     /note="similar to Saccharomyces cerevisiae MRK1 (YDL079C)
                     and RIM11 (YMR139W); ancestral locus Anc_2.391"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682900.1"
                     /db_xref="GeneID:11504984"
                     /db_xref="GOA:G8ZXS2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZXS2"
                     /translation="MMNVEITNEAVVHKQVYVGHASGDSGPIEISYPTTEVVGHGSFG
                     VVFTTTIEQTGEMVAIKKVLQDRRFKNRELEIMKLLQHRNVIDLKYYFYEKDPHGDVY
                     LNLILDFMPQSLYQRLRHFVHLSSVMPRLEIKCYMYQLFKALNYLHHHANVCHRDIKP
                     QNLLVDPQSWELKLCDFGSAKQLKPAEPNVSYICSRYYRAPELIFGATNYLNQIDVWS
                     SGCVMAELLLGQPMFPGESGIDQLVEIIKILGTPSKQEICAMNPNYMEHKFPQIKPIP
                     LSKVFKKEDEPTVKFLTNTLKYDPLERFNSLQCLCATYFDEIRFATEDFKRIVDNLQL
                     LKFDYETELGHLTQDQLAAVKLKLTPNII"
     gene            complement(<601947..>602972)
                     /gene="TDEL0G03230"
                     /locus_tag="TDEL_0G03230"
                     /db_xref="GeneID:11504985"
     mRNA            complement(<601947..>602972)
                     /gene="TDEL0G03230"
                     /locus_tag="TDEL_0G03230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682853.1"
                     /db_xref="GeneID:11504985"
     CDS             complement(601947..602972)
                     /gene="TDEL0G03230"
                     /locus_tag="TDEL_0G03230"
                     /inference="similar to DNA sequence:INSDC:YDL078C"
                     /note="similar to Saccharomyces cerevisiae MDH3 (YDL078C);
                     ancestral locus Anc_2.392"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682901.1"
                     /db_xref="GeneID:11504985"
                     /db_xref="GOA:G8ZXS3"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:G8ZXS3"
                     /translation="MVKVAVVGASGGIGQPLSLLLKLNPYVSELALYDVRLAKGVAQD
                     LSHISTNAECRGYDKEEIGQALKGAQVVLIPAGVPRKPGMTRDDLFKINAGIVRGICS
                     SIAQYCPSARVLVISNPVNSTVPIAAETLKAAGCFSAGNVMGVTTLDVVRAETFLADY
                     LNASKRGGLTRQFDKTRMQKDVTVIGGHSGTTIVPVLLGSSLNAALGAEYGKFVHRVQ
                     FGGDEVVKAKEGAGSATLSMALAGYRFAEQVLRSIHRESTDPLPAFVYLPGLENGSAA
                     QKKLKDTVDYFALPITLVDGRAAKVDSTVLDRLSAQEHQLVERAVLELSTSIQKGTGF
                     VVGGSKL"
     gene            complement(<603053..>603583)
                     /gene="TDEL0G03240"
                     /locus_tag="TDEL_0G03240"
                     /db_xref="GeneID:11504986"
     mRNA            complement(<603053..>603583)
                     /gene="TDEL0G03240"
                     /locus_tag="TDEL_0G03240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682854.1"
                     /db_xref="GeneID:11504986"
     CDS             complement(603053..603583)
                     /gene="TDEL0G03240"
                     /locus_tag="TDEL_0G03240"
                     /inference="similar to DNA sequence:INSDC:YMR138W"
                     /note="similar to Saccharomyces cerevisiae CIN4 (YMR138W);
                     ancestral locus Anc_2.393"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682902.1"
                     /db_xref="GeneID:11504986"
                     /db_xref="GOA:G8ZXS4"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZXS4"
                     /translation="MRLLSIIRKQKLKDNETRCLILGLDNAGKSTIVNSLLPESQRTD
                     EITPTVGFKIHSLQLQDKLISLWDVGGQSTLRPFWDNYFDRTDVLVWVVDASETFRLH
                     ESQRELQELLQNDNIPQVIVALNKVDLTAADQLSATETALKEVVGPGASFVRCSGLSG
                     QGLFALKEALARISYI"
     gene            <603608..>605185
                     /gene="TDEL0G03250"
                     /locus_tag="TDEL_0G03250"
                     /db_xref="GeneID:11504987"
     mRNA            <603608..>605185
                     /gene="TDEL0G03250"
                     /locus_tag="TDEL_0G03250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682855.1"
                     /db_xref="GeneID:11504987"
     CDS             603608..605185
                     /gene="TDEL0G03250"
                     /locus_tag="TDEL_0G03250"
                     /inference="similar to DNA sequence:INSDC:YMR137C"
                     /note="similar to Saccharomyces cerevisiae PSO2 (YMR137C);
                     ancestral locus Anc_2.394"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682903.1"
                     /db_xref="GeneID:11504987"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR011084"
                     /db_xref="UniProtKB/TrEMBL:G8ZXS5"
                     /translation="MKKSIVDLTSRDVRMRRRGVVTIKKQRKLFEFDIPTTNTLRVRQ
                     RSFEEVTSNRDDPVVIEDEEDEVEEGEEEEEEIRCPICNVDITKFEIYQKEAHAESCL
                     EKKQERRVKVVKRPTLPDIKILRFDSGYKVVVDGFNFEKDSGINQYFLSHFHSDHYMG
                     LRKSWDHGTIYGSQITVDLMVSKFNMSRDLVRVLPMDRETWVTETISVILLDANHCPG
                     ATVFLFQEWDSTRQTVIKQILHTGDFRSNPELIAKLNSICTSRINQVYLDTTYLIPGF
                     HFPTQNSVLEVTAQFAFDLVQKGIRNYFNDSQQSIFKFVRRKESLFKCLFLVGTYTIG
                     KEKLAIAIAQALKTKIYIPKKSSRFKIISNYTSYFPKDLITHDLQESCVHLVPLSTLR
                     SKESIEAYFKDYSSVYDDAVGFIPTGWTYTNKYAHAPDLPTIESRIQYCRDLLKDDSK
                     NTLELKFITRQYKQHGKYQVFRVPYSEHSSFKDLVLFGTSIPCKEILATVNLHSVERI
                     KDMHLWFNAWRIMENES"
     gene            <605429..>607267
                     /gene="TDEL0G03260"
                     /locus_tag="TDEL_0G03260"
                     /db_xref="GeneID:11504988"
     mRNA            <605429..>607267
                     /gene="TDEL0G03260"
                     /locus_tag="TDEL_0G03260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682856.1"
                     /db_xref="GeneID:11504988"
     CDS             605429..607267
                     /gene="TDEL0G03260"
                     /locus_tag="TDEL_0G03260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682904.1"
                     /db_xref="GeneID:11504988"
                     /db_xref="GOA:G8ZXS6"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZXS6"
                     /translation="MQDLEVQKNTVEDEAAYLQSSDEQGSSSHSVIEKPQQQQPQEQL
                     EQTRPTGFTLYACVISLILSIFLAALDIMIVSTIIENVAREFGDYSKTGWIYAGYSLP
                     SALLTLIWGRIAAVCGFKSSMLTAIIIFEVGSLVAALANSMDMLIGGRVIAGLGGSGI
                     QTLCFVIISTLVEESKRGLLIACMGSAFGIASVVGPFLGGAFTTHVTWRWCFWINLPI
                     GGLAFAFFILFYNPHGSDQTFVGYVTDFFKQVGGWLKNSGKLLKLSTWRMIVHELIYK
                     FDIIEFALCTTGLVLILLALSFGGNKYAWNSGSTIAMFVIGILVTILALVYDFAIFPR
                     LKVVRENPRYQPLIPLRVAKKFFICVNNIAVFFVCMAFMAQVNYIIQFFQLIYNETAW
                     KASIHVIACVVPTVITVITSGILNSKFGIVKPINVLGITAAIVGAGLLTLLTNKSTNS
                     EHIGLLILPGVAFGATMQSTLIGSQIQLDKKSTHYRMDFIAVTTMNNFLKNLGQAFGG
                     VLCNTVFTTSILNKLKQNDITIGDHTTSDALISYRASHFDGSTSLLGNLISDSIKNVF
                     YMCLGCAAIAFIFGIFSSNKKSELHKPTSDTQKETSSDDAQEEEPK"
     gene            complement(<607444..>609081)
                     /gene="TDEL0G03270"
                     /locus_tag="TDEL_0G03270"
                     /db_xref="GeneID:11504989"
     mRNA            complement(<607444..>609081)
                     /gene="TDEL0G03270"
                     /locus_tag="TDEL_0G03270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682857.1"
                     /db_xref="GeneID:11504989"
     CDS             complement(607444..609081)
                     /gene="TDEL0G03270"
                     /locus_tag="TDEL_0G03270"
                     /inference="similar to DNA sequence:INSDC:YMR136W"
                     /note="similar to Saccharomyces cerevisiae GAT2 (YMR136W);
                     ancestral locus Anc_2.395"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682905.1"
                     /db_xref="GeneID:11504989"
                     /db_xref="GOA:G8ZXS7"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:G8ZXS7"
                     /translation="MRPPPEEHFHSKKSSETSDRKSSRTARSGTGTYPSLGNGANNHV
                     LSLQVQNNARAPSVPNLLNVGSQGSSPTSESHPPSPYYTTTSGNRAVSKPGLALTVES
                     TAVQGIYRDEHGNDTTPPSSANKVQFKTPRWRNSDSYLTECSPLSGSSGTTPTLLRKN
                     SIDSLMRAAATIESNADLNKAYQDKMTSIIELKNKLSDEIRDWPISQSLYDTRNLPSH
                     QASLDKQEQILMDQVSMENLISLNQVATTLKDTIGELIDLKNHTRYMEESVAAKLQQQ
                     LHIESPGRITLPPIESLTMNIREEQPASSDYRFPESNVASPVTPTAPGSYSYFPGSQP
                     HPQSGFTHQRGSSSWPMAPGNQGHRATVSDPSGYQDRATEATQFPQPSAKATMNGIPI
                     IFKTPNSLSTAKGKVKSKSTKKKKKSLTEGSSQDYRRSLSHGLMLAETLRKNDQATTS
                     CVHCGEGSTPEWRRGPYGNRTLCNACGLFYRKLIKKFGVKDANLLMRFKKQINPEDRR
                     VPSLVNVPAAFLSQLNEDSSLDSEYNTIGSSPGGSGI"
     gene            <610281..>611513
                     /gene="TDEL0G03280"
                     /locus_tag="TDEL_0G03280"
                     /db_xref="GeneID:11504990"
     mRNA            <610281..>611513
                     /gene="TDEL0G03280"
                     /locus_tag="TDEL_0G03280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682858.1"
                     /db_xref="GeneID:11504990"
     CDS             610281..611513
                     /gene="TDEL0G03280"
                     /locus_tag="TDEL_0G03280"
                     /inference="similar to DNA sequence:INSDC:YMR135C"
                     /note="similar to Saccharomyces cerevisiae GID8 (YMR135C);
                     ancestral locus Anc_2.396"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682906.1"
                     /db_xref="GeneID:11504990"
                     /db_xref="InterPro:IPR006595"
                     /db_xref="InterPro:IPR013144"
                     /db_xref="InterPro:IPR024964"
                     /db_xref="UniProtKB/TrEMBL:G8ZXS8"
                     /translation="MSAKIYEKKSFTKEEWAEQVAASTAATLGDMSGSVNDMTSGKRK
                     ENGSTSAEPTIPKLLLNYFVCMAYEESSVRMARELGYVKSNKDVQEFNDLYKIRERAH
                     ISELLKRGQVSEAMEEINSIFGIEVLECGAAGSWNDPGSTADGSSNGNTAKSNGKEDL
                     HFKLLLLNLIEMIRAHDQQRSQRSDGDDSDDDFVLKLIEYSQEKLALKAASNKSYMAE
                     LELVMTLLLFPKNGSSKVKLPKSLKNLYSLSLRSNIADLVNRKLLRCLHPQVANHASH
                     NAKFPDLIGFSNGIIGKQFSHYNEMLVVRPKEDIAQSLITEKMGDLRESADSYLRSSV
                     TSVSEDWSRTTDLIKEQQKNDSKNTTQSADQFPNDDFNLSEYQYEAKLVQIMKLWAWC
                     ENQLHNNDIGAPRVESSI"
     gene            complement(<611519..>612217)
                     /gene="TDEL0G03290"
                     /locus_tag="TDEL_0G03290"
                     /db_xref="GeneID:11504991"
     mRNA            complement(<611519..>612217)
                     /gene="TDEL0G03290"
                     /locus_tag="TDEL_0G03290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682859.1"
                     /db_xref="GeneID:11504991"
     CDS             complement(611519..612217)
                     /gene="TDEL0G03290"
                     /locus_tag="TDEL_0G03290"
                     /inference="similar to DNA sequence:INSDC:YMR134W"
                     /note="similar to Saccharomyces cerevisiae YMR134W;
                     ancestral locus Anc_2.397"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682907.1"
                     /db_xref="GeneID:11504991"
                     /db_xref="UniProtKB/TrEMBL:G8ZXS9"
                     /translation="MNLSEKYFEFEANIIDRLARTPYVHQFVHDKISGRITLFLMVVG
                     TMALINELYITIEMTFLQKDTYEELNKGYIDESLKLHKMIVDDKYHSREYTDEKSGIV
                     IEEFEDRDKFFAKPVHVAHLYVMCNVLQDGKKLLAKPLQFHIEFSPEDYEDEKRPEFG
                     CRLRVLRTKLYHFFKDTELFDELVKDPKNFTVSRGVNIYNTLKEPLPCEIDEVQLCFL
                     KIETGDTIECNFVI"
     gene            <612831..>613394
                     /gene="TDEL0G03300"
                     /locus_tag="TDEL_0G03300"
                     /db_xref="GeneID:11504992"
     mRNA            <612831..>613394
                     /gene="TDEL0G03300"
                     /locus_tag="TDEL_0G03300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682860.1"
                     /db_xref="GeneID:11504992"
     CDS             612831..613394
                     /gene="TDEL0G03300"
                     /locus_tag="TDEL_0G03300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682908.1"
                     /db_xref="GeneID:11504992"
                     /db_xref="UniProtKB/TrEMBL:G8ZXT0"
                     /translation="MKLVLGLTFLELALVAQCAPLNEQDSSANGSISTVGLVTTAAEQ
                     QASASDIASSQTPATVYSFLGESGDASSAILQMPTSSSEMLASATSDSMDESSAVSQF
                     LNGSGDLNSKQTATGRASSVTSIKSSGVSSASNSSSRASSHANSSSGNSTGSSSSTNS
                     VTTSGGANKMGLPLVAGGLVAGIVALL"
     gene            <613655..>614200
                     /gene="TDEL0G03310"
                     /locus_tag="TDEL_0G03310"
                     /db_xref="GeneID:11504993"
     mRNA            <613655..>614200
                     /gene="TDEL0G03310"
                     /locus_tag="TDEL_0G03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682861.1"
                     /db_xref="GeneID:11504993"
     CDS             613655..614200
                     /gene="TDEL0G03310"
                     /locus_tag="TDEL_0G03310"
                     /inference="similar to DNA sequence:INSDC:YLR040C"
                     /note="similar to Saccharomyces cerevisiae YLR040C;
                     ancestral locus Anc_2.398"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682909.1"
                     /db_xref="GeneID:11504993"
                     /db_xref="GOA:G8ZXT1"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:G8ZXT1"
                     /translation="MRFWLFFLSNAFVAAVAFSQMTTKTDEEARKSAAGANLPFFTVF
                     VSDINTNLAAYNSFMESNNMKLPQAVADYYFHVIRLSQTADLEKDVASSFPFTQFKTF
                     ITKFPWYDSLLQRASVSTLYVPQDFVSSATAGAQLGTSTSKVSTTSSGTAETALDSSN
                     AAPGVNKGHITLLLVICGFIL"
     gene            complement(<614197..>615639)
                     /gene="TDEL0G03320"
                     /locus_tag="TDEL_0G03320"
                     /db_xref="GeneID:11504994"
     mRNA            complement(<614197..>615639)
                     /gene="TDEL0G03320"
                     /locus_tag="TDEL_0G03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682862.1"
                     /db_xref="GeneID:11504994"
     CDS             complement(614197..615639)
                     /gene="TDEL0G03320"
                     /locus_tag="TDEL_0G03320"
                     /inference="similar to DNA sequence:INSDC:YMR133W"
                     /note="similar to Saccharomyces cerevisiae REC114
                     (YMR133W); ancestral locus Anc_2.399"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682910.1"
                     /db_xref="GeneID:11504994"
                     /db_xref="GOA:G8ZXT2"
                     /db_xref="InterPro:IPR004354"
                     /db_xref="UniProtKB/TrEMBL:G8ZXT2"
                     /translation="MKDYFSALVKFYSTYSEAIPAPDGFETPVAPLDPSKWQHFPVEC
                     PITLSVGLESNNNCVIEVSWNARTLDMARINLLHSARVIQFTARSPTISCKYMVWKNS
                     VPCVKRFQVTLSSGDDFRNLHSVLTAIHLVVKPARPAMSQPSPSSQIQPSQSQQALPG
                     RTNDLAYRLQNAPYGTSAATNNSVATLTGNPILDRKYLSQSTHLEPGYLLNSQIAPDN
                     FLQSLPAQAQFPVRVNDLMKRNETRHPNITPVLPCPKSKAQHARSPLSDSSLGRVMAI
                     QQERLPLQPTASTIAPNQHLSEGVEVTLEDVQLAECRERPLQTNSVDQFVAHLGLKGY
                     AMPQAHTMAGSEVELAQEPELAKIHKTSSLITSIAPEERNVPKEINCDKLIQNNVLVK
                     TNNISLEKDINQEKTVESSIDIHKQGDTGKKKTKCDLTDIRSAAVSSSKIRVSRRLIK
                     EKLKDESLMKWVMKVEETLQGMTAESKHNL"
     gene            <617427..>617951
                     /gene="TDEL0G03330"
                     /locus_tag="TDEL_0G03330"
                     /db_xref="GeneID:11504995"
     mRNA            <617427..>617951
                     /gene="TDEL0G03330"
                     /locus_tag="TDEL_0G03330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682863.1"
                     /db_xref="GeneID:11504995"
     CDS             617427..617951
                     /gene="TDEL0G03330"
                     /locus_tag="TDEL_0G03330"
                     /inference="similar to DNA sequence:INSDC:YMR132C"
                     /note="similar to Saccharomyces cerevisiae JLP2 (YMR132C);
                     ancestral locus Anc_2.400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682911.1"
                     /db_xref="GeneID:11504995"
                     /db_xref="InterPro:IPR008532"
                     /db_xref="UniProtKB/TrEMBL:G8ZXT3"
                     /translation="MVYFYDSAPLGVARKYQLVTGKDKFENDMLIKWGYKELNYVWFH
                     ADKYSSGHVYLKLQHDEKSLEEVPPEVINDCLQLCKSMSIQGNKMNQCTIIHTPWTNL
                     RKNKFMKPGEVSFKSLQRVRRMESFARDQPLLNRLTKTRVELAENVEEILHHAKKTKD
                     GDFFYDILMTTAEG"
     gene            <618276..>619820
                     /gene="TDEL0G03340"
                     /locus_tag="TDEL_0G03340"
                     /db_xref="GeneID:11504996"
     mRNA            <618276..>619820
                     /gene="TDEL0G03340"
                     /locus_tag="TDEL_0G03340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682864.1"
                     /db_xref="GeneID:11504996"
     CDS             618276..619820
                     /gene="TDEL0G03340"
                     /locus_tag="TDEL_0G03340"
                     /inference="similar to DNA sequence:INSDC:YMR131C"
                     /note="similar to Saccharomyces cerevisiae RRB1 (YMR131C);
                     ancestral locus Anc_2.401"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682912.1"
                     /db_xref="GeneID:11504996"
                     /db_xref="GOA:G8ZXT4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR022052"
                     /db_xref="UniProtKB/TrEMBL:G8ZXT4"
                     /translation="MSKRSIDLEEEQRVVSAKVGNSDLPNAGTIDKEPDVAMGEFEDQ
                     YSDEFESDGEIIEVDDEEDKDEEQDDDQEFVERKQQKAQELVEKDKNEEENKQEIYLP
                     HMSRPLGPDEVLEADPTVYEMLHNVNMPWPCLTLDIIPDGLGTERRNYPQSILMATAT
                     QASKKKENELMVLKLSQLNKTLVKDDADEEEDDEDDEDNDSDPIIENEEISLRDTTNR
                     LKISPFASSQEVLTATMSENGEVYIHDLGPQTKAFETPGYQIPKSAKKPLHTIRNHGN
                     VEGYGLDWSPLIKTGALLTGDCSGQVYLTQRHTSKWVTDKQPFTFSNNKSIEDIQWSR
                     TESTVFATSGCDGYIRIWDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGDDDG
                     RWGVWDLRQLSPNNSENVQPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDL
                     SVEADDEEIKQQAAETKELQQIPPQLLFVHWQKEVKDVKWHRQIPGCLVSTGTDGLNV
                     WKTISV"
     gene            <619979..>622969
                     /gene="TDEL0G03350"
                     /locus_tag="TDEL_0G03350"
                     /db_xref="GeneID:11504997"
     mRNA            <619979..>622969
                     /gene="TDEL0G03350"
                     /locus_tag="TDEL_0G03350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682865.1"
                     /db_xref="GeneID:11504997"
     CDS             619979..622969
                     /gene="TDEL0G03350"
                     /locus_tag="TDEL_0G03350"
                     /inference="similar to DNA sequence:INSDC:YLR039C"
                     /note="similar to Saccharomyces cerevisiae RIC1 (YLR039C);
                     ancestral locus Anc_2.402"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682913.1"
                     /db_xref="GeneID:11504997"
                     /db_xref="InterPro:IPR009771"
                     /db_xref="UniProtKB/TrEMBL:G8ZXT5"
                     /translation="MSKHIWPLSPPQKARINECVHELTDREIKNDDILQTISLPQVNV
                     LILMTPARVLVYNMKPLALVASHERSSESISEFGLNRSITPSTALDRDVNGLLSQQES
                     YSLIWNQGKVVFYVVTERNFILSYQILKSSTNLTTFKEYGIPVIDVGKIREDIDHDFD
                     DTLDNDTLTVFERNKASRIIQNGYTVTKDKGFLQFLSVNQDNINELPVKKLELRLKVV
                     LKFDYQIIDLFGFKRLLEGNKSKAEESLLVLFPHGLQLLSLEEFKLKKTSLVELTNGK
                     EICFNAGHLIVISKESEEDISINVIDFSNKKVKSNRLEVRGTLLSCFELRKRLALIFE
                     DRIIYFNTTTNQVDYSYDPPFRIKLGGKLSDEMLLMISTANSVHFVTPLGNSLFSSSA
                     DSDLEKPPTTLEYSDFAYVDKFLVLVSHSGNYEVWNLWEEAKQTFSDSRSPVSYVLHN
                     NNNDVAIYSPLGSSPVRNDSMQMVKLPTKTINNCVSQIKVNSNLKMMAVYVSNKNILL
                     IHNLETNAWYDFNDLTIIDMHWLCSSYLLCQIKTEDWATSVQCFRFHLQGLDTSDISK
                     YRVWEYEIPTSVPVLKVKVNVSSKYRLLKLKSRESPELEKYGEKFYRTAEIIIVTENH
                     ISIFAVLSIIHPSGVNIIKKFHEQAKIELPAAFSADSIEWITSFKDGLIYLYDDKIIK
                     TATTDAQNWREDILLRDVERIIDVVFDEIYFVCKTQELFYKMDDLWEGKPPMLSIPLE
                     DDFYPISVTSETTTTHGLNCLYHEDYVKLVLKHKIYLDQIIAAKMDQNVDPKDIMAEF
                     GSIRHYKFALEKILSLKILASEPLNQIVELVKLCDAPLGSDMTTHNNQNGSLEIISNC
                     LRKIEIKHWNQLFTSLKMTPRDLLARCLEGNEAKILGVLLLVFLNYDAELVEDLRNDE
                     IPEEEEGQNNSEFPDSSVVDLIRDQEMMLRVLRLLVTSGANATDSTKAADSWDMCFQL
                     MRLLKELDKENNTHLVQQALDMLQ"
     gene            <623563..>623853
                     /gene="TDEL0G03360"
                     /locus_tag="TDEL_0G03360"
                     /db_xref="GeneID:11504998"
     mRNA            <623563..>623853
                     /gene="TDEL0G03360"
                     /locus_tag="TDEL_0G03360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682866.1"
                     /db_xref="GeneID:11504998"
     CDS             623563..623853
                     /gene="TDEL0G03360"
                     /locus_tag="TDEL_0G03360"
                     /inference="similar to DNA sequence:INSDC:YLR038C"
                     /note="similar to Saccharomyces cerevisiae COX12
                     (YLR038C); ancestral locus Anc_2.403"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682914.1"
                     /db_xref="GeneID:11504998"
                     /db_xref="GOA:G8ZXT6"
                     /db_xref="InterPro:IPR003213"
                     /db_xref="UniProtKB/TrEMBL:G8ZXT6"
                     /translation="MSAEHKIAELAEKEAEPQQASPLHTVGFDARFPNQNQTKHCWQS
                     YVDYHKCVNVKGEDFAPCKVFFRTFSSLCPVDWVDKWDEQRSKGIFPGDINP"
     gene            <624823..>625278
                     /gene="TDEL0G03370"
                     /locus_tag="TDEL_0G03370"
                     /db_xref="GeneID:11504999"
     mRNA            <624823..>625278
                     /gene="TDEL0G03370"
                     /locus_tag="TDEL_0G03370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682867.1"
                     /db_xref="GeneID:11504999"
     CDS             624823..625278
                     /gene="TDEL0G03370"
                     /locus_tag="TDEL_0G03370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682915.1"
                     /db_xref="GeneID:11504999"
                     /db_xref="UniProtKB/TrEMBL:G8ZXT7"
                     /translation="MNLANFISSSNLTTYQNWYGHYAGNNTYEAWNPSSNYSALTLEI
                     RTGDDSVLSAITFNVTGDLQSAYEQMELEEAAATSAEGYSTQLLATSIDPWTEPTMAV
                     DEPNRLNKRACGSFCGVNLHCLLAPCFKCAAYRPGTWRKRCATGWGRAG"
     gene            complement(<626110..>626646)
                     /gene="TDEL0G03380"
                     /locus_tag="TDEL_0G03380"
                     /db_xref="GeneID:11505000"
     mRNA            complement(<626110..>626646)
                     /gene="TDEL0G03380"
                     /locus_tag="TDEL_0G03380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682868.1"
                     /db_xref="GeneID:11505000"
     CDS             complement(626110..626646)
                     /gene="TDEL0G03380"
                     /locus_tag="TDEL_0G03380"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682916.1"
                     /db_xref="GeneID:11505000"
                     /db_xref="GOA:G8ZXT8"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:G8ZXT8"
                     /translation="MILFIDMWRFSKKAHFIPCAKGLDARDVIDLLYRFIFAYHVFPK
                     SIISDRDTRLMAKLFRDFTERPGIKLTISSSNHPQTDDQSERETLNRLLRTYTNSDHA
                     LWDEIENVYSSTPSQSSRLTLFEVHCGYIPSKILRSSGTDQALENYHHPKPRMPLQPL
                     NSAKKRITRGGGRKLSLD"
     gene            627528..627600
                     /gene="TDEL0Gtrna7A"
                     /locus_tag="TDEL_0Gtrna7A"
                     /db_xref="GeneID:11505001"
     tRNA            627528..627600
                     /gene="TDEL0Gtrna7A"
                     /locus_tag="TDEL_0Gtrna7A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCA"
                     /db_xref="GeneID:11505001"
     gene            <627732..>629243
                     /gene="TDEL0G03390"
                     /locus_tag="TDEL_0G03390"
                     /db_xref="GeneID:11505333"
     mRNA            <627732..>629243
                     /gene="TDEL0G03390"
                     /locus_tag="TDEL_0G03390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682869.1"
                     /db_xref="GeneID:11505333"
     CDS             627732..629243
                     /gene="TDEL0G03390"
                     /locus_tag="TDEL_0G03390"
                     /inference="similar to DNA sequence:INSDC:YGL122C"
                     /note="similar to Saccharomyces cerevisiae NAB2 (YGL122C);
                     ancestral locus Anc_6.130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682917.1"
                     /db_xref="GeneID:11505333"
                     /db_xref="InterPro:IPR021083"
                     /db_xref="UniProtKB/TrEMBL:G8ZXT9"
                     /translation="MSQEQFTENLKVIVAEKLGTLPNFHEDIKYVAEYIVLLMVNGGT
                     VETVVQELSTLFDSVSPDSLTDVVQTAFFALEALQQGETVDSIVSKIRGSGSAPVVPE
                     PQQVQQVQQIQQPQMMAQQEALAAQEPLSAFANFVPKQPVAQPEQSNDMGSQTQYSQK
                     VGAVGKQRGGRGGRGASRGASRGHSRNQNARFNPLAKALGINGDNGNVNFVHQKKEGR
                     CRLFPRCPLGRSCPHAHPTKVCNEYPNCPKPPGTCEYLHPNEDEDLMREIEKTREEFQ
                     QRKAAIIAARTKPVSTGIVLCKFGALCSNPMCPFGHPTPADEDAKVLELLWCADNLQC
                     SDKNCKKAHSSLSKIREVAPLGQKNFSRPGPAAPRAQEKSLEQCKFGTHCTNKRCKYR
                     HARSHVMCREGANCTRIDCFFGHPINEDCKFGIECRNANCLFRHPEGRVLPQKTKSAA
                     GNQTFTPTDNNGSNTSQRMFALPEGAHIENAGNQAGLQSIHANAQPDNDTDMS"
     gene            complement(<629518..>630300)
                     /gene="TDEL0G03400"
                     /locus_tag="TDEL_0G03400"
                     /db_xref="GeneID:11505002"
     mRNA            complement(<629518..>630300)
                     /gene="TDEL0G03400"
                     /locus_tag="TDEL_0G03400"
                     /product="40S ribosomal protein S2"
                     /transcript_id="XM_003682870.1"
                     /db_xref="GeneID:11505002"
     CDS             complement(629518..630300)
                     /gene="TDEL0G03400"
                     /locus_tag="TDEL_0G03400"
                     /inference="similar to DNA sequence:INSDC:YGL123W"
                     /note="similar to Saccharomyces cerevisiae RPS2 (YGL123W);
                     ancestral locus Anc_6.129"
                     /codon_start=1
                     /product="40S ribosomal protein S2"
                     /protein_id="XP_003682918.1"
                     /db_xref="GeneID:11505002"
                     /db_xref="GOA:G8ZXU0"
                     /db_xref="InterPro:IPR000851"
                     /db_xref="InterPro:IPR005324"
                     /db_xref="InterPro:IPR005711"
                     /db_xref="InterPro:IPR013810"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018192"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:G8ZXU0"
                     /translation="MSAPAPAQAQAQGAPRRGGFGGRNRGRGGRRGGRQVEEKGWVPV
                     TKLGRLVKAGKITTLEEIFLHSLPVKEFQIIDTLLPTLSDEVMNIKPVQKQTRAGQRT
                     RFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGNNLGQPHSL
                     ATKTSGKCGSVTVRLIPAPRGSGIVASPAVKKLLQLAGLEDVYTQSNGSTRTLENTLK
                     AAFVAIGNTYGFLTPNLWAEHALPLSPMDVYADEAAIQKKRF"
     gene            <630843..>631409
                     /gene="TDEL0G03410"
                     /locus_tag="TDEL_0G03410"
                     /db_xref="GeneID:11505003"
     mRNA            join(<630843..630850,630938..>631409)
                     /gene="TDEL0G03410"
                     /locus_tag="TDEL_0G03410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682871.1"
                     /db_xref="GeneID:11505003"
     CDS             join(630843..630850,630938..631409)
                     /gene="TDEL0G03410"
                     /locus_tag="TDEL_0G03410"
                     /inference="similar to DNA sequence:INSDC:YBR230C"
                     /note="similar to Saccharomyces cerevisiae OM14 (YBR230C);
                     ancestral locus Anc_6.128"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682919.1"
                     /db_xref="GeneID:11505003"
                     /db_xref="UniProtKB/TrEMBL:G8ZXU1"
                     /translation="MSEPHADHSKKFEKHAEKAGEEAKKAVDELKKDDKVYKKKLQEG
                     ENYVVERVREFASFASTQVANTMNYACGVAHSTAARAQSLACRAASRSANPVILVNLL
                     LGTGVVAALLTGYAKYDTRYLKDKSDGAILCVVGSATALLALDTVLSAKYYSKFDKK"
     gene            <631557..>633302
                     /gene="TDEL0G03420"
                     /locus_tag="TDEL_0G03420"
                     /db_xref="GeneID:11505004"
     mRNA            <631557..>633302
                     /gene="TDEL0G03420"
                     /locus_tag="TDEL_0G03420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682872.1"
                     /db_xref="GeneID:11505004"
     CDS             631557..633302
                     /gene="TDEL0G03420"
                     /locus_tag="TDEL_0G03420"
                     /inference="similar to DNA sequence:INSDC:YGL124C"
                     /note="similar to Saccharomyces cerevisiae MON1 (YGL124C);
                     ancestral locus Anc_6.127"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682920.1"
                     /db_xref="GeneID:11505004"
                     /db_xref="InterPro:IPR004353"
                     /db_xref="UniProtKB/TrEMBL:G8ZXU2"
                     /translation="MDSPEEQYIDSRPSRDQVSLRPSLSATSSMFVTNATSEPTTSIT
                     LDQTLFRASTPPLEAISDRNDNDNSNDDDDNDDNDNDDDALLESLSQSINSYENSVSR
                     FSHRVVSTDIPTVFIDEAPGGNDELSSWNKNFFILTSAGKPIYSMHGRDQQVTSLAGI
                     INTIMSYFQLRNSEDIRTISSGNAKFSFLNRSPIILVAYSRKGETSNELINQLDFLHS
                     YLISSLSQRQLSRFFNKRENFDLRNFLEATDFENLDEICSLICERLYPDVLLGALQCL
                     TLKKTYRTQIHNAMLQCLLKESDLPRGTILYGLIVAPNNKLCSVLRPRGHTLHTTDLH
                     LLFCLIYHQFQNLQNQQEMWVPICFPKFNSNGFLYCYIKFMTNAPQQVSGPKPVLVLI
                     SAQKDAFFPLKSLGTNLIRSLQSSELIDKLYRAKSIKITDVPAPLVHHFIYKSRKHVQ
                     YVMPELQFATQPDTESTSEQTLGYEKKIMTYYQQIHKSLVRDDGGSFSRSTLSFVQWT
                     ATDSLSTVTDQSLFQEENISMMGLAWITPSFELYLICNNGTNDKNVVLKSAKKIVSWC
                     RKHEERLFVNEGAIF"
     gene            complement(<633324..>634625)
                     /gene="TDEL0G03430"
                     /locus_tag="TDEL_0G03430"
                     /db_xref="GeneID:11505005"
     mRNA            complement(<633324..>634625)
                     /gene="TDEL0G03430"
                     /locus_tag="TDEL_0G03430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682873.1"
                     /db_xref="GeneID:11505005"
     CDS             complement(633324..634625)
                     /gene="TDEL0G03430"
                     /locus_tag="TDEL_0G03430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682921.1"
                     /db_xref="GeneID:11505005"
                     /db_xref="GOA:G8ZXU3"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:G8ZXU3"
                     /translation="MSIRTAFQIYTPEVKSGICKENKDTIASFNSKSRKPEFTFKQAH
                     LGPSPSLPPPPPPPPPTRESSVAPDETEPPFKIIKDSVIPRGLPELRRSSVLAPDTSF
                     LESSAIRETLPRTKKLQTQRGPIAEVQIAIPSRQLVSGTNSIRPLSEFFKSAKRDDNS
                     LLDKLDQHEHDAAVALMVLKDCSAHVTNMTKHWSQPLCKISLCDFIVAQKKCQTMLEN
                     IETLKDAKIQARETTAVEDGCDNHALMVDLILKKRNSFDLYKARSKVVSSRSSSIVSI
                     VNAMQKDGDKECRHQSSSTDRTLTKSPIPSNSETPRLASDPYVLQSAGSFVFDREGNG
                     SREFTMQSPEDGKRHMGKIGKTSKSGKNRNTHMKCLHCAATDTPEWRKGPVGPTTLCN
                     ACGLFFKKLVKKFGPETASVIMKSRQDENPQDRKVPRSFCA"
     gene            <635055..>637823
                     /gene="TDEL0G03440"
                     /locus_tag="TDEL_0G03440"
                     /db_xref="GeneID:11505006"
     mRNA            <635055..>637823
                     /gene="TDEL0G03440"
                     /locus_tag="TDEL_0G03440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682874.1"
                     /db_xref="GeneID:11505006"
     CDS             635055..637823
                     /gene="TDEL0G03440"
                     /locus_tag="TDEL_0G03440"
                     /inference="similar to DNA sequence:INSDC:YBR229C"
                     /note="similar to Saccharomyces cerevisiae ROT2 (YBR229C);
                     ancestral locus Anc_6.126"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682922.1"
                     /db_xref="GeneID:11505006"
                     /db_xref="GOA:G8ZXU4"
                     /db_xref="InterPro:IPR000322"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR025887"
                     /db_xref="UniProtKB/TrEMBL:G8ZXU4"
                     /translation="MIHPNKLTLLIAFWVLQLSVAAGFTDYLLKTCAQSGFCHRNREY
                     ARNIQSSKSSYYSVDQQTVQYDKVHRVVSANIIKSIPKPDGADVSISLPFTMMLLDDD
                     SFRFTIDEIRPDISDLSEDLSSKRYNGTSDWAFVNDSALGFQQVTLRRSWFHNDVITL
                     KNSAETIKIELHTKSFLLKVFHGGHLSLIINERALLNMEHYRKKEDNYCNLLPEESSF
                     NMFGDNFEYSRKDTIPFGPESVALDFSFKDYQNAYGIPEHADSLRLRDTSERDPYRLF
                     NVDVFEYNLQATTPMYGTIPLLIVSRPQSSVGLFWVNAADTWIDIKYDGDDTKSHWMS
                     ESGIIDVVLFFGQEPSDITNKYTALTGRPTLPLLSSIGYHQCRWNYNDEQDVLKVDSE
                     MDRAHIPYDFIWLDLEYTDDKKFFTWKPDSFPHPRRMLGRLASLGRQLAVLIDPHLKK
                     GYGVSNFIIEKGAAVKDHEGKTFIGHCWPGKSVWIDTLGTLGQNIWGSFFKKFVKGVS
                     NLHIWNDMNEPSIFSGPETTAPKDLIHSGGNEERSVHNLYGMTVHQSTYEALKDAHSE
                     QDLRPFILTRSFFAGSQRSAATWTGDNVANWDYLKISVPMCLTNNIAGLPFIGADIAG
                     FSGDPEAELIARWYQAGLWYPFFRGHAHIDTKRREPYLFSEPLQSIVRDAIQLRYRLL
                     PTLYSSFQKASIDGTPIMKPMFYEKPHFLDLYDIDDQFYLGDSGLLVKPVLEKGQTEV
                     EITLPPGKYYQYPNLESLVVDSADVGVKKLDAPIDRIPILLEGGHIIFSKEKYRRSSK
                     LLRNDAYTLTVAPSKSQNAFGRIYVDDGETFGYERGEYLEAEVRLMSGHAIKNTPTHV
                     PTNHRSIGSTLIEKIVLPVGSMVLKEVVKLHIGNRVFDLAVSRDGPDTVAISNPRVRL
                     DEEWEIIL"
     gene            complement(<637839..>638771)
                     /gene="TDEL0G03450"
                     /locus_tag="TDEL_0G03450"
                     /db_xref="GeneID:11505007"
     mRNA            complement(<637839..>638771)
                     /gene="TDEL0G03450"
                     /locus_tag="TDEL_0G03450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682875.1"
                     /db_xref="GeneID:11505007"
     CDS             complement(637839..638771)
                     /gene="TDEL0G03450"
                     /locus_tag="TDEL_0G03450"
                     /inference="similar to DNA sequence:INSDC:YBR228W"
                     /note="similar to Saccharomyces cerevisiae SLX1 (YBR228W);
                     ancestral locus Anc_6.125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682923.1"
                     /db_xref="GeneID:11505007"
                     /db_xref="GOA:G8ZXU5"
                     /db_xref="InterPro:IPR000305"
                     /db_xref="InterPro:IPR027520"
                     /db_xref="UniProtKB/TrEMBL:G8ZXU5"
                     /translation="MSSSPVNETDQCEQHRVPDFYCCYLLQSICKRQSFYIGSTPNPV
                     RRLRQHNGILARGGAYRTKRGNTRPWEMILLVHGFPCKVAALQFEHAWQHGYKTHYIA
                     EDVRIVKNRNGGRSLHHKLGVMKLLLTHVYFQHMSLRIEIFNLETQRIWEQDKFQTQN
                     YGHIVSSIMPGALGVPDTSNSENVKAFECSNLELIRSFYAQCSEKDRLRSMRYEERLA
                     NGMIPCSICELPFDYTSEEEVMKPMVGFCYFNGCDFVAHLSCLHRYFVDDEQLLLGKQ
                     VLIPIGGKCPDCTRSIKWTTIVKYSTLMKTLYGS"
     gene            <638931..>640466
                     /gene="TDEL0G03460"
                     /locus_tag="TDEL_0G03460"
                     /db_xref="GeneID:11505008"
     mRNA            <638931..>640466
                     /gene="TDEL0G03460"
                     /locus_tag="TDEL_0G03460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682876.1"
                     /db_xref="GeneID:11505008"
     CDS             638931..640466
                     /gene="TDEL0G03460"
                     /locus_tag="TDEL_0G03460"
                     /inference="similar to DNA sequence:INSDC:YBR227C"
                     /note="similar to Saccharomyces cerevisiae MCX1 (YBR227C);
                     ancestral locus Anc_6.124"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682924.1"
                     /db_xref="GeneID:11505008"
                     /db_xref="GOA:G8ZXU6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004487"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZXU6"
                     /translation="MLKIHVRAAIRRYVTSSATFATPAAQKLVQSRVQQIPLPKVLKS
                     FLDEYVVGQEIGKKVLSVAVYNHYLRAYDKQKKAEMKMQQEILEEERRKDDENEPLYS
                     GSSESKAGLKNLQQQFGLSSTRNDDDLELSKSNVLVIGPSGSGKTLLAATLARVLDVP
                     IAITDCTQMTQAGYIGEDVQVCVERLLVNADFDVAKAEQGIIVLDEIDKLAKPAASIG
                     TKDVSGEGVQQALLKLIEGHKLEVNVKRPVKAGTDNQKNTTTAKKDETFVVDTSNILF
                     MIMGAFVGLDKHVSKRINTLRAPKEHQTQESQKDDIQRLRFNNTIEEIVLDNGKRVSA
                     LNMVTPSDLVSFGLIPELIGRVPIVTALEPLQKKDLYEILREPKNAILDQYKYIFQQF
                     NVKLSVTRKALEKVAQFALKEGTGARGLRGIMERLLLNVNYQCPGSGISYVLIDEETV
                     NSLQQTEHSLASHVEAKYYSRGQRDEFINDTTKEDEELGRELDREFGRTPTREKEHQE
                     IDT"
     gene            complement(<640557..>643019)
                     /gene="TDEL0G03470"
                     /locus_tag="TDEL_0G03470"
                     /db_xref="GeneID:11505009"
     mRNA            complement(<640557..>643019)
                     /gene="TDEL0G03470"
                     /locus_tag="TDEL_0G03470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682877.1"
                     /db_xref="GeneID:11505009"
     CDS             complement(640557..643019)
                     /gene="TDEL0G03470"
                     /locus_tag="TDEL_0G03470"
                     /inference="similar to DNA sequence:INSDC:YBR225W"
                     /note="similar to Saccharomyces cerevisiae YBR225W;
                     ancestral locus Anc_6.123"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682925.1"
                     /db_xref="GeneID:11505009"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZXU7"
                     /translation="MRAPESGAPISDSTSRRMSTSSNRIDSKTNGPSSEPGSQGSGTK
                     EEKTKLLQEIESMKNRKLTEPIVIRDEKAGGDPLSVSSSPTADHSAAYSKLKNKSQVT
                     PSLSSSDAIRPHHGPQDQLFGRMSSGEIPVVPYFGLSDDASCRSSSSPLSKGKKTSSG
                     VSSMLDSKNYFGSEQETEWNVSEGQGLTPTTGIHGNTSKVVATQHRRRTWDWSLLPKV
                     GSSILIRTHSFNLISVPIDGEIKQILYTPCYNKNFKQMNIFLSFNMDTKPKDALVHSR
                     KRLVSFGNYITHYLKSRMYAYQCYPFFLQGLSEEDIKMHNYVSYNASHDYTEIETLIS
                     LWFFQAQRVFYNTNSVFFSAEVIQSLLQRKANTRHQSAVQNTLLVQQSDMDSPKPVPT
                     DLFQEIDILLLRPLTEGQMGWQLAYDEPNLIVADYPLDITPWTTNEEDADKAFRKEAS
                     SSSTLRIVTKEESLEFLDTHTASQYFFDCMDRNISELGDEYIPSISQKTSSSEEFNLK
                     EAATADSKKKAAHGKLGKRAGLANLFKRKHTHSIPQNFIQETAETSSPETKAAGRTQS
                     IQNVWLEDYFSKFLANYRKLKLPTQFFLPQDASTARSVSSDDEKTAARKAFLYNKETI
                     QIVLPFPENTLPSIFAPRIWSSLCYTKWKSMLREMYRCIVPGGFALATAYDLRVSNTL
                     TAANDDGTQFPTILERDKTYDAISLGAINNGIHIFPTKHLAQAFKEVGFTNIKYSLLS
                     LKVGDLSTEMGCLNELFSQIIWDSLFRREVPDPSKPPKDTDPTTLVQRYITEHLDKID
                     ENAGCLRTILIVAQKPRKFASE"
     gene            complement(<643689..>645491)
                     /gene="TDEL0G03480"
                     /locus_tag="TDEL_0G03480"
                     /db_xref="GeneID:11505010"
     mRNA            complement(<643689..>645491)
                     /gene="TDEL0G03480"
                     /locus_tag="TDEL_0G03480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682878.1"
                     /db_xref="GeneID:11505010"
     CDS             complement(643689..645491)
                     /gene="TDEL0G03480"
                     /locus_tag="TDEL_0G03480"
                     /inference="similar to DNA sequence:INSDC:YGL125W"
                     /note="similar to Saccharomyces cerevisiae MET13
                     (YGL125W); ancestral locus Anc_6.122"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682926.1"
                     /db_xref="GeneID:11505010"
                     /db_xref="GOA:G8ZXU8"
                     /db_xref="InterPro:IPR003171"
                     /db_xref="InterPro:IPR004621"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="UniProtKB/TrEMBL:G8ZXU8"
                     /translation="MKVSEKLQKHKEVSTKATFSYEYFVPKTTQGVQNLYDRMDRMYE
                     SSLPQFIDITWNAGGGVLSQLSTDLVATAQSVLGLETCMHLTCTNMPVSEIDDALQKA
                     YDSGCQNILALRGDPPVDSNEWTPVEGGFRYAKDLVKYIKAKYGDHFDIGVAGYPEGH
                     PEDDTDDSKLIDYLKQKVDAGASFLITQMFYDADIFIAWCKKVRAAGIEIPIIPGIMP
                     ITTYAAFLRRAQWCDIHLPQEFLDRLEPIKDDDQQVRDTGTDLLVEMCQKILDSGYVT
                     HLHLYTMNLEKAPLMILDRLGLLSQEEHVNGENSLAMLPWRKSLNPQRRNEEVRPIFW
                     QRRPYSYVARTSQWAVDEFPNGRFGDSSSPAFGDLDLCGSSLIRQSGKKSLELWSTPK
                     TVEDVAQLVVNFLERKVSCLPWSDTALNHEVDVILNDLIDLNKKTIITINSQAQVNGI
                     KSSDPIFGWGPKDGYVYQKQYLEFLLPKSKLPKLHDALNSDAILTYFAVDNAGNLTSN
                     HPDGNKANAVTWGIFPGREVLQPTIVEKISFLAWKEEFFHILKEWRLNFQNHQIKESI
                     DVLNDLIDNYVLVNIVDNDYVSQENKIFALLNNI"
     gene            <646102..>647679
                     /gene="TDEL0G03490"
                     /locus_tag="TDEL_0G03490"
                     /db_xref="GeneID:11505011"
     mRNA            <646102..>647679
                     /gene="TDEL0G03490"
                     /locus_tag="TDEL_0G03490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682879.1"
                     /db_xref="GeneID:11505011"
     CDS             646102..647679
                     /gene="TDEL0G03490"
                     /locus_tag="TDEL_0G03490"
                     /inference="similar to DNA sequence:INSDC:YBR223C"
                     /note="similar to Saccharomyces cerevisiae TDP1 (YBR223C);
                     ancestral locus Anc_6.121"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682927.1"
                     /db_xref="GeneID:11505011"
                     /db_xref="GOA:G8ZXU9"
                     /db_xref="InterPro:IPR010347"
                     /db_xref="InterPro:IPR027415"
                     /db_xref="UniProtKB/TrEMBL:G8ZXU9"
                     /translation="MDSNECRRAVAAKWSNVDYRSLGTDNYDSSASSTDIEENVRPIK
                     RLKQEVIDLTSDDENQEEDISSPFKLVKSDVYDSNVNSAHFITFKEIFGDKRLKKSIL
                     FSFQYELDFLFEQFYSGVREIVIVAQKGTIRPCTTQKGISMVDRLSVIEFFMPQYTCH
                     HSKMILNLYDDGSCKMFLPSNNFTYAEANYPQQVCWCSPNLPPSRSGYTEGASEFHDD
                     LIEYLKVYHNKEIVQKIVKDVKLLDFTPLKDVTFIFSAPTKDLTTGFQLLSQRLSDHR
                     KPAESKNSTNHYLCQTSTLGAAISKKTHANLFTHVFIPILHGITSLKSKLVDTETLGG
                     LYRAHNITPYIVYPTVEEIRTSPVGWLCSGWFHFNYNRDMAHYNMLAEELSVFYKQDP
                     KFLSANRKATPSHSKFYMKSTISDDSNPFNNLDWCLYTSANLSLTAWGSGTARPRNYE
                     AGVLYKSGRKPLVCKSFTNVVYKTSRQEIVSDNSQIVLVPFTLPVVKYETAQDEAFCM
                     AKDYNLLDIHGIPYQHH"
     gene            <647836..>649452
                     /gene="TDEL0G03500"
                     /locus_tag="TDEL_0G03500"
                     /db_xref="GeneID:11505012"
     mRNA            <647836..>649452
                     /gene="TDEL0G03500"
                     /locus_tag="TDEL_0G03500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682880.1"
                     /db_xref="GeneID:11505012"
     CDS             647836..649452
                     /gene="TDEL0G03500"
                     /locus_tag="TDEL_0G03500"
                     /inference="similar to DNA sequence:INSDC:YBR222C"
                     /note="similar to Saccharomyces cerevisiae PCS60
                     (YBR222C); ancestral locus Anc_6.120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682928.1"
                     /db_xref="GeneID:11505012"
                     /db_xref="GOA:G8ZXV0"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:G8ZXV0"
                     /translation="MSLTASFNDTFKVSDNVAVVIPETGVEVTYRDLSHQVGHFQTLF
                     QDPQSPLYDVILRQSTVAISMRNGLEFIVAFLGATMDSKIGAPLNPNYKSEEFNFYLN
                     DLQSKVIVVSKGTVKQEKEAEIVKSARKFGCYIVELYFNKDRFRAEYDVYSPDDNYNK
                     VVFSSLKNALFINNDPVHFPGFARSSDVALILHTSGTTSKPKTVPLLHLNIVRSTYNI
                     SRTYKLADTDRSYVVMPLFHVHGLIGVLLSTFRTQGSVIVPEKFSAKKFWDEFITFKA
                     NWFSCVPTISMIMLNMPRPSQMPRIRFIRSCSSALAPATFHKLETEFRAPVLEAYAMT
                     EASHQMTSNDLPPKKRKPGTVGRPQGVEVVILNENDKVLKPGQIGEISIRGENVTLGY
                     AHNEKANEENFTKRENYFRTGDQGYFDPEGFLVLTGRIKELINRGGEKISPIELDGIM
                     LSHPKVDEAVAFGVSDETYGQVVQAVVVLKKGEKLTYEELAKFISERAAKFKVPSKIY
                     FTDVLPKTATGKIQRRVIASTFAGKNKSKL"
     gene            <649769..>650848
                     /gene="TDEL0G03510"
                     /locus_tag="TDEL_0G03510"
                     /db_xref="GeneID:11505013"
     mRNA            <649769..>650848
                     /gene="TDEL0G03510"
                     /locus_tag="TDEL_0G03510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682881.1"
                     /db_xref="GeneID:11505013"
     CDS             649769..650848
                     /gene="TDEL0G03510"
                     /locus_tag="TDEL_0G03510"
                     /inference="similar to DNA sequence:INSDC:YBR221C"
                     /note="similar to Saccharomyces cerevisiae PDB1 (YBR221C);
                     ancestral locus Anc_6.119"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682929.1"
                     /db_xref="GeneID:11505013"
                     /db_xref="GOA:G8ZXV1"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR027110"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G8ZXV1"
                     /translation="MNFRVSSSIAKGMSIGSPFRLQALRYASNKTMTVREALNSAMAE
                     EMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDTPITEYGLAGLAVGSALKG
                     LKPIVEFMSFNFSMQAIDHVVNSAAKTHYMSGGTQRCPIVFRGPNGAAVGVGAQHSQD
                     FSAWYGSIPGMKVLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEECLSP
                     DFTLPYTSKIEREGTDISIITYTRNVQFSLQAAEILDKQYGISAEVLNLRSIRPLDVD
                     AIIKTVKKTNHLITVESAFPQFGVGSEIIAQVMESEAFDYLDAPVQRVTGADVPTPYA
                     KELEDFAFPDPDTIVRAAKETLSVE"
     gene            <651309..>652967
                     /gene="TDEL0G03520"
                     /locus_tag="TDEL_0G03520"
                     /db_xref="GeneID:11505014"
     mRNA            <651309..>652967
                     /gene="TDEL0G03520"
                     /locus_tag="TDEL_0G03520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682882.1"
                     /db_xref="GeneID:11505014"
     CDS             651309..652967
                     /gene="TDEL0G03520"
                     /locus_tag="TDEL_0G03520"
                     /inference="similar to DNA sequence:INSDC:YBR220C"
                     /note="similar to Saccharomyces cerevisiae YBR220C;
                     ancestral locus Anc_6.118"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682930.1"
                     /db_xref="GeneID:11505014"
                     /db_xref="GOA:G8ZXV2"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR024371"
                     /db_xref="UniProtKB/TrEMBL:G8ZXV2"
                     /translation="MDRSLKTNSLASHDVPQFYLLVALYLLQGIPVGLAFGTIPFLLK
                     SMAKDTSFTTLGLFSIATYPYSLKIIWSPIVDSIYSKKSGRRRSWIIPIQLISGILLF
                     VIGSAISKGIIFSGVDDAFHGRNGGIHDLNILSLTWYFGVLVFLCATQDIAVDGWALT
                     ILSKQSLTYASTAQTVGINMGYFLSFTIFLSLNSNDFANKYFRSTPKDHGLVSLGGYM
                     KFSGVLYVLLTFYVMFNTKERPLEDVLPVDISKKKDDEAKVMIEYGDGDAVGTENTSS
                     IIYTYRSFVKILRLPTVRTLAIVHLTSKLAFQCNEAATNLKLLEQGFKREDLAVTVLI
                     DVPFEIIFGYYVAKWSSDNDHDAHHGFSRSSRCVRWLVGEKGVLTPWLWGFLGRLASA
                     ILGSFVVKAFPKDGQITTPYFLLVIVQHLLGSFMSTIQFIGISSFHTRIADPVVGGTY
                     MTLLNTLSNFGGTWPRLIIMSMINYFSIYECYVPATNNKYQYRGNGMESCTKGLMGKV
                     SVVRDGYYITNGLCVVFGILLYFRFLKRKAQQLQSLPVSAWRCE"
     gene            complement(<652945..>654051)
                     /gene="TDEL0G03530"
                     /locus_tag="TDEL_0G03530"
                     /db_xref="GeneID:11505015"
     mRNA            complement(<652945..>654051)
                     /gene="TDEL0G03530"
                     /locus_tag="TDEL_0G03530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682883.1"
                     /db_xref="GeneID:11505015"
     CDS             complement(652945..654051)
                     /gene="TDEL0G03530"
                     /locus_tag="TDEL_0G03530"
                     /inference="similar to DNA sequence:INSDC:YGL126W"
                     /note="similar to Saccharomyces cerevisiae SCS3 (YGL126W);
                     ancestral locus Anc_6.117"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682931.1"
                     /db_xref="GeneID:11505015"
                     /db_xref="InterPro:IPR019388"
                     /db_xref="UniProtKB/TrEMBL:G8ZXV3"
                     /translation="MMTISRYKLFTLIVCPATLLLGHLLSYWFPDDLQYRINKDGLLN
                     SFFVKRGWFWTSAIGWWCMIRYRSFNRQNHHSLVRYAILTIWWYMFTQSLWFGSAPIM
                     DLIFTLTGGSCKFDVFDERGRLSSLFHDTFPRRIRSLERIYHLLKKKPAHDELLEQSL
                     NSIRCAMNGTECHRELAKSVVPTDLNHYIHDSLFSGVTRNSSAVCRTLGGYWVGGHDP
                     SGHIFLITLMIMYLLGELHIFGKRAFSRILREKNMSFKPFIDLFDNGAIWNVLSKKPE
                     TYSQLFFMTVVQPPLTFANSFTVFSLQLIKFVVLENPVILLVGLFLMWWWSFLVTSVV
                     FHTLSEQVSGLAFAYLVAGVIYWNDHWFIRNAMH"
     gene            <654206..>654574
                     /gene="TDEL0G03540"
                     /locus_tag="TDEL_0G03540"
                     /db_xref="GeneID:11505016"
     mRNA            <654206..>654574
                     /gene="TDEL0G03540"
                     /locus_tag="TDEL_0G03540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682884.1"
                     /db_xref="GeneID:11505016"
     CDS             654206..654574
                     /gene="TDEL0G03540"
                     /locus_tag="TDEL_0G03540"
                     /inference="similar to DNA sequence:INSDC:YGL127C"
                     /note="similar to Saccharomyces cerevisiae SOH1 (YGL127C);
                     ancestral locus Anc_6.116"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682932.1"
                     /db_xref="GeneID:11505016"
                     /db_xref="GOA:G8ZXV4"
                     /db_xref="InterPro:IPR008831"
                     /db_xref="UniProtKB/TrEMBL:G8ZXV4"
                     /translation="MSEQPPQDPEATLPTRFEVELEFVQSLANIPYVTYLLSQQQQMW
                     KDPKFKNYLKYLEYWAQPPYVQNIVYPNCLHVLRLLNGFMETATINEDGLLEGLDDLP
                     KIIQLQGAQLMNEMVERWAT"
     gene            <655096..>658629
                     /gene="TDEL0G03550"
                     /locus_tag="TDEL_0G03550"
                     /db_xref="GeneID:11505017"
     mRNA            <655096..>658629
                     /gene="TDEL0G03550"
                     /locus_tag="TDEL_0G03550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682885.1"
                     /db_xref="GeneID:11505017"
     CDS             655096..658629
                     /gene="TDEL0G03550"
                     /locus_tag="TDEL_0G03550"
                     /inference="similar to DNA sequence:INSDC:YBR218C,YGL062W"
                     /note="similar to Saccharomyces cerevisiae PYC2 (YBR218C)
                     and PYC1 (YGL062W); ancestral locus Anc_6.115"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682933.1"
                     /db_xref="GeneID:11505017"
                     /db_xref="GOA:G8ZXV5"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR003379"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR005930"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:G8ZXV5"
                     /translation="MSKNKRFAGLRDNFSLLGEKNKLLVANRGEIPIRIFRSAHELSM
                     RTVAIYSHEDRLSMHKLKSDEAYVIGEEGKYTPVGAYLAIDEIIEIAKQHNVDFIHPG
                     YGFLSENSEFAKKVADNGITWIGPPADVIDAVGDKVSARNLALKADVPTVPGTPGPIE
                     NVQEAKAFVEKYGYPVIIKAAFGGGGRGMRVVREGDDIEDAFQRATSEARTAFGNGTC
                     FIERFLVKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLPVEVRNAI
                     LTDAVKLAHTAGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDIVAAQI
                     QIAAGASLEQLGLMQDRITTRGFAIQCRITTEDPSKNFQPDTGRLEVYRSAGGNGVRL
                     DGGNAFAGAIISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTL
                     LTNPVFVNGDYWTTFIDDTPQLFQMISSQNRAQKLLHYLADLAVNGSSIKGQLGVPKL
                     TTHPTIPHLHDAQGEIINVNSAAPPAGWRQILLDYGPKEFAKQVRDFDGTLIMDTTWR
                     DAHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWGGATFDVAMRFLHEDPWERLRI
                     LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENGVDIFRVFDALNDLEQLK
                     VGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVTGKIVEMGTHILGIKDMAGT
                     MKPSAARLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACALAGADVVDVATNSMSGL
                     TSQPSMNALLASLDGQINTNIDVQHTRELDAYWAEMRLLYSCFEADLKGPDPEVYEHE
                     IPGGQLTNLLFQAQQLGLGEKWAETKRAYKEANYLLGDLVKVTPTSKVVGDLAQFMVS
                     NKLTSGDVKRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDILKNKRRKLTCRPGL
                     ELAPFDLEKIREDLQDRFGDIDECDVASYNMYPKVYEDFHKIKERYGDLSVLPTKNFL
                     SPPKIGEEIEVTIEKGKTLIIKHQAVGDLNKETGVREVYFELNGELRKIPVVDKSQKV
                     ESVAKPKADGHDPLQVGAPMAGVIVEVKVHKGSLVKKGEPVAVLSAMKMEMVISAQAD
                     GQVKEVYINDGDNVDASDLLVVLEEAVPAEN"
     gene            complement(<658855..>659508)
                     /gene="TDEL0G03560"
                     /locus_tag="TDEL_0G03560"
                     /db_xref="GeneID:11505018"
     mRNA            complement(<658855..>659508)
                     /gene="TDEL0G03560"
                     /locus_tag="TDEL_0G03560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682886.1"
                     /db_xref="GeneID:11505018"
     CDS             complement(658855..659508)
                     /gene="TDEL0G03560"
                     /locus_tag="TDEL_0G03560"
                     /inference="similar to DNA sequence:INSDC:YGL061C"
                     /note="similar to Saccharomyces cerevisiae DUO1 (YGL061C);
                     ancestral locus Anc_6.114"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682934.1"
                     /db_xref="GeneID:11505018"
                     /db_xref="GOA:G8ZXV6"
                     /db_xref="InterPro:IPR013960"
                     /db_xref="UniProtKB/TrEMBL:G8ZXV6"
                     /translation="MDDSTVNKLIPQMFDQMRSNLGIKPREHDDGHGHYLDSSAQGSA
                     INTQSLLKELGSLDKIIPMIEAVDSLLQKAVPSHLNRLHEICKSTNAMLDSWVSIQSH
                     AGYVHNLMDSDKYLKYCDTQLNSGDAVTAEAIIAEEMKDIESLREQIANEGNKKLNRE
                     QKPSSDGPVSVRGPTSAGKVNKNKSIIRSRVQRPSAIPSVTSRITRPTASSSRKMFR"
     gene            complement(<659742..>660371)
                     /gene="TDEL0G03570"
                     /locus_tag="TDEL_0G03570"
                     /db_xref="GeneID:11505019"
     mRNA            complement(<659742..>660371)
                     /gene="TDEL0G03570"
                     /locus_tag="TDEL_0G03570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682887.1"
                     /db_xref="GeneID:11505019"
     CDS             complement(659742..660371)
                     /gene="TDEL0G03570"
                     /locus_tag="TDEL_0G03570"
                     /inference="similar to DNA sequence:INSDC:YBR217W"
                     /note="similar to Saccharomyces cerevisiae ATG12
                     (YBR217W); ancestral locus Anc_6.113"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682935.1"
                     /db_xref="GeneID:11505019"
                     /db_xref="GOA:G8ZXV7"
                     /db_xref="InterPro:IPR007242"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8ZXV7"
                     /translation="MSRILESESDNDESGQSSLANSGSADVANVGRDNSSDANSNVIQ
                     RRLEQFSRRLSMLGLMSSQEIEEKDGEEQPDVIESQGLAPLRQEVPMTASLILNKLPK
                     ATNEALEKSQQASSKKSHQDKQLKVQIKFQPIGSIAQITPSVCKISATQPFALISTFL
                     TRSLKVSQVYCYINNSFAPNPQQIVGDLWSQFKVDNELIVSYCGTVAFG"
     gene            <660516..>662501
                     /gene="TDEL0G03580"
                     /locus_tag="TDEL_0G03580"
                     /db_xref="GeneID:11505020"
     mRNA            <660516..>662501
                     /gene="TDEL0G03580"
                     /locus_tag="TDEL_0G03580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682888.1"
                     /db_xref="GeneID:11505020"
     CDS             660516..662501
                     /gene="TDEL0G03580"
                     /locus_tag="TDEL_0G03580"
                     /inference="similar to DNA sequence:INSDC:YBR216C,YGL060W"
                     /note="similar to Saccharomyces cerevisiae YBP1 (YBR216C)
                     and YBP2 (YGL060W); ancestral locus Anc_6.112"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682936.1"
                     /db_xref="GeneID:11505020"
                     /db_xref="InterPro:IPR013877"
                     /db_xref="UniProtKB/TrEMBL:G8ZXV8"
                     /translation="MESIETICDNLEKAFTDQKDDPVSLVTIIDMYNDQVNTEYTKEE
                     RVQYLKKLYSVLSENPDVVSEIGWDLPKGLLKFHSLENLLPHQGLRNNAIVVTIMNCF
                     HEIALHGNPKECLLTGCQLLSDLSVEELAQEVEDYNKAKEAEGSKEVSAEESEFGVKL
                     QNPVEYLLGLNSYVLFELIQSVLRRIQSLYPSKFLGMAVSAICKFLRSNIDSIDNTAF
                     VLRRIFTFCKNYTPMQAPLDSEIIGELDKKELASIADDEAALQGKVLRSLSTFAIGYC
                     LKNKQLRIDVRYYSSFAGGQLNEVPYMKEVVEVCSRFYQLAYSFDIDIKEEFVNLLKE
                     TKNIYRSLPSESDIANDEANRAIGQVVYQLSYTYQLQKLTKPEGLELDPLGILVLSGL
                     HYLQTKQHLSSEISVQDAIYLYIRCSTPALFSALFSSKVAEEVSRYWLWVSITNTSYK
                     VLKKQLSEIPSYISSVFLQMMLLTTCNQTNEQARMINFTLLTRIMCLMPEETTFSFTL
                     DTLLTCPYVKPKICILGILKDLMLKTRQCKQEQDISTQLKDLKIKESSSVGVNEPPAL
                     PPREFVSINDDRMASLHSVALIAITKAAEEKANKEDLILLQNYLNFFAALRNKWDKSL
                     LKAINEEVGGHFDVNESETTPEIGFIIIANETLGKDL"
     gene            complement(<662563..>664407)
                     /gene="TDEL0G03590"
                     /locus_tag="TDEL_0G03590"
                     /db_xref="GeneID:11505021"
     mRNA            complement(<662563..>664407)
                     /gene="TDEL0G03590"
                     /locus_tag="TDEL_0G03590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682889.1"
                     /db_xref="GeneID:11505021"
     CDS             complement(662563..664407)
                     /gene="TDEL0G03590"
                     /locus_tag="TDEL_0G03590"
                     /inference="similar to DNA sequence:INSDC:YBR215W"
                     /note="similar to Saccharomyces cerevisiae HPC2 (YBR215W);
                     ancestral locus Anc_6.111"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682937.1"
                     /db_xref="GeneID:11505021"
                     /db_xref="InterPro:IPR014840"
                     /db_xref="UniProtKB/TrEMBL:G8ZXV9"
                     /translation="MPGNRTHDEEPIKGADQNKRKAPKEETLKAVKKAKKDSIRIPNI
                     AQELAKNRNQVKGTSPSPVVKLSSSPFPLVTDGKVSKSETDTDVDDSSATSGQVTVKT
                     ERLRISSLLSSGENQDGNSLQSQSPLPQSPSEQPRLSSLPPKVILPTQKFGESALETK
                     GSPIDPSILVARISSPVHLPPDKFRGALKRFHSIGAVDCTEKVESEGLTKATVPSKLK
                     SETTLEVVKKASKKPTTSKSTSQKVTSSEGAAKKDSAATSKNADTKKKTAAKKASVKK
                     EPATKKEPGSKKESTAKKESATKKEATAKKEPATKKEPAAKKDPAGKKEPTTKKEQGA
                     KKETNTKKESGAKKETTGKTEAAGKKESSTKKEASAKKETTGKTEAAGKKESSTKKEA
                     SAKKEPSVKKEPTPSTKAKTPKKLVAAPPIKSPSLLEVFERGKSTKEAEDPTIILDIP
                     LYSAQDNEYLDENGQVVFNVCKLVHDNLTAQNGHGGADVKVAKRNLLSQLNGGSRQIE
                     STEDDDEEDIVEVDDDGDDDEEDEGEDEKTTASPKKKSHPNKGKSLIGKYDTEDPFID
                     DTELLWEEQRAATKDGFFVFFGPLIEKGHYASLERADGTMKRGGVKNK"
     gene            <665436..>666899
                     /gene="TDEL0G03600"
                     /locus_tag="TDEL_0G03600"
                     /db_xref="GeneID:11505022"
     mRNA            <665436..>666899
                     /gene="TDEL0G03600"
                     /locus_tag="TDEL_0G03600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682890.1"
                     /db_xref="GeneID:11505022"
     CDS             665436..666899
                     /gene="TDEL0G03600"
                     /locus_tag="TDEL_0G03600"
                     /inference="similar to DNA sequence:INSDC:YGL059W"
                     /note="similar to Saccharomyces cerevisiae YGL059W;
                     ancestral locus Anc_6.110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682938.1"
                     /db_xref="GeneID:11505022"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR018955"
                     /db_xref="UniProtKB/TrEMBL:G8ZXW0"
                     /translation="MNRFTSQSVRLKHSVHTPDISQIPNFTKYSPIKPINEELAPYVL
                     ETMKAFPSRSKHINQQHYYHNRTVLIQDYLRKRPHPMSLTQLAQYYDDSSQLTKQKII
                     TSGKFVKEELSIRMAHKLNSLQQLPFHVVNNFHFVQVYESYYNIFERFRKYPTIRTID
                     DNWRFAAFLRQILQDFNSLNLPHLIMGALECTILELYPQDKMDELLSSLLRARISRRL
                     IVEEHISITSNYASGKKENTLVLGDIFQECSAKEYIVDASKMCQKFIQDMYFEKVPLP
                     ELIIDGELDLKFYFLPTHLKYLLGEILRNTYEATVKDYIRQGLEKPQPIVITIVKNDE
                     SFIFRISDRAGGVPHNDKNIWSFGKSKERASESLENFHRLPGLQTVSLYDHLYQTKHA
                     VSVDKANQPYRHTSLEPMSHSNLTSGKFRFETPLIRLMERSYRYKLGIGLAMCKVYAE
                     YWNGDLTLHSLPGYGTDTVLKLGNLMHTPRKQQLDKV"
     gene            <667177..>667749
                     /gene="TDEL0G03610"
                     /locus_tag="TDEL_0G03610"
                     /db_xref="GeneID:11505023"
     mRNA            join(<667177..667218,667282..>667749)
                     /gene="TDEL0G03610"
                     /locus_tag="TDEL_0G03610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682891.1"
                     /db_xref="GeneID:11505023"
     CDS             join(667177..667218,667282..667749)
                     /gene="TDEL0G03610"
                     /locus_tag="TDEL_0G03610"
                     /inference="similar to DNA sequence:INSDC:YGL058W"
                     /note="similar to Saccharomyces cerevisiae RAD6 (YGL058W);
                     ancestral locus Anc_6.109"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682939.1"
                     /db_xref="GeneID:11505023"
                     /db_xref="GOA:G8ZXW1"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:G8ZXW1"
                     /translation="MSTPARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPA
                     DTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDV
                     ASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVEKSWEDDMDDMGDDD
                     DDDDDDDDE"
     gene            complement(<667834..>668565)
                     /gene="TDEL0G03620"
                     /locus_tag="TDEL_0G03620"
                     /db_xref="GeneID:11505024"
     mRNA            complement(<667834..>668565)
                     /gene="TDEL0G03620"
                     /locus_tag="TDEL_0G03620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682892.1"
                     /db_xref="GeneID:11505024"
     CDS             complement(667834..668565)
                     /gene="TDEL0G03620"
                     /locus_tag="TDEL_0G03620"
                     /inference="similar to DNA sequence:INSDC:YGL057C"
                     /note="similar to Saccharomyces cerevisiae YGL057C;
                     ancestral locus Anc_6.108"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682940.1"
                     /db_xref="GeneID:11505024"
                     /db_xref="UniProtKB/TrEMBL:G8ZXW2"
                     /translation="MLRLVRYKSTRLPPKSLIIKQNSRLNKKNTENSKVVISSLRDVI
                     SLFQANSQTQEDDDLETLNHEMYLLQQIESGEVERLLKSKFQIDESKQLLSTGALIKN
                     YPQLNKDELELIKKVNDLENIKPWSQIPQFVKQAQFYLSYGSYGPRLDLPFKANEKPL
                     DFTYVNRARKQFGQEPYKRLKKDQLVNIYEVTPTRQRYFNDKTVDPVSRFFIWTAIAV
                     SAAVGWKEYKLREDGESLVTVVDKD"
     gene            complement(<668697..>670229)
                     /gene="TDEL0G03630"
                     /locus_tag="TDEL_0G03630"
                     /db_xref="GeneID:11505025"
     mRNA            complement(<668697..>670229)
                     /gene="TDEL0G03630"
                     /locus_tag="TDEL_0G03630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682893.1"
                     /db_xref="GeneID:11505025"
     CDS             complement(668697..670229)
                     /gene="TDEL0G03630"
                     /locus_tag="TDEL_0G03630"
                     /inference="similar to DNA sequence:INSDC:YBR214W,YGL056C"
                     /note="similar to Saccharomyces cerevisiae SDS24 (YBR214W)
                     and SDS23 (YGL056C); ancestral locus Anc_6.107"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682941.1"
                     /db_xref="GeneID:11505025"
                     /db_xref="GOA:G8ZXW3"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR016711"
                     /db_xref="UniProtKB/TrEMBL:G8ZXW3"
                     /translation="MSGSNSANSNSNSNTNNSPNLTGSRHASIVEMLSTPPHLPHHHQ
                     RGQQQQQQQQQQQRIEKSEGLTKVGSHGSAHSSVSSIASMREAEGPASVEHEAVQMTP
                     TASQCLYTVHHQEWQHIQLSQLIEPNKLITVSGSLSVEEAFNTLIRHHLTSLPVEQQP
                     GDMNCLTFDYNDLNSYLLLVLNKIQVNNRQVQQDCQNGKSVPVGEIVKLTPKNPFYKL
                     AETENLSTVMGILGSGVHRVAITDVEMTQIKGVLSQRRLIKYLWDNARSFSSLEPLLN
                     SSLQDLKIGVLNSHAKPTSRQSRIISIQGDEPLIMALYKMYTDRISSIAVVDQQGNLI
                     GNISVTDVKHVTRTSQYPLLHKTCRHFISIILNVRGLETGKDSFPIFHVYPTSSLART
                     LAKLVATKSHRLWIVQPQEVSSSTSLDTIPLPPAGGSQGSTSSTPNTSQSPIMSALED
                     PPSPHSAAVASGLFEKEYRTGKLIGVVSLTDILSLLARSQTEHKQVDPQSARRQRGSV
                     VS"
     gene            <671677..>673137
                     /gene="TDEL0G03640"
                     /locus_tag="TDEL_0G03640"
                     /db_xref="GeneID:11505026"
     mRNA            <671677..>673137
                     /gene="TDEL0G03640"
                     /locus_tag="TDEL_0G03640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682894.1"
                     /db_xref="GeneID:11505026"
     CDS             671677..673137
                     /gene="TDEL0G03640"
                     /locus_tag="TDEL_0G03640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682942.1"
                     /db_xref="GeneID:11505026"
                     /db_xref="InterPro:IPR001959"
                     /db_xref="InterPro:IPR010095"
                     /db_xref="InterPro:IPR021027"
                     /db_xref="UniProtKB/TrEMBL:G8ZXW4"
                     /translation="MTIVVQNQAKKRKTSNSKTTKPYWNEDAAHISQQWGLNTILPTA
                     AKNLSQKITSDSWFNVVKHPQVPVINDSLNLPLSNGVKEEITRARKIRIYPTNSQKET
                     LKKWFGCQRYIYNRALKLHRDGMAMTIKGLRQTLLNRDTNILEPQEQWLNDYSYDLKD
                     EALRDLVKNYSSNMAKLKNTGVPFKLRFKSKKAPAQTLSVLKKHWNKRTKSFWSKVFS
                     SSKMRSAEVLPEKLLMDSRLQRTRNNKFYLILPVVGEEIVRKMKADKFIFIDPGIRTF
                     LTGYDSGQNVVEIGKNAVVRIEKLKRRRRQLQSKLAKLRKHKKRQNHRKALHRLDEKI
                     QHIVRDMHKKTASYLCKNYENIFLPKLNYHQCTRLTRKTRSSMATIAHCCFHDRLTMK
                     AEQFHSTSVHEVEEDYTSKTCSSCGNLKDDLGSNKIYSCSSCSSVFDRDFNAAKNIML
                     KYICEHLMASGGSSISSALSVRNVGFAMMGPGPFVH"
     gene            <673347..>674798
                     /gene="TDEL0G03650"
                     /locus_tag="TDEL_0G03650"
                     /db_xref="GeneID:11505027"
     mRNA            <673347..>674798
                     /gene="TDEL0G03650"
                     /locus_tag="TDEL_0G03650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682895.1"
                     /db_xref="GeneID:11505027"
     CDS             673347..674798
                     /gene="TDEL0G03650"
                     /locus_tag="TDEL_0G03650"
                     /inference="similar to DNA sequence:INSDC:YGL055W"
                     /note="similar to Saccharomyces cerevisiae OLE1 (YGL055W);
                     ancestral locus Anc_6.106"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682943.1"
                     /db_xref="GeneID:11505027"
                     /db_xref="GOA:G8ZXW5"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR001522"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="InterPro:IPR009160"
                     /db_xref="InterPro:IPR015876"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:G8ZXW5"
                     /translation="MSKMDEVDLVQANVLASGANKKSVRIVNGLGSLMGSKSMVDVDF
                     KSDSNMDYLLRRDEEEKARYAKNRHISEQPWTLNNWHKHLNWLNMILVVFLPSIGWYM
                     ALSGKAPLQLNTLLFSLFYYAVGGASITAGYHRLWSHRSYSARWPLRLLYAFFGSASV
                     EGSVKWWGHSHRIHHRYTDTVRDPYDARRGLWFSHMGWMLLKPNPKYRARADIEDLAD
                     DWIVRFQHRHYIPLMLLSAFVLPTIVCGYFFNDYLGGFVYAGLIRVFCIQQATFCINS
                     LAHYLGDQPFDDRRTPRDNWITALVTFGEGYHNFHHEFPTDYRNAIRWYQYDPTKVII
                     YLSSMCGLAYDLKKFSHNAIQQALVQQQQKKLDRQRSKLNWGPQLTDLPVWDKQDFLK
                     EMETRKGLVVISGIVHDVSGYITEHPGGETLLQAALGKDATKAFNGGVYRHSNAAHNV
                     LATMRVAVVKDGEDAAIKFAARRGETYAKSKAE"
     gene            complement(<674888..>675709)
                     /gene="TDEL0G03660"
                     /locus_tag="TDEL_0G03660"
                     /db_xref="GeneID:11505028"
     mRNA            complement(<674888..>675709)
                     /gene="TDEL0G03660"
                     /locus_tag="TDEL_0G03660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682896.1"
                     /db_xref="GeneID:11505028"
     CDS             complement(674888..675709)
                     /gene="TDEL0G03660"
                     /locus_tag="TDEL_0G03660"
                     /inference="similar to DNA sequence:INSDC:YBR213W"
                     /note="similar to Saccharomyces cerevisiae MET8 (YBR213W);
                     ancestral locus Anc_6.105"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682944.1"
                     /db_xref="GeneID:11505028"
                     /db_xref="GOA:G8ZXW6"
                     /db_xref="InterPro:IPR006367"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028161"
                     /db_xref="InterPro:IPR028162"
                     /db_xref="InterPro:IPR028281"
                     /db_xref="UniProtKB/TrEMBL:G8ZXW6"
                     /translation="MGGKSLILAHQLHEKNVLVVGGGEVALTRLKKLISTGTRVTLVS
                     PEIHPTILKEYCGFVGQRTEIDVIDDDWKAGQGVYRVIRSRFKMEYLTLYTKGNDSGW
                     SLILTCIPNKPLSEEIYHESKRRFGSQQTVNVADNPPLCDVYFGANLEFGNRQGSSMQ
                     MMISSNGMGPRYVALVRDEIKSMLEGIDFEGSLKNLGELRSRVREIAHEDSDTKYRMN
                     WMKSCTENFGIKNCEKMDVDKLVELFDKMYVDDRNMIFPSRDTMIEHYMKESNSK"
     gene            complement(<675820..>677673)
                     /gene="TDEL0G03670"
                     /locus_tag="TDEL_0G03670"
                     /db_xref="GeneID:11505029"
     mRNA            complement(<675820..>677673)
                     /gene="TDEL0G03670"
                     /locus_tag="TDEL_0G03670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682897.1"
                     /db_xref="GeneID:11505029"
     CDS             complement(675820..677673)
                     /gene="TDEL0G03670"
                     /locus_tag="TDEL_0G03670"
                     /inference="similar to DNA sequence:INSDC:YBR212W"
                     /note="similar to Saccharomyces cerevisiae NGR1 (YBR212W);
                     ancestral locus Anc_6.104"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682945.1"
                     /db_xref="GeneID:11505029"
                     /db_xref="GOA:G8ZXW7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8ZXW7"
                     /translation="MSDDQIQQVQQSSGDSPVSAIPLPPSATIETSSEPPRTLWMGDL
                     DPSFDEMTIQDIWQQLDKKVFVKLIRAKKNLLIPCSSTAATSSSNGTPNSNAAENITG
                     NGSSNDSDPSDVLESTQKININGVSFIDPATTPLHHAGYCFVEFESQQDAQFALSLNS
                     GPLPNIISRSTNLPTNPSGQRNFRLNWASGATLQSSIPSRPEFSLFVGDLSPTATEAD
                     LLSLFQQKFRSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALVEMNGVWCQGRCLR
                     VAYATPRNNMTWHVQSQQQQQQQQQQQQQQQQQQQQQQQLQQPQQQHTPLLVKTANNI
                     MTANPSGICGSSNLMSMPMSQKPSASSVTSNSSMNIPDFSSSQAYTTPPNNTTVFIGG
                     LTPKINEAQLQALFSPFGNILTVKIPQGKNCGFVKYENRIDAEAAIQGMQGFIVGGNP
                     VRLSWGRNTVASGSSNNVSSNLPQMTSHHYIPQQSYSSGPQYVPMRHASSNSPVSNQP
                     LDPYQNISRDPMIMQPQQQLPQASQQVWTNGMQWNNMSSRVYRETPMMNQQNVPSMLP
                     QQQYQRAQYPMMSSVYHGFDTGMVQNPSGITLTSVNGKPNDVPPIHPSVLR"
     gene            <678362..>679279
                     /gene="TDEL0G03680"
                     /locus_tag="TDEL_0G03680"
                     /db_xref="GeneID:11505030"
     mRNA            <678362..>679279
                     /gene="TDEL0G03680"
                     /locus_tag="TDEL_0G03680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682898.1"
                     /db_xref="GeneID:11505030"
     CDS             678362..679279
                     /gene="TDEL0G03680"
                     /locus_tag="TDEL_0G03680"
                     /inference="similar to DNA sequence:INSDC:YBR211C"
                     /note="similar to Saccharomyces cerevisiae AME1 (YBR211C);
                     ancestral locus Anc_6.103"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682946.1"
                     /db_xref="GeneID:11505030"
                     /db_xref="UniProtKB/TrEMBL:G8ZXW8"
                     /translation="MSANLTDRGIKLLYRQRGSRSRQVVHEGDDDRLIIRGPIIEQQS
                     DVEESPREQFEDEPLLDGPFVEPEHEEQEPLHEERHNEYQFDNEKVEQPVVHENFDEE
                     ELLSYYNFQDMPLRQLSSSITSVTSIDVLISMFTNLFENDLIPQAIKEFESSKDSNSK
                     MMYKLDVRIFESVLEQLIKDFKDILDINMSNNELCYQLKQIVVAREELNQELVETRSE
                     LQKLKCGGEWYKVQQEQSELNGRVELNDQLNHLNAQLHGEAAIPTSQEPLATNETVSD
                     FCEMVNPYSGILARLEQMNNSLQQEHSVE"
     gene            complement(<679342..>679755)
                     /gene="TDEL0G03690"
                     /locus_tag="TDEL_0G03690"
                     /db_xref="GeneID:11505031"
     mRNA            complement(<679342..>679755)
                     /gene="TDEL0G03690"
                     /locus_tag="TDEL_0G03690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682899.1"
                     /db_xref="GeneID:11505031"
     CDS             complement(679342..679755)
                     /gene="TDEL0G03690"
                     /locus_tag="TDEL_0G03690"
                     /inference="similar to DNA sequence:INSDC:YBR210W,YGL054C"
                     /note="similar to Saccharomyces cerevisiae ERV15 (YBR210W)
                     and ERV14 (YGL054C); ancestral locus Anc_6.102"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682947.1"
                     /db_xref="GeneID:11505031"
                     /db_xref="GOA:G8ZXW9"
                     /db_xref="InterPro:IPR003377"
                     /db_xref="UniProtKB/TrEMBL:G8ZXW9"
                     /translation="MGAWLFILAVVVNCINLFGQVHFTILYADLEADYINPIELCSKV
                     NSLITPEAALHGVLTTLFLLNGYWFVFLLNLPILAYNANKVYHKVQLLDATEIFRTLG
                     KHKRESFLKLGFYLLMFFFYLYRMIMALISESGDE"
     gene            complement(680052..680123)
                     /gene="TDEL0Gtrna6E"
                     /locus_tag="TDEL_0Gtrna6E"
                     /db_xref="GeneID:11505032"
     tRNA            complement(680052..680123)
                     /gene="TDEL0Gtrna6E"
                     /locus_tag="TDEL_0Gtrna6E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:11505032"
     gene            complement(<680234..>680977)
                     /gene="TDEL0G03700"
                     /locus_tag="TDEL_0G03700"
                     /db_xref="GeneID:11505330"
     mRNA            complement(<680234..>680977)
                     /gene="TDEL0G03700"
                     /locus_tag="TDEL_0G03700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682900.1"
                     /db_xref="GeneID:11505330"
     CDS             complement(680234..680977)
                     /gene="TDEL0G03700"
                     /locus_tag="TDEL_0G03700"
                     /inference="similar to DNA sequence:INSDC:YLR301W"
                     /note="similar to Saccharomyces cerevisiae YLR301W;
                     ancestral locus Anc_6.101"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682948.1"
                     /db_xref="GeneID:11505330"
                     /db_xref="UniProtKB/TrEMBL:G8ZXX0"
                     /translation="MPTLLQRLVFQVGPVPNERAFVLSSVSTDGHYISLRPFVKPRNA
                     SEEAFPFEWVFAGTNQNVVVNQKSEAIVTQDFNNWFDSNVYLNLPNTHRGEINTTWEN
                     WESGCIAETGSVFPAGRELDGVPFFELWQPLDSTRDELVVSTPQNEKSASSAKSIVFK
                     TTEGSGFDGLVVVTGRWAQGFLSKQNDGTINGMNFIRTLETGNSNVVQTLLQYGRDAD
                     KFPRKFDGIKLGDVVEANGLKWEVIESYL"
     gene            complement(<681294..>684938)
                     /gene="TDEL0G03710"
                     /locus_tag="TDEL_0G03710"
                     /db_xref="GeneID:11505033"
     mRNA            complement(<681294..>684938)
                     /gene="TDEL0G03710"
                     /locus_tag="TDEL_0G03710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682901.1"
                     /db_xref="GeneID:11505033"
     CDS             complement(681294..684938)
                     /gene="TDEL0G03710"
                     /locus_tag="TDEL_0G03710"
                     /inference="similar to DNA sequence:INSDC:YOR191W"
                     /note="similar to Saccharomyces cerevisiae RIS1 (YOR191W);
                     ancestral locus Anc_6.100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682949.1"
                     /db_xref="GeneID:11505033"
                     /db_xref="GOA:G8ZXX1"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZXX1"
                     /translation="MNAVSVPTIDLTLDDSDDGSKVSDGPSTTRLPGLGLSKVRKDMS
                     SPLKQSTQEDSLAPKRKYEALDDDNTTVKRPSPEQEVITVSDDERGMHNLRDEDKEIF
                     LKNAFRSLQSNSTILQRKLTRREQEVADAEKKLLLHKRTSPGNEGQMSKTQHILVEEA
                     EISLKRLKTKRNHTKQKLDEVKGRMYDFSERWNSFVAEREEKIKQEAGKALVKKRQEL
                     LSQKELIAHMAREGSLSEYTYKSMAEELDQKLNELNAQGETTVKHPSSSPEPQKHIDP
                     FTKSLDTAKELLAKNTSRTEMTKRTLYQQLDVIRNYRDHFQRGRECNVSMRNASRDAA
                     EILFQNGVKMPLVYDTLQDYGIRFRTHGITSVDRRAQYYKSLEVARELVRNSNRHFAI
                     KVRIADSLNVLLDLRQSIDAGFPPKPAFKLEVGRSCVELQEQGLKMEKLYENIRKYGI
                     VTSRSELDFLQKYQKSEEPLSIPDEEPINYPMIEQQRSQFTGTDDLQIANLYSADDKE
                     HIRALLENIKQDEDEIEGETLTPEQLTVNLLRHQRVGLQWLLNVEKSKKRGGILADDM
                     GLGKTVQAIALMLANRSKDAACKTNLIVAPVSVLRSWQGEIETKIKQSAGFTCYIYGG
                     GGGNKISRWRALSHYDAILVSYQTLAIEFKKHWPVNLGEAGKDLPPIPQIKALNSLKT
                     LNEYWSPFFCNESDFYRVILDEGQNIKNKNTKAAKACCTISSTYRWVLSGTPIQNNMN
                     ELYSLIRFLRIPPYHREERFNADIGRPLNYKSTDYDSEDRKRTMKKVRILLKAIMLRR
                     SKTDKIDGEPILELPAKEVEVEEAQLEGQELEFYSDLEQKNQKLAKRILERKAKGNYS
                     SVLTLLLRLRQACCHPELVIAGEKKAEGTRVANGKSFEDDWLRLYRRIRMMTNEQHET
                     VSKSMDMMICFWCMEQLEPESTCVLSGCGHLLCDACVEPFTDEASGASNALTTEKGIL
                     RLPCKKCQNRTMETEIVSYKLYDQVVNQSFTEQMLYAEFKSEMERQKMRAGKSYVPDL
                     NKLEPSTKMRQCMDVIKKVLDKSDTEKILVFSQFTTFFDLFQHFLARDLDVPFLKYTG
                     VMNAQHRSEVINRFYSEKDKRVLLISMKAGNSGLTLTCANHVVIVDPFWNPYVEEQAQ
                     DRCHRISQTKEVHVHKLFIKNSVEDRIAELQKRKKELVDAAMDASHKESINRLGAREI
                     GFLFGLNTLQ"
     gene            complement(<685061..>686395)
                     /gene="TDEL0G03720"
                     /locus_tag="TDEL_0G03720"
                     /db_xref="GeneID:11505034"
     mRNA            complement(<685061..>686395)
                     /gene="TDEL0G03720"
                     /locus_tag="TDEL_0G03720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682902.1"
                     /db_xref="GeneID:11505034"
     CDS             complement(685061..686395)
                     /gene="TDEL0G03720"
                     /locus_tag="TDEL_0G03720"
                     /inference="similar to DNA sequence:INSDC:YLR300W,YOR190W"
                     /note="similar to Saccharomyces cerevisiae EXG1 (YLR300W)
                     and SPR1 (YOR190W); ancestral locus Anc_6.99"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682950.1"
                     /db_xref="GeneID:11505034"
                     /db_xref="GOA:G8ZXX2"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR018087"
                     /db_xref="UniProtKB/TrEMBL:G8ZXX2"
                     /translation="MFLQSLLVSVVSFTALVLGSPIPAKSPHSVQFVTDRNEKRFFDY
                     ATHQYSDPVRGVNIGGWLVLEPYITPTLFEAFRTNAYNDDGIPVDEYHYAQQLGQDIA
                     ASRLEAHWSSFYTEQDFKDISDLGFNLVRIPIGYWAYEKLENDPYVMGKQAEYLDQAI
                     EWAGKYNLKVWVDLHGAAGSQNGFDNSGLRDSWAFLEDSNLQVTTRVIEHLLDKYSQD
                     EYLETVVGIELINEPLGPVLDLQKMKDQYYTPAYNYLRNTLNRNQIIVIHDAFMAFNY
                     WDDFLTADSGAWGVVVDHHHYQCFNNDDLQKSIDEHVELACSWGKGVLNEAHWTVSGE
                     FSAALTDCTKWINGVGVSPRYDGSFNKDGETSSYIGSCANNEDISSWSEERKQNTRRY
                     VEAQLDAFEMRGGWIIWCYKTENTIEWDLQRLTYNGLFPQPLTARQYPGQCN"
     gene            complement(<686846..>687139)
                     /gene="TDEL0G03730"
                     /locus_tag="TDEL_0G03730"
                     /db_xref="GeneID:11505035"
     mRNA            complement(<686846..>687139)
                     /gene="TDEL0G03730"
                     /locus_tag="TDEL_0G03730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682903.1"
                     /db_xref="GeneID:11505035"
     CDS             complement(686846..687139)
                     /gene="TDEL0G03730"
                     /locus_tag="TDEL_0G03730"
                     /inference="similar to DNA sequence:INSDC:YOR189W"
                     /note="similar to Saccharomyces cerevisiae IES4 (YOR189W);
                     ancestral locus Anc_6.98"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682951.1"
                     /db_xref="GeneID:11505035"
                     /db_xref="UniProtKB/TrEMBL:G8ZXX3"
                     /translation="MSQSGSHTAQTSPSPESRPKPPTKDEPKNKKFSTDPVTPWQLEP
                     KGVPIRTFAGYEFKLNGWVRQDVQQQRSQQIHQIPPSSQDNKSEIEIDSSSVH"
     gene            complement(<687233..>690907)
                     /gene="TDEL0G03740"
                     /locus_tag="TDEL_0G03740"
                     /db_xref="GeneID:11505036"
     mRNA            complement(<687233..>690907)
                     /gene="TDEL0G03740"
                     /locus_tag="TDEL_0G03740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682904.1"
                     /db_xref="GeneID:11505036"
     CDS             complement(687233..690907)
                     /gene="TDEL0G03740"
                     /locus_tag="TDEL_0G03740"
                     /inference="similar to DNA sequence:INSDC:YOR188W"
                     /note="similar to Saccharomyces cerevisiae MSB1 (YOR188W);
                     ancestral locus Anc_6.97"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682952.1"
                     /db_xref="GeneID:11505036"
                     /db_xref="InterPro:IPR012965"
                     /db_xref="UniProtKB/TrEMBL:G8ZXX4"
                     /translation="MTSASASKPLPTPPPATFVNREAVSSSPRRDVIDNNIPMKAYRK
                     TTNQDTNDDDDDEEFEFFNNFEREKVKAVIHSITAELKDRGADVEYLMIPFRPQQTNE
                     KLLKLLNSLFPMGNGQPVPEKQMWKIVKKAEPLTLFQGLKYIWCRLPEGQVVSWKAYL
                     EFKRREKSKDYPRRAFLEIMPQCLESPSHASIVYDYFDLIITLASNSRINKMSARKIS
                     KMCAIWAFGVAIEQGGKSLDYDFTNTSTLPSNSFQDGLDEWIPGTDAMFHLLLAFLKS
                     FVPQELESAKLPLSLKSLLFNNDYPPKGSTAYSSETVLTIPLVTLQTDKFSRKPWQLL
                     ERCNELLDFTDHDAFQAREDFALLKSLFKKKNNVEGISRKMSQESRRLMKLMSTKHST
                     FQAGWATRKCLPNESNLKENIEVSRVEIDDYFIWAWLSTLSYEQTSQKEKLFGRSLIL
                     EFEFDGFKKWVMFQECDITLESRKRQRQRDMEPPVASPKVAQPVQQQVDSQRKVTPTY
                     DNFQNRVPSSGSRSADSSSGEMYHTVISKESLGKNNAKNNVNLHSIEQKFSKWNPLSK
                     VKKKGSNHSTSSSKEEMLMPDIKQKKKESMIINPHHSIYQLPPIECDNDDFKDIFAAQ
                     GISEGEDDDAQSLDITSAKPKRTPPPQDYRAPIRQEEPNRNSSEEAMEELKGMVDQMM
                     TDDISKLIIDDGSSTTVNSTREIFEDFTKFDQYKPSNEEFADTPTSSSSAVPSLRLDH
                     GVPSLKPADTKPLPQVVPITQGPPPLQIHKGVEQRVPRDMNKRLPEIRIDEPSEANRS
                     VSPQRVPAPTELYAPRHESPPMVVRQEHHVPTSAEYSSPRPFVQPTAEAQEHERRRRQ
                     SPTRPDAALANRYTQRQQSPPRAIPQDQYGQRQQSPPRPREVVADHYTHTRPVAQQEN
                     YVPVPQGQRQHSPPRPMVQPQSEAAADHYTQPRPVIQDPYTHVPQAHRQQSPPKPLVH
                     PPQVQRHHSPPEAVADHYTQPRPVVHQDHHVPVPNVQKQHSPREPVADRYSQRRDPQR
                     PTGQYPPATQAHNPRQDIPPVAADHYQRQDTQRPIEQYPPQTGYYPQLSPIAPDAGHF
                     AQRQEPIPADYARPPEHYPSGPYTQRYAPAMTSPQTQYPHGPAPRGYASPELRYYKNE
                     RPARQAYGYPRAPPQQQFTAPIRSPSPGRPMRSPPMPKHTNVPFAPAAPHATKLHGQT
                     NRQQERKKLHNNIRNGNFGI"
     gene            complement(<691110..>692978)
                     /gene="TDEL0G03750"
                     /locus_tag="TDEL_0G03750"
                     /db_xref="GeneID:11505037"
     mRNA            complement(<691110..>692978)
                     /gene="TDEL0G03750"
                     /locus_tag="TDEL_0G03750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682905.1"
                     /db_xref="GeneID:11505037"
     CDS             complement(691110..692978)
                     /gene="TDEL0G03750"
                     /locus_tag="TDEL_0G03750"
                     /inference="similar to DNA sequence:INSDC:YLR299W"
                     /note="similar to Saccharomyces cerevisiae ECM38
                     (YLR299W); ancestral locus Anc_6.96"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682953.1"
                     /db_xref="GeneID:11505037"
                     /db_xref="GOA:G8ZXX5"
                     /db_xref="InterPro:IPR000101"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8ZXX5"
                     /translation="MWAKKWLQLGVILLLSRVVSTHPIILGQSTLEDPRFFHRLGTDH
                     NIEIDPLKRQPTLDPDTSFLKVGHNGAISSDLQICSNLTITNVLKKFPGSNAADAAVT
                     HALCIGMINFFNSGIGGGGYAVFSSKDENKYLTVDFREQAPSGSHKKMFDGCPECSKL
                     GGLSVAVPGELQGLYELYESRGSGEVTWFDLLKPVADLGYEGWHIGDALGAALKYYEP
                     SLLAMRDDWSFVINGTGNGVKKVNDWINRPVLSDTLMELARNGSAAPFYDSNHWIAQS
                     MVKSITKHGGILTLEDLEKYNVSKSKPLSLKIRSGFHHAPDNDLNVLTSSGSSSGAAL
                     ISALGIMDRLDSVEGGDYLPRKAFELVEAMKWMASARSRLGDYEGEELPSHIEEVLHK
                     EWIDNAAGSIKQSCLDNDLKTMRNWTDYKPAYEINDPHGTAHFSIVDSFGNAVSLTTT
                     VNLLFGSLVHDPATGVIFNNEMDDFSQVERSNSFGLAPSIYNYPEPGKRPLSSAVPTI
                     ILNELGIPDLIVGASGGSTITTSVLQAIVRSYWYRMPLLETIAYPRVHHQLLPDTLEV
                     ENLAMLGKTAINTFHEMGHNTLERNPRSVVNAIRYSDGDWHAVSDYWRKRGVSSVY"
     gene            complement(<693213..>694508)
                     /gene="TDEL0G03760"
                     /locus_tag="TDEL_0G03760"
                     /db_xref="GeneID:11505038"
     mRNA            complement(<693213..>694508)
                     /gene="TDEL0G03760"
                     /locus_tag="TDEL_0G03760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682906.1"
                     /db_xref="GeneID:11505038"
     CDS             complement(693213..694508)
                     /gene="TDEL0G03760"
                     /locus_tag="TDEL_0G03760"
                     /inference="similar to DNA sequence:INSDC:YOR187W"
                     /note="similar to Saccharomyces cerevisiae TUF1 (YOR187W);
                     ancestral locus Anc_6.95"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682954.1"
                     /db_xref="GeneID:11505038"
                     /db_xref="GOA:G8ZXX6"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004541"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZXX6"
                     /translation="MLTPRFASRLISSKFLRPQCAVRGLSTTLRVSAAAFDRKKPHLN
                     IGTIGHVDHGKTTLTAAITKTLAEKGGADFLDYAAIDKAPEERARGITISTAHVEYET
                     ENRHYSHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQH
                     IVVFVNKVDTMDDPEMLELVEMEMRELLSQYGFDGDNVPVVMGSALCALEGRQPEIGE
                     QAIMKLLEQVDEYIPTPKRDLDKPFLMPVEDIFSISGRGTVVTGRVERGNLKKGEEIE
                     IVGHNTTPLKTTVTGIEMFRKELDQAMAGDNAGILLRGVRRDQLKRGMVLAKPGTVKA
                     HTKFLSSLYILSKEEGGRHSGFGENYRPQMFIRTADVTVVLKFPESVEDHSMQVMPGD
                     NVEMECELIHPTPLEVGQRFNIREGGKTVGTGLITRLLE"
     gene            <694656..>695231
                     /gene="TDEL0G03770"
                     /locus_tag="TDEL_0G03770"
                     /db_xref="GeneID:11505039"
     mRNA            <694656..>695231
                     /gene="TDEL0G03770"
                     /locus_tag="TDEL_0G03770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682907.1"
                     /db_xref="GeneID:11505039"
     CDS             694656..695231
                     /gene="TDEL0G03770"
                     /locus_tag="TDEL_0G03770"
                     /inference="similar to DNA sequence:INSDC:YLR298C"
                     /note="similar to Saccharomyces cerevisiae YHC1 (YLR298C);
                     ancestral locus Anc_6.94"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682955.1"
                     /db_xref="GeneID:11505039"
                     /db_xref="GOA:G8ZXX7"
                     /db_xref="InterPro:IPR000690"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR013085"
                     /db_xref="InterPro:IPR017340"
                     /db_xref="UniProtKB/TrEMBL:G8ZXX7"
                     /translation="MARYYCEYCHSYLTHDTLSVRKSHLVGKNHLRIVADYYRNKAHQ
                     EHPTRRRQHGKHSTNEPIKIHLPVNREKRRTNSLARCHRKELLQEESLLKRVYEGSPG
                     YSKVFVDSNRLDIGDLVRSSRLPQRANVDTHQTRSRNETFTSPTQQPLEPPRLLARWQ
                     TTAPKATYHEERLLQGTLNEAKQRLSRKRKN"
     gene            complement(<695284..>695529)
                     /gene="TDEL0G03780"
                     /locus_tag="TDEL_0G03780"
                     /db_xref="GeneID:11505040"
     mRNA            complement(<695284..>695529)
                     /gene="TDEL0G03780"
                     /locus_tag="TDEL_0G03780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682908.1"
                     /db_xref="GeneID:11505040"
     CDS             complement(695284..695529)
                     /gene="TDEL0G03780"
                     /locus_tag="TDEL_0G03780"
                     /inference="similar to DNA sequence:INSDC:YOR186W,YLR297W"
                     /note="similar to Saccharomyces cerevisiae YOR186W and
                     YLR297W; ancestral locus Anc_6.93"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682956.1"
                     /db_xref="GeneID:11505040"
                     /db_xref="UniProtKB/TrEMBL:G8ZXX8"
                     /translation="MTKLCDMHHGYQTGVFDSVSALFRHQAGDAEPTGDFLALAMIAF
                     VLGVVLVLIVGLVLILLFSRDETDADVDEEACYDEKL"
     gene            <698116..>698472
                     /gene="TDEL0G03790"
                     /locus_tag="TDEL_0G03790"
                     /db_xref="GeneID:11505041"
     mRNA            <698116..>698472
                     /gene="TDEL0G03790"
                     /locus_tag="TDEL_0G03790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682909.1"
                     /db_xref="GeneID:11505041"
     CDS             698116..698472
                     /gene="TDEL0G03790"
                     /locus_tag="TDEL_0G03790"
                     /inference="similar to DNA sequence:INSDC:YLR295C"
                     /note="similar to Saccharomyces cerevisiae ATP14
                     (YLR295C); ancestral locus Anc_6.92"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682957.1"
                     /db_xref="GeneID:11505041"
                     /db_xref="InterPro:IPR019711"
                     /db_xref="UniProtKB/TrEMBL:G8ZXX9"
                     /translation="MFALRSSCLLQRTLAVRPVLRQLHYTPVNRNVVQDLYLKELKNV
                     KLNPITAKDAEGNVRPWSEPVKPKAPELEGQGTDALKAYSNEPVETKTEAAEEEAPVE
                     DDWLVLEDDVEETHSH"
     gene            <698567..>699304
                     /gene="TDEL0G03800"
                     /locus_tag="TDEL_0G03800"
                     /db_xref="GeneID:11505042"
     mRNA            <698567..>699304
                     /gene="TDEL0G03800"
                     /locus_tag="TDEL_0G03800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682910.1"
                     /db_xref="GeneID:11505042"
     CDS             698567..699304
                     /gene="TDEL0G03800"
                     /locus_tag="TDEL_0G03800"
                     /note="ancestral locus Anc_6.91"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682958.1"
                     /db_xref="GeneID:11505042"
                     /db_xref="InterPro:IPR021622"
                     /db_xref="UniProtKB/TrEMBL:G8ZXY0"
                     /translation="MFETVEDATQFINGQLLARGYLKTGNSLKIDGAPDDARLVINTI
                     HKLLKAVQSKDQQLTEAQTKLQRLQKAVPEPQPRPTTPREPPREPPKRPTPNKIVKNK
                     DELLRKLYKVRLNGLQSTIDELKDRFHRERRSTNITWQAHQEITTQTNPQIQEDFSDQ
                     LTQLLARESQQYEFDKELQKFLANVNRFTYSCAVLGIPDIDLQPQPPHTFDYFKSHEK
                     AELVECITDWYEIVDISRRPVRIDHEP"
     gene            <699414..>700082
                     /gene="TDEL0G03810"
                     /locus_tag="TDEL_0G03810"
                     /db_xref="GeneID:11505043"
     mRNA            <699414..>700082
                     /gene="TDEL0G03810"
                     /locus_tag="TDEL_0G03810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682911.1"
                     /db_xref="GeneID:11505043"
     CDS             699414..700082
                     /gene="TDEL0G03810"
                     /locus_tag="TDEL_0G03810"
                     /inference="similar to DNA sequence:INSDC:YLR293C,YOR185C"
                     /note="similar to Saccharomyces cerevisiae GSP1 (YLR293C)
                     and GSP2 (YOR185C); ancestral locus Anc_6.90"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682959.1"
                     /db_xref="GeneID:11505043"
                     /db_xref="GOA:G8ZXY1"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR002041"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZXY1"
                     /translation="MSAPAAGNAQGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKY
                     IATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRIT
                     YKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNY
                     NFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDED
                     DADL"
     gene            <700212..>700793
                     /gene="TDEL0G03820"
                     /locus_tag="TDEL_0G03820"
                     /db_xref="GeneID:11505044"
     mRNA            <700212..>700793
                     /gene="TDEL0G03820"
                     /locus_tag="TDEL_0G03820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682912.1"
                     /db_xref="GeneID:11505044"
     CDS             700212..700793
                     /gene="TDEL0G03820"
                     /locus_tag="TDEL_0G03820"
                     /inference="similar to DNA sequence:INSDC:YLR292C"
                     /note="similar to Saccharomyces cerevisiae SEC72
                     (YLR292C); ancestral locus Anc_6.89"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682960.1"
                     /db_xref="GeneID:11505044"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G8ZXY2"
                     /translation="MTEISYDTNSKKLSSVGEPTEGLEIALGQVNTLTTALISETNPN
                     FTPQPHEDVSKLIKNLFDSGLKNAQQNKFPEALKNVSLAIEMAQRKRAPWEAFAIQLK
                     ELQFMLRHKIDILLVLGRYLEALQDLDMLMNTGLIQPEVLIRKTDALLKLGQLDQARI
                     ECERGLTLQPQNAKLKALLMECTRKLADFNGEI"
     gene            <700903..>702084
                     /gene="TDEL0G03830"
                     /locus_tag="TDEL_0G03830"
                     /db_xref="GeneID:11505045"
     mRNA            <700903..>702084
                     /gene="TDEL0G03830"
                     /locus_tag="TDEL_0G03830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682913.1"
                     /db_xref="GeneID:11505045"
     CDS             700903..702084
                     /gene="TDEL0G03830"
                     /locus_tag="TDEL_0G03830"
                     /inference="similar to DNA sequence:INSDC:YLR291C"
                     /note="similar to Saccharomyces cerevisiae GCD7 (YLR291C);
                     ancestral locus Anc_6.88"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682961.1"
                     /db_xref="GeneID:11505045"
                     /db_xref="GOA:G8ZXY3"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:G8ZXY3"
                     /translation="MPSSATSSAATSTNNDINVSIEYFIARLKRRQIDDTYAMALETL
                     QLLKRFISAARWNHVTELIEQIRQLADRLEKAQPAAFCCGNVIRRVLAVIRDELEEDL
                     RDTMVTTAATTNTVAEPMISSMFNLLQKPEHQQQQQQQTQEQQQQQQQHKLQRNHKSK
                     TDFRQVAIQGIKDLIDEITNIDDGIQQIAIDLIHDHEILLTPTPESKTVLKFLIKTRE
                     RSNRTFTVLVTEGFPNNTSKAHEFAKKLAQHNIETIIIPDSAVFALMSRVGKVIIGTK
                     AVFINGGTIASASGVSLVCECAREFKTPVFAVAGLYKLSPLYPFDVEKLVEFGGSKKV
                     LPHMDPHKRLDIINPITAYVPPENIDIYITNIGGFAPSFIYRIAWDNYKQVDVNVGQA
                     P"
     gene            <702457..>703284
                     /gene="TDEL0G03840"
                     /locus_tag="TDEL_0G03840"
                     /db_xref="GeneID:11505125"
     mRNA            <702457..>703284
                     /gene="TDEL0G03840"
                     /locus_tag="TDEL_0G03840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682914.1"
                     /db_xref="GeneID:11505125"
     CDS             702457..703284
                     /gene="TDEL0G03840"
                     /locus_tag="TDEL_0G03840"
                     /inference="similar to DNA sequence:INSDC:YLR290C"
                     /note="similar to Saccharomyces cerevisiae YLR290C;
                     ancestral locus Anc_6.87"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682962.1"
                     /db_xref="GeneID:11505125"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZXY4"
                     /translation="MIPKIVVFGGNGFLGKRICQEAINNGFKVLSVSRSGKAPPLQSP
                     NDRQWIAEVEWKSGDVFNPDSYKKYLHGASNVVHSMGILLEDESYKMRIKSPLSGSFD
                     LKSLIPSFGSNPLDKKNPNFTYQRMNKESALLLAQTFSQIIDPSETKVRDMPTFTYIS
                     ADKGFPIIPKGYIHSKREAEAGLMRYEDVFRPILVRPGFMFDEYKTTRDARSYVHHAL
                     EFLNCSNRLLLGNKLRFVNEMVRPTVSTQQVSRSIIKKIKDPSFKGVLPLESIIDMT"
     gene            complement(<703343..>705274)
                     /gene="TDEL0G03850"
                     /locus_tag="TDEL_0G03850"
                     /db_xref="GeneID:11505126"
     mRNA            complement(<703343..>705274)
                     /gene="TDEL0G03850"
                     /locus_tag="TDEL_0G03850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682915.1"
                     /db_xref="GeneID:11505126"
     CDS             complement(703343..705274)
                     /gene="TDEL0G03850"
                     /locus_tag="TDEL_0G03850"
                     /inference="similar to DNA sequence:INSDC:YLR289W"
                     /note="similar to Saccharomyces cerevisiae GUF1 (YLR289W);
                     ancestral locus Anc_6.86"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682963.1"
                     /db_xref="GeneID:11505126"
                     /db_xref="GOA:G8ZXY5"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006297"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR013842"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZXY5"
                     /translation="MIPLRGLQRVLHRSWRPLIRRSHQQAPSKLELLQKRIDEIPIEN
                     YRNFSIVAHVDHGKSTLSDRMLEITGVIKPGENKQVLDKLEVERERGITIKAQTCSMF
                     YHDKRDNKDYLLHLVDTPGHVDFRGEVSRSYASCGGALLLVDASQGVQAQTVANFYLA
                     YSMNLKLIPVINKIDLDIADIPQAEDQIVNTFELPQEDIIKVSAKTGINIAENLLPAI
                     IDRIPPPTGLLRKPFRALLVDSWYDSYMGVVLLVHIVDGSIKKGDKILSAQTDKKYEV
                     KEIGIMYPDRTPTGTLSRGQVGYIVPGMKASKDAKIGDTLMHVGRESETEVLPGFEET
                     KPMVFVGAFPADGTEFKALDDDISRLVLNDRSVSLQRETSNALGQGWRLGFLGSLHAS
                     VFRERLEKEYGSKLIITQPTVPYQVKFIDGTQKIVTNPDDFPDLSLRKSKIEAFEEPY
                     VEAIMTLPQEHLGNVIKLCDNNRGQQIEITYLNMTGQVMLKYHLPLAHLVDDFFGRLK
                     SVSRGYASLDYEDIGYKPSDVIKLELLVNGKSVDALAQVLHRSQVDRVGREWVKKFKE
                     FIKAQLYEVVIQARANNKIIARETIKARRKDVLAKLHASDVSRRKKLLVRQKEGKKQM
                     RSIGNVQVSQEAYQAFLRR"
     gene            <705400..>706629
                     /gene="TDEL0G03860"
                     /locus_tag="TDEL_0G03860"
                     /db_xref="GeneID:11505127"
     mRNA            <705400..>706629
                     /gene="TDEL0G03860"
                     /locus_tag="TDEL_0G03860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682916.1"
                     /db_xref="GeneID:11505127"
     CDS             705400..706629
                     /gene="TDEL0G03860"
                     /locus_tag="TDEL_0G03860"
                     /inference="similar to DNA sequence:INSDC:YLR288C"
                     /note="similar to Saccharomyces cerevisiae MEC3 (YLR288C);
                     ancestral locus Anc_6.85"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682964.1"
                     /db_xref="GeneID:11505127"
                     /db_xref="GOA:G8ZXY6"
                     /db_xref="InterPro:IPR007150"
                     /db_xref="UniProtKB/TrEMBL:G8ZXY6"
                     /translation="MKLKLIVNGGEAPDDYKLLRTTVSTVASLRKTAVLRFTSERLLI
                     ISTPRSSSSGSTLLHGDTGQLWCTIPRDLFKLYTVASARELNTITMEYKCDSLISVFK
                     RYDRIMSQGCSSDMTIKLQSMPEWNVGPAIANPGGIKANPVCALGITFEELLHTSNGG
                     NDNEYEDGSTNYGTKFTNNKTVFHSFKIPVKLLFKAQDARIQEPMINYAQLMMYKLPP
                     YSGEFGAGFSNFIKRVDRFTNVRHIRLSGLKRENEVGNEDAQLKIIVNELDWNLEICW
                     NGPLDSVMQQTTPSQTENEQVQAADDDLRIEDSTMSGANPQDIDVELVDVSAMVQRAE
                     QENLSVNEVYMRCRDWKVCHKLYGAFEEVVLAISHDESCVLHCSLDRGGSDEGEEVGE
                     AKERGQIIYYIARSKPL"
     gene            complement(<706646..>707833)
                     /gene="TDEL0G03870"
                     /locus_tag="TDEL_0G03870"
                     /db_xref="GeneID:11505128"
     mRNA            complement(<706646..>707833)
                     /gene="TDEL0G03870"
                     /locus_tag="TDEL_0G03870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682917.1"
                     /db_xref="GeneID:11505128"
     CDS             complement(706646..707833)
                     /gene="TDEL0G03870"
                     /locus_tag="TDEL_0G03870"
                     /inference="similar to DNA sequence:INSDC:YOR184W"
                     /note="similar to Saccharomyces cerevisiae SER1 (YOR184W);
                     ancestral locus Anc_6.84"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682965.1"
                     /db_xref="GeneID:11505128"
                     /db_xref="GOA:G8ZXY7"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR003248"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020578"
                     /db_xref="InterPro:IPR022278"
                     /db_xref="UniProtKB/TrEMBL:G8ZXY7"
                     /translation="MPLEREEPHHFGAGPAQLPTSVLQQAAKDLLNFNNIGLGIGEIS
                     HRSKDAKKVIEDAKKHLTELMEIPDTHEVFFLQGGGTTGFSSTASNLAAAYVGKTGEI
                     APAGYLVTGSWSQKSFEEAKRLHVPAEVIFNSKDYYNGKYGSIPDESQWADKVKGKKF
                     SYVYLCENETVHGVEWPKLPECLTSDPSIEVVADLSSDILSRKIDVSQYGMILAGAQK
                     NIGLAGLTLYIIKKTILEEISKASEDELHKLGLPITPIAFHYPTVVKNDSAYNTIPIF
                     TLHVMDLVFQHLLKKGGVPAQQAENEEKARLLYGALDQYSDFYNIPVEKSCRSKMNVV
                     FTLKKEGLDDKFLKEAGEHKLTGLKGHRSVGGFRASIYNALSLESVQKLVEFVKEFAE
                     NNA"
     gene            <708405..>708713
                     /gene="TDEL0G03880"
                     /locus_tag="TDEL_0G03880"
                     /db_xref="GeneID:11505129"
     mRNA            join(<708405..708407,708525..>708713)
                     /gene="TDEL0G03880"
                     /locus_tag="TDEL_0G03880"
                     /product="40S ribosomal protein S30"
                     /transcript_id="XM_003682918.1"
                     /db_xref="GeneID:11505129"
     CDS             join(708405..708407,708525..708713)
                     /gene="TDEL0G03880"
                     /locus_tag="TDEL_0G03880"
                     /inference="similar to DNA
                     sequence:INSDC:YLR287C-A,YOR182C"
                     /note="similar to Saccharomyces cerevisiae RPS30A
                     (YLR287C-A) and RPS30B (YOR182C); ancestral locus
                     Anc_6.83"
                     /codon_start=1
                     /product="40S ribosomal protein S30"
                     /protein_id="XP_003682966.1"
                     /db_xref="GeneID:11505129"
                     /db_xref="GOA:G8ZXY8"
                     /db_xref="InterPro:IPR006846"
                     /db_xref="UniProtKB/TrEMBL:G8ZXY8"
                     /translation="MGKVHGSLARAGKVKSQTPKVEKQEKPKKPKGRAYKRMLYTRRF
                     VNVTLYNGKRRMNPGPSSQ"
     gene            <708841..>709884
                     /gene="TDEL0G03890"
                     /locus_tag="TDEL_0G03890"
                     /db_xref="GeneID:11505130"
     mRNA            <708841..>709884
                     /gene="TDEL0G03890"
                     /locus_tag="TDEL_0G03890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682919.1"
                     /db_xref="GeneID:11505130"
     CDS             708841..709884
                     /gene="TDEL0G03890"
                     /locus_tag="TDEL_0G03890"
                     /inference="similar to DNA sequence:INSDC:YLR287C"
                     /note="similar to Saccharomyces cerevisiae YLR287C;
                     ancestral locus Anc_6.82"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682967.1"
                     /db_xref="GeneID:11505130"
                     /db_xref="GOA:G8ZXY9"
                     /db_xref="InterPro:IPR026907"
                     /db_xref="UniProtKB/TrEMBL:G8ZXY9"
                     /translation="MSEIDQDKLKELVESIKSQFIEPYKDVQSLREIKSTTSFKDSDP
                     LTEIQKLSQIIKAHSTKIGIVCQPAKFFENYPVVFKELQNFTNSLFYLLSILPLIHND
                     KSDTWTSYLAKKLDSLVLNLLNGVSSLCQDIERMIEEGKGDDNDRLITIGSIWAACDS
                     LDELAKKGNFQLLADSIRSSCDLVDDMVQDVDSWLEDPQFGDELLIDDDLSDEDDEEK
                     EDDDAQALKAMEKFLIQWKTNLKMVKLLLSSFAKSLATNVYNSKSTKASMLDKLHTLQ
                     LLIVEQLDEFLSDVFMSDASFEPADFKDNITALNDSLGQMVKIIKNLNTSDPKKLKWI
                     TVWENKYFQDGNN"
     gene            complement(<709906..>711855)
                     /gene="TDEL0G03900"
                     /locus_tag="TDEL_0G03900"
                     /db_xref="GeneID:11505131"
     mRNA            complement(<709906..>711855)
                     /gene="TDEL0G03900"
                     /locus_tag="TDEL_0G03900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682920.1"
                     /db_xref="GeneID:11505131"
     CDS             complement(709906..711855)
                     /gene="TDEL0G03900"
                     /locus_tag="TDEL_0G03900"
                     /inference="similar to DNA sequence:INSDC:YOR181W"
                     /note="similar to Saccharomyces cerevisiae LAS17
                     (YOR181W); ancestral locus Anc_6.81"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682968.1"
                     /db_xref="GeneID:11505131"
                     /db_xref="GOA:G8ZXZ0"
                     /db_xref="InterPro:IPR000697"
                     /db_xref="InterPro:IPR003124"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR028297"
                     /db_xref="UniProtKB/TrEMBL:G8ZXZ0"
                     /translation="MGLLNSADKDQIKRALPKSSNKIIDVAIARLYIAYPNPNEWQYT
                     GLSGAVVLVDDLVGHTFFLKLVDIKGHRGVLWDHELYVNFEYYQDRTFFHAFEIEDCY
                     AGLLFEDLNEASHFLKRVHKREKYASKKTLSNKNAIALTKKVNEERANTVVKGPRGES
                     LYGNQRERYNYDNAESIPIVKHKAPPPPPPVAPAPESSDEESVEDTVSDWTSSAPATA
                     PATPAPHISAPETPVASSASSQPRAKHPIPPPPPASLVPPAPVQAAPAVPTSPAPPAP
                     PAPLAPPAQSAPAAAPPGAQTPQSPTLPRRNNNPFPFPVPQPTASQQTNPFPFPVPQQ
                     STPMSPPPQSTPFPVPAQTQPSLPAFNRPVPAPPNRNSRPVPAPPNRMGRNPPPVPPS
                     RHGQAPPPSPHRRITPQLTTPGGLQTQTTGRAPAPPPPRRGPAPPPPPRAARTQQFPQ
                     QSPRPAEVTFPLQGQYQSPPPPPTPPTTFNSLPAATNNVASPPPPPPMPVQNTAAVPP
                     PPPPMPVQNTAAAPPPPPPPMPAQNSAAPPPPPPFMAQPQATPAAPQSTFVEATGDSG
                     RDALLASIRGAGGIGALRKVDKSQLDRPSVLLQEAHGQPAQPTTNSSGPPPPGGGSLA
                     DALAAALSQRKAKVGSDDYDNGDDW"
     gene            <713022..>714731
                     /gene="TDEL0G03910"
                     /locus_tag="TDEL_0G03910"
                     /db_xref="GeneID:11505132"
     mRNA            <713022..>714731
                     /gene="TDEL0G03910"
                     /locus_tag="TDEL_0G03910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682921.1"
                     /db_xref="GeneID:11505132"
     CDS             713022..714731
                     /gene="TDEL0G03910"
                     /locus_tag="TDEL_0G03910"
                     /inference="similar to DNA sequence:INSDC:YLR286C"
                     /note="similar to Saccharomyces cerevisiae CTS1 (YLR286C);
                     ancestral locus Anc_6.80"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682969.1"
                     /db_xref="GeneID:11505132"
                     /db_xref="GOA:G8ZXZ1"
                     /db_xref="InterPro:IPR001579"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G8ZXZ1"
                     /translation="MISSFLTWLCLLLLSPLTYAFDIQSKQNVALYWGQNSAGSQQSL
                     GEYCQSTDADIYLLSFLYQFPTIGLNFASACTTSFGDGTLHCSEIAQDIKTCQSLGKK
                     VFLSLGGASGAYGFSDDNSAKQFAQTLWDTFGEGSGTAERPFDSAIIDGFDLDIENNQ
                     PTGYAALVTELRTLFAKGTKKYYISAAPQCVYPDASVGDVLANADVDFAFIQFYNNYC
                     NVDKSFNWDTWLNFAQSVSPNKDIKLYLGLPGSATAASSGYISDLSLLKETIAKISTT
                     ANFGGVAMWDASQAFANKIDGQSYVSHIKNILSSGSSDLTGTSASSSSSTFTSSASSS
                     TSSIAVPATTSSSEAKTSTLEPSFPTTTVATNTEAKTTTLAPQDTLQTSVTTSASDSS
                     TTSTTSTVKITQTLTSANIKQVSTSSNETPVVTTETSSSATRTTLAPTTTPVTTTTPV
                     ITTTPASTTTPATTATTATTATPAVTTSATTTQATTSASTAHEQAVSLNALYSSGKYN
                     GKETCSNGDIACSSTGEFAICNYGTWVTMACAQGTTCFAYDSGESVSSGCNFSNLKDN
                     FTK"
     gene            complement(<714844..>715632)
                     /gene="TDEL0G03920"
                     /locus_tag="TDEL_0G03920"
                     /db_xref="GeneID:11505133"
     mRNA            complement(<714844..>715632)
                     /gene="TDEL0G03920"
                     /locus_tag="TDEL_0G03920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682922.1"
                     /db_xref="GeneID:11505133"
     CDS             complement(714844..715632)
                     /gene="TDEL0G03920"
                     /locus_tag="TDEL_0G03920"
                     /inference="similar to DNA sequence:INSDC:YLR285W"
                     /note="similar to Saccharomyces cerevisiae NNT1 (YLR285W);
                     ancestral locus Anc_6.79"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682970.1"
                     /db_xref="GeneID:11505133"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR025784"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZXZ2"
                     /translation="MSDTESIDEGFGLFEEPEDFRPPPPAAHFAEYERSSVSPESKSQ
                     IGKIQLRLVGSSPLWGHLLWNAGIYTAKHLDRNTQLVKGKKVLELGAAAGLPSLVSSM
                     IGAEKVVSTDYPDADLLQNIQHNVDHVLFEGKSVSEISQRDIVVEGYIWGNDYSPLQK
                     HIGGPGAKFDLIILSDLVFNHTEHTKLLQTTKDLLADDGKALVVFSPHRPWLLNDDLQ
                     FFETAKEFGLKPEVIEMVNWKPMFEEDEETSEVRSRVYAHYLTH"
     gene            <715860..>716684
                     /gene="TDEL0G03930"
                     /locus_tag="TDEL_0G03930"
                     /db_xref="GeneID:11505134"
     mRNA            <715860..>716684
                     /gene="TDEL0G03930"
                     /locus_tag="TDEL_0G03930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682923.1"
                     /db_xref="GeneID:11505134"
     CDS             715860..716684
                     /gene="TDEL0G03930"
                     /locus_tag="TDEL_0G03930"
                     /inference="similar to DNA sequence:INSDC:YLR284C,YOR180C"
                     /note="similar to Saccharomyces cerevisiae ECI1 (YLR284C)
                     and DCI1 (YOR180C); ancestral locus Anc_6.78"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682971.1"
                     /db_xref="GeneID:11505134"
                     /db_xref="GOA:G8ZXZ3"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:G8ZXZ3"
                     /translation="MAADNSTDRIKFHKDGPFFVIKLDDPGSLNALGGPEYLYLAELL
                     EKADQDPEIYFTVLQSSGRFFSSGADFQSILKAQKKDSSEPELNKWLSYFVSRNVYVT
                     DMFSRHSKALICCMNGPAIGMSAALCALCDIVYAMNDKVYLLYPFSSIGLVTEGGTSV
                     TLPMKLGSSVSFESLMFSKPIKYDKLEGTIITKNYEMSNTEEFNEAVMKDLKLKVKDL
                     HWPSVLGIKKLVKENYVRDLERANSVEVNDAIKYWVKGIPQRSFKQLSQKQRRHKL"
     gene            complement(<716704..>717531)
                     /gene="TDEL0G03940"
                     /locus_tag="TDEL_0G03940"
                     /db_xref="GeneID:11505135"
     mRNA            complement(<716704..>717531)
                     /gene="TDEL0G03940"
                     /locus_tag="TDEL_0G03940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682924.1"
                     /db_xref="GeneID:11505135"
     CDS             complement(716704..717531)
                     /gene="TDEL0G03940"
                     /locus_tag="TDEL_0G03940"
                     /inference="similar to DNA sequence:INSDC:YLR283W"
                     /note="similar to Saccharomyces cerevisiae YLR283W;
                     ancestral locus Anc_6.77"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682972.1"
                     /db_xref="GeneID:11505135"
                     /db_xref="InterPro:IPR024461"
                     /db_xref="UniProtKB/TrEMBL:G8ZXZ4"
                     /translation="MLRCIFRRSWPLRGPLRVRYSTVSPKSRLLSNEPAKMTSGSGST
                     APRGGFMGKLPEQLISEGNGMKPTRAENQIDTLKCYNMLVDRGFTPAQTELVIDLLLE
                     TLNKNFFSSYNNVFLQNMELENQSHLFHAAETELKYAIQTSRDSQLNDQHLQLMKLIR
                     DLDSLQDEINELIINLLQKDSKVDFNNQKTENTLLQRKIKLELSDCTNKIATKMLGNA
                     RSEIESLRWQTTRSGLLAILILVFFIMGGASFARKLTAQHDEAELKESEAKEPEITQ"
     gene            <717640..>718095
                     /gene="TDEL0G03950"
                     /locus_tag="TDEL_0G03950"
                     /db_xref="GeneID:11505136"
     mRNA            <717640..>718095
                     /gene="TDEL0G03950"
                     /locus_tag="TDEL_0G03950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682925.1"
                     /db_xref="GeneID:11505136"
     CDS             717640..718095
                     /gene="TDEL0G03950"
                     /locus_tag="TDEL_0G03950"
                     /inference="similar to DNA sequence:INSDC:YLR281C"
                     /note="similar to Saccharomyces cerevisiae YLR281C;
                     ancestral locus Anc_6.76"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682973.1"
                     /db_xref="GeneID:11505136"
                     /db_xref="GOA:G8ZXZ5"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:G8ZXZ5"
                     /translation="MNVRWFCSTTLNLIKKNKLPPRPKFTNEMEIQCEEKFLHGGRGP
                     GGQKINKCNSKVQLKHLETGIVVTCQETRSRENNRKIAREKMALEIARFHNGDARLDS
                     RTEALQKWVVQGKKAKSKKSRLKHDKHDAERQERQEEALKRDAEILNSI"
     gene            <718226..>719008
                     /gene="TDEL0G03960"
                     /locus_tag="TDEL_0G03960"
                     /db_xref="GeneID:11505137"
     mRNA            <718226..>719008
                     /gene="TDEL0G03960"
                     /locus_tag="TDEL_0G03960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682926.1"
                     /db_xref="GeneID:11505137"
     CDS             718226..719008
                     /gene="TDEL0G03960"
                     /locus_tag="TDEL_0G03960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682974.1"
                     /db_xref="GeneID:11505137"
                     /db_xref="GOA:G8ZXZ6"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:G8ZXZ6"
                     /translation="MRLFVTITIDDPLKLNSLSFDSFTEIARLLQMAEEDNEVVATVL
                     QSTGEFFSAGGKFESIKDIDKTGVREREDRLRAEIAAMNVYVADVFAHHTKLLVCCLN
                     GPAIGLAASLVLLCDMVYAMNESVYVLLPFTSLGFVAELGCSVTVPSKLGVNRANEHF
                     FFSTRIGYDEMIQSRMISQNFNLPKGSTKEFNHRVHELLDQSLKGNNRQAMLNIKRLL
                     NSGDALIKAQSRETNTTLPFWLKGEPFKRFEQLQSKQRKHRL"
     gene            <720080..>723187
                     /gene="TDEL0G03970"
                     /locus_tag="TDEL_0G03970"
                     /db_xref="GeneID:11505138"
     mRNA            <720080..>723187
                     /gene="TDEL0G03970"
                     /locus_tag="TDEL_0G03970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682927.1"
                     /db_xref="GeneID:11505138"
     CDS             720080..723187
                     /gene="TDEL0G03970"
                     /locus_tag="TDEL_0G03970"
                     /inference="similar to DNA sequence:INSDC:YLR278C"
                     /note="similar to Saccharomyces cerevisiae YLR278C;
                     ancestral locus Anc_6.75"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682975.1"
                     /db_xref="GeneID:11505138"
                     /db_xref="GOA:G8ZXZ7"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G8ZXZ7"
                     /translation="MGRPKKLVSLENIQNFQRELDLAGNNAEILLSDKKGRSRSCLLC
                     RRRKQRCDRKQPSCTNCLKANVKCIQPARYNSTTPTETATASPMSLSSIDETTQKHFR
                     PNGAPARNPNDRYTLYLENKIQSLENMLKKNESQMSMATHSNDGCESSASPPTGNVNG
                     GDVMKTNNSSGSGSQLFNGNIGLNPNGRARLFGAVSTFKNSSPNSKDGKKNGTMLPAL
                     SSDSLESIDFSKCIFAKYNLKEFFQYDPAFEFDGLLSRSFLDTFFTRLQFKYPLLDEQ
                     EIYTFHEIYISNNVHAFSELNFHFACGRMWLVFAISACLFMTTGKYKGLPPVRYFSTA
                     IRHITRCGQNLDNVQRVELLTLLVLYVLRTDRESSVLYEIMKDVMGICKDNLHLNVWQ
                     PNDPNANKKLRIFWCVYLLERMICVAVGRPFTISESEINLPFFSEDSFNSGQGYISEQ
                     CHKRRGVHFINQSLKLRRIESQFVEHLQILPLRHNRKETLREQLPTVRKFFHDLEVWR
                     SSCSRDDVRNFENETLKLYYYRSVRLLIQPYLEFITPDDRLFRECQAAAGQICQLYKI
                     FHQKTLRGHSTPAIHTVFIAGVTLIYCMWLARNFDDEKRKRLGDDSKHTRPSISASLF
                     STMDDLRACSVCLYVMTERSNFARTFRDTFDELMNATVGNLIERCGPNSSELIHLSTQ
                     EKFVNTFDHQAPISYEDERERGMPPATNRTFGKRQAEEHVGFVEISQVDPEEQKEFKR
                     KQDVLEETSVPKSLAHLLIKVGDKGKTGDAHHDQRGKIERNKYIVQKPANSAEFDWES
                     FQQQAFVQQHMAKENLKAYLSALKYNGSGKSPTDHAASSIFASALPEQSISASKNVQA
                     PVKTEQAEDRGGIGRAMPSMSQMMPQIVSNTTTNSNSPNSLLNEGILFNNGTHDMIND
                     ISTWTNDSVVNKNHQYAPIDFNSQDTLSFLPDEDEFLPQIRATDNQSQANAINRSPNV
                     PGPPLLNTYVNSQDRFIGSSNIGHPSSETDQDRKRRHLVPSTTGRGGIAEKFWTVNDD
                     YGFLT"
     gene            <723679..>726006
                     /gene="TDEL0G03980"
                     /locus_tag="TDEL_0G03980"
                     /db_xref="GeneID:11505139"
     mRNA            <723679..>726006
                     /gene="TDEL0G03980"
                     /locus_tag="TDEL_0G03980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682928.1"
                     /db_xref="GeneID:11505139"
     CDS             723679..726006
                     /gene="TDEL0G03980"
                     /locus_tag="TDEL_0G03980"
                     /inference="similar to DNA sequence:INSDC:YLR277C,YOR179C"
                     /note="similar to Saccharomyces cerevisiae YSH1 (YLR277C)
                     and SYC1 (YOR179C); ancestral locus Anc_6.74"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682976.1"
                     /db_xref="GeneID:11505139"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR011108"
                     /db_xref="InterPro:IPR021718"
                     /db_xref="InterPro:IPR022712"
                     /db_xref="UniProtKB/TrEMBL:G8ZXZ8"
                     /translation="MDALGKNSLKFFALGGGNEVGRSCHILQFKGKTIMLDAGVHPAH
                     QGYSSLPFYDEFDLSKIDVLLISHFHVDHAASLPYVMQKTNFQGRVFMTHPTKAIYRW
                     LLRDFVRVTSIGVSSGGKDDNLYTDEDLAESFDRIETIDFHSTVDVNGIKFTAYHAGH
                     VLGAAMFQIEIAGVRILFTGDYSRELDRHLNSAEVPTLPSDVHIVESTFGTATHEPRV
                     NRERKLTQLIHSTVSRGGRVLLPVFALGRAQEIMLILDEYWTQHSDELGGGQVPIYYA
                     SNLAKKCMSVFQTYVNMMNDDIRKKFRDSQTNPFVFKNISYLRNIDDFQDFGPSVMLA
                     SPGMLQSGLSRDVLEKWCPEDKNLVLITGYSVEGTMAKFLMLEPDTIPSINNPEATIP
                     RRCQIEEISFAAHVDFRENLEFIEKISAPNIILVHGESNPMGRLKSALLSNFASLRGS
                     EQEVHVFNPRNCVDVTLEFNGIKIAKAVGNIVDDIRREEEEGTEVKEEDKDNAVEKTS
                     VKKEKPDEDVEELPNGDEQEIVVSGILVSDEKNFDLNLVSLTDLREHHTELSTTVLRE
                     RQTVHVDCKKELIYWHLCQMFGDIRVIIDEENVTNKLKREDADGRISDGKLNGKLVLK
                     VMNDIKLTVFDNVATLEWTQGLISDTVADSIVAILMSVDSSPASVRMSSRSCEHHHEE
                     FSDGVMPKDPVWKVKQIAKLFKEQFGETFTLMLAKGDDHKIEDGDIFGVITIGKNNAR
                     INFSKMQIEECNSNPLKGRVERILDMGADLAASLC"
     gene            <726319..>728085
                     /gene="TDEL0G03990"
                     /locus_tag="TDEL_0G03990"
                     /db_xref="GeneID:11505140"
     mRNA            <726319..>728085
                     /gene="TDEL0G03990"
                     /locus_tag="TDEL_0G03990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682929.1"
                     /db_xref="GeneID:11505140"
     CDS             726319..728085
                     /gene="TDEL0G03990"
                     /locus_tag="TDEL_0G03990"
                     /inference="similar to DNA sequence:INSDC:YLR276C"
                     /note="similar to Saccharomyces cerevisiae DBP9 (YLR276C);
                     ancestral locus Anc_6.73"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682977.1"
                     /db_xref="GeneID:11505140"
                     /db_xref="GOA:G8ZXZ9"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZXZ9"
                     /translation="MTTKGSDLASDAYLDDSTSFEALQLDPRLLQAIHRNGYHHPTLI
                     QSHAIPLALQQKRDIIAKAATGSGKTLAYLIPVIQTILDCKKDESSELGSNKTLGIVL
                     VPTKELASQVSTVLEQLTLYCSKDVKNLNASSDMSHAVLSSLLLESPEIIIATPAKLL
                     SLLETNINAISLENLKFLVIDEVDLVLSFGYQDDLTKISEFLPLQKSLQTFLMSATLN
                     DDIQDLKKRFCRSPAILKFNDDQITKDDSKLLQYYVKTTEFDKFLLCYVIFKLGLIKG
                     KSLIFVNNIDRGYRLKLVLEQFGIKSCILNSELPANSRQHIVDQFNKNVYQLLIATDD
                     TEYIREEDEEEKESEVSEDSKEVDGKNNNKKIKRLQVKKDKEYGVSRGVDFKNVACVL
                     NFDLPTTAKSYVHRVGRTARAGKSGTAISFVVPLKEFGKHKPSMCPTAKRDEKILTRI
                     IKQQSKLGLELQPYSFDNKQVEGFRYRLEDGFRAVTQVAVREARIKELKQELLASDKL
                     KRHFEENPQELQSLRHDKELHPARVQQHLKRVPEYLLPDSVKQGKSKKIGFVPFHKPK
                     KAHKKGKVQKRNGKSDPLKNFK"
     gene            complement(<728142..>728537)
                     /gene="TDEL0G04000"
                     /locus_tag="TDEL_0G04000"
                     /db_xref="GeneID:11505141"
     mRNA            complement(join(<728142..728466,728533..>728537))
                     /gene="TDEL0G04000"
                     /locus_tag="TDEL_0G04000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682930.1"
                     /db_xref="GeneID:11505141"
     CDS             complement(join(728142..728466,728533..728537))
                     /gene="TDEL0G04000"
                     /locus_tag="TDEL_0G04000"
                     /inference="similar to DNA sequence:INSDC:YLR275W"
                     /note="similar to Saccharomyces cerevisiae SMD2 (YLR275W);
                     ancestral locus Anc_6.72"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682978.1"
                     /db_xref="GeneID:11505141"
                     /db_xref="GOA:G8ZY00"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027248"
                     /db_xref="UniProtKB/TrEMBL:G8ZY00"
                     /translation="MLELADRPKAELTNDELEQLEEFEFKHGPLSLINDSVVSKTPVI
                     ISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKRGNKAENKERFISKLFLRGDSVIV
                     VLKAPVQ"
     gene            complement(<728724..>730991)
                     /gene="TDEL0G04010"
                     /locus_tag="TDEL_0G04010"
                     /db_xref="GeneID:11505142"
     mRNA            complement(<728724..>730991)
                     /gene="TDEL0G04010"
                     /locus_tag="TDEL_0G04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682931.1"
                     /db_xref="GeneID:11505142"
     CDS             complement(728724..730991)
                     /gene="TDEL0G04010"
                     /locus_tag="TDEL_0G04010"
                     /inference="similar to DNA sequence:INSDC:YLR274W"
                     /note="similar to Saccharomyces cerevisiae CDC46
                     (YLR274W); ancestral locus Anc_6.71"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682979.1"
                     /db_xref="GeneID:11505142"
                     /db_xref="GOA:G8ZY01"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR008048"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:G8ZY01"
                     /translation="MSFDRPEVYSAPVLQGESTNDDDNTEIIKSFKNFILEFRLDSHF
                     LYRDQLRNNLLVKNYSLTVDMEHLIGYNEDVYKRLSDEPSDVVPLFESAITQVAKRIA
                     VLTKTSRDAGVDEELTVFPTFQLVLNSRANETLLRQLDSDHVSKMVRISGIIISASVL
                     SSRATFLSLMCRNCRHTTTLRINSFNSISGNSVSLPHSCLSNLSSGTNENGLMGSTDD
                     EGRKNCGPDPYIVVHESSQFIDQQFLKLQEIPEMVPVGEMPRNILMTCDRYLTNRVVP
                     GTRVTIVGIYSIYQSKRKNAQGSGGIAIRNPYIKILGIQTNLETSGVWNSMTRFSEEE
                     EEEFLQMSRRPDLYELFANSIAPSIFGSKDIKKAIVCLLMGGSKKLLPDGMRLRGDIN
                     VLLLGDPGTAKSQLLKFVEKVSPISVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAM
                     VLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIY
                     GRYDDLKSPGENIDFQTTILSRFDMIFIVKDDHNEERDISIANHVMNIHTGRTTQTEG
                     ELENAGMEISMEKMRRYITYCRLKCAPRLSAQAAEKLSSQFVSIRKQLLINELESTER
                     SSIPITIRQLEAIIRITESLAKLELSPVAHERHVDEAIRLFQASTMDAASQDPIGGMN
                     GNTNIMAEIRRIEQDLKRRLPIGWSTSYQTLRREFVDTNRFSQNALDKAIYALEKHET
                     IQLRYQGQNIYRCGV"
     gene            <731887..>733896
                     /gene="TDEL0G04020"
                     /locus_tag="TDEL_0G04020"
                     /db_xref="GeneID:11505143"
     mRNA            <731887..>733896
                     /gene="TDEL0G04020"
                     /locus_tag="TDEL_0G04020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682932.1"
                     /db_xref="GeneID:11505143"
     CDS             731887..733896
                     /gene="TDEL0G04020"
                     /locus_tag="TDEL_0G04020"
                     /inference="similar to DNA sequence:INSDC:YLR273C,YOR178C"
                     /note="similar to Saccharomyces cerevisiae PIG1 (YLR273C)
                     and GAC1 (YOR178C); ancestral locus Anc_6.70"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682980.1"
                     /db_xref="GeneID:11505143"
                     /db_xref="InterPro:IPR005036"
                     /db_xref="UniProtKB/TrEMBL:G8ZY02"
                     /translation="MVISPLRKLNLNSKAIIDSDNRSETSDMLKSPTPPVFRRLKSSL
                     KLSKSQSTPSVATTLSSSSSQKNVRFAAELTTVKKFDSSLEPISISNENSPRFYPLSD
                     TDLQYNIANPETLYDNEGDCCATEDGFWFNESSLLPSLQRLNDVKRLKKFNKKKNVAV
                     SKFQLDYDSDSGLDDDDDDDEMEEDDLDSAPRSAVMKRDESFDSKFLEVIDWRLIRTN
                     VCPFKHVLNPFVLIDQNDGYENQLFEYLQGSNIRLHTLKQSKSEFGKIVGLIYVNNLN
                     FEKFIEIKLTFNSWKDIHYITANYSRSVTKKIDEFKFVIDLNSLKYALQVKSLIYAKS
                     NAETTLCPLNIDLCCRYDVNNETFYDNNNYDNYQVKLIASTRNISEPIRPVVKMTPPT
                     PVVEKTSPKVTPFARDFLVSTTLSHNPILRGNDVGSRKFSDDTDYYNTSPLKHLYHND
                     TSLIRPVRLNQVLMNPSSTDEEDYTTPEPEEVPPMSAPILAKASIDSHNSSSSFSSSS
                     SGGYSPLEDFTSLGTREYCSIDSMSSMDMVNYNYHLPIFNTLNSYNENHEDGQSIVTD
                     VLGDHQNNRDNSTDTLINPNFIPRPLSSASTESASLQTSQRNERLSAATPLPINANKS
                     NPEIISGTKDQDYQAFLSSYCFYNSPSSKGFDNPFTLENKSALLD"
     gene            734442..734515
                     /gene="TDEL0Gtrna8V"
                     /locus_tag="TDEL_0Gtrna8V"
                     /db_xref="GeneID:11505144"
     tRNA            734442..734515
                     /gene="TDEL0Gtrna8V"
                     /locus_tag="TDEL_0Gtrna8V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:11505144"
     gene            <734750..>738232
                     /gene="TDEL0G04030"
                     /locus_tag="TDEL_0G04030"
                     /db_xref="GeneID:11505337"
     mRNA            <734750..>738232
                     /gene="TDEL0G04030"
                     /locus_tag="TDEL_0G04030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682933.1"
                     /db_xref="GeneID:11505337"
     CDS             734750..738232
                     /gene="TDEL0G04030"
                     /locus_tag="TDEL_0G04030"
                     /inference="similar to DNA sequence:INSDC:YLR272C"
                     /note="similar to Saccharomyces cerevisiae YCS4 (YLR272C);
                     ancestral locus Anc_6.68"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682981.1"
                     /db_xref="GeneID:11505337"
                     /db_xref="GOA:G8ZY03"
                     /db_xref="InterPro:IPR007673"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024324"
                     /db_xref="InterPro:IPR026971"
                     /db_xref="UniProtKB/TrEMBL:G8ZY03"
                     /translation="MTLFNLADQLAKLQNTDKRSFPPVERPSDELNTVIDRLAVSPEQ
                     VDADDETLESLIDLCHGFPHLPAKLQTQLCYLVASSMGNLAHDIVSNLSGNSNSNTDV
                     IEFLPQYRKHLEEYGYLSHVLLSFLQEDVHIAASQATTLGRGGSKKVKSTGPAAELFK
                     RSCNQIESTAEAVIKVLEINLSRIFQTTPEKDLFVGLFTKPLFSLIEVEAAVKVPSLK
                     LLVQRIIAMSVKYQNQSSSVQNAVMTTLTYFLHLSNFNAELLKSLNDDFDYPQLTEEI
                     LREISSRVFNAKDTTGPKAISSFLTKLSELSPQIMLRQMSLVVRFLNNSSITLRCSVV
                     ETFGNIVTRLAQNEQASDHYKQQIEVLLELLEERFQDSNPYVRTKAIQGCLKICELES
                     KFNKNKSNFTKLALRSLQDRSSLVRRNAVKLLSKLLLNHPFKAIHGSQLNLSDWEKHL
                     KTATNNLNKYLENNSLETPLETAIEMSQVQQTEESSQEHELSDDDELSRIEKETQSIN
                     TTDTEVVLRLKLMVVYYTDAVEFIKTIHKSLKLAATLLFSRNRNEVLETMDYLVLADA
                     YGLEPSKIGIKRMLHLVWMKGTNDEGKSISAHLIACYTQLFLTAPDGFNFRERAAFIA
                     KNLIHLTVGASLADLASLEQLLGMMYKDKLIEENVINVLWAIYNSASKEEGVTEHFDK
                     QQVHGSVIVLGMLAVANHEITLRGLDSLLNVGLGKPGDEDLILCRYSCLALERMVPRN
                     STKYVSMIGDVREDEVVKKLYSKIITYTEDPEWYPVCEQALNAFFVISSKADTVVTEL
                     IREKTMMTFGKSEEDDSTILQHTSRVTSLSQLLFIVGQTAVKALVYLEKCEAEFKRAK
                     IEAETRQGREKGQQDDEREEDPGNGKEKELEMIGGTNEDDFADAIAFIKENELLFGEN
                     SLLSKFCPIVEEICSNTSRFSDSLLQRVAALCLEKFMCVSSKYCERRLSLLITMMEKS
                     DDPIIRSNAVLGLGDMAVCFNNLVDENTDYLYRRLHDKNLTVQRTSLMTVTFLILAGQ
                     VKVKGQLGQMAKCLENPDQGISDMCRLFFTELATKDNAVYNGFIDIFSNLSSDKDLSK
                     DSFKKIIKFLLSFIEKEKHQKQLSEKLFGRLLKCESQKQWNDVAYVLNNIPYKDERLA
                     EVLEKGFKMVSARE"
     gene            complement(<738287..>739462)
                     /gene="TDEL0G04040"
                     /locus_tag="TDEL_0G04040"
                     /db_xref="GeneID:11505145"
     mRNA            complement(<738287..>739462)
                     /gene="TDEL0G04040"
                     /locus_tag="TDEL_0G04040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682934.1"
                     /db_xref="GeneID:11505145"
     CDS             complement(738287..739462)
                     /gene="TDEL0G04040"
                     /locus_tag="TDEL_0G04040"
                     /inference="similar to DNA sequence:INSDC:YOR176W"
                     /note="similar to Saccharomyces cerevisiae HEM15
                     (YOR176W); ancestral locus Anc_6.67"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682982.1"
                     /db_xref="GeneID:11505145"
                     /db_xref="GOA:G8ZY04"
                     /db_xref="InterPro:IPR001015"
                     /db_xref="InterPro:IPR019772"
                     /db_xref="UniProtKB/TrEMBL:G8ZY04"
                     /translation="MLTRTLAGRGLICKDLSSTITRRSFMSTAVNSSSSPTGIVFMNM
                     GGPSTVEETQDFLYQLFSDNDLIPISKNWQPTFAKYIAKFRTSKIEQQYKEIGGGSPI
                     RKWSEYQAAKVCEILDETCPETAPHKPYVAFRYAKPLTHEAYEQLLKDGVKRAVAFTQ
                     YPQFSYSTTGSSLNELWRKIKELDPDRTISWSTIDRWPTSDGLTSAFAENIKKKLQEF
                     PEDIRHKVVLLFSAHSLPMDVINTGDAYPAEVASTVNKVMEKLKFSNPYRLVWQSQVG
                     PKPWLGAQTAAIAEHLGPKTDGLLFIPIAFTSDHIETLFEIDLELIDESPYKSKFKRC
                     ESLNGNETFIKGMAELVKEHLKSGDLYSKQLPLDFELGKSNDPITDASEVFGEHAKK"
     gene            <739736..>741541
                     /gene="TDEL0G04050"
                     /locus_tag="TDEL_0G04050"
                     /db_xref="GeneID:11505146"
     mRNA            <739736..>741541
                     /gene="TDEL0G04050"
                     /locus_tag="TDEL_0G04050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682935.1"
                     /db_xref="GeneID:11505146"
     CDS             739736..741541
                     /gene="TDEL0G04050"
                     /locus_tag="TDEL_0G04050"
                     /inference="similar to DNA sequence:INSDC:YOR175C"
                     /note="similar to Saccharomyces cerevisiae ALE1 (YOR175C);
                     ancestral locus Anc_6.66"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682983.1"
                     /db_xref="GeneID:11505146"
                     /db_xref="GOA:G8ZY05"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="UniProtKB/TrEMBL:G8ZY05"
                     /translation="MYNPIDAALVSLSNRFGINDFMLRYAICLLGSFPFNAILKRLPD
                     KRINLKCIYIIGVSMLYLFGVLNLYEGFRTLFISTMFTYVISRFYKSSFMPHLNFIFL
                     MGHLAFNHLHAQFLNPSGETGVDITGSQMVLVMKLTAFAWSYHDGSYVKEKAELSDYQ
                     KSRAITKHPSVLKFLAYAYFYPTLLTGPSFDFADFDNWLNCEMFHDLPESKKPRRRLH
                     PDQRRQIPKNGKLAFWKMLQGLGWMFLSVKSPEYVNVDYMLNFEKFMQKSFFYRINYM
                     YFLGMSFRFKYYAAWTIAEASCILCGLGYNGFDKKTQTIKWNRVQNIDIWHVEMAQST
                     RELLEAWNMNTNKWLKNYVYLRVAKKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTFAT
                     GALYQTCGKIYRRNLRPIFMDRDGVTPLRYKWVYDAVCFYVIKLACGFMVQPFIILDW
                     KKSLQAWGSVFFYIHIGIIVTLVLFKGPYARQVVKFCKSKQPKEQAIMEQKKLEKQVS
                     TSSTSLGDIISDKHAYEEKNGSEAEMNLGIPAFDSYHMEEAKEAWEDFCKDYNEWREK
                     NGLEIEEEKLAVAFQRFRDELAANPGRRMSFSSYR"
     gene            complement(<741796..>742458)
                     /gene="TDEL0G04060"
                     /locus_tag="TDEL_0G04060"
                     /db_xref="GeneID:11505147"
     mRNA            complement(<741796..>742458)
                     /gene="TDEL0G04060"
                     /locus_tag="TDEL_0G04060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682936.1"
                     /db_xref="GeneID:11505147"
     CDS             complement(741796..742458)
                     /gene="TDEL0G04060"
                     /locus_tag="TDEL_0G04060"
                     /inference="similar to DNA sequence:INSDC:YOR174W"
                     /note="similar to Saccharomyces cerevisiae MED4 (YOR174W);
                     ancestral locus Anc_6.65"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682984.1"
                     /db_xref="GeneID:11505147"
                     /db_xref="GOA:G8ZY06"
                     /db_xref="InterPro:IPR019258"
                     /db_xref="UniProtKB/TrEMBL:G8ZY06"
                     /translation="MSQVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGK
                     SLDKFGLYDEVDKELQRLDRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRK
                     VLEQRGRVNSAVLLEYATKLSKFTKAPAGVAVGPNNFVWPAEDALRRGQLAVAALHSE
                     EITLGSTGERSGSVESSEPVQPSESAEPRKYEPRRVEPAKEEASESPVDLDLDLFDPD
                     EF"
     gene            complement(<742472..>743497)
                     /gene="TDEL0G04070"
                     /locus_tag="TDEL_0G04070"
                     /db_xref="GeneID:11505148"
     mRNA            complement(<742472..>743497)
                     /gene="TDEL0G04070"
                     /locus_tag="TDEL_0G04070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682937.1"
                     /db_xref="GeneID:11505148"
     CDS             complement(742472..743497)
                     /gene="TDEL0G04070"
                     /locus_tag="TDEL_0G04070"
                     /inference="similar to DNA sequence:INSDC:YLR270W,YOR173W"
                     /note="similar to Saccharomyces cerevisiae DCS1 (YLR270W)
                     and DCS2 (YOR173W); ancestral locus Anc_6.63"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682985.1"
                     /db_xref="GeneID:11505148"
                     /db_xref="GOA:G8ZY07"
                     /db_xref="InterPro:IPR008594"
                     /db_xref="InterPro:IPR011145"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019808"
                     /db_xref="UniProtKB/TrEMBL:G8ZY07"
                     /translation="MRKNKGRVLRMDSLLQRFEFVRVLDSNPQTKVVSLLGHIDSQHA
                     IVTLEKTHFNTDDARCSCADAVQETREIAANDIYHWAVALLKQDIQTNPAAKVNVIWP
                     ATPVHVRKYSQQALHLVRESPQLYERVVAPWVKEQATPERLRWVHDILYNGAEQERVV
                     YRDFTGAEHGNGNGKNDGFLVLPDMKWDGVSLDALYLVALVYRDDVRSLRDLRPQHRE
                     WLIALNNRIRAVVPACYNYALHADELRIFVHYPPSYYHFHIHVVNIRHPGLGDGIAAG
                     RAVLLEDVIESLGYLGELGFMNRTLTYVMGENHELWSRGLQDAVAQQLEKDGIPKRPP
                     VLNRESS"
     gene            complement(<743675..>744377)
                     /gene="TDEL0G04080"
                     /locus_tag="TDEL_0G04080"
                     /db_xref="GeneID:11505149"
     mRNA            complement(join(<743675..744285,744344..>744377))
                     /gene="TDEL0G04080"
                     /locus_tag="TDEL_0G04080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682938.1"
                     /db_xref="GeneID:11505149"
     CDS             complement(join(743675..744285,744344..744377))
                     /gene="TDEL0G04080"
                     /locus_tag="TDEL_0G04080"
                     /inference="similar to DNA sequence:INSDC:YLR268W"
                     /note="similar to Saccharomyces cerevisiae SEC22
                     (YLR268W); ancestral locus Anc_6.62"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682986.1"
                     /db_xref="GeneID:11505149"
                     /db_xref="GOA:G8ZY08"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR010908"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:G8ZY08"
                     /translation="MIKSTLIYRDDGLPLCASVDDDSDPTLTEQKKKIKMVVSRMTPQ
                     SAEEATLESGDYEIHYLKLAVVVYFVICEKGYPPNLAFSYLNDVAQEFEHSYGLESTR
                     PTVRPYAFVSFDNFLQKTKKTYSDKKVQDNLDQLNNELHGVKQIMSKNIEDLLYRGDS
                     LDKMSDMSASLKESSKRYRKSAQKINLDLLISQYAPIAIVALFFVFLIWWIFLR"
     gene            complement(<744499..>746730)
                     /gene="TDEL0G04090"
                     /locus_tag="TDEL_0G04090"
                     /db_xref="GeneID:11505150"
     mRNA            complement(<744499..>746730)
                     /gene="TDEL0G04090"
                     /locus_tag="TDEL_0G04090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682939.1"
                     /db_xref="GeneID:11505150"
     CDS             complement(744499..746730)
                     /gene="TDEL0G04090"
                     /locus_tag="TDEL_0G04090"
                     /inference="similar to DNA sequence:INSDC:YOR172W"
                     /note="similar to Saccharomyces cerevisiae YRM1 (YOR172W);
                     ancestral locus Anc_6.61"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682987.1"
                     /db_xref="GeneID:11505150"
                     /db_xref="GOA:G8ZY09"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8ZY09"
                     /translation="MELGDNKDAIDSYEDERDILDGSDGPKVKKTRRKLIKSCAFCRK
                     RKLRCDQKKPICSTCSQRRFSTCIYPSYDASEQIFGPEPVQIPSAEDDLRRRIAELET
                     KLREAQLSDNEVEKVPNPLRDLFWLQTKDNGRRIIFGPTAMRTFVMKSNKWGFLELWR
                     KVKIARDQLKRKTGHTMLKENCLVEVPFTERTTSHLPLNLVQETCAALPSYETILRLL
                     TVFFEEKNLFEINEMLDQKKVIDDFRAAFVAGPPLPLTSERPIVNILPFAKKNYYPVG
                     VIIGILSLVYYRVKIPTEIERFLVFLTGLSTAKVMYVERIQMLFLRYYYRASVSGCPD
                     SSHYMILVNSLVQEAVQMGLNRPIRTVFKDQETHVGRLDILENLWCWILIADFDVAFH
                     GGQSLQVTPELIHNDNFFNDDSRTSYGLLKRFLKMVRPMVHSVYGKYKPDLEAHEEKI
                     IDFIETELPPIWFLTEAKRVDAFSIVEERVLCHLLSMLLSFNGLRFLVYGEVSARLKN
                     GGLLTSMISFIVCINLLHYAHEQDMKSCPPLTQNDSKELGPHLTRAVTTTAKLLARAI
                     SMFYGIAYYKLTLFESGLMIANPHINEQICDFKTLRVQSDMHLSLMGSFELFRNMFDG
                     LLSDRLFRMNALRSYSLTIFFTMERVGRVIIDKVLEYRTSAENAWIAQFQKDLTPEDP
                     GFILSADEPMPPALPINEDEIKPDMAGLISEDFWASYNLGLEELMSKADTDKMFSDFM
                     LWD"
     gene            complement(<746975..>749074)
                     /gene="TDEL0G04100"
                     /locus_tag="TDEL_0G04100"
                     /db_xref="GeneID:11505151"
     mRNA            complement(<746975..>749074)
                     /gene="TDEL0G04100"
                     /locus_tag="TDEL_0G04100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682940.1"
                     /db_xref="GeneID:11505151"
     CDS             complement(746975..749074)
                     /gene="TDEL0G04100"
                     /locus_tag="TDEL_0G04100"
                     /inference="similar to DNA sequence:INSDC:YLR266C,YOR162C"
                     /note="similar to Saccharomyces cerevisiae PDR8 (YLR266C)
                     and YRR1 (YOR162C); ancestral locus Anc_6.60"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682988.1"
                     /db_xref="GeneID:11505151"
                     /db_xref="GOA:G8ZY10"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8ZY10"
                     /translation="MAEDAKLRKRRRKIVRSCTFCRRRKLKCDHAKPMCNQCLERKLP
                     NCLYTDDFNFQLTTDELFSDSPNVELIRRVKELESKLAIKFGCDKPRSCANNPLWGYR
                     TFIQDQSQKIIFGPTSWRTTVIAQGERFQSEYKKLWEVILPERDRWIREQCASPLETV
                     MRTKDNDSLVNEVCKQLPSFSEIKSFVVRFFSDDYHDMFRVLDREKTLQDLEVGFVRS
                     VDDPNRVVKLIDPEGDGNFFKVALILWILNLLKYDDNTPPIFLKFFLSLNGLGTASRF
                     NFFERAQLLVLRFLSKIYSSYVCIGTSQLSSLVAELVECSLSLGLATVDWCYKDQEHL
                     VGPLWTLKNVWFWTLYADVMVSFEIGKPLLISDDHFDPELLANYPHDSSGLLLRRRTM
                     LLEFLRASRICMREINHRTTSGDIGSAIDRLITFLNEQMLPIQYYTSLDKIRTVDFFD
                     VIVLAPTLGMLQNFHNIQRTGLKLKTTSVTNGLVKFGLLSLSLCVNTILGVFDRDQHT
                     DGGKAALNIALLLVNPLLMRVVSEIHAAFFHKISLFEKGLLKINDSKEPIELETLEMP
                     KDQYYSFTASIEKFREITDQLLNPANEEVQKAFTKSYSITTTLALESLSRNLFDIGRQ
                     SREMAENYCNFDDKSTISQDMLDQMTEIFWSTYEQQSQDLWSVKPQGFHGFQHESLDF
                     DGTVPSENGTVDLDGDI"
     gene            <749452..>750900
                     /gene="TDEL0G04110"
                     /locus_tag="TDEL_0G04110"
                     /db_xref="GeneID:11505152"
     mRNA            <749452..>750900
                     /gene="TDEL0G04110"
                     /locus_tag="TDEL_0G04110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682941.1"
                     /db_xref="GeneID:11505152"
     CDS             749452..750900
                     /gene="TDEL0G04110"
                     /locus_tag="TDEL_0G04110"
                     /inference="similar to DNA sequence:INSDC:YLR267W"
                     /note="similar to Saccharomyces cerevisiae YLR267W;
                     ancestral locus Anc_6.59"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682989.1"
                     /db_xref="GeneID:11505152"
                     /db_xref="UniProtKB/TrEMBL:G8ZY11"
                     /translation="MSGVFGDRVPIEILDLVLDELERLSDVSVVDFGYVIDALKESVE
                     LQKRVRDRWQIVNCTGVESVEKLKCMSRSTRLLASDSNVVKLGDSELGRPVYIVDEHT
                     DVGLLNRAVALDLVYCGDISAVGDFLESLSVKCQVPLHLVIECGENAYAGRDLFGILK
                     PELFASDWAFDHLNVSFPWVEELECDYMAIDAFVYKVVNGRDPQAVFDRFLKCFTLNF
                     PVLDTIRFVRPTTTRDETCNFIDLSTLVLSKFKSQKIGLMNLFKVHSLRNWNLPRIER
                     FSGHRFKFDETAMTGSPERRSSSLKENLQFLRDLAVNETSDATPYYRTSLIPKGVKQT
                     RILNWIPIQSTPILILKSNSLERLSIKLLKFDLPSTAMVHGLFFPNLESLNLEQMDEQ
                     HISPSCFIDEQGSIILTNTTSHHVNAFASSMNPIAFSSWNQLTNLQVIQISANGDHYV
                     FDIENLKRLLPSIDLKRSFQTFFDEQQRFVVV"
     gene            <750980..>751525
                     /gene="TDEL0G04120"
                     /locus_tag="TDEL_0G04120"
                     /db_xref="GeneID:11505153"
     mRNA            <750980..>751525
                     /gene="TDEL0G04120"
                     /locus_tag="TDEL_0G04120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682942.1"
                     /db_xref="GeneID:11505153"
     CDS             750980..751525
                     /gene="TDEL0G04120"
                     /locus_tag="TDEL_0G04120"
                     /inference="similar to DNA sequence:INSDC:YOR163W"
                     /note="similar to Saccharomyces cerevisiae DDP1 (YOR163W);
                     ancestral locus Anc_6.58"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682990.1"
                     /db_xref="GeneID:11505153"
                     /db_xref="GOA:G8ZY12"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:G8ZY12"
                     /translation="MDNHEVERTKVSRVGRENQVYSAKTGARVVAGCVCLSKDKRHVL
                     MISSSAHKDRWIFPKGGVEKDEPDYKLTAQRETWEEAGCVGNIVNSLGTIEDMRPPKE
                     WNKDISSFSKSQDEVISHPPRSEFHFYEMEVTELPEKYPESNKRGRKWFNYVDAKQQL
                     LLAKRPELLEALNKSSIVKDI"
     gene            complement(<751575..>752495)
                     /gene="TDEL0G04130"
                     /locus_tag="TDEL_0G04130"
                     /db_xref="GeneID:11505154"
     mRNA            complement(<751575..>752495)
                     /gene="TDEL0G04130"
                     /locus_tag="TDEL_0G04130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682943.1"
                     /db_xref="GeneID:11505154"
     CDS             complement(751575..752495)
                     /gene="TDEL0G04130"
                     /locus_tag="TDEL_0G04130"
                     /inference="similar to DNA sequence:INSDC:YOR164C"
                     /note="similar to Saccharomyces cerevisiae YOR164C;
                     ancestral locus Anc_6.57"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682991.1"
                     /db_xref="GeneID:11505154"
                     /db_xref="InterPro:IPR007317"
                     /db_xref="UniProtKB/TrEMBL:G8ZY13"
                     /translation="MSSVNAKLQKTLQRFQDRIEAGDYYEAHQTLRTIANRYVRSKSY
                     QDAIDLISHGAQSFLKAKQGGSGTDLVFYLLEVYEVAEVKVDDVSVSRLVQLLVIIDP
                     QEPNLKDVVTAMNNWSIKFGDYKFGDPYLHSAIGSVLIEGGFAYEAERYLMLGPHEAV
                     NKYISLIWDWFYQEDDVETVGDFFSRPIFNFLFISNISYAYEARDKLLNLLIEKHSPK
                     FQITEKNGFKMYYFDNFADLNFLQLIILTCQTKNVDLFHNLKEHYGGSSSKYAAELEF
                     LGQEYFGIVAHRQTNFLQDMMAGFLGGGPK"
     gene            <752693..>755026
                     /gene="TDEL0G04140"
                     /locus_tag="TDEL_0G04140"
                     /db_xref="GeneID:11505155"
     mRNA            <752693..>755026
                     /gene="TDEL0G04140"
                     /locus_tag="TDEL_0G04140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682944.1"
                     /db_xref="GeneID:11505155"
     CDS             752693..755026
                     /gene="TDEL0G04140"
                     /locus_tag="TDEL_0G04140"
                     /inference="similar to DNA sequence:INSDC:YOR165W"
                     /note="similar to Saccharomyces cerevisiae SEY1 (YOR165W);
                     ancestral locus Anc_6.56"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682992.1"
                     /db_xref="GeneID:11505155"
                     /db_xref="GOA:G8ZY14"
                     /db_xref="InterPro:IPR008803"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZY14"
                     /translation="MAAAADDQHAVQLIDEQKRFHEKTLTYFKQWVSGRDVGLDYHVI
                     SVFGSQSSGKSTLLNMLFNTSFDTMDAQFKRQQTTKGIWLAHTRNVNTATVQTAKEKD
                     LFVLDVEGSDGAERGEDQDFERKAALFAIAVSEVLIVNMWEQQIGLYQGNNMALLKTV
                     FEVNLSLFGKNRNGHKILLLFVIRDHVGITPLSSLSESLVSELEKIWSELSKPAECAD
                     ASLKDFFDLEFVGLSHKLLQPKEFEQDVKKLGDRFVFEHNSPFYFKPTYHHRLPLDGW
                     TIYAENCWEQIENNKDLDLPTQQILVSRFKTEEIASEALANFRSGYQKEIGTAIDDKE
                     KLIAVMQQLKTRCLKEYDEQASRYAETEYLEKRNELEGEMVKDFTGTAKMFLENLSKL
                     LIQTLEKEVGDRKSNRSFAERSEASETAVKNQFHAAADDFDKGGFITSSREFVDVFEQ
                     QLKEEVEKLRKDEIASIITRAKKGITLKIKDATISLLSNPEIDVWDKVMKGFHQTIRD
                     VLEKYEMSEGNYDFQVGLSEGKNQDIYQQICHCAWHLLNVTVHDYLKEDTVVGILRDR
                     FESKFRYDDNDSPRLWKNEEEIDQAFRIAKEHALEVLGVLSLASTSDNVEVVANFDAA
                     DDVEDEFYQDDMGIYHSRRFAHILNEVQKEKVLQQFRRQINVTVLDSKRSIIKTTNSI
                     PIWIYIIIVVLGWNEFMIVIRNPLFVTLTLILGAGFYFVNRLGLWGPVLNVAQSAVGE
                     TRSTIKEKLRNLVLDEHERKPIAVPESFEMKDMSDEH"
     gene            <755159..>756142
                     /gene="TDEL0G04150"
                     /locus_tag="TDEL_0G04150"
                     /db_xref="GeneID:11505156"
     mRNA            <755159..>756142
                     /gene="TDEL0G04150"
                     /locus_tag="TDEL_0G04150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682945.1"
                     /db_xref="GeneID:11505156"
     CDS             755159..756142
                     /gene="TDEL0G04150"
                     /locus_tag="TDEL_0G04150"
                     /inference="similar to DNA sequence:INSDC:YLR265C"
                     /note="similar to Saccharomyces cerevisiae NEJ1 (YLR265C);
                     ancestral locus Anc_6.55"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682993.1"
                     /db_xref="GeneID:11505156"
                     /db_xref="UniProtKB/TrEMBL:G8ZY15"
                     /translation="MEYNALITLVTDRNVETNWSTSTVSKLNHFTCALALPTDTILFC
                     FIPVLLSEPYVASIPFHSLQDQCQKQGFLDKSIGQIQKHLRSQTIKLSSGLSFEKKGK
                     IIELSLSISSALKVLLKAEIIDTDGNLSFMLLRRLLDDVLSSSDLLRKQSTSMEKMID
                     DKDRALSFLRDHLEESYDGQALNRWAPKGSHNYQALEKFENANVKRAIFESSDDTSLD
                     QAEVMEVADVLFTMKRELKDYKKLHPTSPSKKKKAVKMNSDFAPIQESVVFNHKPPEN
                     NVNVKFEPTPSLVKSESPVKLESPVSGRDSSESPSRKRKFRKVKISKGSAP"
     gene            complement(<756131..>757405)
                     /gene="TDEL0G04160"
                     /locus_tag="TDEL_0G04160"
                     /db_xref="GeneID:11505157"
     mRNA            complement(<756131..>757405)
                     /gene="TDEL0G04160"
                     /locus_tag="TDEL_0G04160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682946.1"
                     /db_xref="GeneID:11505157"
     CDS             complement(756131..757405)
                     /gene="TDEL0G04160"
                     /locus_tag="TDEL_0G04160"
                     /inference="similar to DNA sequence:INSDC:YOR166C"
                     /note="similar to Saccharomyces cerevisiae YOR166C;
                     ancestral locus Anc_6.54"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682994.1"
                     /db_xref="GeneID:11505157"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:G8ZY16"
                     /translation="MVLPSIHASNEGKRSPKRRFEGTLKSSTSKITKSGSDDGGNHKY
                     TVADIDQLIQNTPDEDCAMIDMQDEDDVQNVSKMLSNRRSSLIENQDEIPLSREDVDS
                     RIPTLTPTRVKTLFVVDTNFLISHLGTLESLRRLGQSFHHQIVLPNTVIRELDGLKNS
                     SREVQLSEGTESIGKLARRANDWIYKNFANLNSAVMGQKLGQAINPNCVKDDAILDCG
                     LYFKEKMDCFVILLSNDKNLCVKALTENLLTVTFKKGMTAELIASMTYNENLSLFGPG
                     AHNDEPMDDTQVSAANLIQRAAEVYREITTAVTEAIIHVINDEYGEDVDLLGFQADTL
                     TDLLSATHCLEKFWISVFAEYFKRSRIKKNDWKGFPDCLTSLPTSFGDLKNLVNFWGE
                     ILKYLFMKRCDEDNENLEKSIQYWTHMSALGS"
     gene            complement(<758179..>758382)
                     /gene="TDEL0G04170"
                     /locus_tag="TDEL_0G04170"
                     /db_xref="GeneID:11505158"
     mRNA            complement(<758179..>758382)
                     /gene="TDEL0G04170"
                     /locus_tag="TDEL_0G04170"
                     /product="40S ribosomal protein S28"
                     /transcript_id="XM_003682947.1"
                     /db_xref="GeneID:11505158"
     CDS             complement(758179..758382)
                     /gene="TDEL0G04170"
                     /locus_tag="TDEL_0G04170"
                     /inference="similar to DNA sequence:INSDC:YLR264W,YOR167C"
                     /note="similar to Saccharomyces cerevisiae RPS28B
                     (YLR264W) and RPS28A (YOR167C); ancestral locus Anc_6.53"
                     /codon_start=1
                     /product="40S ribosomal protein S28"
                     /protein_id="XP_003682995.1"
                     /db_xref="GeneID:11505158"
                     /db_xref="GOA:G8ZY17"
                     /db_xref="InterPro:IPR000289"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR028626"
                     /db_xref="UniProtKB/TrEMBL:G8ZY17"
                     /translation="MDSKTPVTLAKVIKVLGRTGSRGGVTQVRVEFLDDTSRTIVRNV
                     KGPVRENDVLVLMESEREARRLR"
     gene            complement(<758601..>761150)
                     /gene="TDEL0G04180"
                     /locus_tag="TDEL_0G04180"
                     /db_xref="GeneID:11505159"
     mRNA            complement(join(<758601..760801,760886..>761150))
                     /gene="TDEL0G04180"
                     /locus_tag="TDEL_0G04180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682948.1"
                     /db_xref="GeneID:11505159"
     CDS             complement(join(758601..760801,760886..761150))
                     /gene="TDEL0G04180"
                     /locus_tag="TDEL_0G04180"
                     /inference="similar to DNA sequence:INSDC:YLR263W"
                     /note="similar to Saccharomyces cerevisiae RED1 (YLR263W);
                     ancestral locus Anc_6.52"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682996.1"
                     /db_xref="GeneID:11505159"
                     /db_xref="GOA:G8ZY18"
                     /db_xref="InterPro:IPR012491"
                     /db_xref="UniProtKB/TrEMBL:G8ZY18"
                     /translation="MDAIEAITKDLFGVALPNLECGTGAAINVNHCSMDLHHSRQFGT
                     LLKIVSSRDHTIKNLEVLQAVIQVGTRLSKAKLISNNFWWTLMVNKCRDVQWCVELSP
                     KWRTRKNNRDSWKYLYLLTEICYGVPKSKQLITDLIGSRYAGKIGEFLDLMRDFQQVN
                     ILIELLSNCFPRKSTQEVGVIHPPTLWGMENARNVQFFNSQLYPFRGKHGDDQVMKFI
                     WDICHGEMDNLIRLHNVTLGSSSNGSGGKRLKVNSHHEANQYCYIQAMYDSIFLWDGE
                     GVFLEMDRRHVDITKNLKGKVKINVIGKPGKCFNSTCKSFLEKFSNVKWLKLDAIDQA
                     SCDRFFYETTNIRKISEVQTFLALNHTDEDPLESNEDITARGLQYQSEATALELNEQQ
                     CESTNLIDKRDQLVTPEHSDVRICTDEWDFNTSSGEKGTVMSNTQGGKQVTPEQSDEL
                     LSKSSRYDEQSPLVLAQKRKKIRETTKTLEMLKKGFALTSNPPSSKGVDSKTVERSPS
                     LMITKFETNVKISEKPTVVEKNKTPKIKAVNSIGAKDISILNTIFGKTDSSTLKRSKR
                     QQRLKNYKPVIEVPSQDVPVTKVRNLSKKVAVIEKNAKEDTKEDTKEDTIEDIKEDSN
                     SEKGKRMRKQERVEKEVKMKTRKRVADEKADQLMQEKKQKIKENLAAESPQPSGKHSQ
                     SKIESIENPTLANTSLLDSTTMLGNTSVAAPTSLPIPTGNAFTDKLNEQIYNSITHFY
                     NEMISKMAIINKELNHKIMKELSEKYQNLFQEIQKSFQHDTEEMLKFMTEIKDLMNLP
                     ENELVRVIRNRKFGQQALPSAAQ"
     gene            <761363..>763792
                     /gene="TDEL0G04190"
                     /locus_tag="TDEL_0G04190"
                     /db_xref="GeneID:11505160"
     mRNA            <761363..>763792
                     /gene="TDEL0G04190"
                     /locus_tag="TDEL_0G04190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682949.1"
                     /db_xref="GeneID:11505160"
     CDS             761363..763792
                     /gene="TDEL0G04190"
                     /locus_tag="TDEL_0G04190"
                     /inference="similar to DNA sequence:INSDC:YOR168W"
                     /note="similar to Saccharomyces cerevisiae GLN4 (YOR168W);
                     ancestral locus Anc_6.51"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682997.1"
                     /db_xref="GeneID:11505160"
                     /db_xref="GOA:G8ZY19"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR004514"
                     /db_xref="InterPro:IPR007638"
                     /db_xref="InterPro:IPR007639"
                     /db_xref="InterPro:IPR011035"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020056"
                     /db_xref="InterPro:IPR020058"
                     /db_xref="InterPro:IPR020059"
                     /db_xref="InterPro:IPR020061"
                     /db_xref="UniProtKB/TrEMBL:G8ZY19"
                     /translation="MSEVDDLTVLFSQVGFEEPKVKEIVKNKKVSDTLSVLVREAPAS
                     YQWDKSSRALVHNLASLIKGAEFPNSKLIVEGIVNGDLKTNLQVEAAYKYVKQNGDSA
                     TKEAMNENSGVGIEVTEDQVRASVINYIETNKKLILAERYKLVPGIFANIKNLPELKW
                     ADPRSFKPIIDQEILKVLGPKDERDLVKKKNKKSSDSSKNGANAKNKAGKETASAPKR
                     NMFSEGFLGDLHEVDDNPQATPELLAEHLKAVNGKVRTRFPPEPNGYLHIGHSKAIMV
                     NFGYAKYNGGETYLRFDDTNPEAEAPEYFESIKRMVSWLGFKPFKITYSSDYFDKLYE
                     LAEVLIKSGKGYVCHCTSEEVKAGRGIKEDGTPGGERFACKDRDRSIEETLDEFRKMR
                     NGFYKPGEATLRMKQDLSSPSPQMWDLVAYRVLNAPHPRTGSKWKIYPTYDFTHCLVD
                     SFENITHSLCTTEFYLSRESYEWLCDQVHVFRPTQREYGRLNITGTVLSKRKIAKLVE
                     EKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTTNIQVVRFESAIRKYLE
                     DSTPRLMFVLDPVEVVLDNLPEDYEELVKIPFRPGSPEFGEREVPFTKRFFIERSDFS
                     ENSDDKEFFRMTPKQPVGLIKVPYNVSFKSAEKDESGRIIRIHAHYDNSPQDGKPQKP
                     KTYIQWVPFSKKYNSPVQVAETRIYNQLFSSENPSAHPEGYLKDINPESELVYTNSVV
                     EPNFSEVAKKSPWVVDSVKKSEFYVPEEEGRKEVCRFQAMRVGYFTLDKDSEDNRIIL
                     NRIVSLKESTK"
     gene            <764331..>764525
                     /gene="TDEL0G04200"
                     /locus_tag="TDEL_0G04200"
                     /db_xref="GeneID:11505161"
     mRNA            <764331..>764525
                     /gene="TDEL0G04200"
                     /locus_tag="TDEL_0G04200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682950.1"
                     /db_xref="GeneID:11505161"
     CDS             764331..764525
                     /gene="TDEL0G04200"
                     /locus_tag="TDEL_0G04200"
                     /inference="similar to DNA sequence:INSDC:YLR262C-A"
                     /note="similar to Saccharomyces cerevisiae TMA7
                     (YLR262C-A); ancestral locus Anc_6.50"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682998.1"
                     /db_xref="GeneID:11505161"
                     /db_xref="InterPro:IPR015157"
                     /db_xref="UniProtKB/TrEMBL:G8ZY20"
                     /translation="MSGRQGGKAKPLKQKKKQQHDDDPEEAAFKEKQRQDAAAKKAFL
                     ANVKSGKPLVGGGIKKSGKK"
     gene            <764766..>765434
                     /gene="TDEL0G04210"
                     /locus_tag="TDEL_0G04210"
                     /db_xref="GeneID:11505162"
     mRNA            <764766..>765434
                     /gene="TDEL0G04210"
                     /locus_tag="TDEL_0G04210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682951.1"
                     /db_xref="GeneID:11505162"
     CDS             764766..765434
                     /gene="TDEL0G04210"
                     /locus_tag="TDEL_0G04210"
                     /inference="similar to DNA sequence:INSDC:YLR262C"
                     /note="similar to Saccharomyces cerevisiae YPT6 (YLR262C);
                     ancestral locus Anc_6.49"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003682999.1"
                     /db_xref="GeneID:11505162"
                     /db_xref="GOA:G8ZY21"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZY21"
                     /translation="MSGTRPGKSLTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQAT
                     IGIDFLSKTMYLDDKTIRLQLWDTAGQERFRSLIPSYIRDSRVAIVVYDITKKKSFEF
                     IDKWIEDVKNERGEENVILCIVGNKSDLADERQVSTEEGEAKAKLLGAKIFMETSTKA
                     GHNVKNLFKKIAKSLPEFQEGQHAGALEGDNSNEVGKKEANGSGVIDITTTEDQAQGG
                     GCQC"
     gene            complement(<765502..>767400)
                     /gene="TDEL0G04220"
                     /locus_tag="TDEL_0G04220"
                     /db_xref="GeneID:11505163"
     mRNA            complement(<765502..>767400)
                     /gene="TDEL0G04220"
                     /locus_tag="TDEL_0G04220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682952.1"
                     /db_xref="GeneID:11505163"
     CDS             complement(765502..767400)
                     /gene="TDEL0G04220"
                     /locus_tag="TDEL_0G04220"
                     /inference="similar to DNA sequence:INSDC:YLR260W,YOR171C"
                     /note="similar to Saccharomyces cerevisiae LCB5 (YLR260W)
                     and LCB4 (YOR171C); ancestral locus Anc_6.48"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683000.1"
                     /db_xref="GeneID:11505163"
                     /db_xref="GOA:G8ZY22"
                     /db_xref="InterPro:IPR001206"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="UniProtKB/TrEMBL:G8ZY22"
                     /translation="MNLPPTSPANLQTLKDKDFNEATLTDDGIMITSQGHPDSYKASA
                     NVNADPVTGDHNESMTSVRSNNSFFETASLISCVTCLSDNYDQGNRLNPSGENTEGAA
                     KNTGEDDVPYSSVTGQLLVNTVIPYSRILHARYLENPKGYTDDLETANASSDLIEIDD
                     TATGSGSDPFSKDSIEHHKPKYSKTKGRLNRPALVEITFAKPRRHDIVPKHLTLSISY
                     PSLSRGADIVEEILKRSYKNAKRERSILVIVNPFGGKGKAKKMFMSKCKPILLASNCS
                     IDTAYTKYAMHAVDIAREIDLDKYDTIACASGDGIPYEVINGLYQRPDRAEAFTKLAI
                     TQLPCGSGNAMSVSCHWTSNPSYAALCLVKSVEARIDLMCCSQPSYYQNFPRLSFLSQ
                     TYGVIAESDINTEFIRWMGPARFELGVAFNVLQRKKYPCDIYVKYAAKSKNDLKVHYM
                     EHKNRASLRFENDVDDILNDNLSGDCFQDPSWSQVKESDFKLKYPLEDGVPSDWERIS
                     PDITDNLGIFYTGKMPYIAADTKFFPAALPADGTMDLVVTDARTPVTRMAPILLALDK
                     GSHVLQPEVIHSKISAYKLVPKITNSLFSVDGEKFPLEPLQVEIMPHLCKTLLRNGCY
                     VDTEFDSM"
     gene            <768248..>769972
                     /gene="TDEL0G04230"
                     /locus_tag="TDEL_0G04230"
                     /db_xref="GeneID:11505164"
     mRNA            <768248..>769972
                     /gene="TDEL0G04230"
                     /locus_tag="TDEL_0G04230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682953.1"
                     /db_xref="GeneID:11505164"
     CDS             768248..769972
                     /gene="TDEL0G04230"
                     /locus_tag="TDEL_0G04230"
                     /inference="similar to DNA sequence:INSDC:YLR259C"
                     /note="similar to Saccharomyces cerevisiae HSP60
                     (YLR259C); ancestral locus Anc_6.47"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683001.1"
                     /db_xref="GeneID:11505164"
                     /db_xref="GOA:G8ZY23"
                     /db_xref="InterPro:IPR001844"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR018370"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:G8ZY23"
                     /translation="MLRSVVTRSRVSGLRSANLLRRCYSSHKEVKFGVDARASLLRGV
                     ETLADAVQATLGPKGRNVLIEQPFGAPKITKDGVTVAKSIVLEDKFENMGAKLLQEVA
                     SKTNEAAGDGTTSATVLGRAIFTESVKNVAAGCNPMDLRRGSQAAVEKVIEFLSQNKK
                     EITTSEEIAQVATISANGDAHVGKLLASAMEKVGKEGVITIREGRTLEDELEVTEGMR
                     FDRGFISPYFITDPKSGKVEFEKPLILISEKKISSIQDILPALEISNQSRRPLLILAE
                     DVDGEALAACILNKLRGQVKVCAVKAPGFGDNRKNTLGDIAVLTGGTVFTEELDLKPE
                     QCTIEQLGSCDSITITKEDTVVLNGNGSKDALETRVEQIKNSIDLTTTNSYEKEKLQE
                     RLAKLSGGVAVIRVGGASEVEVGEKKDRYDDALNATRAAVEEGILPGGGTALAKATRV
                     LDEVKVDNFDQKLGVDIIRKAISRPARQIIENAGEEGSVIVGKMVDEYGSDFAKGYDS
                     SKSEFTDMLAAGIIDPFKVVRSGLVDASGVASLLATTEVAIVDAPQPPSPGGAGIPGG
                     MPGMPGMM"
     gene            complement(770167..770277)
                     /gene="TDEL0Gtrna4P"
                     /locus_tag="TDEL_0Gtrna4P"
                     /db_xref="GeneID:11504387"
     tRNA            complement(join(770167..770203,770241..770277))
                     /gene="TDEL0Gtrna4P"
                     /locus_tag="TDEL_0Gtrna4P"
                     /product="tRNA-Pro"
                     /note="codon recognized: CCA"
                     /db_xref="GeneID:11504387"
     gene            <770798..>772132
                     /gene="TDEL0G04240"
                     /locus_tag="TDEL_0G04240"
                     /db_xref="GeneID:11505324"
     mRNA            <770798..>772132
                     /gene="TDEL0G04240"
                     /locus_tag="TDEL_0G04240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682954.1"
                     /db_xref="GeneID:11505324"
     CDS             770798..772132
                     /gene="TDEL0G04240"
                     /locus_tag="TDEL_0G04240"
                     /inference="similar to DNA sequence:INSDC:YML043C"
                     /note="similar to Saccharomyces cerevisiae RRN11
                     (YML043C); ancestral locus Anc_6.46"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683002.1"
                     /db_xref="GeneID:11505324"
                     /db_xref="InterPro:IPR007224"
                     /db_xref="UniProtKB/TrEMBL:G8ZY24"
                     /translation="MFEQPVALTTRRLRNAKKLRYQYVNNLSAKFNRLERITNTNGLP
                     TPENSAAESSENEEALQRKKKRIRRRLKSAAGESYSDSESDEVDNNHDNEVVEDEEED
                     QERKFLNNYELPQESFEKWQDDPSKRVPIQRSKISFTKYQRLRRHAKRKMNTSIDLAS
                     KRNKIYMDTISEGFEMVDPVDGKPDTFQMKHISILTTLLHLHVSRREWDAAYTCFALL
                     IRVPKVDIRNIWGIGDLILREREPIKSLEFLSWMSSVYSSRSAFAEDVNHRTPPVFTK
                     GSKTHVPKFATTWMWESLIQCTKNSLETGELEQIESNDGLQDLIERISEMVLAPPYMD
                     ASEVWFIYGLCHLIKADILSNQFDGRLAGSARDIASNQVIQHIQRTKSCLQTCLSKGD
                     FKYPKRYIERQLEEFEKRLDRQEDTPDDSDHEVESLHDKLDTQSIESDDDSS"
     gene            complement(<772180..>773733)
                     /gene="TDEL0G04250"
                     /locus_tag="TDEL_0G04250"
                     /db_xref="GeneID:11505165"
     mRNA            complement(<772180..>773733)
                     /gene="TDEL0G04250"
                     /locus_tag="TDEL_0G04250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682955.1"
                     /db_xref="GeneID:11505165"
     CDS             complement(772180..773733)
                     /gene="TDEL0G04250"
                     /locus_tag="TDEL_0G04250"
                     /inference="similar to DNA sequence:INSDC:YOL013C"
                     /note="similar to Saccharomyces cerevisiae HRD1 (YOL013C);
                     ancestral locus Anc_6.45"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683003.1"
                     /db_xref="GeneID:11505165"
                     /db_xref="GOA:G8ZY25"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G8ZY25"
                     /translation="MAISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLT
                     EGFNIVIITVFFTLNSVLLWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFS
                     EHDFLTVAIYGLLLLFMKVFHWILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAI
                     ADYQIISHCVSNSLDNSFGASASVHLMMGMEFALLLIDLLNTTLHAALCFYEFYQSQT
                     HGRRNAVNDDEDDTQFSGLEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDV
                     LWDCLTLHQNAKGLWKIWRNNKQLDDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGH
                     TRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTVPTTAEVT
                     PTDEINVPETVVERSQEQIQDNQQQMGEGQVAVLDSWYSFPVEETSENLVTFSMKNSA
                     TNETVPASLLIERTNASERYDDDDDQVETIIIPDEVVDQAQTIENLKRRVSELESQVE
                     HLNKRVRKD"
     gene            complement(<773903..>774298)
                     /gene="TDEL0G04260"
                     /locus_tag="TDEL_0G04260"
                     /db_xref="GeneID:11505166"
     mRNA            complement(<773903..>774298)
                     /gene="TDEL0G04260"
                     /locus_tag="TDEL_0G04260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682956.1"
                     /db_xref="GeneID:11505166"
     CDS             complement(773903..774298)
                     /gene="TDEL0G04260"
                     /locus_tag="TDEL_0G04260"
                     /inference="similar to DNA sequence:INSDC:YOL012C"
                     /note="similar to Saccharomyces cerevisiae HTZ1 (YOL012C);
                     ancestral locus Anc_6.43"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683004.1"
                     /db_xref="GeneID:11505166"
                     /db_xref="GOA:G8ZY26"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G8ZY26"
                     /translation="MSGKVHGGKGKSGAKDGGNLRSQSSSARAGLQFPVGRIKRYLKR
                     NASGKVRVGSKSAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDEL
                     DSLIRATIASGGVLPHINKALLLKVEKRK"
     gene            <775229..>777178
                     /gene="TDEL0G04270"
                     /locus_tag="TDEL_0G04270"
                     /db_xref="GeneID:11505167"
     mRNA            <775229..>777178
                     /gene="TDEL0G04270"
                     /locus_tag="TDEL_0G04270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682957.1"
                     /db_xref="GeneID:11505167"
     CDS             775229..777178
                     /gene="TDEL0G04270"
                     /locus_tag="TDEL_0G04270"
                     /inference="similar to DNA sequence:INSDC:YMR008C,YOL011W"
                     /note="similar to Saccharomyces cerevisiae PLB1 (YMR008C)
                     and PLB3 (YOL011W); ancestral locus Anc_6.42"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683005.1"
                     /db_xref="GeneID:11505167"
                     /db_xref="GOA:G8ZY27"
                     /db_xref="InterPro:IPR002642"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:G8ZY27"
                     /translation="MNLKEWLLFSIAVFFAQGTLAWSPSNSYTPANVSCDEDINLIRQ
                     ASGPSDDETEWLKKRDVYTREALRSFLDRATSNFSDSSLVSQLFSNASDIPRIAVACS
                     GGGYRAMLSGAGMLAAMDNRTDGANEHGLGGLLQSTTYLAGLSGGNWLVGTLAWNNWT
                     SVQDIVNNMTADDSIWDISNSIINPGGFMIVTTIKRWDHISDAVEGKQDAGFNVSLTD
                     IWGRALSYNFFPSLYSGDVAYTWSTLRDVEVFQNGEMPFPISVADGRYPGTQIIDLNA
                     TVFEFNPFEMGSWDPTLNAFTDVKYLGTKVSNGEPVNKGQCVAGYDNTGFIMGTSSSL
                     FNQFLLQINSTSLPSFIKNLVTGFLDDLSEDEDDIAIYAPNPFKDTSYIHDNFSKSIS
                     ESDYLYLVDGGEDNQNIPLVPLVQDERNIDVIFALDNSADTDYYWPDGASLVSTYERQ
                     FSSQGMNMSFPYVPDKRTFVNLGLADKPSFFGCDAQNLTDLNYIPPLVVYIPNARHSY
                     NSNTSTFKLSYTDDERLKMIKNGFEAATRGNLTDDSSFMGCVACAVMRRKQQSLNATL
                     PEECNTCFTNYCWNGTIDDTPVSGLDNSDFDPTAASSAYSAYNTESYSSSSATGSKKN
                     GAGLPASPTSFTSVLTLLTAIAGFL"
     gene            <777677..>779650
                     /gene="TDEL0G04280"
                     /locus_tag="TDEL_0G04280"
                     /db_xref="GeneID:11505168"
     mRNA            <777677..>779650
                     /gene="TDEL0G04280"
                     /locus_tag="TDEL_0G04280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682958.1"
                     /db_xref="GeneID:11505168"
     CDS             777677..779650
                     /gene="TDEL0G04280"
                     /locus_tag="TDEL_0G04280"
                     /inference="similar to DNA sequence:INSDC:YMR006C"
                     /note="similar to Saccharomyces cerevisiae PLB2 (YMR006C);
                     ancestral locus Anc_6.41"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683006.1"
                     /db_xref="GeneID:11505168"
                     /db_xref="GOA:G8ZY28"
                     /db_xref="InterPro:IPR002642"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:G8ZY28"
                     /translation="MKVSSLTSLLAVSALADAWSPSNGYAPSRVNCEEDIQLVRKADG
                     LSSNETQWLEKRDANTREALQSFLERATANFSDNALVSQLFDLSDDSNVPRIAVACSG
                     GGYRAMLSGAGMLSAMDNRTEGANAHGLGGLLQSTTYLAGLSGGAWLVGSLAWNNWTS
                     VQDIVDHTSEKGSIWDITNSLGQGGTNITATNQTWSDIMRAVTTKQMAGFNVTLADYW
                     GRGLSYGFFPSLPEGGVGYTWSSLRSSDVFKNGEMPFPITVADFRKPYSEIAYGNTTI
                     FEFNPFEMGSWDDSLQAFTDVKYLGTKAFNGTPVNKGQCVAGFDNTGFVLGTSSTLFT
                     PSMSSAVGLLLNGGAVGEIFAKAMANDTNDVANYAPNPFKGVTFGSETEKYLTEDYLY
                     LVDGGEDNEVIPFVPLLQPDRAMDVIFALDSSSDTAQAWPNGSALTTTYERQFTSQGD
                     GIAFPHVPGPEIFELLRLNKQPTFFGCDAGNLTDLEYIPPLVVYIPNSPYSFNSNQST
                     LKLSYSGQERLSMIKNGFEITTRGNLTQDPGFAGCIACAIMRRQQENVNATLPQECQE
                     CFANYCWTGEVTSSNMSLPDGSSSYNNTSSTHLTSTLSPSSSISQSSSASPTATISSS
                     TNHNSANILRQSASYGKSIITLLCILMIVSISF"
     gene            complement(<779834..>780937)
                     /gene="TDEL0G04290"
                     /locus_tag="TDEL_0G04290"
                     /db_xref="GeneID:11505169"
     mRNA            complement(<779834..>780937)
                     /gene="TDEL0G04290"
                     /locus_tag="TDEL_0G04290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682959.1"
                     /db_xref="GeneID:11505169"
     CDS             complement(779834..780937)
                     /gene="TDEL0G04290"
                     /locus_tag="TDEL_0G04290"
                     /inference="similar to DNA sequence:INSDC:YMR005W"
                     /note="similar to Saccharomyces cerevisiae TAF4 (YMR005W);
                     ancestral locus Anc_6.40"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683007.1"
                     /db_xref="GeneID:11505169"
                     /db_xref="GOA:G8ZY29"
                     /db_xref="InterPro:IPR007900"
                     /db_xref="UniProtKB/TrEMBL:G8ZY29"
                     /translation="MSSPVKREAGDNSEQLRKKSKSNTPLNESEPAFDLSPQDNVISE
                     IMPRSNPMDFSSDVPTPFDDLMGDNPPLPKTSAPSTDLNRNNSNSASGLALPKRDDKK
                     KAKMQQKEAQGGKSQSDPNKMQDVLFSAGVDIREEEALLSSSVNASKSQNQAPNAETP
                     NHPPFLHPEQLGMFMRKACKMQSFSQNFSKNPEVLRMMSTACEMYMKDIITNSLVISR
                     HRRKAVRVNSGRRNEVATALRTLAVAQKKEEERRVKKRIALGLEKEDLENKMDSEETL
                     HRASNVTAGLRAGSKKQYGWLTSSTSKPAVMGSKTYGKVATAVAARGDSGLRFREARE
                     EPGIVMRDLLYALENRRNGVRNVISKGYARIRD"
     gene            <781852..>782949
                     /gene="TDEL0G04300"
                     /locus_tag="TDEL_0G04300"
                     /db_xref="GeneID:11505170"
     mRNA            <781852..>782949
                     /gene="TDEL0G04300"
                     /locus_tag="TDEL_0G04300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682960.1"
                     /db_xref="GeneID:11505170"
     CDS             781852..782949
                     /gene="TDEL0G04300"
                     /locus_tag="TDEL_0G04300"
                     /inference="similar to DNA sequence:INSDC:YOL010W"
                     /note="similar to Saccharomyces cerevisiae RCL1 (YOL010W);
                     ancestral locus Anc_6.39"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683008.1"
                     /db_xref="GeneID:11505170"
                     /db_xref="GOA:G8ZY30"
                     /db_xref="InterPro:IPR000228"
                     /db_xref="InterPro:IPR013791"
                     /db_xref="InterPro:IPR013792"
                     /db_xref="InterPro:IPR016443"
                     /db_xref="InterPro:IPR020719"
                     /db_xref="InterPro:IPR023797"
                     /db_xref="UniProtKB/TrEMBL:G8ZY30"
                     /translation="MSSRGSYVVFSGSQNFRLRLVLATLSGKAIKIEKIRSNELNPGL
                     KDHEVSFLRLLESVTNGSAIEISYTGTTVIYRPGIIVGGSVTHNCPNGKPVGYFVEPM
                     LYLAPFSKKKFSIIFRGCTASHDDAGLEAIKWGMMPVMEKFGVRECALHTLKRGSPPL
                     GGGEVHLVVDSLIAQPLTMHELERPTISSIRGVAYSTRVSPSMVNRMIDAAKVVLKKV
                     GCEVNITADVWRGENSGKSPGWGITLVAETKKGWCYFAEKIGDAGDVPEDIGNVVAYH
                     LLEEISKSAAVSRDQLPLALVYMVIGKEDIGRLRITSNQIDEKLINLLRDIKSIFGTE
                     VFLKPVDYDNTDDFIATIKGVGFTNTSKKIA"
     gene            complement(<783015..>784586)
                     /gene="TDEL0G04310"
                     /locus_tag="TDEL_0G04310"
                     /db_xref="GeneID:11505171"
     mRNA            complement(<783015..>784586)
                     /gene="TDEL0G04310"
                     /locus_tag="TDEL_0G04310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682961.1"
                     /db_xref="GeneID:11505171"
     CDS             complement(783015..784586)
                     /gene="TDEL0G04310"
                     /locus_tag="TDEL_0G04310"
                     /inference="similar to DNA sequence:INSDC:YMR004W"
                     /note="similar to Saccharomyces cerevisiae MVP1 (YMR004W);
                     ancestral locus Anc_6.38"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683009.1"
                     /db_xref="GeneID:11505171"
                     /db_xref="GOA:G8ZY31"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:G8ZY31"
                     /translation="MDLFEEADPWNPKKDSDIVPRNEWASNGTPSLSDNINASLETPF
                     RDMTLAGTTRETGLPTVAGNILKSSIWEDSSAANDEDILSERGPFNYGSNLSGNPAQQ
                     TTNEDVLSNSEVQEPHELSEDLNDWLKSVRNTYKPLSADIILIEQLPDREGLLFKHTN
                     YVVKHLVPLPDTETSKDRSVIRRYSDFVWLQEVLLKRYPFRLIPELPPKKIGTQNADA
                     VFLERRRRGLTRFINLVMKHPVLSKDDLLLTFLTVPTDLSSWRKQAIYDTTEEFSDKK
                     ITSSFTKMWQKEISEQWNEAEATTERSIEQWVKITVFMERYERRVKFMARERLALGSL
                     VQEFSGTIPSLYPVQQGGTILDIKSHLSIIDKHLGSTEELCSERTKEFSTGLVPKFRI
                     FIDVLLSLRGLFERYRLMAGNNIAQLQRRVEINTQKIEGMKDKPDVSGVEYDKIKSVI
                     QRDKKTISEELNRAWLIRECILEEFTVFQETQFLISRAFQEWAKLNSTFAGLSVNQWE
                     KLTDNLSDMPTSNGL"
     gene            complement(<784738..>785523)
                     /gene="TDEL0G04320"
                     /locus_tag="TDEL_0G04320"
                     /db_xref="GeneID:11505172"
     mRNA            complement(<784738..>785523)
                     /gene="TDEL0G04320"
                     /locus_tag="TDEL_0G04320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682962.1"
                     /db_xref="GeneID:11505172"
     CDS             complement(784738..785523)
                     /gene="TDEL0G04320"
                     /locus_tag="TDEL_0G04320"
                     /inference="similar to DNA sequence:INSDC:YOL009C"
                     /note="similar to Saccharomyces cerevisiae MDM12
                     (YOL009C); ancestral locus Anc_6.37"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683010.1"
                     /db_xref="GeneID:11505172"
                     /db_xref="GOA:G8ZY32"
                     /db_xref="InterPro:IPR027532"
                     /db_xref="UniProtKB/TrEMBL:G8ZY32"
                     /translation="MSFDIDWTKLESDSRLNKSIKSHLNSYLQSINLPSYVSNLRLID
                     FSIGKIAPNITLREISDPLDDFYQALNEEQESGKTLEPSPNDIQFLTEIEYKGDLLIT
                     LAADLVLHYPTEGFMTLPVKLTISNIGIHSLCLIAYLAKELFISFVCDVSDTKLDNDE
                     SVLDPAGPVLAPRRSLERIFIIRSMKIETEIGEQYLGEGSVLRSVGKLEQYLLENLKD
                     VLRKELSWPSWINLDFGNDNEDDDDNNATDQDDGNAEKPDQGE"
     gene            <785667..>786278
                     /gene="TDEL0G04330"
                     /locus_tag="TDEL_0G04330"
                     /db_xref="GeneID:11505173"
     mRNA            <785667..>786278
                     /gene="TDEL0G04330"
                     /locus_tag="TDEL_0G04330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682963.1"
                     /db_xref="GeneID:11505173"
     CDS             785667..786278
                     /gene="TDEL0G04330"
                     /locus_tag="TDEL_0G04330"
                     /inference="similar to DNA sequence:INSDC:YOL008W"
                     /note="similar to Saccharomyces cerevisiae COQ10
                     (YOL008W); ancestral locus Anc_6.36"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683011.1"
                     /db_xref="GeneID:11505173"
                     /db_xref="InterPro:IPR005031"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:G8ZY33"
                     /translation="MSFYLWKSVKLHSRANWLLQGSFHSRTLLGWTSHTSDKPQNFTL
                     TKTINATPSQVYDVVSEVSKYHEFIPYCIESFVNERNQVDNRPTEAGLRVGFRQYDER
                     YTCKIKCEEKANEEFIVQADSISHTLFQDLSTRWIIRAHPQRHNATQAELLLRFKFRS
                     RLYNSVSSIFGKSVTELVMKAFEKRVFELRKRSLKAATNASNM"
     gene            complement(<786389..>787030)
                     /gene="TDEL0G04340"
                     /locus_tag="TDEL_0G04340"
                     /db_xref="GeneID:11505174"
     mRNA            complement(<786389..>787030)
                     /gene="TDEL0G04340"
                     /locus_tag="TDEL_0G04340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682964.1"
                     /db_xref="GeneID:11505174"
     CDS             complement(786389..787030)
                     /gene="TDEL0G04340"
                     /locus_tag="TDEL_0G04340"
                     /inference="similar to DNA sequence:INSDC:YMR003W"
                     /note="similar to Saccharomyces cerevisiae YMR003W;
                     ancestral locus Anc_6.35"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683012.1"
                     /db_xref="GeneID:11505174"
                     /db_xref="GOA:G8ZY34"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="UniProtKB/TrEMBL:G8ZY34"
                     /translation="MSRLAMNGAAIRVLRGLGNPLPRAGGPMRPMLFGDLRQVHNTAK
                     KHHTSLMTSDVKHSTFHKMSLNALKSECRVRGLKVSGRKAELVDRITSFEGKAKPVQK
                     RHINTKQPSKVDSKPKETVSKQLFDITTDVRTTIPRSVFTMKTPSLKEQAPRLGGNTL
                     KSENVTNTKTTDQTVLGDTIFVEEKLTLKDKLFLLGFGTITALWWGSESGEQV"
     gene            complement(<787201..>787656)
                     /gene="TDEL0G04350"
                     /locus_tag="TDEL_0G04350"
                     /db_xref="GeneID:11505175"
     mRNA            complement(<787201..>787656)
                     /gene="TDEL0G04350"
                     /locus_tag="TDEL_0G04350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682965.1"
                     /db_xref="GeneID:11505175"
     CDS             complement(787201..787656)
                     /gene="TDEL0G04350"
                     /locus_tag="TDEL_0G04350"
                     /inference="similar to DNA sequence:INSDC:YMR002W"
                     /note="similar to Saccharomyces cerevisiae MIC17
                     (YMR002W); ancestral locus Anc_6.34"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683013.1"
                     /db_xref="GeneID:11505175"
                     /db_xref="UniProtKB/TrEMBL:G8ZY35"
                     /translation="MARSRGSARPASRPMQTRSASTMAAPAHAPPQQHQSAYSHPPAT
                     AAGQAKQPGMFAQMASTAAGVAVGSAVGHTLGAGLTGMFSGSGSAPAEQQQQQLATNG
                     SLEQNQQVKACDVDARNFTRCLDENNGNFQICDYYLQQLKACQEAARQY"
     gene            complement(<787848..>788777)
                     /gene="TDEL0G04360"
                     /locus_tag="TDEL_0G04360"
                     /db_xref="GeneID:11505176"
     mRNA            complement(<787848..>788777)
                     /gene="TDEL0G04360"
                     /locus_tag="TDEL_0G04360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682966.1"
                     /db_xref="GeneID:11505176"
     CDS             complement(787848..788777)
                     /gene="TDEL0G04360"
                     /locus_tag="TDEL_0G04360"
                     /inference="similar to DNA sequence:INSDC:YOL007C"
                     /note="similar to Saccharomyces cerevisiae CSI2 (YOL007C);
                     ancestral locus Anc_6.33"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683014.1"
                     /db_xref="GeneID:11505176"
                     /db_xref="UniProtKB/TrEMBL:G8ZY36"
                     /translation="MTLIALRVRTWIALLFVFLFLQEAKCEETLGKRGLPTLTTTTAS
                     SQSSNYLNLSDSSYSNSTYSNTTTSSQSASVTFVPVIPSSDDNKYVYHTKHMSSTVFV
                     AVGSCMAFIIAVVVVVWILFGIGAWRSARKEYKLKEMEQKYQYDPFFYGNGMETGESS
                     DSDEGSDISEKVLKNKSSRLSLYSLGSTSVLNLLNQAKSDAPEPNATTNNNRRSMFIS
                     PTELLQSEANNSTLWAGDSPVTTSLFDPQASTPSQQSYSQVISFAAGPHAARPQVAQY
                     TDSPAATQSNTKSNYRPPSIVLDQLLDEQNLQA"
     gene            complement(<789063..>791345)
                     /gene="TDEL0G04370"
                     /locus_tag="TDEL_0G04370"
                     /db_xref="GeneID:11505177"
     mRNA            complement(<789063..>791345)
                     /gene="TDEL0G04370"
                     /locus_tag="TDEL_0G04370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682967.1"
                     /db_xref="GeneID:11505177"
     CDS             complement(789063..791345)
                     /gene="TDEL0G04370"
                     /locus_tag="TDEL_0G04370"
                     /inference="similar to DNA sequence:INSDC:YOL006C"
                     /note="similar to Saccharomyces cerevisiae TOP1 (YOL006C);
                     ancestral locus Anc_6.32"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683015.1"
                     /db_xref="GeneID:11505177"
                     /db_xref="GOA:G8ZY37"
                     /db_xref="InterPro:IPR001631"
                     /db_xref="InterPro:IPR008336"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR013030"
                     /db_xref="InterPro:IPR013034"
                     /db_xref="InterPro:IPR013499"
                     /db_xref="InterPro:IPR013500"
                     /db_xref="InterPro:IPR014711"
                     /db_xref="InterPro:IPR014727"
                     /db_xref="InterPro:IPR018521"
                     /db_xref="InterPro:IPR025834"
                     /db_xref="UniProtKB/TrEMBL:G8ZY37"
                     /translation="MTSDLHERSSDEEDTPLAQSGKRRRAAQVTIDEEYDTEDGEYNS
                     DIALSQVSENLNGKTTPEVEEPPKRVRRKVKNETPKKKTTRKLKKIKVESSPKKLTTP
                     KSEEDKSVKEEEDEQEDDGGYKWWEAEKEDDTIKWTTLKHNGVIFPPAYEPLPSHVKL
                     YYDGKPVDLPPKAEEVAGFYAALLQSDHTKNPVFQRNFFDDFLEVLKECGGTLNGIEI
                     KVFSKCDFNKMFEYYELQKEQRKQLSSQEKKQLRLEKEKLEEPYKFCELDGRKEQVGN
                     FRIEPPGLFRGRGAHPKTGKLKRRVYPEDVVLNLDNEAPIPPLPEGQNWGEIRHDNTV
                     QWLAMWRENISNSFKYVRFAANSSLNGLSDFKKFEKARQLKDHIDPIRKDYTKNLKSK
                     IMLERQKSVAIYLIDVFALRAGGEKSEDEADTVGCCSLRYEHVTLKPPTTVIFDFLGK
                     DSIRFYQEVEVDKQVFKNLAIFKRPPKQPGHQLFDRLDPSILNKHLQHYMPGLTAKVF
                     RTYNASKTMQDQLDLIPNEGTVAEKLLKYNAANRTVAILCNHQRSVTKTHAQSVQKAS
                     DKIRELEWQKIRLKKAILQLDKKQMKERPKFFEEVEDITKEDEMAIHKRIIEREVEKC
                     HKKFARDNDKRKFENMELLKESDLKEWLDKVEEQRLNFEQELKTGVVELKMASTVEKL
                     DKQIEKLDQRIQNSAIQLRDKEENSQVSLGTSKINYIDPRLSVVFCKKYGVPIEKIFT
                     KSLREKFKWAVESVDENWRF"
     gene            <792278..>794446
                     /gene="TDEL0G04380"
                     /locus_tag="TDEL_0G04380"
                     /db_xref="GeneID:11505178"
     mRNA            <792278..>794446
                     /gene="TDEL0G04380"
                     /locus_tag="TDEL_0G04380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682968.1"
                     /db_xref="GeneID:11505178"
     CDS             792278..794446
                     /gene="TDEL0G04380"
                     /locus_tag="TDEL_0G04380"
                     /inference="similar to DNA sequence:INSDC:YMR001C"
                     /note="similar to Saccharomyces cerevisiae CDC5 (YMR001C);
                     ancestral locus Anc_6.31"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683016.1"
                     /db_xref="GeneID:11505178"
                     /db_xref="GOA:G8ZY38"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000959"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZY38"
                     /translation="MSLAPLQTVNEKRLNNRSNLVHTPVKGANANNNAGVGIGVSAGL
                     DGKENHRSGSHHHNYQNNNNNKRVEPHGQPPQKKKKEKLSALCKTPPSLIKTRGRDYH
                     RGHFLGEGGFARCFQIKDDSGKIFAAKTVAKLSIKTEKTRKKLLSEIQIHKSMRHANI
                     VQFIDCFEDETNVYILLEICPNGSLMELLKKRKTLTEPEVRFFTTQICGGIKYMHSRR
                     VIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLMGKHSG
                     HSYEVDIWSIGVMIYALLIGKPPFQAKDVNTIYERIKCCDFVFPKEKYISSEARILVQ
                     DLLSLDPLERPSIMEVLDYVWFRGIFPPYIQSDVMTEVPDYEKKITMQESMVNFRTCM
                     ERSGLIDNTESYKNSNDVIPFDNIEMSNQQRQTILPNSLSPGGTRNKYKEVVDLEAQR
                     RLNDLAREARLRRAQQATIKKDLVATSTNLIKSEISLRILASECHLTLNGILEAEAQK
                     RMGGLPQSRLPKIKHPIVVTKWVDYSNKHGFSYQLSTEDIGVLFNNGTTVLRLADAEE
                     FWYISYDDREGWVASHYLLTEKPRELTRHLEVVDFFSKYMRANLSRVSTFVREEYHKD
                     DVFLRRYTRYKQFVMFELSDGTFQFNFKDHNKLAVSEGGKLVTYISPSHESLTYPLVE
                     LLKIGEIPNYPDCNFMEKLALIKEGLKQKSSVVTIEQNQT"
     gene            complement(<794577..>794945)
                     /gene="TDEL0G04390"
                     /locus_tag="TDEL_0G04390"
                     /db_xref="GeneID:11505179"
     mRNA            complement(<794577..>794945)
                     /gene="TDEL0G04390"
                     /locus_tag="TDEL_0G04390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682969.1"
                     /db_xref="GeneID:11505179"
     CDS             complement(794577..794945)
                     /gene="TDEL0G04390"
                     /locus_tag="TDEL_0G04390"
                     /inference="similar to DNA sequence:INSDC:YOL005C"
                     /note="similar to Saccharomyces cerevisiae RPB11
                     (YOL005C); ancestral locus Anc_6.30"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683017.1"
                     /db_xref="GeneID:11505179"
                     /db_xref="GOA:G8ZY39"
                     /db_xref="InterPro:IPR008193"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="UniProtKB/TrEMBL:G8ZY39"
                     /translation="MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGN
                     LIRSELLNDTKVLFAAYKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLK
                     TNFETEWNLQTLASDDNYGI"
     gene            <795501..>799973
                     /gene="TDEL0G04400"
                     /locus_tag="TDEL_0G04400"
                     /db_xref="GeneID:11505180"
     mRNA            <795501..>799973
                     /gene="TDEL0G04400"
                     /locus_tag="TDEL_0G04400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682970.1"
                     /db_xref="GeneID:11505180"
     CDS             795501..799973
                     /gene="TDEL0G04400"
                     /locus_tag="TDEL_0G04400"
                     /inference="similar to DNA sequence:INSDC:YOL004W"
                     /note="similar to Saccharomyces cerevisiae SIN3 (YOL004W);
                     ancestral locus Anc_6.29"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683018.1"
                     /db_xref="GeneID:11505180"
                     /db_xref="GOA:G8ZY40"
                     /db_xref="InterPro:IPR003822"
                     /db_xref="InterPro:IPR013194"
                     /db_xref="UniProtKB/TrEMBL:G8ZY40"
                     /translation="MSGTQGWSQQASSLSAGAGAASASASGGNATTETHNNENGMNQA
                     VETSTVGLTGGKTPEMTKQEIKVESKPHVTLPSISDLSGESAHNGKDGLTSSNTPLRL
                     PSVQSTYGSKAPGAGQEVNGTIMESTVNPAPAQGRQNSVGLSFASFDNPLPPQQQTIL
                     SSSHFQVLPPHQQQQEQQQQMQQQMQHDAYYRPLNVKDALSYLEQVKYQFNSRPDVYN
                     HFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTFLPQGYRIECSANPDEPIR
                     VTTPMGSSSVAGTIENAVAGFPAQPRIQQLQQLGQQQEQSLPEHVLPGVQVTTSATTT
                     PTLNNQQPQPQPRPQLPADYQLPLQPAAGQQSQLPSNDQGKKTADVEFSQAINYVNKI
                     KNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSP
                     SANRQQQQPGVLQQQSPAFGLSAYYNETSPPTSRQNLPPLGSFSPPPNGAVPHNYYRD
                     QQPQTLGLPPVAQVENHIDQRSPPHIATQGIAGEPMPVSNLRSQITAQSPSELAQLHQ
                     QQQIPSQPTANIPDGQYLDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDR
                     AKKFIGNKQIYTEFLKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDK
                     PKHIENIVHEKHRLDLDLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPV
                     WASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMSEEE
                     KATFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDE
                     EWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTN
                     KRMHWLTPKPKDQLDYYVPDKSVFFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVS
                     LFFSIPMYEVNEAVSRRGNLDDDKEDSTQKMESDNLNNSKRPREDEISLSEVLHRAKN
                     QRFKSRAADETSEESAAEPEPELNEEEETIRQEAKKPWLLGNLVEEVNAQGLINNRKT
                     FNMFANTNIYVFFRHLTTLYERLEEVKKMNDAVTKEINSRKVVQFAKDLNLISQQLKE
                     MGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNNKAFKLYTVDKVIQSLVK
                     HAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYRLQVRSYMSSTENMFRIEYNKQS
                     KNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEELQLPFLEKVLETE
                     EDYGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFSRKSVNRFPVIV
                     DSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQEKLARVKENGSLDDFNEAS
                     QTQQASEIIAPSKVEQSKESTVADVNSLPKELVEAEDRGNDTTADEVDPEVVAH"
     gene            complement(<800085..>801230)
                     /gene="TDEL0G04410"
                     /locus_tag="TDEL_0G04410"
                     /db_xref="GeneID:11505181"
     mRNA            complement(<800085..>801230)
                     /gene="TDEL0G04410"
                     /locus_tag="TDEL_0G04410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682971.1"
                     /db_xref="GeneID:11505181"
     CDS             complement(800085..801230)
                     /gene="TDEL0G04410"
                     /locus_tag="TDEL_0G04410"
                     /inference="similar to DNA sequence:INSDC:YOL003C"
                     /note="similar to Saccharomyces cerevisiae PFA4 (YOL003C);
                     ancestral locus Anc_6.28"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683019.1"
                     /db_xref="GeneID:11505181"
                     /db_xref="GOA:G8ZY41"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:G8ZY41"
                     /translation="MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQ
                     CNLALIWLSYYYAIYTNPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVL
                     MMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFH
                     RSELVFLTILTPLDAFVLLTITILLCRCLANQIFNGMSQIETWELERLQALFDSKRLV
                     PLLIEAAWDIFPGTREQINESTAAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPL
                     LWLWPFGRPKGDGMSFVKNEISEYSSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIE
                     SITKQGEQLIRRRPNDTSDLIGRRQWQNDWGENLEDFGVDVDTEQAS"
     gene            802259..802331
                     /gene="TDEL0Gtrna10T"
                     /locus_tag="TDEL_0Gtrna10T"
                     /db_xref="GeneID:11505182"
     tRNA            802259..802331
                     /gene="TDEL0Gtrna10T"
                     /locus_tag="TDEL_0Gtrna10T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:11505182"
     gene            complement(<802412..>803380)
                     /gene="TDEL0G04420"
                     /locus_tag="TDEL_0G04420"
                     /db_xref="GeneID:11505322"
     mRNA            complement(<802412..>803380)
                     /gene="TDEL0G04420"
                     /locus_tag="TDEL_0G04420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682972.1"
                     /db_xref="GeneID:11505322"
     CDS             complement(802412..803380)
                     /gene="TDEL0G04420"
                     /locus_tag="TDEL_0G04420"
                     /inference="similar to DNA sequence:INSDC:YOL002C"
                     /note="similar to Saccharomyces cerevisiae IZH2 (YOL002C);
                     ancestral locus Anc_6.27"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683020.1"
                     /db_xref="GeneID:11505322"
                     /db_xref="GOA:G8ZY42"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="UniProtKB/TrEMBL:G8ZY42"
                     /translation="MSDSLKKRSQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRK
                     LYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFV
                     LCFDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDY
                     LGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYR
                     AAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKY
                     APGKYDIWGHSHQLFHVLVVVAALCHLYGLIKSYNLVHLKMAIAQL"
     gene            <804428..>805471
                     /gene="TDEL0G04430"
                     /locus_tag="TDEL_0G04430"
                     /db_xref="GeneID:11505183"
     mRNA            <804428..>805471
                     /gene="TDEL0G04430"
                     /locus_tag="TDEL_0G04430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682973.1"
                     /db_xref="GeneID:11505183"
     CDS             804428..805471
                     /gene="TDEL0G04430"
                     /locus_tag="TDEL_0G04430"
                     /inference="similar to DNA sequence:INSDC:YOL001W"
                     /note="similar to Saccharomyces cerevisiae PHO80
                     (YOL001W); ancestral locus Anc_6.26"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683021.1"
                     /db_xref="GeneID:11505183"
                     /db_xref="GOA:G8ZY43"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:G8ZY43"
                     /translation="MQAIEDAEVTVAARDKPIPSESSKEGTDEISTIYLPRKFSKCSR
                     TDLAVLISRMLTFLIQINDSLALSKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSL
                     EHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVG
                     GVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKFTLYEEPEMGQNSRPQNS
                     LKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNYVLRPSSPIKDGSRDSTHDHALSS
                     QTSLESISTRTINSDSKPKSHEDEEPSARKRNLDSEAHPNGKDKVPSPGESKLKKMTN
                     NQRTPNINHHSYS"
     gene            <805881..>808088
                     /gene="TDEL0G04440"
                     /locus_tag="TDEL_0G04440"
                     /db_xref="GeneID:11505184"
     mRNA            <805881..>808088
                     /gene="TDEL0G04440"
                     /locus_tag="TDEL_0G04440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682974.1"
                     /db_xref="GeneID:11505184"
     CDS             805881..808088
                     /gene="TDEL0G04440"
                     /locus_tag="TDEL_0G04440"
                     /inference="similar to DNA sequence:INSDC:YOR001W"
                     /note="similar to Saccharomyces cerevisiae RRP6 (YOR001W);
                     ancestral locus Anc_6.25"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683022.1"
                     /db_xref="GeneID:11505184"
                     /db_xref="GOA:G8ZY44"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR012588"
                     /db_xref="UniProtKB/TrEMBL:G8ZY44"
                     /translation="MPPAEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDE
                     TSTRMVSLINSLLSSIDQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRA
                     PGSRKDGEKLKFLDNSSSNDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALR
                     PLISDIVPGNDAVPEHYAQPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIE
                     VLKTMISDLKSVTEIAVDLEHHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILN
                     EVFANPKILKVFHGAFMDIIWLQRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFA
                     NFKTSKKYQLADWRLRPLSKAMNAYARADTHFLLNIYDQLRNTLIEQNKLAGVLAESR
                     NVAKRRFEYSKFRPIAPSPTVYCPIDKPDPWKVLMFQYSISPNREELVKKLYDWRDTI
                     ARRDDESPRYVMPNQLLVELARQAPTEPINVISVNSIVTDHVRSNSLVLAHLIKNTLA
                     SSDKESDKGTFEADNNSTDAASLLTVPQIQKLAACFAGVSRAFTILQNEYKDGRSSSI
                     FTDILTSEDDAVNYVGNNMDHITKKELGKRAAKALQSMEQFDEATSYYMPIPEIAKES
                     NTMEEIRPPAPEEVKESPSPPKEDMDEIITLKKIKKQKSQSPKELGISEREIPAVDYT
                     KTKKVLATNQDKNKDKKKRKFDPYAASNHSSDAPRAPKKRKPVNRERNVSFKR"
     gene            complement(<808210..>808836)
                     /gene="TDEL0G04450"
                     /locus_tag="TDEL_0G04450"
                     /db_xref="GeneID:11505185"
     mRNA            complement(<808210..>808836)
                     /gene="TDEL0G04450"
                     /locus_tag="TDEL_0G04450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682975.1"
                     /db_xref="GeneID:11505185"
     CDS             complement(808210..808836)
                     /gene="TDEL0G04450"
                     /locus_tag="TDEL_0G04450"
                     /inference="similar to DNA sequence:INSDC:YML001W"
                     /note="similar to Saccharomyces cerevisiae YPT7 (YML001W);
                     ancestral locus Anc_6.24"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683023.1"
                     /db_xref="GeneID:11505185"
                     /db_xref="GOA:G8ZY45"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZY45"
                     /translation="MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGAD
                     FLTKEVVLDDDKVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNVKSFENIKS
                     WRDEFLVHANVSSPETFPFVILGNKIDVEESKKVVNTKSAQDLAKSLGNVPLFFTSAK
                     NAINVDTAFEEIGRSALQQNQADADAFEEDFNDAINIQLDGEPSSCSC"
     gene            <809440..>810549
                     /gene="TDEL0G04460"
                     /locus_tag="TDEL_0G04460"
                     /db_xref="GeneID:11505186"
     mRNA            <809440..>810549
                     /gene="TDEL0G04460"
                     /locus_tag="TDEL_0G04460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682976.1"
                     /db_xref="GeneID:11505186"
     CDS             809440..810549
                     /gene="TDEL0G04460"
                     /locus_tag="TDEL_0G04460"
                     /note="ancestral locus Anc_6.23"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683024.1"
                     /db_xref="GeneID:11505186"
                     /db_xref="InterPro:IPR003829"
                     /db_xref="InterPro:IPR008778"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR012093"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:G8ZY46"
                     /translation="MLMTKKNSKKNICRNQCYGYKLGLLLLALWLGIRFSLLEESITS
                     RKIITDFISQSETMSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLML
                     DHFTVSPPAGFPDHPHHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIH
                     SEIPVKMDSGQPAVGLQLWVDLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGT
                     SYGVQSARDLAYTPVHYYHFATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQF
                     STVFFDTDGDAVEGFSASDNAEFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQN
                     SINGFDRGRNWRSTIAGGITESEAKKDFRNSKGIK"
     gene            <810734..>812362
                     /gene="TDEL0G04470"
                     /locus_tag="TDEL_0G04470"
                     /db_xref="GeneID:11505187"
     mRNA            <810734..>812362
                     /gene="TDEL0G04470"
                     /locus_tag="TDEL_0G04470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682977.1"
                     /db_xref="GeneID:11505187"
     CDS             810734..812362
                     /gene="TDEL0G04470"
                     /locus_tag="TDEL_0G04470"
                     /inference="similar to DNA sequence:INSDC:YOR002W"
                     /note="similar to Saccharomyces cerevisiae ALG6 (YOR002W);
                     ancestral locus Anc_6.22"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683025.1"
                     /db_xref="GeneID:11505187"
                     /db_xref="GOA:G8ZY47"
                     /db_xref="InterPro:IPR004856"
                     /db_xref="UniProtKB/TrEMBL:G8ZY47"
                     /translation="MAPKNKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVL
                     FALIIGCAVGHGSYSGQFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPP
                     LTAYHSYVLGKIGSFIKPEWFELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFT
                     KWLGKHRQKSPIGQFISAAAILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYA
                     VAAICFVLSICFKQMALYYAPIFFAYLLSKSLFSPRFNFPRLFAIAVATVLSFAAMYA
                     PLYIFGGGLANVIQSVHRIFPFARGIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSL
                     IATMLGFLPAVIVIFLYPKKHIICYALATCSMSFYLFSFQVHEKTILVPLLPITLLYT
                     SSNWDVLSMANWINNVGLFTLYPLLKKDGLTLQYFVCFTLSNWLLGNFSFVTPKFLPK
                     FLTPGPSVSSVDINYRRRSFLPSNVIWKIIIVSSYTAMGVLHVVDFVMGPPVSYPDLW
                     VLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQQL"
     gene            813279..813351
                     /gene="TDEL0Gtrna10R"
                     /locus_tag="TDEL_0Gtrna10R"
                     /db_xref="GeneID:11505188"
     tRNA            813279..813351
                     /gene="TDEL0Gtrna10R"
                     /locus_tag="TDEL_0Gtrna10R"
                     /product="tRNA-Arg"
                     /note="codon recognized: CGU"
                     /db_xref="GeneID:11505188"
     gene            <813648..>814679
                     /gene="TDEL0G04480"
                     /locus_tag="TDEL_0G04480"
                     /db_xref="GeneID:11505321"
     mRNA            <813648..>814679
                     /gene="TDEL0G04480"
                     /locus_tag="TDEL_0G04480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682978.1"
                     /db_xref="GeneID:11505321"
     CDS             813648..814679
                     /gene="TDEL0G04480"
                     /locus_tag="TDEL_0G04480"
                     /inference="similar to DNA sequence:INSDC:YOR007C"
                     /note="similar to Saccharomyces cerevisiae SGT2 (YOR007C);
                     ancestral locus Anc_6.21"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683026.1"
                     /db_xref="GeneID:11505321"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G8ZY48"
                     /translation="MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESF
                     EVQKGDSKAVFGGKGLVELLQNESGSSSETATTQAESIKVNIPAEDAETKAKAETLKL
                     EGNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKT
                     DPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSL
                     DLEKKPETQARGADAGAGGAGGSGGFGDFASMLGGGLGGLLNNPQLMQAAQQMMQNPQ
                     AMSQMESMMQNPGVRQMAENFAQGNGMPNMGDLMNNPALRDMAGSLFGGANGNAPNDV
                     PKNSDNGSN"
     gene            complement(<814781..>818062)
                     /gene="TDEL0G04490"
                     /locus_tag="TDEL_0G04490"
                     /db_xref="GeneID:11505189"
     mRNA            complement(<814781..>818062)
                     /gene="TDEL0G04490"
                     /locus_tag="TDEL_0G04490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682979.1"
                     /db_xref="GeneID:11505189"
     CDS             complement(814781..818062)
                     /gene="TDEL0G04490"
                     /locus_tag="TDEL_0G04490"
                     /inference="similar to DNA sequence:INSDC:YML002W"
                     /note="similar to Saccharomyces cerevisiae YML002W;
                     ancestral locus Anc_6.20"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683027.1"
                     /db_xref="GeneID:11505189"
                     /db_xref="GOA:G8ZY49"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="InterPro:IPR020675"
                     /db_xref="InterPro:IPR020679"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8ZY49"
                     /translation="MPYHLPVLLNPLVNAVFNCPNPSTSNLKKLFSNLKDRKFILLVP
                     PCDRLLDCNDKLSGSPLQELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGK
                     KVIVRSQNRIILTSDGFQVKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESV
                     RTQRVQISQTLGSGKRETKDGSSPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYR
                     STPEGDDPHIELFHDIIRRAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITH
                     HFKDSEVESNGLRYLSLHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAH
                     AHADKAMYLIDTLRNLSRVDKSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFY
                     LQNFAKNETSITFGVLGYAISTLEAAVCYFDELKGSKKMSRLESECENARSLVDKLSS
                     ESSSVNLIHYQKTLSYRTEQGESLLSICIANGKNDILQELLSDERSFPLEDILEDQTT
                     EGCTLLMQSLKCGNGDAASLIVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINI
                     LEQIGNFFDWDVKDSSGHTALFTIFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFT
                     VHEDRKENTLLHILKRSISILLEYESVDVNARNRKGLTPLMVYAKYNRLDNTKSILTD
                     KRVILGKIQHPLLLCSIDYAKNPLILHEIAKQSAMDTAFGKCFVHTLKYESSSWLVNI
                     TVQADRKGNFETVEFHLKTVQNFFRTVLRTCPMTFLPLDSTLNQLASLGKARLSSIGK
                     LETVCYLRSLTNCFNVLINSQELPKDILANESKLLSWIKVQYKAFRNGTTHIFSKKVE
                     PEEMSIIQGFLRFNQAELSTLRSKLHVMKKLAIFLRLKSSDVEQSVELLLPLGSEGMG
                     DLYPLTDHKFSCTTVYGNDSMILLVEDIDLMLKCTIRLYDHINNLLQVKIPEWWKLYG
                     ELLNFRKQYAQNFPHLVKNGETSTDAGIIGKILEGKKEKLEKRLSFSIAETRRSMNQA
                     GAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWVRENIKELKERLIHIQRDLRNISG
                     QKLRS"
     gene            <818321..>819226
                     /gene="TDEL0G04500"
                     /locus_tag="TDEL_0G04500"
                     /db_xref="GeneID:11505190"
     mRNA            <818321..>819226
                     /gene="TDEL0G04500"
                     /locus_tag="TDEL_0G04500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682980.1"
                     /db_xref="GeneID:11505190"
     CDS             818321..819226
                     /gene="TDEL0G04500"
                     /locus_tag="TDEL_0G04500"
                     /inference="similar to DNA sequence:INSDC:YOR006C"
                     /note="similar to Saccharomyces cerevisiae YOR006C;
                     ancestral locus Anc_6.19"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683028.1"
                     /db_xref="GeneID:11505190"
                     /db_xref="GOA:G8ZY50"
                     /db_xref="InterPro:IPR007177"
                     /db_xref="InterPro:IPR007209"
                     /db_xref="InterPro:IPR022968"
                     /db_xref="UniProtKB/TrEMBL:G8ZY50"
                     /translation="MSKGKNKNREAKNGHSGKGSNGHSSRQNHKRMEMKRGTEDTKFP
                     VKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVE
                     EHGASVVECSWARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFA
                     IVGRMDWASELLSHFSWGLGFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEE
                     RKSQAKDEDIWMTGNVNRKGTTFLDDNEEEESSEVEESDEEEDNGKTLRYDRLGNLIE
                     SDSGDEESSEEELEEAGGSVEKVYI"
     gene            <819479..>822388
                     /gene="TDEL0G04510"
                     /locus_tag="TDEL_0G04510"
                     /db_xref="GeneID:11505191"
     mRNA            <819479..>822388
                     /gene="TDEL0G04510"
                     /locus_tag="TDEL_0G04510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682981.1"
                     /db_xref="GeneID:11505191"
     CDS             819479..822388
                     /gene="TDEL0G04510"
                     /locus_tag="TDEL_0G04510"
                     /inference="similar to DNA sequence:INSDC:YOR005C"
                     /note="similar to Saccharomyces cerevisiae DNL4 (YOR005C);
                     ancestral locus Anc_6.18"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683029.1"
                     /db_xref="GeneID:11505191"
                     /db_xref="GOA:G8ZY51"
                     /db_xref="InterPro:IPR000977"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR012308"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR016059"
                     /db_xref="InterPro:IPR029710"
                     /db_xref="UniProtKB/TrEMBL:G8ZY51"
                     /translation="MESAEILTSTHEVSQELQESESTEKAPPNFAPSPDFIWLCEELF
                     VKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLWRKTVGNNIFPALVLSLPYRDRRIY
                     NIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRGVRLSNFCVEEIRKRKSEPSPG
                     RRITIDKLNECLDHLVEERNAKGGFKGLSDSPTFNFCLQNMSFIELRFFFDIVLKNRV
                     IGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEHRLRRDDLSINLGYAFVPQLA
                     KKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYTQLYGENL
                     QSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGICSQGH
                     RPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIRKSL
                     EKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPGKKDS
                     LMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIANGIS
                     QQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDNTE
                     SSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKSSTGVGSFNKQYSKKM
                     KSKKRKIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSEFDDLILQ
                     NSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRMVVKL
                     EPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNMKQTEPNLMREANSE
                     LDVVPLFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDIPSCNLIIMPNENQR
                     LGTQSLVEMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDFTPVYA"
     gene            <822826..>824865
                     /gene="TDEL0G04520"
                     /locus_tag="TDEL_0G04520"
                     /db_xref="GeneID:11505192"
     mRNA            <822826..>824865
                     /gene="TDEL0G04520"
                     /locus_tag="TDEL_0G04520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682982.1"
                     /db_xref="GeneID:11505192"
     CDS             822826..824865
                     /gene="TDEL0G04520"
                     /locus_tag="TDEL_0G04520"
                     /inference="similar to DNA sequence:INSDC:YEL062W"
                     /note="similar to Saccharomyces cerevisiae NPR2 (YEL062W);
                     ancestral locus Anc_6.17"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683030.1"
                     /db_xref="GeneID:11505192"
                     /db_xref="InterPro:IPR009348"
                     /db_xref="UniProtKB/TrEMBL:G8ZY52"
                     /translation="MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFD
                     AIKNYIIPKPQLCHKLLTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTS
                     PYEPAIARLGKMFKVLEEQNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLS
                     KSQAYASEKYHKIMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIF
                     PMMTPPNSNISIEDVPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDP
                     GLVIECIKHLIYYNCVLLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDST
                     LPRLPFKRVNHSATESVDHELADSHRSQRTSGSRTTSMSSNGKFFPSSNNEMPALISE
                     ESLYRTGKHSQSSFSSNNTNPSNMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGT
                     IRANRIDVRRFITFGVINGLIYRCYSYPIMKNLEIFDLAKRLHREDISNHTVKHNKAK
                     NPSKNIFSTSDIKFGVEYERQRNKHHKALNLDIADEVLRNVYKKLSVTNSTDTRPNSA
                     DPIARLYRERSLGSLADGSTNNIYRLQNSDRPSKVSFDKQQEIGHISKGMSSSNDKVK
                     MDEEAKLERRERDLILLESVEAADSLDTICVKLEMSRYDVEALIQNLGEYKIINS"
     gene            complement(<824970..>827846)
                     /gene="TDEL0G04530"
                     /locus_tag="TDEL_0G04530"
                     /db_xref="GeneID:11505193"
     mRNA            complement(<824970..>827846)
                     /gene="TDEL0G04530"
                     /locus_tag="TDEL_0G04530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682983.1"
                     /db_xref="GeneID:11505193"
     CDS             complement(824970..827846)
                     /gene="TDEL0G04530"
                     /locus_tag="TDEL_0G04530"
                     /inference="similar to DNA sequence:INSDC:YEL061C"
                     /note="similar to Saccharomyces cerevisiae CIN8 (YEL061C);
                     ancestral locus Anc_6.16"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683031.1"
                     /db_xref="GeneID:11505193"
                     /db_xref="GOA:G8ZY53"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:G8ZY53"
                     /translation="MVAMPQASGEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDV
                     TGSNEVSINTTGDVGITAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNC
                     TVLVYGMTSTGKTYTMTGDEKLYDGELSESAGIIPRILFKLFETLELQKEDYVVKCSF
                     VELYNEELKDLLGDSQEIASSRKLRIFDSNTMSAATNSMSTGNSTKNSRNNSPRSSSE
                     LPTATFLRKRWKTAPSVTQSHQNSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHR
                     QVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAK
                     EAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKI
                     NSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIY
                     MSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRIKLQNM
                     RDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDLFN
                     NEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCV
                     EKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFFKNN
                     HEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEM
                     QLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLGSSQEAINKTITKVKE
                     QMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSDHADAVDKLKEAID
                     HVVSERGSSMEGERVEHVDGILRRMDEQNLLYLDRSPLRPANFKMNKSERNSPNRSSP
                     CKSVSHSPCKQPVCHPRINYKRSLTDLNDGQEEGLNKLSRHRCG"
     gene            complement(<828055..>828792)
                     /gene="TDEL0G04540"
                     /locus_tag="TDEL_0G04540"
                     /db_xref="GeneID:11505194"
     mRNA            complement(<828055..>828792)
                     /gene="TDEL0G04540"
                     /locus_tag="TDEL_0G04540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682984.1"
                     /db_xref="GeneID:11505194"
     CDS             complement(828055..828792)
                     /gene="TDEL0G04540"
                     /locus_tag="TDEL_0G04540"
                     /inference="similar to DNA sequence:INSDC:YOR004W"
                     /note="similar to Saccharomyces cerevisiae UTP23
                     (YOR004W); ancestral locus Anc_6.15"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683032.1"
                     /db_xref="GeneID:11505194"
                     /db_xref="GOA:G8ZY54"
                     /db_xref="InterPro:IPR006984"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:G8ZY54"
                     /translation="MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFD
                     LVKGLQRTLQAEVKVMITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIEC
                     LESIVCVNGHNKHRYVVASQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSS
                     AAEAEKLHKGLNDPRNAGIKTENPQTSIKKRTKQPNPLSVKKRKTESKGEPKAAQDTE
                     PVASNTKKRRRKHKSSTTEPQGQEEST"
     gene            complement(<829468..>831162)
                     /gene="TDEL0G04550"
                     /locus_tag="TDEL_0G04550"
                     /db_xref="GeneID:11505195"
     mRNA            complement(<829468..>831162)
                     /gene="TDEL0G04550"
                     /locus_tag="TDEL_0G04550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682985.1"
                     /db_xref="GeneID:11505195"
     CDS             complement(829468..831162)
                     /gene="TDEL0G04550"
                     /locus_tag="TDEL_0G04550"
                     /inference="similar to DNA sequence:INSDC:YEL060C,YOR003W"
                     /note="similar to Saccharomyces cerevisiae PRB1 (YEL060C)
                     and YSP3 (YOR003W); ancestral locus Anc_6.14"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683033.1"
                     /db_xref="GeneID:11505195"
                     /db_xref="GOA:G8ZY55"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR009020"
                     /db_xref="InterPro:IPR010259"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR022398"
                     /db_xref="InterPro:IPR023827"
                     /db_xref="InterPro:IPR023828"
                     /db_xref="UniProtKB/TrEMBL:G8ZY55"
                     /translation="MRFEQTVLPVAALASLGAALVIPELKGKVLCHGKDKALDHPKDK
                     ALDHPRERPQHRGPRRGPRRGPPPPLPEGRHDGPSHEGHHDALPEHRGIVHKMGEGVA
                     PLSIPPNAFPHRYIVVLKHSSPEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRTT
                     GGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGL
                     SRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDE
                     DLDGNGHGTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQSHQK
                     AVKDKKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAA
                     AEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPH
                     VAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIY
                     NGGGHGLKGFWDGHDKQEANTRFQDTDLQELSDNLGAKTDALFDQVRDVLDRLNII"
     gene            <831920..>833368
                     /gene="TDEL0G04560"
                     /locus_tag="TDEL_0G04560"
                     /db_xref="GeneID:11505196"
     mRNA            <831920..>833368
                     /gene="TDEL0G04560"
                     /locus_tag="TDEL_0G04560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682986.1"
                     /db_xref="GeneID:11505196"
     CDS             831920..833368
                     /gene="TDEL0G04560"
                     /locus_tag="TDEL_0G04560"
                     /inference="similar to DNA sequence:INSDC:YOR177C"
                     /note="similar to Saccharomyces cerevisiae MPC54
                     (YOR177C); ancestral locus Anc_6.69"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683034.1"
                     /db_xref="GeneID:11505196"
                     /db_xref="UniProtKB/TrEMBL:G8ZY56"
                     /translation="MSTSLCTRTTAETDPYYIEESSTKIYQNLYNDENHSNARPQDYI
                     TGPLEIKGVNYAVEKALRDFEREGRKDRKALRYITNKKIVGISSQTGSLPLTRPATKY
                     VVKKVTFGLSSVVHFEESDIVPKKSVGGPIRGKSILKRSSFNSPSTDYEKIGRRELQN
                     AIARIYNLCDLPFTLFRKDDPLLSLELLARGVCNAFKSHEICWKKVGEEELLELKEKI
                     NNLETENETKERELNHFKQELYNDLNRLIPEEQVLKIPDISYGIVKTGIAKIEHISTK
                     WKLRAASCENNDLREENEALREENAELRKGLLGQRDISELLVETKISEKKTIIRTRPI
                     NSRIKGVNDERSTVNELILKRLLKASQKSNETLAGEYKELKDLQDSLYEKVHSLKVFL
                     GAMKQAFCNSISREKALERVNLKLISELEGYRFQNDQLKENSVASELELNIRIEQRKN
                     ETHGNSTRISVLIRVLEGVIGELQTPSDPEEI"
     gene            <835369..>835998
                     /gene="TDEL0G04570"
                     /locus_tag="TDEL_0G04570"
                     /db_xref="GeneID:11505197"
     mRNA            <835369..>835998
                     /gene="TDEL0G04570"
                     /locus_tag="TDEL_0G04570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682987.1"
                     /db_xref="GeneID:11505197"
     CDS             835369..835998
                     /gene="TDEL0G04570"
                     /locus_tag="TDEL_0G04570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683035.1"
                     /db_xref="GeneID:11505197"
                     /db_xref="UniProtKB/TrEMBL:G8ZY57"
                     /translation="MYYPIFAILALICKVILCEEYPFDECNALKRDTLSASTQIPGTT
                     FQLIDAPTVESISNRSTEDAAAMNSTAIGTTDISKHYDIGPSRRDTLWGGPILQWSCN
                     ARHSIGGGIASFKSTVLSFYNRIGPNSPRFICLQSQGNNLCVSWAIYNPNQLPDGFFA
                     HKIKFASECLAAGRRAQVKVSTSDYLEYACVSDRCAKKLTTMTRPHLTK"
     gene            complement(<836367..>837821)
                     /gene="TDEL0G04580"
                     /locus_tag="TDEL_0G04580"
                     /db_xref="GeneID:11505198"
     mRNA            complement(<836367..>837821)
                     /gene="TDEL0G04580"
                     /locus_tag="TDEL_0G04580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682988.1"
                     /db_xref="GeneID:11505198"
     CDS             complement(836367..837821)
                     /gene="TDEL0G04580"
                     /locus_tag="TDEL_0G04580"
                     /inference="similar to DNA sequence:INSDC:YPL262W"
                     /note="similar to Saccharomyces cerevisiae FUM1 (YPL262W);
                     ancestral locus Anc_6.13"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683036.1"
                     /db_xref="GeneID:11505198"
                     /db_xref="GOA:G8ZY58"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR005677"
                     /db_xref="InterPro:IPR008948"
                     /db_xref="InterPro:IPR018951"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="InterPro:IPR022761"
                     /db_xref="InterPro:IPR024083"
                     /db_xref="UniProtKB/TrEMBL:G8ZY58"
                     /translation="MLRTGLLSRPLSVVKMSTKAGQFRVETDAFGEIKVAADRYWGAQ
                     TQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNESLGTLDPKVAEPIKQAADEVA
                     QGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKQIHPNNHCNQAQSS
                     NDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLG
                     QEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIGFAEKIAEQVSKETGL
                     DFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPEN
                     EPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSS
                     VRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAASKVAKNAHK
                     KGITLKQSALDLGVLTESEFDEWVVPENMIGPKP"
     gene            complement(<838052..>838276)
                     /gene="TDEL0G04590"
                     /locus_tag="TDEL_0G04590"
                     /db_xref="GeneID:11505199"
     mRNA            complement(<838052..>838276)
                     /gene="TDEL0G04590"
                     /locus_tag="TDEL_0G04590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682989.1"
                     /db_xref="GeneID:11505199"
     CDS             complement(838052..838276)
                     /gene="TDEL0G04590"
                     /locus_tag="TDEL_0G04590"
                     /inference="similar to DNA sequence:INSDC:YEL059C-A"
                     /note="similar to Saccharomyces cerevisiae SOM1
                     (YEL059C-A); ancestral locus Anc_6.12"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683037.1"
                     /db_xref="GeneID:11505199"
                     /db_xref="GOA:G8ZY59"
                     /db_xref="InterPro:IPR024645"
                     /db_xref="UniProtKB/TrEMBL:G8ZY59"
                     /translation="MAPPTPVLAREELPEIPQSKNCVLKSLTQFQCQLRPAGSGLYEC
                     VPFKRLFQECRDPSGRFKSRIEVTSPLTNH"
     gene            <838381..>839967
                     /gene="TDEL0G04600"
                     /locus_tag="TDEL_0G04600"
                     /db_xref="GeneID:11505200"
     mRNA            <838381..>839967
                     /gene="TDEL0G04600"
                     /locus_tag="TDEL_0G04600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682990.1"
                     /db_xref="GeneID:11505200"
     CDS             838381..839967
                     /gene="TDEL0G04600"
                     /locus_tag="TDEL_0G04600"
                     /inference="similar to DNA sequence:INSDC:YEL058W"
                     /note="similar to Saccharomyces cerevisiae PCM1 (YEL058W);
                     ancestral locus Anc_6.11"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683038.1"
                     /db_xref="GeneID:11505200"
                     /db_xref="GOA:G8ZY60"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="InterPro:IPR016657"
                     /db_xref="UniProtKB/TrEMBL:G8ZY60"
                     /translation="MREPLESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIV
                     ACLRSQVLNGKPVGVMITASHNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRP
                     LEDIKAKVGQLTSGESSVRPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLT
                     TPQLHFLTNETMITGAHVDEQAYFAHFLGAWDQIAALQPVKLPNVVVDCANGIGGPKM
                     SALLTQWGFAKQCSVINDKCDEPELLNHGCGADFVKTSQRLPNGVKPNANDLYCSFDG
                     DADRVVFYYLDQNLGFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGS
                     STKYLQDNLQVPVSCTKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNH
                     ADQTPELKILKYLAKLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTK
                     VVVSDRSAFTTTDQERRLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAA
                     TQSEKDQLSSIVGDLVREYC"
     gene            <840098..>841999
                     /gene="TDEL0G04610"
                     /locus_tag="TDEL_0G04610"
                     /db_xref="GeneID:11505201"
     mRNA            <840098..>841999
                     /gene="TDEL0G04610"
                     /locus_tag="TDEL_0G04610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682991.1"
                     /db_xref="GeneID:11505201"
     CDS             840098..841999
                     /gene="TDEL0G04610"
                     /locus_tag="TDEL_0G04610"
                     /inference="similar to DNA sequence:INSDC:YPL263C"
                     /note="similar to Saccharomyces cerevisiae KEL3 (YPL263C);
                     ancestral locus Anc_6.10"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683039.1"
                     /db_xref="GeneID:11505201"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="InterPro:IPR025183"
                     /db_xref="UniProtKB/TrEMBL:G8ZY61"
                     /translation="MAKKNKKDKEAKKARAELKSKKSQGKAAEKEKKKSKKLLGAEED
                     DDLDIEQVLANFKKEQEQFEKVVVENIERPSRRINPSMIANPIHGKSELIMFGGEHTI
                     QSTSTTHFFNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPK
                     QNTFYHYSDTWLLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTT
                     YLNDCWLFDITTYKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQ
                     KGKILTDCWYLKMSSNTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEE
                     TEESLESNFYNDVFTYQINMNRWYSLSLRPQRKKQVKLNNRSTKDQEKELEDLLNKIL
                     RNAQLDDQGEEEEIDAAEESTAVEEDSDESESLDKEHVIMNELPHPRFNAATAVVDDT
                     LFIFGGVWEFGEKDYSIDSFYGIDLNKADGVTVYWEDLTALENAKDEDDSDEDEGEED
                     DDDEEDSEEEQVDQKLVAEDEDEEEEEFEEEEMEIPDPRPWLPHPKAFESLRSFYVRT
                     GATFLEWAISNNRHVKGKHLKTKSFEICESRWWERRDQVRLEEDKLEELGGVGEIIER
                     DTTKTKKRR"
     gene            <842202..>843380
                     /gene="TDEL0G04620"
                     /locus_tag="TDEL_0G04620"
                     /db_xref="GeneID:11505202"
     mRNA            <842202..>843380
                     /gene="TDEL0G04620"
                     /locus_tag="TDEL_0G04620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682992.1"
                     /db_xref="GeneID:11505202"
     CDS             842202..843380
                     /gene="TDEL0G04620"
                     /locus_tag="TDEL_0G04620"
                     /inference="similar to DNA sequence:INSDC:YEL056W"
                     /note="similar to Saccharomyces cerevisiae HAT2 (YEL056W);
                     ancestral locus Anc_6.9"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683040.1"
                     /db_xref="GeneID:11505202"
                     /db_xref="GOA:G8ZY62"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR022052"
                     /db_xref="UniProtKB/TrEMBL:G8ZY62"
                     /translation="MAEEQVDKPLSIDEEYELWRSNVPLMYDFVSETNLTWPTLTLEW
                     LPGNSHSNRQELILGTHTSEEEPNYLKIAAIDLPDEIVPGKEDRERDGFTKSNIKIIK
                     KFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLS
                     FNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSV
                     SEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTG
                     NVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPE
                     VVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKLPRVGGLPKVDDSVLE
                     "
     gene            complement(<843474..>844985)
                     /gene="TDEL0G04630"
                     /locus_tag="TDEL_0G04630"
                     /db_xref="GeneID:11505203"
     mRNA            complement(<843474..>844985)
                     /gene="TDEL0G04630"
                     /locus_tag="TDEL_0G04630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682993.1"
                     /db_xref="GeneID:11505203"
     CDS             complement(843474..844985)
                     /gene="TDEL0G04630"
                     /locus_tag="TDEL_0G04630"
                     /inference="similar to DNA sequence:INSDC:YPL272C"
                     /note="similar to Saccharomyces cerevisiae YPL272C;
                     ancestral locus Anc_6.8"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683041.1"
                     /db_xref="GeneID:11505203"
                     /db_xref="GOA:G8ZY63"
                     /db_xref="InterPro:IPR010828"
                     /db_xref="UniProtKB/TrEMBL:G8ZY63"
                     /translation="MSFRSLGGFEKKILSQSLEGHRNGVVFGAMYSTTPEEWSDDATL
                     LTYKDSRLNLSLLSRTLAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYK
                     DEFVNCRFGAPPYLLRHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAA
                     NFHKIFLQTLNSISKSGSKLSTIFKLEKAVLPPFPKSIYDNAKLRLPAKAADLFNLQT
                     QSFFKSLYFNAVKKPLDYINSNPPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRL
                     ESLDCIFKQQNICLKSFVCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMF
                     YKDIRVECPLSLIDDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVV
                     AALRQRMKAWEKFGFNDDDIKRMKFGSDDTATNTKLIQINDVSDIPVDAHEDISGKFH
                     MRELNMTQSLKPGQLMSLSYTHSEKGLDICIHYPDGYNMESFVECFQSFIEDA"
     gene            complement(<845491..>848544)
                     /gene="TDEL0G04640"
                     /locus_tag="TDEL_0G04640"
                     /db_xref="GeneID:11505283"
     mRNA            complement(<845491..>848544)
                     /gene="TDEL0G04640"
                     /locus_tag="TDEL_0G04640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682994.1"
                     /db_xref="GeneID:11505283"
     CDS             complement(845491..848544)
                     /gene="TDEL0G04640"
                     /locus_tag="TDEL_0G04640"
                     /inference="similar to DNA sequence:INSDC:YEL055C"
                     /note="similar to Saccharomyces cerevisiae POL5 (YEL055C);
                     ancestral locus Anc_6.7"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683042.1"
                     /db_xref="GeneID:11505283"
                     /db_xref="GOA:G8ZY64"
                     /db_xref="InterPro:IPR007015"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZY64"
                     /translation="MTGRVNRDWFYKLASDLQEERVQAAVALIQELSALDLPDGASEW
                     SYVLKRLINGLSSSRNSARLGFSLCLTEVINLALNLEGDRPEELSSIDTFLDLLSSTL
                     SLQPSGQDSKKQIKGKDERGLLFGKMFGLQALLSEPLFEKVFISKEKGISDFALRFMD
                     ELCQLAVFKSWLREPCLFTLFQAYERILPLADIETAQVVLRLLDQYQLTLTNEGLAIY
                     LLLLYKSPRDYSSSILQMDFESKSWKSNDPLARGNLPLLSQVLRDSSVATEDESSPKA
                     SNWTPRLHFVWDILLPIITQDNSRRESEDRKPKTKKRKKEKATAIQFPEFWQMAVDES
                     MFNEKASTERKFLGLVIFQKALEVTPHKLVGCCFSQNVMRTLINHASDSKRLLFKISL
                     KVLNSIVDICKKRPKEKLVPCLSAILFGPHGSINFDKLTKSKTATNLLAVNGLDETAL
                     NELFGLLSSNLIESSLVEQKNQQFILDTMLHAVRSHKSELNKDIIVTSILRPIISLAF
                     FTVKDEHTSNLAKERFYSILSEITHLNNEGPSYQNMALDIIRDEIAAGKELTTKLDDT
                     LEDVKSEALRTLQAISNNEKNPQLRGLEMLISMCLLQLYSGESEAVSVIEELCAFYQD
                     TDENSTSLVGITEILLSLLAQKKAVLRKLSLSAWQQFVSEIGEAELKALLDVLPAREN
                     KKGFSQLFEGEDDFEEAEEEFDEDAEKDNEEDNEEESEEDEESEEDDLSSSTGEDSNE
                     NQDDVAKIDKEATSALAKALNLPDNIVNDKGEVDLNNWDDGADDVADDGADDEVDGEE
                     DEDEDEDSMDDEKMMELDDQLSQIFKRRKDALSNISTGNQRKNEAKESREDVIAFKQR
                     VIDMLEIYVKFVEKQSLKEENYSKISSCLLLLEPMIKCIQQTTDKSLANRIAKLLRTK
                     VFKLKTSAFCGSCDQDELMEMLRMTHEKIQTLKPGQHQAIYYSVCSTASLFLTKIIIE
                     NSDSKDAAVHDIIDLYAETMKQWASNGKFGPNIFIDFSNWLSSRK"
     gene            <850149..>850337
                     /gene="TDEL0G04650"
                     /locus_tag="TDEL_0G04650"
                     /db_xref="GeneID:11505284"
     mRNA            <850149..>850337
                     /gene="TDEL0G04650"
                     /locus_tag="TDEL_0G04650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682995.1"
                     /db_xref="GeneID:11505284"
     CDS             850149..850337
                     /gene="TDEL0G04650"
                     /locus_tag="TDEL_0G04650"
                     /inference="similar to DNA sequence:INSDC:YPL271W"
                     /note="similar to Saccharomyces cerevisiae ATP15
                     (YPL271W); ancestral locus Anc_6.6"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683043.1"
                     /db_xref="GeneID:11505284"
                     /db_xref="GOA:G8ZY65"
                     /db_xref="InterPro:IPR006721"
                     /db_xref="UniProtKB/TrEMBL:G8ZY65"
                     /translation="MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDAR
                     YVKYEKGSAASDSVPLQE"
     gene            <850475..>852694
                     /gene="TDEL0G04660"
                     /locus_tag="TDEL_0G04660"
                     /db_xref="GeneID:11505285"
     mRNA            <850475..>852694
                     /gene="TDEL0G04660"
                     /locus_tag="TDEL_0G04660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682996.1"
                     /db_xref="GeneID:11505285"
     CDS             850475..852694
                     /gene="TDEL0G04660"
                     /locus_tag="TDEL_0G04660"
                     /inference="similar to DNA sequence:INSDC:YPL270W"
                     /note="similar to Saccharomyces cerevisiae MDL2 (YPL270W);
                     ancestral locus Anc_6.5"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683044.1"
                     /db_xref="GeneID:11505285"
                     /db_xref="GOA:G8ZY66"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZY66"
                     /translation="MGLIIGRTGSLLMGPSPSIARSVILRRFTPLVRRLPIVQPSVRS
                     VISKRCQLSPLSQIQFQTTRPLTRSFTSSVRLLQAKSPKEAEQKSGLKDVVRLLMLAK
                     PDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEGKDGPISMADVPPIFM
                     GYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDR
                     HKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGVGMMVSISPQLSGLLLLFTP
                     PVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAI
                     RDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTE
                     YTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGEIVFKDVTF
                     SYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQD
                     ISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIV
                     KFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYT
                     FGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPSSELSKLL
                     NEKSSRSENSSSSYSPNASEQPEDEANQKNAPEEAHDDSVEEILKDVTAEGKPIKIS"
     gene            <853039..>854760
                     /gene="TDEL0G04670"
                     /locus_tag="TDEL_0G04670"
                     /db_xref="GeneID:11505286"
     mRNA            <853039..>854760
                     /gene="TDEL0G04670"
                     /locus_tag="TDEL_0G04670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682997.1"
                     /db_xref="GeneID:11505286"
     CDS             853039..854760
                     /gene="TDEL0G04670"
                     /locus_tag="TDEL_0G04670"
                     /inference="similar to DNA sequence:INSDC:YPL269W"
                     /note="similar to Saccharomyces cerevisiae KAR9 (YPL269W);
                     ancestral locus Anc_6.4"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683045.1"
                     /db_xref="GeneID:11505286"
                     /db_xref="InterPro:IPR013889"
                     /db_xref="UniProtKB/TrEMBL:G8ZY67"
                     /translation="MSDLDDSVHPGQLVSASLLEIERISLALENTTSLTSAGHDQIHD
                     LSKQLKSIEQNLPLVFTLDVPKDRINQQLLLLRDSKSIFPTITRTGKKIESALCHLLD
                     ILEQGISTLDGDQDFDTLFDLIENCTQMAVRMEAWTRSRKSILDVSLEFGEILVDHIE
                     ALESVIEKNIELCFEIQEERFSSPVRHTPSFTLKQLVGLLSSNSENSEVKVPIFSNME
                     EALCRKFLTLKRSVPPIEKSLKEILPERIAEFGNRNVSNMEFMSSLLQDRAKNLSTKF
                     RFMVSEIRELKSELIDKRWTTLFRNLNHELSSILEEVQMLQHKIANNDYSYSREIDQK
                     FTKQLQKKTKTITKTFNVIYRALEFSLLEAEVASETNTLAQKWLDIRPVSDKLLSDSR
                     CDEADIQSLTQQLRDLKVKSSTPSADGPGPQRNNFGALLMKKMNIKPVIIKGTPQSAV
                     KVNPFYEKSPTKERNMPTEGLILKTAPLLPYSSQHSSAEDIFEAFETSSSPTSRSMES
                     LESEKFQHYASRGSRIPTLPNTTLSLATIVTPRSKLTQLWTPYPTEGQFLHQPTPRAV
                     LLSSGMM"
     gene            <854988..>857567
                     /gene="TDEL0G04680"
                     /locus_tag="TDEL_0G04680"
                     /db_xref="GeneID:11505287"
     mRNA            <854988..>857567
                     /gene="TDEL0G04680"
                     /locus_tag="TDEL_0G04680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682998.1"
                     /db_xref="GeneID:11505287"
     CDS             854988..857567
                     /gene="TDEL0G04680"
                     /locus_tag="TDEL_0G04680"
                     /inference="similar to DNA sequence:INSDC:YPL268W"
                     /note="similar to Saccharomyces cerevisiae PLC1 (YPL268W);
                     ancestral locus Anc_6.3"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683046.1"
                     /db_xref="GeneID:11505287"
                     /db_xref="GOA:G8ZY68"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR001192"
                     /db_xref="InterPro:IPR001711"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:G8ZY68"
                     /translation="MVSFRRSPSRGSVDDIAINKRDVADHKVSIPPSAFPLSSSSSAN
                     MSKNIKAMFKRSGLSNSSKESIILGHAGPMTYPYSFKEVIGYYISKEAVFQGLNSSCS
                     ALTEGLCMKRISRRKQVPYIFRLHENEAITWKDGTKRLELDSIKDIRTGDMASNYREE
                     YGVSDKVAGLWVTIIYTVSNKLKALHVVARHGSDFSIFFNCICGLVKSRRELMESISV
                     PDNEKFANIHWHRTVSERKEDEIKDTLRFEDVRRLCDKFHIYCSSSHLLRFFKIADVN
                     HNGLLNFHEFQTFVKLLKERPEVHHLWKSCTLGKNYMDFGMFYNFIRDVQKEDLTKEN
                     ACELFENFRRPKQKHLDEEDFVRFLGAQPYAKEIEEDYSKPLNHYFIASSHNTYLLGK
                     QVGERPSVEGYVQVLQQGCRCIEIDIWDDDIGPVVCHGFLTTAIPLINVVEIIKKYAF
                     ITSPYPLIISLEMNCGKENQLIATSIFQNCFGSLLYYPDDKDNFLPSPMKLRHKIVLK
                     GKKTNRKSLAGTTGNLNSIESSSSSYSSSYDSEIESGNKGKENLYNTSNNSKIRRIKR
                     LTLKRRVEVIDDLLNICGLHGLKFRNLSLPESKTVAHCFSFNEKSFYNMQKDKTQELS
                     LDKHNRRFLTRVYPHALRYKSSNFNPINFWKLGVQMVATNWQTNDLGQQINLAMFQLS
                     SQKSGVAHSGYILKPAKLLPTVSKVQQIPQLYQKLRKNPSKIELKILSAQLLPKPAEI
                     KDGKESSFAPYVVAELFSDEEPAASSTVDNGLKLSNMSAATENCKDNGFNPVWGMNMS
                     ATLKSLDFAFVRFTVKTGEISLATSCLRLQYLKPGYRHIPLYSMEGELYIFSTLFIFT
                     RSI"
     gene            <857805..>858452
                     /gene="TDEL0G04690"
                     /locus_tag="TDEL_0G04690"
                     /db_xref="GeneID:11505288"
     mRNA            <857805..>858452
                     /gene="TDEL0G04690"
                     /locus_tag="TDEL_0G04690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003682999.1"
                     /db_xref="GeneID:11505288"
     CDS             857805..858452
                     /gene="TDEL0G04690"
                     /locus_tag="TDEL_0G04690"
                     /inference="similar to DNA sequence:INSDC:YPL267W"
                     /note="similar to Saccharomyces cerevisiae ACM1 (YPL267W);
                     ancestral locus Anc_6.2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683047.1"
                     /db_xref="GeneID:11505288"
                     /db_xref="UniProtKB/TrEMBL:G8ZY69"
                     /translation="MGSPVKKRTALAGKNVNARPSSSSIHKVGSLSNHTSPSKKSQVD
                     LTYALNNSPVRSVSLSPKKSAETSAFTFHEETPSERAAALMKHMSLAKKSSLSVDEND
                     FDAVKENMSPTKLANMNKTAQRQSIRRPLQDLSIEEHKGYVERPQFARTAPLTLHYSR
                     RTTLPTFVTPPRDQKLRECFTISNNDAAPAANSRTTDDIPKDKVVRKLNFKIHEN"
     gene            <858722..>859681
                     /gene="TDEL0G04700"
                     /locus_tag="TDEL_0G04700"
                     /db_xref="GeneID:11505289"
     mRNA            <858722..>859681
                     /gene="TDEL0G04700"
                     /locus_tag="TDEL_0G04700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683000.1"
                     /db_xref="GeneID:11505289"
     CDS             858722..859681
                     /gene="TDEL0G04700"
                     /locus_tag="TDEL_0G04700"
                     /inference="similar to DNA sequence:INSDC:YPL266W"
                     /note="similar to Saccharomyces cerevisiae DIM1 (YPL266W);
                     ancestral locus Anc_6.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683048.1"
                     /db_xref="GeneID:11505289"
                     /db_xref="GOA:G8ZY70"
                     /db_xref="InterPro:IPR001737"
                     /db_xref="InterPro:IPR011530"
                     /db_xref="InterPro:IPR020596"
                     /db_xref="InterPro:IPR020598"
                     /db_xref="InterPro:IPR025814"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZY70"
                     /translation="MGKAAKKKYSGAPTTSKQVDAEKHLSSVFKFNTDLGQHILKNPL
                     IAQGIVDKAQIRPSDTVLEVGPGTGNLTVRILEQAKNVIAVEMDPRMAAELTKRVHGT
                     PVERKLEILLGDFMKTELPYFDICISNTPYQISSPLVFKLINQPRPPRVSILMFQREF
                     ALRLIARPGDSLYCRLSANVQMWANVTHIMKVGKNNFRPPPQVESSVVRLEVKNPRPQ
                     VDYNEWDGLLRIVFVRKNRTISAGFKSSTILEILEKNYKTYLAMNNEMVDDTKGSMLE
                     VVKSKINTVLQETELADKRAGKCDQNDFLKLLYAFHQVGIHFS"
     gene            <860069..>861289
                     /gene="TDEL0G04710"
                     /locus_tag="TDEL_0G04710"
                     /db_xref="GeneID:11505290"
     mRNA            <860069..>861289
                     /gene="TDEL0G04710"
                     /locus_tag="TDEL_0G04710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683001.1"
                     /db_xref="GeneID:11505290"
     CDS             860069..861289
                     /gene="TDEL0G04710"
                     /locus_tag="TDEL_0G04710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683049.1"
                     /db_xref="GeneID:11505290"
                     /db_xref="GOA:G8ZY71"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="UniProtKB/TrEMBL:G8ZY71"
                     /translation="MSKTATTKLDVETEASERFGKLNLVHSEEAPRTGDYDTHFYAGQ
                     DEVSEDGILRINSEYRAKSTVPDFLPTWDPREKLPPLEFHEYHDPGLRADPSFPNLFP
                     EQLQDQYKTKRITPKLGTEVRGVQLSQLTDAGKDELALLVAQRGIVVFRDQDFSKAGP
                     QGVVDYAKHFGKLHVHQTSGHPENVPELHITYRRPDHKEFERVFEQDISSIFWHTDVS
                     YELQPPSYTFFNVLEGPNGGGDTLFADAFEAFDRLSPTMQEFISGLHVIHSAYEQAEN
                     SKGAGGVQRRLPTAHIHPLVRVHPVLKRKALFVNESFSRRIVELKKPESDALLRFLYD
                     IVGRTHDLQLRANWEPNTVAIWDNRRVQHSAVVDWEEPVHRHAFRITPQGERPVEDLK
                     YLNDKNYYGEEVPR"
     gene            <861535..>862818
                     /gene="TDEL0G04720"
                     /locus_tag="TDEL_0G04720"
                     /db_xref="GeneID:11505291"
     mRNA            <861535..>862818
                     /gene="TDEL0G04720"
                     /locus_tag="TDEL_0G04720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683002.1"
                     /db_xref="GeneID:11505291"
     CDS             861535..862818
                     /gene="TDEL0G04720"
                     /locus_tag="TDEL_0G04720"
                     /inference="similar to DNA sequence:INSDC:YLL063C"
                     /note="similar to Saccharomyces cerevisiae AYT1 (YLL063C)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683050.1"
                     /db_xref="GeneID:11505291"
                     /db_xref="GOA:G8ZY72"
                     /db_xref="InterPro:IPR003480"
                     /db_xref="InterPro:IPR023213"
                     /db_xref="UniProtKB/TrEMBL:G8ZY72"
                     /translation="MELELDVLGQQPGLLQIYTQVSLCFSVPDASLHEEIINTLAKGL
                     ERLSDSFPWIAGQVDRKGYQITPLDKSPALIVKDLRNEMTIKRLRDAEFPMKMLEEEL
                     IAPRRTLAGESSEPNAVFLVQVNWIEGGLILTYNGQHAAMDMVGQGQVIGLLSKACRN
                     EPFTEEELASNNLNRTKVVPLLGQEYKPKQDAGTYSRPIAPASDALWAYFSFDARSLH
                     DLKVEAEKTKDESTPFISTDDAVSAFIWKSTTKARIHRLHASDNTKFCRAVDVRSAVG
                     VPKSYPGLLQIMTYHSGRVQCIADAPLGVIAAGLRSKLDPNELRSRTREFATSIAKTI
                     DRASISLTPGLNPGSDVQLSSWAKVNYWGMDFGLSLGKPESVRRPRFTPFEGLIYLMP
                     KAPNGEISMAISLRREDMEMLKADEEFSRYARFIG"
     gene            complement(<862915..>864624)
                     /gene="TDEL0G04730"
                     /locus_tag="TDEL_0G04730"
                     /db_xref="GeneID:11505292"
     mRNA            complement(<862915..>864624)
                     /gene="TDEL0G04730"
                     /locus_tag="TDEL_0G04730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683003.1"
                     /db_xref="GeneID:11505292"
     CDS             complement(862915..864624)
                     /gene="TDEL0G04730"
                     /locus_tag="TDEL_0G04730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683051.1"
                     /db_xref="GeneID:11505292"
                     /db_xref="GOA:G8ZY73"
                     /db_xref="InterPro:IPR004742"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZY73"
                     /translation="MPVAPLKLYHNPSLPAERAQDALDDAALEQIYSRDEEVEYRDHD
                     DTDDGDFKVSVREYAVTRFTSLLHIHKVSAENLNPIPELRKMTLQNWNYFFMGYLAWL
                     CAAWAFFCVSVSAGSLSKLYGKTTHDITWGLSLVLFVRSAGAIIFGTWTDRYSRKWPF
                     ITCLLIFAVAQLCTPFCDTYSKFLGVRWLTGISMGGIYACASATAIEDAPVKARSFLS
                     GLFFSAYAMGFIFAIIFNRAFSSVGGSNSWKIQFWFSMWLPLSLAAWRLLWPETNYFT
                     KVLKARKLIAKDAIEANGGQPLPKLSFKQKWVNIKSTVRRHWVHFVYLVLLLVGPNYL
                     THASQDLLPTMLRSQLGLSEDAVTVIVVVTNLGAICGGMIFGQLMEITGRRLGLIIAC
                     TMGGCFIYPAFMLRTKEAILGAGFMCYFCVFGVWGILPIHMAELAPADARALVSGLAY
                     QLGNLASAASATIETQLAERYPLARNAAGEVTKNDYAKVMAILTGSVFIFTLVCVFVG
                     HEKFHHDLSSPTMKKYIDQVDDLESDGVSVSEYVTQELKSAPMNFSESNRSKASDEQV
                     EIA"
     gene            complement(<865319..>867124)
                     /gene="TDEL0G04740"
                     /locus_tag="TDEL_0G04740"
                     /db_xref="GeneID:11505293"
     mRNA            complement(<865319..>867124)
                     /gene="TDEL0G04740"
                     /locus_tag="TDEL_0G04740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683004.1"
                     /db_xref="GeneID:11505293"
     CDS             complement(865319..867124)
                     /gene="TDEL0G04740"
                     /locus_tag="TDEL_0G04740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683052.1"
                     /db_xref="GeneID:11505293"
                     /db_xref="GOA:G8ZY74"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G8ZY74"
                     /translation="MSVVNGKEQTKFETANSELSSHTHEDAGEEKDAGVHNIEVFTAQ
                     YDHIGYRLMLFFSIFLISYAYGLDQNIRYTLQTYATNSYSQHSLLATVNCIIAVIAAP
                     GQVCFARAADIFGRFTVLIVAVIFYVMGTIIESQATNVSRFAAGACFYRLGITGLMLM
                     MEVIAMDFSNLNWRLLASFVPALPFIINTWISGNVLTAIGTNWKWGIGMWAFILPLSC
                     IPLGFCMLHMRYLAHKNAKDQLRSEFKLFKTMSWYEYIVEVFFWRLDFPGLILICVTF
                     GCILIPFTLGGGLNEKWKTAGIIVPEVIGWVVALPLYMIWESKYARHPLTPWKLIKDR
                     GIFSALIIAFHINFIWYMQGDYMFTVLRVAVNESNSSAQRITSLYSFVSVITGTLLGL
                     VIVKVRRTKKFILFGIVCWFISFGLLVHFRGDSSSHSGIIGSLCLMGFGAGFFTYTTQ
                     ASIQASTKHHENLAVITSLYLATYNIGSAVGAAVSGAIWTNVLPKEIGKRLNDATLTQ
                     QAYLEPLTFILTYTWETIERQAVVLAYRYTQKVLCIVGLCFCAPLLFSAFLLRDHRLG
                     DVIALEDLDEKNLAEDEESGKFWGKYFRFARKHED"
     gene            <867732..>868655
                     /gene="TDEL0G04750"
                     /locus_tag="TDEL_0G04750"
                     /db_xref="GeneID:11505294"
     mRNA            <867732..>868655
                     /gene="TDEL0G04750"
                     /locus_tag="TDEL_0G04750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683005.1"
                     /db_xref="GeneID:11505294"
     CDS             867732..868655
                     /gene="TDEL0G04750"
                     /locus_tag="TDEL_0G04750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683053.1"
                     /db_xref="GeneID:11505294"
                     /db_xref="UniProtKB/TrEMBL:G8ZY75"
                     /translation="MVNPFKTPFQNEDQFAVDCQNNGSLEPQFQINRRRNMPIVKAFG
                     QIGYYLFPSENSYDQFKVKGGDFEHLSAEGMGVPLLQFVLRLPSLGMVVGNSPTFVIF
                     KFLLLSTNSPPPAVQHEVVAANGQFCVYKVPFCEIYRYKSFKETEYRLVFPFGNGLGH
                     NCIMKRSFANRDLYTHVGDSNLRWYVPASILYNRDHYKLQILDDCVPSILDDPELKKK
                     KKALKKGRKPNNITIAHYTRTFRDALPHKYAKRANLYVGERADVTSYGIENVPWTTQL
                     LACQGLLIQYVEHMRRKERSNSGSGGGGVGS"
     gene            complement(<868891..>870468)
                     /gene="TDEL0G04760"
                     /locus_tag="TDEL_0G04760"
                     /db_xref="GeneID:11505295"
     mRNA            complement(<868891..>870468)
                     /gene="TDEL0G04760"
                     /locus_tag="TDEL_0G04760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683006.1"
                     /db_xref="GeneID:11505295"
     CDS             complement(868891..870468)
                     /gene="TDEL0G04760"
                     /locus_tag="TDEL_0G04760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683054.1"
                     /db_xref="GeneID:11505295"
                     /db_xref="GOA:G8ZY76"
                     /db_xref="InterPro:IPR001362"
                     /db_xref="InterPro:IPR011040"
                     /db_xref="InterPro:IPR013148"
                     /db_xref="InterPro:IPR013189"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:G8ZY76"
                     /translation="MNDPNGLWYDAKEELYHMYFQYNPEDNIWGSPLYWGHAVSDDLT
                     TWEERGIALGPKTNDSAAFSGSAVVDVDNTSGFFNDTTDPRQRVVAIWTHNAPDKQSQ
                     YVSYSVDGGDTFIEYENNPVLDLNSTQFRDPKVIWHEETKKWIMIVAMSQKYEIAIYS
                     SDDLVDWTYESAFGNAGYLGFQYECPGLVKVPVVQTEQGGLTVSNLTYPNTTSYNSTY
                     FNATNTSTVNNEAWVMFLSIYPGGPLGGSATQYFIGDFNGTHFEPFTTQARFLDLGKD
                     YYAVQTFYNSPNADEVLGIAWASNWQYAQNVPTYEWRSSMSLARNFTLREYSPNPESV
                     QLNLNSEPVLNANPVEAQNATFSFEDELLLIDNELSGNFPSNISATAIEFEIEWSVNE
                     IAFNITELNGFVLSLATDDYDEFLTFGYEANAQSFFFNRGNTEEPFVYANPFFNEKLS
                     VYLEPYSTSSNGTNTYKVHGIVDQNIAELYFNDGSVVSTNLFFTTPGNQLTWWSVDTS
                     IDGGFKLDNFTISVLDV"
     gene            <871701..>873281
                     /gene="TDEL0G04770"
                     /locus_tag="TDEL_0G04770"
                     /db_xref="GeneID:11505296"
     mRNA            <871701..>873281
                     /gene="TDEL0G04770"
                     /locus_tag="TDEL_0G04770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683007.1"
                     /db_xref="GeneID:11505296"
     CDS             871701..873281
                     /gene="TDEL0G04770"
                     /locus_tag="TDEL_0G04770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683055.1"
                     /db_xref="GeneID:11505296"
                     /db_xref="InterPro:IPR003495"
                     /db_xref="InterPro:IPR011629"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZY77"
                     /translation="MTMTQRQPIPVTILSGFLGSGKTTLLERILTENHGLKIAVIIND
                     MSQVNVDAALVQQHKVSNQEEKLIQLQNGCICCTLRGDLLEELLGLSEQGAFDYIVIE
                     STGIAEPMQVAETFSTDFSQALLDTPGGIPENEELLLKRVVELGGLEKVAKIDTCVTV
                     VDAANFLSNIETTEFLAQRFGESGQNESERTVTNLMVDQIEFADVIIINKVSRVKKND
                     LLKIGKMISSLNPVAKILRSDYCKVPIKEIINTGLYDFEKASSSAGWLQSIHEMTLRE
                     GFGDKTKSVLTPKPETEEYGVNSFVYNSRRPFHPERLYYLLKDKFFIIEETPTAEEET
                     DNEEGEQEDEEETANEKDEQGDEEEDQDGEEDEVSEEELLKNKKSSPFGPLLRSKGFF
                     WLATRHIMRGEWSSAGLMLTLKGGIPWFDVSGLEGIPEDTAEIIRQEFEEPHGDRRNE
                     IVFIGLGIDKEALAKTLDSCLLTDKEYEKFMKIISQEKNLLKVERKLANTFDDGFEDW
                     ILIDDDDVEEEEEEEEEE"
     gene            <873633..>874553
                     /gene="TDEL0G04780"
                     /locus_tag="TDEL_0G04780"
                     /db_xref="GeneID:11505297"
     mRNA            <873633..>874553
                     /gene="TDEL0G04780"
                     /locus_tag="TDEL_0G04780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683008.1"
                     /db_xref="GeneID:11505297"
     CDS             873633..874553
                     /gene="TDEL0G04780"
                     /locus_tag="TDEL_0G04780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683056.1"
                     /db_xref="GeneID:11505297"
                     /db_xref="GOA:G8ZY78"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8ZY78"
                     /translation="MSEDFTTPQVVDDIEDKRAHSFRRTAKDILAGTISGVAQVLVGQ
                     PFDITKVRLQTSQGDSTAYQVIKNLIKDEGLFAFYKGTWAPLLGIGACVSCQFGCNEA
                     MKKYFHVRNGNNPNQGLSLPQYYACGAVSGAANAFLATPIEHVRIRMQIQTKSLNAGE
                     FSGSFDCFKKLLKRGVLMRGLTATMLRTSHGFGIYFLTYEALTNRQISKGIKREDIPT
                     WKVCGFGAISGAFFWAMTYPFDVIKSVMQADKLHLPVHGTNVVQVAKAIYRTRGASAF
                     LKGFAPTMFRSLPVNGATFATFEMAMRVLA"
     gene            <875064..>876323
                     /gene="TDEL0G04790"
                     /locus_tag="TDEL_0G04790"
                     /db_xref="GeneID:11505298"
     mRNA            <875064..>876323
                     /gene="TDEL0G04790"
                     /locus_tag="TDEL_0G04790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683009.1"
                     /db_xref="GeneID:11505298"
     CDS             875064..876323
                     /gene="TDEL0G04790"
                     /locus_tag="TDEL_0G04790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683057.1"
                     /db_xref="GeneID:11505298"
                     /db_xref="GOA:G8ZY79"
                     /db_xref="InterPro:IPR001670"
                     /db_xref="InterPro:IPR018211"
                     /db_xref="UniProtKB/TrEMBL:G8ZY79"
                     /translation="MRTTLVNRLVYKRPLLSNGVFASLKRSTLQSNTFKRMSSSVTGF
                     YIPPVSYFGEGALEQSIEHLKKKEFSKVLIVTDPGIAKIGLSAKVADLLKKAGVEVSI
                     YDKTQPNPNIQNVVDGLKILKENDAKAVISLGGGSAHDNAKAIALLATNGGQIGDYEG
                     VDRSKNQCLPLFAINTTAGTASEMTRFTIISNEEKKIKMAIIDNNVTPSVAINDPTLM
                     YGLPPALTAATGMDALTHCFEAYVSTAANPITDACALKGIDLIRESLCEVYKNGQDKK
                     ARTDMCYAEYLAGMAFNNASLGYVHALAHQLGGFYHLPHGVCNAVLLPHVQKFNTADK
                     VAAKRLGEIALHLGQSAGTAESAVQALHELNKQLNIPRNLKELGVKQEDFDILADNAM
                     NDACHLTNPVQFTKDEVKQILQEAYDC"
     gene            <876710..>877900
                     /gene="TDEL0G04800"
                     /locus_tag="TDEL_0G04800"
                     /db_xref="GeneID:11505299"
     mRNA            <876710..>877900
                     /gene="TDEL0G04800"
                     /locus_tag="TDEL_0G04800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683010.1"
                     /db_xref="GeneID:11505299"
     CDS             876710..877900
                     /gene="TDEL0G04800"
                     /locus_tag="TDEL_0G04800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683058.1"
                     /db_xref="GeneID:11505299"
                     /db_xref="UniProtKB/TrEMBL:G8ZY80"
                     /translation="MIYNLMLNKKYGIVLTVGLIWVLVGVFFLHNRGKNASSGIWEET
                     IDINGVLGPKFDVTKRIAYISGHIGTTTDFKYMAQHLLLENVDYYDSRDFFDYLSSRD
                     GYRSIVIDGTVEEICSTHDAIFISDSLADGWPFIMDGKQPCKNVVFVTTNRFDCGVHE
                     GDREVFYQDFNYSLNRNDEYRARVIANNRFEVPYMRSKGIDVPDYHPVIRPFGYTSVQ
                     AIEIDPNDVNAACLIIGRVPQDEILMNNLVDQHTTHKCKVVPYHYGGPKTLEKYESVV
                     VHLPYQVSIMKMWENLAYGVLMLVPSPEFFTQICTENVCQQDHDAMEPKRVIGEEHWS
                     EYLDFYLPGWGECFIQYNSWEELDNILTSKDYLKNVNTCRNKMEDLRELNLQLWKKLL
                     TVLH"
     gene            <881433..>886448
                     /gene="TDEL0G04810"
                     /locus_tag="TDEL_0G04810"
                     /db_xref="GeneID:11505300"
     mRNA            <881433..>886448
                     /gene="TDEL0G04810"
                     /locus_tag="TDEL_0G04810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683011.1"
                     /db_xref="GeneID:11505300"
     CDS             881433..886448
                     /gene="TDEL0G04810"
                     /locus_tag="TDEL_0G04810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683059.1"
                     /db_xref="GeneID:11505300"
                     /db_xref="GOA:G8ZY81"
                     /db_xref="InterPro:IPR001389"
                     /db_xref="InterPro:IPR008966"
                     /db_xref="InterPro:IPR024672"
                     /db_xref="UniProtKB/TrEMBL:G8ZY81"
                     /translation="MRLSRSSLSATLALTCYSLIASAKDLGNVFTSLDIEPESNTENL
                     PQGLWDASLGITIKDSMNPQNGDTFTLDIPNVYKVYGSGSDNTFSLKSASGDSLADCT
                     SFSGTSLTTDSRVTCTITNANINQLASVADVKGQITLPFIFSAGGSDQAPDVTAAKVY
                     SAGTNTVEWNGMTATVSFAAGPTYTPALATGYNQATDPNYLVRTSVNNEIQGLFLGSQ
                     CSTGSVTEENIEIDFAGFSRGDGNTGNLISCSNVAIKMSNQFNAWMMPETAEDVPSTV
                     TSTCSGNVLKINAKGLPAGYRVFVSSYQAPSNSGNPITIMNQYYDNVTCSDGKTQNKM
                     FKINTQLQLAAATGNYLPFKIVTSTYPGEVTTISTVITSGTQEIIVLNPTPRTTITKT
                     YDGSVITTKTLSHASDASFITVEVDVPTRTRTTTIPWTGTVTTSSLNTDASIFTQVVE
                     TPAPRTTVTHIWTSHSHSTTTQPFNPASDKTITVDVYQPSSTTTTTTSMYTGVKEIYT
                     TKTFSDADETITVIDIKPYPRSTRFVATTSTSFYSTIYQTNSAGQTTGLDVIKYAPIT
                     TRTTTYVWSSSTTSSSLMTTASGASIVTHVNYVPPFTQSAGGICGPTNGVSSMNCATS
                     LYCNENNPNSKYCVTIGTTTSTVYYTGTTPSTTTLPYVTSDTTVVAYLPPKTVTQTKV
                     WSHVQTSTTTEAYQTNDPTKYIDILVPTTTTIKSVWTQTTFMTTTLPTKADDTQYTVV
                     VYGPPVSSYTSTRSYTGTTTLYSTSTKNPTEVQVIEYEPIPRTTVTRGWTENYVGTTT
                     FNCGDIEQANPTQNIFHKRDNPYTQLCDPLDTVTTQITEVVHVPFVTSTINYPYTGKT
                     TSTSISLEDGSRTETIINYVPNSVCATSGGFLWYHVXXLSRTNFWTQTACCQLGLKCA
                     TDSSNVVCVPASTGSTVVTKYWTSPTTRTTTYTTYIDGLPFVETEIDKPIVTTTVTTS
                     WKSDFTSTVTTITGDSTKGTATVIVEVPSSKAHVSSTTTTAWTGTVTSTYSTDVSTST
                     GSDGVETVSTLYYVETPKPSVVSTTYKPWTGTYTTTYSTAVNTTRGSNGVDTISTLYY
                     VETPEVSVVSTTYKPWTGSYTTTYSTAVNTTRGSNGVETISTLYYVETPEASVVSTTY
                     KPWTGTYTTTYSTAVNTTRGSNGVETISTLYYVETPEASVVSTTYKPWTGTYTTTYST
                     SVQTVRGSDGVDTISTLYYVETPKSAVVSTTYRSWTGTFTSTFSTSTTTFIGPDGQTT
                     EQGVYFVETPAAGYYGNSSTVMSSSTFKPSGSASVSSSSLIPDTLIPGSSSSGQPAKT
                     DSATSGAQTSSGTASGKTKTSSTTPDFPTITPTSAYSITSGNDEAFTSSVVTTTVSGT
                     VTSFTTTCPVSDETQQITNPTDSQTQPAEQATSVVTTTVSGVVTSYTTTCPLSDSTQQ
                     TANPTGSQSQTEQVATSSEDVSATSTENTNNATENASQEASADQGSQPAGSQSGYSTT
                     AGSDDHPSTADSQHGSDNHSSMASSAGQASPANGEQAQETSGSTSAEAQYVGSTSTSN
                     NTPVTPAADIVPGTANATPTAQAVSPSSSVVTGAEASNATPVTSDANNTSGAANATPT
                     TLSGSYGGSAEQPKSAATPSQYAASSSALVSSTSSISFTTYEGGATRVKAAMLFLLPL
                     ALL"
     gene            complement(<886654..>889404)
                     /gene="TDEL0G04820"
                     /locus_tag="TDEL_0G04820"
                     /db_xref="GeneID:11505301"
     mRNA            complement(<886654..>889404)
                     /gene="TDEL0G04820"
                     /locus_tag="TDEL_0G04820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683012.1"
                     /db_xref="GeneID:11505301"
     CDS             complement(886654..889404)
                     /gene="TDEL0G04820"
                     /locus_tag="TDEL_0G04820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683060.1"
                     /db_xref="GeneID:11505301"
                     /db_xref="GOA:G8ZY82"
                     /db_xref="InterPro:IPR001389"
                     /db_xref="InterPro:IPR018871"
                     /db_xref="UniProtKB/TrEMBL:G8ZY82"
                     /translation="MRTVCGFILILLMELAAAATIDSGTLIGCDPQSVTSGFSVKYYD
                     YPHAAAGSSPCYNLAYQTDDYLYNGGYQTLGAGLLAQSSGVTDLTFATSSNMSRLFGI
                     MANMPSNYNLNQQISVSNFAMLITGYFLAKTTGTYSFNLDYIDDLAYVNVGAGKAFDC
                     CQQGSSESKPAPFDLFAQWASSKPTDSIQADLIAGLYYPIRLFYVNRDYIGGLQFSYT
                     DPSGAKSSNWDSYIFQAPDGSKCEAEPATTTTPWDSTFTSTYTTVSTYTNAKSVVTTG
                     AVVVVETPRPLTSTTTYTAYSGSSTTTYSTGVTTIIGTDGKSTKETVYYVKTPIRATT
                     TYTGYDGSSTTTYSTGATTFIGSDGKSTTETVYYVKTPTYATTTYTPWSGSSTTTYST
                     GATTFIGSDGKSTTETVYYVKTPGYATTTYTEYDGSSTTTYSTGITTITGTDGNPTKE
                     IVYYVKTPGYATTTYTEYDGSSTTTYSTGATTFIGPDGKSTTETVYYVKTPAIATTTY
                     AGYDGTSTTTYSTGITTITGTDGNPTKEIVYYVKTPGYATTTYTEYDGSSTTTYSTGV
                     TTFTGPDGKATTETVYYVKTPVNKPVLTTKYTNYPGSTPRTYSTESTWFTGGDGNQTP
                     LYVYYVETPIVRYTNGSSSYIPKTLTSTTSGSEITTNPINTVSSSENTVHTNTLTTVT
                     TTVDGVVTSYTTTCPMIAISSDTKPVDSQSQTQTTVTTTVNGIVTSYTTTCPITTISS
                     NDKPVTTEPQSNLVTTVNGGVTFYTTTRAVNKPSSGTAAQDSYTLETVTTESNGVTIV
                     YTTTCPLSTGTGAVGHTPSAEASESAADSVQVGEGEQTVLQPAGVSTTLSSVVSTAQT
                     PLITTNSQPYATGSGSSIISSVTQILPSNTRSITQYEGAAPKSFVSHFFYFVVALPLA
                     LI"
     gene            complement(<891989..>893620)
                     /gene="TDEL0G04830"
                     /locus_tag="TDEL_0G04830"
                     /db_xref="GeneID:11505302"
     mRNA            complement(<891989..>893620)
                     /gene="TDEL0G04830"
                     /locus_tag="TDEL_0G04830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683013.1"
                     /db_xref="GeneID:11505302"
     CDS             complement(891989..893620)
                     /gene="TDEL0G04830"
                     /locus_tag="TDEL_0G04830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683061.1"
                     /db_xref="GeneID:11505302"
                     /db_xref="GOA:G8ZY83"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:G8ZY83"
                     /translation="MAEKRFTKFNWLSLLGIAFSLTSSWLGVSSSLVAGLYSGGPVLI
                     IYGLIIGAVFTIMCGLSLCEFSSMLPNASGVCFWVLKLLSEPLDPEVMEKEAIECDND
                     DLLDITGDGPLADELDEPVLESYCSAENLFITKKWKKDLGIMTGLFNYAGAVFTSASI
                     CASLSLSILGVYSLMHPDYELRHWNVFLTYELLNIAMAFVASWARWLPAISQFGLGIS
                     VVSYVLTFLISIISRSFNHSEQWPTGKTVFGEFTNTTGWSSSGMAFIVGLINPLWSFA
                     GIDSATHMVDDVGYSASRKLVPRIIIATILLGFATAFPYAIVMFFCITDSTQVVSSIL
                     PILQIYYQATGNKSLSAFMQSCCIITGFICGVSSSTWQNRILWSVSRTYHLIECDEMN
                     AKKAQVVAKIASISPTIRIPVYAHLLSHFFVAVIGCIFMGSSTAFNAIITACISILLL
                     SYAVPCIIMVFVVGKKNFYRNIASEQQALGLSHQVEESRASWYLVPNILTICWALFCL
                     IFLSFPYVIPVDSSNMNYVSVVYGVMAILIAIALY"
     gene            complement(<893840..>894535)
                     /gene="TDEL0G04840"
                     /locus_tag="TDEL_0G04840"
                     /db_xref="GeneID:11505303"
     mRNA            complement(<893840..>894535)
                     /gene="TDEL0G04840"
                     /locus_tag="TDEL_0G04840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683014.1"
                     /db_xref="GeneID:11505303"
     CDS             complement(893840..894535)
                     /gene="TDEL0G04840"
                     /locus_tag="TDEL_0G04840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683062.1"
                     /db_xref="GeneID:11505303"
                     /db_xref="GOA:G8ZY84"
                     /db_xref="InterPro:IPR004472"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZY84"
                     /translation="MTSIEESSPAIPTAQPIIFVTGTDTDVGKTFISTLLAHKWRANY
                     WKPLQTGIESDDGDSVTVKTAKCDASWMPEIFQPRYEMIKPLSPYKAMDYEPSIDIQL
                     TDFEIPKGSEKAPLIVEGAGGAFVPITKDLKTMTDLMKHLAITNTHRPFKIIVVARSG
                     LGTLNHTLLTINYLENEGLSEHILGIVVNGEKNQGNVEVLRDYGLEILAEVETTSSPA
                     SALNFIPPLNGLL"
     gene            <895116..>896576
                     /gene="TDEL0G04850"
                     /locus_tag="TDEL_0G04850"
                     /db_xref="GeneID:11505304"
     mRNA            <895116..>896576
                     /gene="TDEL0G04850"
                     /locus_tag="TDEL_0G04850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683015.1"
                     /db_xref="GeneID:11505304"
     CDS             895116..896576
                     /gene="TDEL0G04850"
                     /locus_tag="TDEL_0G04850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683063.1"
                     /db_xref="GeneID:11505304"
                     /db_xref="GOA:G8ZY85"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR005815"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8ZY85"
                     /translation="MQFSTAVNDLLKYDRDHIWHPYTSMSNPMMVYPVKEARGCEMIL
                     ASEEPKDYRMIDAMSSWWCAIHGYNNQEINDALVSQISKVSHVMFGGLTHEPAVSLVG
                     KLLTLLDHSELQHCFLADSGSVAMEIALKMALQYQWSLTPASDSEFKKTKFLTISRGY
                     HGDTIGAMSVCDPKSSMHSIYAGYVAENIFVTGPPTVPTLPTSNIYLENKELFNEAVT
                     FDPECLEVFRSKLEHEIEEICAVVLEPILQGAGGMRLYHPQFLIEVRKLCDQYDVPLI
                     MDEIATGFGRTGAMFAFHHCRAYQDDMNIPKDSQVDVYPDIICVGKALTGGYMTLSAV
                     VTTPKIAMTISNPELQTGGCLMHGPTFMGNPLACAAANKSLDILLRGDWTTQVQRIER
                     QLFDGLYKDVLSDSKISSVISDIRITGAVAVLELKQSVDSLWFHHKFVSKGVYVRPFR
                     NLCYIMPPYIISPEQLDKVTRVIREVLREWADKVLA"
     gene            <897615..>899309
                     /gene="TDEL0G04860"
                     /locus_tag="TDEL_0G04860"
                     /db_xref="GeneID:11505305"
     mRNA            <897615..>899309
                     /gene="TDEL0G04860"
                     /locus_tag="TDEL_0G04860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683016.1"
                     /db_xref="GeneID:11505305"
     CDS             897615..899309
                     /gene="TDEL0G04860"
                     /locus_tag="TDEL_0G04860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683064.1"
                     /db_xref="GeneID:11505305"
                     /db_xref="GOA:G8ZY86"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="UniProtKB/TrEMBL:G8ZY86"
                     /translation="MLFDVETLRRCDKFLQVPHHEKDSLTVLRNPDLEPIPLERRIWG
                     FWSFFGYWGIPNITIWTWSTGSAMLSLGLNIQHTMGALTLGNILICVYTCLNSGPGAK
                     YRIGYTVCQRMIFGIYGSGIGIFIRIVLSIVFYGSQSWLGGLGFVVMFSSWSKSYMNL
                     ENTFSSSVAMTTRDFIGFLVFQVLQYAFFFMRPEKMNKVVNFSCLITIIAMVGVFIAT
                     LAKNHGAGPLYSEPVTLSKSYTGWMWLYSMTIWYGALSPDCTNQSDFSRFSSSRKKMY
                     LGIISAVMITGTIVPLMGLLCASATQQLYGTELWLPTDICLQWLINDYSPGARAASFF
                     CGLAFMASQMSFNVLANGFAGGMDLAGVLPRYINIKRGAIITALLSWATQPWNFYNTS
                     SVFITVMSSFGVIVTPIIAITVADYHIIRRGTLPLSHLYITDPDGTFYFKKGFNFRAI
                     FTWICGMVPGLPGLADAVSPISGFPEGMRNFFYGSVVFSFFCPLILYVIVCKIFPVKN
                     LGMVEEEDVYDNMTVEEIGESGSQTYNMTLLEGVDVEMGSMVKDANASVKQKVVES"
     gene            complement(<899901..>901367)
                     /gene="TDEL0G04870"
                     /locus_tag="TDEL_0G04870"
                     /db_xref="GeneID:11505306"
     mRNA            complement(<899901..>901367)
                     /gene="TDEL0G04870"
                     /locus_tag="TDEL_0G04870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683017.1"
                     /db_xref="GeneID:11505306"
     CDS             complement(899901..901367)
                     /gene="TDEL0G04870"
                     /locus_tag="TDEL_0G04870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683065.1"
                     /db_xref="GeneID:11505306"
                     /db_xref="GOA:G8ZY87"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:G8ZY87"
                     /translation="MKHDPILQVLPDQKSKLVITSRRYDSINGIQENPSEDCHRNKEF
                     WIILKASLPLVTTFFLQFSLTLVSIFSVGHIGKDELAAVSLAIMTFNVSVSIFNGMAT
                     CLDTLCAQAYGAKRYDLVGIYFQKCTCMILAAYIPMAFIWCFSSHLFALIVPDRKLAV
                     LAEKFLRGMSLGAPGYIFFETGKRFLQAQGIFVAGQYCLFIAAPINLLLNYLLVWNKH
                     FGIGLYGAPLSTSISYWLMSLLLLCYVRFIDGKKCWDGINLQEALRGWGTMFNLALNG
                     TAMMLSEFVAFEILTLSVSRLGTASLAAQSITSSLATLLFQIPFGISVAASTRIAYHV
                     GAGSINMAKMASRITLNLALVVGVLSFLVVFIFRANIVRIFTTDQEVVKYATVSVGIL
                     GINQLFDCSNVLLAGCLRGQGRQHIGSALNIFVYYVIAVPLALHLAFKTGLGLKGLWI
                     GIGIGVSILAISEGYFVLFRSNWPAILQSAQKRNSLGS"
     gene            <901871..>903211
                     /gene="TDEL0G04880"
                     /locus_tag="TDEL_0G04880"
                     /db_xref="GeneID:11505307"
     mRNA            <901871..>903211
                     /gene="TDEL0G04880"
                     /locus_tag="TDEL_0G04880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683018.1"
                     /db_xref="GeneID:11505307"
     CDS             901871..903211
                     /gene="TDEL0G04880"
                     /locus_tag="TDEL_0G04880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683066.1"
                     /db_xref="GeneID:11505307"
                     /db_xref="GOA:G8ZY88"
                     /db_xref="InterPro:IPR006035"
                     /db_xref="InterPro:IPR020855"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="UniProtKB/TrEMBL:G8ZY88"
                     /translation="MKITKSCLLLSSAAYIQAASIPEQMFLSCERSDGNPNHQASPHT
                     KTTGNKSFLDAYFGNFLDGVADAVTVKGKREPLPLPDEIRGLAVHDNYEYPDPDDLRD
                     INGSAVLYRGGEFGYIDTFAHLPLTNCFDPELYEKESFDIAVIGAPFDSGVSYRPGAR
                     FGPSGIRLGSRRLAPAYSVYNEKLNPYKNWAKIVDCGSPPVTPLDNRIAIDQIYRANR
                     AAGKHSVTKKNKFDHPKIVTLGGDHTITLPAIKAAFENWGKISVIHFDSHLDTWNPYY
                     FGGNVTDYQSLNHGTYLHWAHEKGLLSDTSIHAAIRGPYPGKKDVEHDISCGFDRILA
                     RDIDKIGADGIIKKIKQRVGDSPVYITVDVDSMDPSTAPASGTVEPGGWTSRELLTVL
                     DGLDGINIIGGDVVEVSPPYDTAAEITSVVAAQVADSIISLMVLQGESDTTDSE"
     gene            <903504..>905316
                     /gene="TDEL0G04890"
                     /locus_tag="TDEL_0G04890"
                     /db_xref="GeneID:11505308"
     mRNA            join(<903504..903581,903640..>905316)
                     /gene="TDEL0G04890"
                     /locus_tag="TDEL_0G04890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683019.1"
                     /db_xref="GeneID:11505308"
     CDS             join(903504..903581,903640..905316)
                     /gene="TDEL0G04890"
                     /locus_tag="TDEL_0G04890"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683067.1"
                     /db_xref="GeneID:11505308"
                     /db_xref="GOA:G8ZY89"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:G8ZY89"
                     /translation="MARVSGTPRKRYSHNGCKECKRRKIKCDEGKPVCWHCDRLEKSC
                     QYLQVKEAEYSVRKVTHLPKAGSIQTALYGEETNSGGTPATPVVSSTGNRPHEVEAGQ
                     LHDSFTAYWAPLLANDLSDLVNSTLSEMTAIEEPESPFYSIPNGITPGSSASVEQVMF
                     QTNVPFSYLNLTGENQFYMKEFYNEFSNVILPFQASSDGIMINPVRDILMIYARDSHY
                     LLYALLACGARSSHRKSSLPEDQSSYKLYLRRCLETLTAAMERDMMGSLDSILLTILV
                     LTCDSASHTRQEWRAHLRGAKDLLSKNDTQKAHSMIFFLCKSWYSSIEILAGLVSPKG
                     GTLKTGEELDLLICNRLEEVSALRKLNIVSDEGFSLFHGYSMELVVIMKDLIKILRRE
                     GKSQQDYCAITELISSVRKQLDFQVIDKSGIVPNSHPYYPKEMNENNTSFSNNIAVTY
                     VDGKKLALSWLDISHRSYALAALLTIFTKLLNIDKGNAFVQSMVEDLISTACCFDGTG
                     GFLKSYCYFVLQWPMLVAGTNSTMEEHKIRVETFFRLVAQLGSGSAGFALARLRRIWT
                     NGPAAENETTNGIDMVTY"
     gene            <905679..>906257
                     /gene="TDEL0G04900"
                     /locus_tag="TDEL_0G04900"
                     /db_xref="GeneID:11505309"
     mRNA            <905679..>906257
                     /gene="TDEL0G04900"
                     /locus_tag="TDEL_0G04900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683020.1"
                     /db_xref="GeneID:11505309"
     CDS             905679..906257
                     /gene="TDEL0G04900"
                     /locus_tag="TDEL_0G04900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683068.1"
                     /db_xref="GeneID:11505309"
                     /db_xref="GOA:G8ZY90"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G8ZY90"
                     /translation="MRQLVPRNCKAVPLITLSVYHIFPLIPKGLVVDDNLMLFLFIRI
                     YKFCYHSWLVLSFAKFLRWLANRGRLEESFDIIVAAKGNREDAQVKLQLEEMKEQVMI
                     DRKAVDFSYRRQFRKKTIRKTIISVSAQIWQQLCGMDVMMYFMVYNFKMAGYSGSTVL
                     VSGSIQYVLNVVMTIPALFLVDKVGHRLVPIT"
     gene            <908763..>910871
                     /gene="TDEL0G04910"
                     /locus_tag="TDEL_0G04910"
                     /db_xref="GeneID:11505310"
     mRNA            <908763..>910871
                     /gene="TDEL0G04910"
                     /locus_tag="TDEL_0G04910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683021.1"
                     /db_xref="GeneID:11505310"
     CDS             908763..910871
                     /gene="TDEL0G04910"
                     /locus_tag="TDEL_0G04910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683069.1"
                     /db_xref="GeneID:11505310"
                     /db_xref="GOA:G8ZY91"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR005886"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018052"
                     /db_xref="InterPro:IPR025308"
                     /db_xref="UniProtKB/TrEMBL:G8ZY91"
                     /translation="MTMTESKVSGKYVLVTGGAGYIGSHAVAELIENGYKCVVVDNLC
                     SSSYESVARLELMTKHYIPFCKVDLCDREGLEKVFQDYDIDSVIHFAGLKAVDESTKI
                     PLKYFNNNIVGTLVLLELMEKYHVEKLVFSSSATVYGDANRFPNMIPIPEECPLGPTN
                     PYGHTKFTIEKMLQDLYASNTSTWKFAILRYFNPIGAHPSGLIGEDPLGIPNNLLSYM
                     AQVATGRREKLYVFGDDYDTRDGTPISDYIHVVDLVKGHIAALEYLDAHSPDGLCREW
                     NLGSGTGSTVFEVYRAFCKASHTKIPYEVTGRRPGDVVNLTVKPERAQRELKWKTELD
                     IGVACSDLWKWATKNPSAFQLKGLKAEFAGAVNDYDNRFTTLGAGSKFEATIANLGAT
                     LVDLKVNGQSVLLGYSRAEDYVSDGGNYIGATVGRFANRIKEGRFTLQDGPHKLTVNN
                     CGNANHSSISSFHLKKFLGPLTENPCKDVYTAEFLLLDDHSIPNEFPGDLEVLVKFTL
                     NVTEMSLKFSYQAQLINGEATPINMTNHTYFNLNKINNEQSISGTEVSICSNKSLEVS
                     EGALIPTGKIIDRDIATFDSARPTTLGEDGPTYDYCFISDDNKDLKSPDSRSQNELCP
                     ILKAYHPESKITMEVSTTEPTFIFYSGDNLFGKFIPRQGFCVEQGRYIDAINRDDWKD
                     CVLLKRGDVYTSETQYRFEN"
     gene            complement(<912754..>914844)
                     /gene="TDEL0G04920"
                     /locus_tag="TDEL_0G04920"
                     /db_xref="GeneID:11505311"
     mRNA            complement(<912754..>914844)
                     /gene="TDEL0G04920"
                     /locus_tag="TDEL_0G04920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683022.1"
                     /db_xref="GeneID:11505311"
     CDS             complement(912754..914844)
                     /gene="TDEL0G04920"
                     /locus_tag="TDEL_0G04920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683070.1"
                     /db_xref="GeneID:11505311"
                     /db_xref="GOA:G8ZY92"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G8ZY92"
                     /translation="MDESTVVMNKSMNFPGRIVKAPRTPKACDNCRRRKIKCSNISPC
                     LNCVASALKCVHSQEPKRLNTSFFESPFKLNHDLSSLKDSLAGLSNRLLSANSQEVKN
                     HIKGAILALEKVEKVDLESITQIQYDAIESYTGTHSIETAMVSKPHLFDRFPIGTNSN
                     VDPPLNAHFGMYTPLVYFTSIGISHLMTKLLQIQDYRGTRETMYLHLKFLDLSSEIYM
                     SLEPELGQDSKISSQFEDLLCMLPCNVENEIFQFRKKPMRKCSDMLHSCSHIQHCLQK
                     AFCQPILKSTLIESYIKAVEKLATLCCKAFGLSVLTGPGRSPSPDILIEIIDEMYWVF
                     DSKSTGMLIALACRSLLDSGYGRWEYNVGINEKSADNKRKIWWKCFWWDRWSAMSTGK
                     PPILSEETSNCPFPREVMCLKVDDEMDCLALAEGVDLKASNLEGCLSFGYILLAKTIS
                     FAFSSMLYSQEFTAYRRYSSDVWRNSDQTLIELKKRHHQLVETFRLVDIKVTPIVQSN
                     LQEQRCHRLYMFIKTTSVFISQELCSLFTRLQKCLPTKEASLVVDLMRRSAQHLFENS
                     KDALLNVLKLEDTKALIEHGKIYIFIHAKHGLSDGGQLGTNRTSSDKFLVNMCEICGR
                     LTDLGNNSNLRHRSLLGSVACFITARMCCQACMGSQRKTKEQLFGVPEESGAQIIKVG
                     RNVMDSKSSLYAVL"
     gene            <915150..>916169
                     /gene="TDEL0G04930"
                     /locus_tag="TDEL_0G04930"
                     /db_xref="GeneID:11505312"
     mRNA            <915150..>916169
                     /gene="TDEL0G04930"
                     /locus_tag="TDEL_0G04930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683023.1"
                     /db_xref="GeneID:11505312"
     CDS             915150..916169
                     /gene="TDEL0G04930"
                     /locus_tag="TDEL_0G04930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683071.1"
                     /db_xref="GeneID:11505312"
                     /db_xref="GOA:G8ZY93"
                     /db_xref="InterPro:IPR007568"
                     /db_xref="UniProtKB/TrEMBL:G8ZY93"
                     /translation="MSEDSNTSNDSSGYQLYHYVPNKGAAILFVVLFLLGTFVSAFQV
                     FFWARRTSSVRMNEAFEVCSTKDLGNTETKFVGETCVRYASVSKQDRKLKVSSISCCF
                     IPFFIGCIFEAIGYVARAISASNKQALVPFIIQSVLLLVAPALYAGSIYMLFGRLLRA
                     MECQKLMLVSSRFGTAVFVTGDVLSFLLQSAGGGLMAKEDQADTGSRLVIGGLVVQIV
                     FFGFFIINELRFSVRVDPVCPFFRRLSRKWLYFNWVLLISSLLIMVRSIVRLIEFVEG
                     SDGFIISHEVFIYVFDALPMFLVIVLFCAALYFGNIFSVIDECRNSKNAAIVRHPIQL
                     EEESF"
     gene            complement(<918767..>922042)
                     /gene="TDEL0G04940"
                     /locus_tag="TDEL_0G04940"
                     /db_xref="GeneID:11505313"
     mRNA            complement(<918767..>922042)
                     /gene="TDEL0G04940"
                     /locus_tag="TDEL_0G04940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683024.1"
                     /db_xref="GeneID:11505313"
     CDS             complement(918767..922042)
                     /gene="TDEL0G04940"
                     /locus_tag="TDEL_0G04940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /pro