GenomeNet

Database: RefSeq
Entry: NC_016508
LinkDB: NC_016508
Original site: NC_016508 
LOCUS       NC_016508             833973 bp    DNA     linear   CON 03-APR-2018
DEFINITION  Torulaspora delbrueckii CBS 1146 chromosome 8, complete genome.
ACCESSION   NC_016508
VERSION     NC_016508.1
DBLINK      BioProject: PRJNA79345
            BioSample: SAMEA2272433
            Assembly: GCF_000243375.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Torulaspora delbrueckii (Candida colliculosa)
  ORGANISM  Torulaspora delbrueckii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Torulaspora.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 833973)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 833973)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-DEC-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE616749.
            Accession numbers for all the chromosomes in this genome project:
            HE616742-HE616749.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..833973
                     /organism="Torulaspora delbrueckii"
                     /mol_type="genomic DNA"
                     /strain="type strain:CBS 1146"
                     /db_xref="taxon:4950"
                     /chromosome="8"
     gene            <1355..>1744
                     /gene="TDEL0H00100"
                     /locus_tag="TDEL_0H00100"
                     /db_xref="GeneID:11501741"
     mRNA            <1355..>1744
                     /gene="TDEL0H00100"
                     /locus_tag="TDEL_0H00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683032.1"
                     /db_xref="GeneID:11501741"
     CDS             1355..1744
                     /gene="TDEL0H00100"
                     /locus_tag="TDEL_0H00100"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683080.1"
                     /db_xref="GeneID:11501741"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ25"
                     /translation="MGWPKGLICSYLTTAEHYSLPFKLPDDLWFYAVKFATLMRNSIV
                     TTSTKESPRAKAGLTGLDISTVLPFGQPVIVNKPKTFSKLHSRGWKGYALCPSSISFG
                     YLIYVPGAPQDIIDTRHYRAIRDEVGT"
     gene            <2134..>3018
                     /gene="TDEL0H00110"
                     /locus_tag="TDEL_0H00110"
                     /db_xref="GeneID:11505341"
     mRNA            <2134..>3018
                     /gene="TDEL0H00110"
                     /locus_tag="TDEL_0H00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683033.1"
                     /db_xref="GeneID:11505341"
     CDS             2134..3018
                     /gene="TDEL0H00110"
                     /locus_tag="TDEL_0H00110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683081.1"
                     /db_xref="GeneID:11505341"
                     /db_xref="InterPro:IPR013103"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ26"
                     /translation="MITKKKVSNVPILKPSVKQMVSTSPKLITIATDDENSFEEQNQS
                     EPTSESEWYPSDPLSGGTNNSGEDETSSSEESSPADAPANNMKRKRDDSGEIEDQEGT
                     TSQESPPSSKQRIHYAQVTKNHSETHAERPSLSYKEAITYNSNAEEKENFIAAYEKEI
                     NQLLKMNTWEKDQPIEARDVRKNRILNTMFIFTTKRDGTKKCRFVARGDQQKPENLQA
                     NTVHNYALMTCMAIALDNDMFITQLDISSAYLYAELKEELYIRAPPHLRLKDKVLRLN
                     KSLYGLKQSGANWYQILG"
     gene            complement(<3213..>3533)
                     /gene="TDEL0H00120"
                     /locus_tag="TDEL_0H00120"
                     /db_xref="GeneID:11505342"
     mRNA            complement(<3213..>3533)
                     /gene="TDEL0H00120"
                     /locus_tag="TDEL_0H00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683034.1"
                     /db_xref="GeneID:11505342"
     CDS             complement(3213..3533)
                     /gene="TDEL0H00120"
                     /locus_tag="TDEL_0H00120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683082.1"
                     /db_xref="GeneID:11505342"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ27"
                     /translation="MKNDGEPHAERRSPSYKEAVTLNSNAEEKEKFIAAYEKEIGQLL
                     KMNTWDNDKVVNTRDVRKNKILNTMFIFTTKRDGTKKLRFVARGDQTKNRKTYRTTQC
                     TITH"
     gap             7194..7213
                     /estimated_length=20
     gene            complement(<10267..>12132)
                     /gene="TDEL0H00130"
                     /locus_tag="TDEL_0H00130"
                     /db_xref="GeneID:11505343"
     mRNA            complement(<10267..>12132)
                     /gene="TDEL0H00130"
                     /locus_tag="TDEL_0H00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683035.1"
                     /db_xref="GeneID:11505343"
     CDS             complement(10267..12132)
                     /gene="TDEL0H00130"
                     /locus_tag="TDEL_0H00130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683083.1"
                     /db_xref="GeneID:11505343"
                     /db_xref="GOA:G8ZZ28"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ28"
                     /translation="MATDYGNGSASDKGFHSGSVNEAKKITVDEKMVAEPLDEYGMPD
                     KLKVTKSLVIRKAELMAKQYDTWFLKSLFLFSAFLCSFGYGLDGNIRGIYMTYAMNSY
                     STHSLISTVGVISMVISAVAQVIYAGLSDVFGRLSLFIVSIVFYVVGTIIQSQAYDVQ
                     RYAAGSVFYSVGLVGVMLQVILVLSDNSSLKWRLFYTFVPAWPSIITTWVSGNVIETA
                     NPEDNWSWNIAMWAFIFPLSCIPLIACMLHMRWKVRNEPEWKELQTEKTYYQSHGLIQ
                     TVVQLFWKLDVVGIILLTVGTGCILVPLTLAGGVSTQWQSAKLIAPFVLGFVLIAIFI
                     YWESKLALAPIAPFKMLKDRGIWAPLWIMFLIAFVYQMAAGYLYTILMVAVDETDLSA
                     TRITSLYSFVSAIFAPVLGFIVARSSRLKPYMVLGCSLYFVTMGLFYRYRVGKDAHQG
                     VIGAMVVWGICSCLFDYPVTVSIQSVTSHENMATVTALSYTIFSIGGAVAASVSGAIW
                     TQLLYPKLLEYIGDADLAEAAYSSPLTFYLDYPWGTPIRDAMVEAYKHVQKYEVLIAL
                     VFTAPMFILTFCLRDPSLTDDVAQKLNDGEYVETSHDDPISEWVTSRFSKLRHRE"
     gene            complement(<13162..>13797)
                     /gene="TDEL0H00140"
                     /locus_tag="TDEL_0H00140"
                     /db_xref="GeneID:11505344"
     mRNA            complement(<13162..>13797)
                     /gene="TDEL0H00140"
                     /locus_tag="TDEL_0H00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683036.1"
                     /db_xref="GeneID:11505344"
     CDS             complement(13162..13797)
                     /gene="TDEL0H00140"
                     /locus_tag="TDEL_0H00140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683084.1"
                     /db_xref="GeneID:11505344"
                     /db_xref="GOA:G8ZZ29"
                     /db_xref="InterPro:IPR001424"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ29"
                     /translation="MVYINRAFQVLAIASFAVADDAPVKTNSPESAKYIAKFSDNIEG
                     SVVFSTTSNSTVKVDVDFDGLPSDGGPFAYHVHVVQVPSDGNCTATLGHLNPYDGSVN
                     ATSPAAKEVGDLSGKHGVIDDQSYQTSYIDEYISLEETDPAFVGNRSIVVHFANNTRL
                     ACANITEYSVSSNSSSNSSNSTVTSGNAAVANYGNAPVLLGAVAAAVGLLI"
     gene            <15728..>16606
                     /gene="TDEL0H00150"
                     /locus_tag="TDEL_0H00150"
                     /db_xref="GeneID:11505345"
     mRNA            <15728..>16606
                     /gene="TDEL0H00150"
                     /locus_tag="TDEL_0H00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683037.1"
                     /db_xref="GeneID:11505345"
     CDS             15728..16606
                     /gene="TDEL0H00150"
                     /locus_tag="TDEL_0H00150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683085.1"
                     /db_xref="GeneID:11505345"
                     /db_xref="GOA:G8ZZ30"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ30"
                     /translation="MTFKVSLTAPAEQAEDPLQPPTEQYNKKKPFLDLFSQKNKLVVI
                     TGASGAIGGAICEGFASAGADLCLLDYQYDPKREQQLMEEFDIKAKAYQVDITDADEV
                     RRCINSIREDFQGRDIDSFIANAGIAWTAGSILNEAATPETWKRVMDVNVQGTYHCSK
                     YIAEVFKSQGHGSMVLTASMSSYISNVPNYQTCYNASKAAVRHMAKGFAVEFAHLTKP
                     AGKIRCNSVSPGYTDTILSSFVPVEQRAQWWGLTPVGREALPQEIVGAYLYLASDAAS
                     FTNGADIVVDGGYTCV"
     gene            complement(<16735..>18462)
                     /gene="TDEL0H00160"
                     /locus_tag="TDEL_0H00160"
                     /db_xref="GeneID:11505346"
     mRNA            complement(<16735..>18462)
                     /gene="TDEL0H00160"
                     /locus_tag="TDEL_0H00160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683038.1"
                     /db_xref="GeneID:11505346"
     CDS             complement(16735..18462)
                     /gene="TDEL0H00160"
                     /locus_tag="TDEL_0H00160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683086.1"
                     /db_xref="GeneID:11505346"
                     /db_xref="GOA:G8ZZ31"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ31"
                     /translation="MTPLMDKYTDRHHPDYIPGTFNIYSSPDSESDVKSGSTTGRLKT
                     DKNGVVLIPQPSDSPNDPLNWSKWRKFLHFGLMAFITAFTAATSNDAGATQDSLNEYY
                     GISYDSMNVGAGVLFLGIGWATLFTAPLASLYGRKITYLICTILGLFGALWFALAKRT
                     SDTIWSQLFVGISESCAEAQVQSSLNDIYFQHQMGSILTVYILCTSIGTFLGPLIAGY
                     IASLTNFRWVGWVAVIISGGLLIALIFGCEETYFDRNKYITPLTYGGNPFGDDCADDR
                     SSVGLNEKANKPIEQADVAGESEVHELSPPADQLIDGASEKLKPYHKRVALITKGSNL
                     KGWGFKQYPKFVLFNLRMMLYPPVWLSGLFWGIQDVFLTFYLTTEESYYYDPPWNYSD
                     YGVAIMCVPTLIGAVIGCIYAGIVSDYFVLWMARKNNGILEAEYRLYFSFATAFIGPA
                     GLLMFGIGTERALSWQVIYVGLGFIGFSWGCSGDIAMAYLMDCYPEMVLEGMVCTAII
                     NNSISCIFTFVCSDWLSASGTENTYIALAVINFAITLLALPSFIYGKRIRLWTKKWYN
                     DSVDLRDFL"
     gene            <19030..>19596
                     /gene="TDEL0H00170"
                     /locus_tag="TDEL_0H00170"
                     /db_xref="GeneID:11505347"
     mRNA            <19030..>19596
                     /gene="TDEL0H00170"
                     /locus_tag="TDEL_0H00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683039.1"
                     /db_xref="GeneID:11505347"
     CDS             19030..19596
                     /gene="TDEL0H00170"
                     /locus_tag="TDEL_0H00170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683087.1"
                     /db_xref="GeneID:11505347"
                     /db_xref="GOA:G8ZZ32"
                     /db_xref="InterPro:IPR008253"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ32"
                     /translation="MSETKYSPMRAGWTSSRFLTFPLRILQLLVSAASLGLFAWLTYH
                     WENTQVHFGLALSALSVLYLLTLPLYSFSSAGSLFICEFVFFLLWLAAFILFTYLFHD
                     CYSWGTRRTEFHNTRCKVCFATIGTSGALMLLFDFTYALCLHNILLPITYSVGRNYLW
                     VPFSSFGARLSRGNALSVSHARTLHSPV"
     gene            <19833..>20606
                     /gene="TDEL0H00180"
                     /locus_tag="TDEL_0H00180"
                     /db_xref="GeneID:11505348"
     mRNA            <19833..>20606
                     /gene="TDEL0H00180"
                     /locus_tag="TDEL_0H00180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683040.1"
                     /db_xref="GeneID:11505348"
     CDS             19833..20606
                     /gene="TDEL0H00180"
                     /locus_tag="TDEL_0H00180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683088.1"
                     /db_xref="GeneID:11505348"
                     /db_xref="GOA:G8ZZ33"
                     /db_xref="InterPro:IPR008253"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ33"
                     /translation="MSEVKTQPTVLAKPVGWCSSLVWARVIRVLQLLFTIVALALCAR
                     TSDFYEAPSEVAYATAVSVFSLVYLLAIFLGTLFGGPYFMVGPLLVSEIIMLIMWFAA
                     FIAMAVFAGGAPCSFYFYSSRCREAKAAIAMCAFNMVLYAASLTLLVLNCVIPLISSH
                     GAPYLWRYASDADATFDQGTGLLIYSSNTWVADPEADVNRQITASSVETPVGVEKPIE
                     ESDQALFQGTLVAEPIIPDPTLTTTADPAIDVPLNAHVR"
     gene            <22076..>22909
                     /gene="TDEL0H00190"
                     /locus_tag="TDEL_0H00190"
                     /db_xref="GeneID:11505349"
     mRNA            <22076..>22909
                     /gene="TDEL0H00190"
                     /locus_tag="TDEL_0H00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683041.1"
                     /db_xref="GeneID:11505349"
     CDS             22076..22909
                     /gene="TDEL0H00190"
                     /locus_tag="TDEL_0H00190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683089.1"
                     /db_xref="GeneID:11505349"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ34"
                     /translation="MTQKKTLEQFIKECRAVHGNKYDYSITKYTNWESKIEYICSLHG
                     VQSQPAQHHRKGRGCNKCGRERTKKAFAYTTELFIEACNKKHNNRYNYPNTVYIDYNS
                     EVKIECELHGEFIQMASYHLRGSGCQKCGFFNKAPGPLVKPTNGEEFISLSIEVHGSQ
                     YDYSQVEFTKYYSSVTIVCLIHGSYKCVPTSHLKGIGCATCQSFDAFVKKASSMHKGK
                     FEYDKSTYIRSKSKMRIVCRDHGEFWEAPGEHTRRRGQGGVPLFCMLPREQANFSPGG
                     H"
     gene            complement(<23587..>24558)
                     /gene="TDEL0H00200"
                     /locus_tag="TDEL_0H00200"
                     /db_xref="GeneID:11505350"
     mRNA            complement(<23587..>24558)
                     /gene="TDEL0H00200"
                     /locus_tag="TDEL_0H00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683042.1"
                     /db_xref="GeneID:11505350"
     CDS             complement(23587..24558)
                     /gene="TDEL0H00200"
                     /locus_tag="TDEL_0H00200"
                     /inference="similar to DNA sequence:INSDC:YGR144W"
                     /note="similar to Saccharomyces cerevisiae THI4 (YGR144W);
                     ancestral locus Anc_5.141"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683090.1"
                     /db_xref="GeneID:11505350"
                     /db_xref="InterPro:IPR002922"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ35"
                     /translation="MSTTTQTETAQLQLNAGSIRHALSDVVKTDDWSDFKFTPIREST
                     VSRAMTSRYFKDLDKHAVSDVIIVGAGSSGLSAAYVIAKNRPDLTVTIIEASVACGGG
                     SWLAGALMSAMIIRKPGHLFLEELKIPYEDEGDYVVVKHAALFITTVISEVLKFPNVK
                     LFNATAVEDLVTRPDGPNGELTVAGVVTNWTLVTQAHGTQCCMDPNVIELSGYKNDGT
                     RDPSAKHGVILSTTGHDGPFGAFSAKRIVSIDENQKLGGMKGLDMNHAEADVVKNAGK
                     YNGVNSMYFAGMEVAELAGCNRMGPTFGAMLVSGIKAAEEILKHFAE"
     gene            complement(<25089..>27215)
                     /gene="TDEL0H00210"
                     /locus_tag="TDEL_0H00210"
                     /db_xref="GeneID:11505351"
     mRNA            complement(<25089..>27215)
                     /gene="TDEL0H00210"
                     /locus_tag="TDEL_0H00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683043.1"
                     /db_xref="GeneID:11505351"
     CDS             complement(25089..27215)
                     /gene="TDEL0H00210"
                     /locus_tag="TDEL_0H00210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683091.1"
                     /db_xref="GeneID:11505351"
                     /db_xref="InterPro:IPR021988"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ36"
                     /translation="MGSSRKPTFRQKAQDAVGLLSTEKVSRSAKFFQGWFANFWSRLS
                     MLLFRRRSNFLLLLLIIVGALVTRVAVTTPQHFDRLYGSKSLRNTDFVERKPELLHVD
                     ISELLKRRQWSSSPITERMLNQEYLSEKVTGFVSNLDLSKLLTKKGKKSEKERQKIES
                     KLNLNQYKDLATCPDLAYISQVYHSKDKILLEDDLKECRRKLLETPSFLWTAVKDEED
                     EKDMTENEVVQKRWFQFGTSAVWLESEQCYLAYSRVIYSTIGVRSQPRVSLVRGQAFD
                     KNWKEIKGKRIPYVDVPIPDDMEESLKKIDHELGIRDCSDLPSDSSAHDTCVVENAKN
                     RLVAQSRKERILSKYYMTYPAIVDIPFAPVGEWKGPEDPHVILRKANGYEEPVIVFNI
                     WDDELSRRIMVTHMPQRKIDPLLKMSILGREQRGVEKNWTPFFHKNLGESSMSRGFIH
                     FIYSFSPLEILKCSLNDGFCELVFGAETLRIKEENRFGGFRGGTQFVSLPDVLPQIKG
                     QQIWVGFPKQHIEGCGCADAFYRPMFSILVEHDGVYSQELLVPALGFNIDVLSWDLTD
                     TYCDEKNVISPNSIAQWDVIRQDTHTKQYEDYLTLTISESDINTRVVTLKGMLNYILG
                     MYKEKELQEKFEISDEADVIIGQTLKCLKDSAFDYCKVYGADHKKPEEEKEEEEENHE
                     EEEQHPEDKENKEKEDDQAAEGEDED"
     gene            complement(<27687..>29141)
                     /gene="TDEL0H00220"
                     /locus_tag="TDEL_0H00220"
                     /db_xref="GeneID:11505352"
     mRNA            complement(<27687..>29141)
                     /gene="TDEL0H00220"
                     /locus_tag="TDEL_0H00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683044.1"
                     /db_xref="GeneID:11505352"
     CDS             complement(27687..29141)
                     /gene="TDEL0H00220"
                     /locus_tag="TDEL_0H00220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683092.1"
                     /db_xref="GeneID:11505352"
                     /db_xref="GOA:G8ZZ37"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ37"
                     /translation="MWKRSTMSAKYTSMYNAEEGEEFRDPENVSLVDKNGLADATTVT
                     SSCNADEEEFNQNFRTCSWQHTAGLMLSEYIVLAIMSFPWSYSVLGLVPGLILTVFVA
                     VTVLYTGLIITDFCERFPHLRNVCDIGQYLLGGGRWAWYATAFCFLANNTLIQGLHVL
                     VGAKYLNTVTNHSICSVGFTAIVAGISMIFSLPRTFSAMSWVGYFSAATMFIAVVLAM
                     VFAGVQGHPDKFDGTPVVFRAFPAEGTSFVDGMSAFLNIVYTFVGQITYPQFISEMKN
                     PREFKKVLWIVTTCEVIIFALAGSIMYVYVGNAYMTGPAFGSLIRKYKIISFSFAIPT
                     IIFVGALYANISAKLVYDQIFKNTRHRYSWTSTSWIFWTLVLFMTWVMAFIIAEVIPF
                     FSDLLSLMSSLFDCWFGFVFWGLAYIRLRKVKYGGHSNLTKWEKLNYGISYFLIATGL
                     YILGPGLYASVQSIINNYKADAYGGVFSCASNGI"
     gene            complement(<29519..>30619)
                     /gene="TDEL0H00230"
                     /locus_tag="TDEL_0H00230"
                     /db_xref="GeneID:11505353"
     mRNA            complement(<29519..>30619)
                     /gene="TDEL0H00230"
                     /locus_tag="TDEL_0H00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683045.1"
                     /db_xref="GeneID:11505353"
     CDS             complement(29519..30619)
                     /gene="TDEL0H00230"
                     /locus_tag="TDEL_0H00230"
                     /inference="similar to DNA sequence:INSDC:YPR191W"
                     /note="similar to Saccharomyces cerevisiae QCR2 (YPR191W);
                     ancestral locus Anc_7.548"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683093.1"
                     /db_xref="GeneID:11505353"
                     /db_xref="GOA:G8ZZ38"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ38"
                     /translation="MSTRLQFAKQALRRYTVSATDGSGKISSLAVKVHAGSRYATKDG
                     VSHLLSRFNFQNTSGKSALRLVRESELLGGKFESSVSREYITLKATFLKEDLPYYVNA
                     LGNVLYKTSFKAHELKETVLPAAHHDLLVAQTCPLKKAEELLYNVTYRKGLGNTVLYD
                     GVEKVTLEDIKEFADKVYTKENIEIVGHGVNEADLKKFVADSLLSSLPNGTPLAASVA
                     PKTYSGESRARFADADSVAAIAVPVTKEKFGQYEVLARYLTSPLSDLSSVVHSAKLQR
                     FQDAGLFALYVKGPDAATVAQDLKRVVSELKKGKDLSVAKEYAALKIALDNDGCSVPA
                     ELKIDNVGNFKLGDFNYVAVGDVSKLPFADEL"
     gene            <31302..>33200
                     /gene="TDEL0H00240"
                     /locus_tag="TDEL_0H00240"
                     /db_xref="GeneID:11505354"
     mRNA            <31302..>33200
                     /gene="TDEL0H00240"
                     /locus_tag="TDEL_0H00240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683046.1"
                     /db_xref="GeneID:11505354"
     CDS             31302..33200
                     /gene="TDEL0H00240"
                     /locus_tag="TDEL_0H00240"
                     /inference="similar to DNA sequence:INSDC:YPR190C"
                     /note="similar to Saccharomyces cerevisiae RPC82
                     (YPR190C); ancestral locus Anc_7.547"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683094.1"
                     /db_xref="GeneID:11505354"
                     /db_xref="GOA:G8ZZ39"
                     /db_xref="InterPro:IPR008806"
                     /db_xref="InterPro:IPR013197"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ39"
                     /translation="MTSVAPVGDPQVSTTQPGPNDDTVTISSLEQRTLSPEWFLYTEL
                     ARFHLGERASSIIDVLLSKGRLSVFEIQERLPDLDTRSIRTTLVSLIQLRCVKYWEET
                     TPTGRTITYYYANEDGLLLFLYSGLIIDEVSQQFQQSKLAAQIMQNILTLGSVTTEDF
                     LQNCKDSKNEIISVFVQLCENEFLSPLTKLHYTPISDLWNHLYLKEYNAIPRTSTLSD
                     LKKRTEAKGKAKIEFQRLTNAARDTSSILTVDPETSLRSVVNTVPLVVNLERFLKTRR
                     SKHLVKYVGTRIGSISAEIYKVALKLTEKKTPPLVDPLTQTGILQELDEAKAIEEELE
                     LAEEKTQGIAFNALDISKYLPASLDLRGSIVSSTKRDKASRGASDSQSTKRLKTEDGF
                     VIPALPNSVKEEDDGEEDINLDLDDIDEDDADPHSASLITNHLKLLASSSIPFLKETR
                     PGVYYVPYSKLVPVLRSSIYDYLLASTLGPSAMRIRRCVCANSLISEKVINSTALMKE
                     KDIRSTIASLVKYNVVEIQEVPRTADRAASRAVFLFRSKERHAYDFMKQNLAWNIGNL
                     LYKKEKLKEQNVDLLTKANRDDVKGRETELLLPSELNQLKMVNERELNIITRMCRVLS
                     LWEVFKLF"
     gene            complement(<33258..>37451)
                     /gene="TDEL0H00250"
                     /locus_tag="TDEL_0H00250"
                     /db_xref="GeneID:11505355"
     mRNA            complement(<33258..>37451)
                     /gene="TDEL0H00250"
                     /locus_tag="TDEL_0H00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683047.1"
                     /db_xref="GeneID:11505355"
     CDS             complement(33258..37451)
                     /gene="TDEL0H00250"
                     /locus_tag="TDEL_0H00250"
                     /inference="similar to DNA sequence:INSDC:YPR189W"
                     /note="similar to Saccharomyces cerevisiae SKI3 (YPR189W);
                     ancestral locus Anc_7.546"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683095.1"
                     /db_xref="GeneID:11505355"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ40"
                     /translation="MSTVKELLKEAKTELAREDYEEAVSISKKVLNLDQSNYFAQVFL
                     GKSYSCIEGKSKDSVEHYKAAIELAPDNLLAWKGLIQFLNSPNIVPDVVSYDEYFDLS
                     SEYARLLLEQEQSQVELIHNIRTFIKKVPGSKESFLWHMIPGSPTAERLGRHLITPQE
                     ALRKLISILDANQKVHISKIVSRERLKLSAQDPEYQMKMNSLAWDVYKDSRIEFLYNQ
                     LVNITDDDDLRAELESEWLEYRILVLKSMPKELKSSYFIDVKRMVEDMVLVDHRSPLA
                     WKLFFEWQDYSDLDNMDQQLILKFFKKFPIEPLAIILYAWLSSIFSKYDMKKLNITPN
                     QSIEHEDARDLADFDEGEKNALNEMMEKENEVAGLLEEEVVDALLENISKAQNSILAN
                     RVVSQYYVYSREYEAALPYVKTGISVIAYKIRDLGGRFVNSKKQFTLSLAILYTYIDA
                     PKNHNAAMSLFEKVLTDDPENTHAKLGKGLIFVEREEWANANALLNEVALEFPNNMEV
                     MSELGWNEAQLGNLEHALSIFKSVLENIEGTDLRAVEFRALNIWRQAKVHIMIEQREP
                     TKDHDNVRYAFKQLVSSIKILDTFSASYSTLGDIYSIFFSDKARAFKCYYKAFELDAG
                     DIVAAKYMSENYADLSNWQAASTVAKRLLGSEKAKRKSKEVNWAYRVVGIFYLETQEE
                     ASSIEWFQSALRIDPKDVESWVGLGQAYYACGRIEASMKVFERALELDSEHQHCRYLK
                     AQSLAALGQFVDSIQVLRDIAAVAPSEEIYQVALASALVSYALDLYSQGLLKKAMSVA
                     ENVIEVLQYATTELGCHAQNLWLALMRSLNLYVLVASEVDRLPIESLVSICNSAKISD
                     FTKELDDQDEVTLDNLLSGNDDSNISIACKFLILSAKYAVSTAAFDQLPRTARSSLWY
                     NVGSAELTAYNISKQMNYRDAAITSYKKSIQYQSNTPESWIGLGIATMDVNYRVAQHC
                     FIKASALAPKELDVWFNLAMLALKNNDVEFAREVLKRSQSLSPQSSSPWLGIALINER
                     EGDLVESYKMFGHAFVLSNGRSKAAQLLYAKSVLQHRIGNSTDERDLEVVEELTAAAY
                     GLDQYFKENPDDDFALQCALLIFERLRIFSKAQDAALKLAESLEAKFERAQDEKALFN
                     YAVIKSQTARIQLGFGNYTAAIDDANVSQSVLTEFDDDERSTVTLSNHVSLALAYFFS
                     GDFDETLQHLQELLKLSKISRHLIILIAKILYEVGSDDAKDIALEELMEYVGVNGADL
                     PVSLTIAAISILENRKGDLNTILAEFTELPLSDLIADKHRDVPYLIEQIKNRLEIQTD
                     AKSTWQRACFLFMNDHKAWLSVDQKIEQRISADGQNKVTAQQLSESYCAQRDLRTIQR
                     SLFLCPTNLTALQSLRQCF"
     gene            <37579..>38058
                     /gene="TDEL0H00260"
                     /locus_tag="TDEL_0H00260"
                     /db_xref="GeneID:11505356"
     mRNA            <37579..>38058
                     /gene="TDEL0H00260"
                     /locus_tag="TDEL_0H00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683048.1"
                     /db_xref="GeneID:11505356"
     CDS             37579..38058
                     /gene="TDEL0H00260"
                     /locus_tag="TDEL_0H00260"
                     /inference="similar to DNA sequence:INSDC:YPR188C"
                     /note="similar to Saccharomyces cerevisiae MLC2 (YPR188C);
                     ancestral locus Anc_7.545"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683096.1"
                     /db_xref="GeneID:11505356"
                     /db_xref="GOA:G8ZZ41"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ41"
                     /translation="MQSSESLNFSQLSQNHIKTLKDAFQMLDDDGDSRVSQKDLKTMY
                     RSIGKQLTDEQANEMLQVEGSEDKNGISFPEYLAVMSKTVGEFPEDSEIIDCLKTLSG
                     NDDLQIPLDELVQQLREAGFQDPESEFEKIFKDFTARNQVVEGKTFKGSQFMDMISD"
     gene            complement(<38116..>38678)
                     /gene="TDEL0H00270"
                     /locus_tag="TDEL_0H00270"
                     /db_xref="GeneID:11505357"
     mRNA            complement(join(<38116..38575,38659..>38678))
                     /gene="TDEL0H00270"
                     /locus_tag="TDEL_0H00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683049.1"
                     /db_xref="GeneID:11505357"
     CDS             complement(join(38116..38575,38659..38678))
                     /gene="TDEL0H00270"
                     /locus_tag="TDEL_0H00270"
                     /inference="similar to DNA sequence:INSDC:YPR187W"
                     /note="similar to Saccharomyces cerevisiae RPO26
                     (YPR187W); ancestral locus Anc_7.544"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683097.1"
                     /db_xref="GeneID:11505357"
                     /db_xref="GOA:G8ZZ42"
                     /db_xref="InterPro:IPR006110"
                     /db_xref="InterPro:IPR006111"
                     /db_xref="InterPro:IPR012293"
                     /db_xref="InterPro:IPR020708"
                     /db_xref="InterPro:IPR028363"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ42"
                     /translation="MSDYEEVFNDGAENFEDFDVEHFSDDGEFGGPNVNGGSEAPGEV
                     KAENGHTVITGGNGPDDYQNHEQTRRKTLKEKAIPKDQRITTPYMTKYERARILGTRA
                     LQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL"
     gene            <38901..>40175
                     /gene="TDEL0H00280"
                     /locus_tag="TDEL_0H00280"
                     /db_xref="GeneID:11505358"
     mRNA            <38901..>40175
                     /gene="TDEL0H00280"
                     /locus_tag="TDEL_0H00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683050.1"
                     /db_xref="GeneID:11505358"
     CDS             38901..40175
                     /gene="TDEL0H00280"
                     /locus_tag="TDEL_0H00280"
                     /inference="similar to DNA sequence:INSDC:YPR186C"
                     /note="similar to Saccharomyces cerevisiae PZF1 (YPR186C);
                     ancestral locus Anc_7.543"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683098.1"
                     /db_xref="GeneID:11505358"
                     /db_xref="GOA:G8ZZ43"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ43"
                     /translation="MLTDLRDVKGEIEELKDPGSFCLSRSNTSDSLNSLSSITSSTAS
                     TARAKSYFCDYDGCNKAFTRPSLLTEHQEVVHQGKKRYICDECHRSFSKKSHLERHVY
                     VHSQDKPLHCSSCGKGFTTGQQLRRHEITHTKSFKCPYDECNESFYKHPQLRSHILAV
                     HEKKLSCKICNKEFQRPYRLQNHMVKHHNPVLENPYQCSFASCAKSFKTWSQLQTHVK
                     SDHPKLRCPVCEKPCVGESGLQMHMKVHDESLVTRNWKCQICDNMSFARKSSMLEHYA
                     QEHIEEHAKLLVEQTRSVGIIDERDFDRATEISNQQVKRRKISEMGLLKSQAKLHQYF
                     AEGKGGLHLLLNTVGRKLRCPYDKCYRTFKTEEKFQKHLDKHKIHQLKLKVLKEKMES
                     SRNEASAGHREDEAFDDSQVANDEKNAKLTNS"
     gene            complement(<40466..>42475)
                     /gene="TDEL0H00290"
                     /locus_tag="TDEL_0H00290"
                     /db_xref="GeneID:11505359"
     mRNA            complement(<40466..>42475)
                     /gene="TDEL0H00290"
                     /locus_tag="TDEL_0H00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683051.1"
                     /db_xref="GeneID:11505359"
     CDS             complement(40466..42475)
                     /gene="TDEL0H00290"
                     /locus_tag="TDEL_0H00290"
                     /inference="similar to DNA sequence:INSDC:YPR185W"
                     /note="similar to Saccharomyces cerevisiae ATG13
                     (YPR185W); ancestral locus Anc_7.542"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683099.1"
                     /db_xref="GeneID:11505359"
                     /db_xref="GOA:G8ZZ44"
                     /db_xref="InterPro:IPR018731"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ44"
                     /translation="MMVSYNTDKEIIELIDNFFVKTTSLICAAKSTKYQTSSDLPSEF
                     DEEWLLSETDADLELPEIIRQWSQFDGEKDLPPLVIETYLDLRQVGPSQWVTLRDEDG
                     NMWNVCKGTKKSEIVLERWLIELDKSSASFKGHKPTVEDSTGLSSQLILLFRYLYTLI
                     QLLPANDLHVNLSKLSEIQGSMPALQISTRVLDGSKPILSKGRIGLSKPIISTYSNVI
                     NESNVPSHLEQRKITSVWTKFGLLRISVSYRHDCHFELHDTEEDYTSNQYIPEAMVKR
                     LASNRSPSLSPQAHAGSLSSMDRPSSQRRPVAISRQLQMFKVGSVGSVPTFQSQTLTR
                     NPSSSSSVVANLQAQRTNNSPIPTNPTLQSQEMHVEGTSVGSASKYSSSFGRIRRHSS
                     TKQTEHTERLAKSSKQPEDQSDTLLDFVKLIDEKPELKFNKNRSVTVDISNSLMKFQS
                     LKPTNDFISENLSLSTSMDPSHASQRRRSSSHSPMPSFSPAVNYPSIPSRLSQADLNE
                     DAGDNRRSSTETHRPSGVSFHGSSVSSQRQSLGSKGSFQYNASPQDVNASNDNEDDDE
                     DDLLMHQTVLGKSGLKNYTSPMSMESVASSIPKNRLSIPQPSQYSQPTTIAVPAYAKL
                     HRPGMERTESQATGKRRNSEGVLGGEEEEDEDLLFFMSDMNLSKM"
     gene            complement(<42956..>47536)
                     /gene="TDEL0H00300"
                     /locus_tag="TDEL_0H00300"
                     /db_xref="GeneID:11505360"
     mRNA            complement(<42956..>47536)
                     /gene="TDEL0H00300"
                     /locus_tag="TDEL_0H00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683052.1"
                     /db_xref="GeneID:11505360"
     CDS             complement(42956..47536)
                     /gene="TDEL0H00300"
                     /locus_tag="TDEL_0H00300"
                     /inference="similar to DNA sequence:INSDC:YPR184W"
                     /note="similar to Saccharomyces cerevisiae GDB1 (YPR184W);
                     ancestral locus Anc_7.541"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683100.1"
                     /db_xref="GeneID:11505360"
                     /db_xref="GOA:G8ZZ45"
                     /db_xref="InterPro:IPR006421"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR010401"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR029436"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ45"
                     /translation="MDRTVLLRLSDSGEPLVSCAYGKGVLTLPSLPLPKDWSLKSPLF
                     TVRLLVGAGSPVARDGLVWHNCPPDAGTGFDRNRFYKRRISTSFHRDDMIDLPVYSPG
                     PYCFYLSFRNEHEVLETTRKFYFVVPPTLQINGHSMQLDSIALQSVISKWMGSDWDKV
                     FARIAAKGYNMIHFTPLQERGESNSPYSIKDQLKFDPDYFQDEEQVHRMVSGLQKKYN
                     MLSLTDIVFNHTANNSPWLLEHPDAGYSAETAPHLTAAIELDRQLLEFSSNLKRLGYP
                     VDLKNTDDLFKVMDGIKVHVLGSLKLWEFYVVDVPGTVDSVKKLWDDASSEESPLEVP
                     SDIVKDNFVQIAEFVRAHATAEEFGGLAGRNGNQIDTKRFIKVLKNLYGESFENEILD
                     HAHKILDEVNLPLYQSYDDDVSEILEQLFNRIKYLRIDDHGPKQGPITDKLPLTEPYF
                     TRFRANDGREYALANNGWIWNGNPLVDFASNKSRAYLRREVIVWGDCVKLRYGRGPQD
                     SPYLWERISKYVKINAKIFDGFRIDNCHSTPLHVAEYFLDLARSVNPNLYVVAELFSG
                     SETMDCLFVERLGISSLIREAMQAWSVDELSRLIHKHGGRPIGSYKFLPLDNFPFPAD
                     LETNQNFHEPRSGYISSASEILIPKILTAAPPHALFMDCTHDNETPYQKRTVEDTLPN
                     AALVALCSSAIGSVYGYDEIFPELLDLVQEKRVYDVKDGNGIGEVKSKLNGIRAEISQ
                     LGSDIEDAEMHVHHAGQYITFHRTDAKTGSGWYLVARTKFDEGGEEQPLPQLQLSQTA
                     CKFQFAYSLKKNGEVPHDEKLLKGIPTKLVEIKAVQTDFDSAKKISIITVNEAFPQGS
                     IAIFKTQQLGVDESLDQFIRSQALKATANVDLDSLNSILYRSEPEEYDSSAGRNGAYD
                     IPNYGKLVYCGLQGWVSVLHPIIFSNDLAHPLSENLRNGPWAFDYIINRLGSYRDGAG
                     VTDVQTWLRDRFDRIRDIPHYLAPSYFALVIGLLYGCCRFRAMQLMSANIGKSTLFVQ
                     SLSMTSIQMVSRMRSTSILPKENVPAMAAGLPHFSTDYMRCWGRDVFISLRGLLLTTG
                     RFDEAKSHILAFAKTLKHGLIPNLLDAGRNPRYNARDAAWFFFQAIQDYVDIVPSGES
                     ILKEKVTRRFPLDDTYITFDDPKAFSYSSTLEEVMYEILVRHAKGIKYREANAGPNLD
                     RVMKDEGFNVEVHVDWSTGLIHGGSQFNCGTWMDKMGESEKAGSVGVPGTPRDGAAVE
                     INGLLKSALRFVNELNENGKFKFTKVEKEDGTEISLKEWEKLLLNNFEKKFYVPEDPA
                     DDCKYDIDSKIVNRRGIYKDLYRSGKPYEDYQLRPNFAIAMAVAPELFTPKLAVHAIN
                     EADKILRGPVGMRTLDPSDYNYRPYYNNGEDSEDFATSKGRNYHQGPEWVWLYGYFLR
                     SFHRFNFLTDPRAQNDAKTAPSSYLYQQLFSRMVKHTEWIAESPWAGITELTNKDGQL
                     CNDSSPTQAWSTGCLLDLFYDLWSKYEDSSDH"
     gene            complement(<47678..>48478)
                     /gene="TDEL0H00310"
                     /locus_tag="TDEL_0H00310"
                     /db_xref="GeneID:11505361"
     mRNA            complement(<47678..>48478)
                     /gene="TDEL0H00310"
                     /locus_tag="TDEL_0H00310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683053.1"
                     /db_xref="GeneID:11505361"
     CDS             complement(47678..48478)
                     /gene="TDEL0H00310"
                     /locus_tag="TDEL_0H00310"
                     /inference="similar to DNA sequence:INSDC:YPR183W"
                     /note="similar to Saccharomyces cerevisiae DPM1 (YPR183W);
                     ancestral locus Anc_7.540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683101.1"
                     /db_xref="GeneID:11505361"
                     /db_xref="GOA:G8ZZ46"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ46"
                     /translation="MAITNSIIVPAYKEKLNIKPLTTRLFAALGNEACKTTELIFVDD
                     NSQDGSVEEVEALKKSGYNVRIIVRTDERGLSSAVLRGFHEAQGEYLVCMDADLQHPP
                     ESVPQLLESLRSHPFAIGTRYAPGVGIDKDWPLYRRVISSTARAMAKPLTSASDPMSG
                     FFGLQKKYLTDADPASINSQGFKIALELLAKLPLPRTASAVGEVPFSFGVRTEGESKL
                     SGKVVVQYLVQLKELYCFRYGANNLVLFVVFWAILVIYALYQLYSLVF"
     gene            complement(<48623..>48874)
                     /gene="TDEL0H00320"
                     /locus_tag="TDEL_0H00320"
                     /db_xref="GeneID:11500897"
     mRNA            complement(<48623..>48874)
                     /gene="TDEL0H00320"
                     /locus_tag="TDEL_0H00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683054.1"
                     /db_xref="GeneID:11500897"
     CDS             complement(48623..48874)
                     /gene="TDEL0H00320"
                     /locus_tag="TDEL_0H00320"
                     /inference="similar to DNA sequence:INSDC:YPR182W"
                     /note="similar to Saccharomyces cerevisiae SMX3 (YPR182W);
                     ancestral locus Anc_7.539"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683102.1"
                     /db_xref="GeneID:11500897"
                     /db_xref="GOA:G8ZZ47"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR016487"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ47"
                     /translation="MSFTPVNPKPFLRELVDQPVVVTLKFNSTQYRGTLVSTDNYFNV
                     RLRDAEEFVDGRSRGTVGEIFVRCNNVLWIGQPQPEAAE"
     gene            complement(<48970..>50151)
                     /gene="TDEL0H00330"
                     /locus_tag="TDEL_0H00330"
                     /db_xref="GeneID:11500898"
     mRNA            complement(<48970..>50151)
                     /gene="TDEL0H00330"
                     /locus_tag="TDEL_0H00330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683055.1"
                     /db_xref="GeneID:11500898"
     CDS             complement(48970..50151)
                     /gene="TDEL0H00330"
                     /locus_tag="TDEL_0H00330"
                     /inference="similar to DNA sequence:INSDC:YLR459W"
                     /note="similar to Saccharomyces cerevisiae GAB1 (YLR459W);
                     ancestral locus Anc_7.538"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683103.1"
                     /db_xref="GeneID:11500898"
                     /db_xref="GOA:G8ZZ48"
                     /db_xref="InterPro:IPR009600"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ48"
                     /translation="METPERWVVLVCVAVRMIVSLSFPQLQQQLDKSVEFSTPFTSYR
                     SLREGVYMLKQGFELYNGGVIHHSPLLVVLMSLIEPEFLVSLLYACLDALIAYQLACI
                     ARCFSKSITIPAWIPCLLYSLNPLALLSCVSRSSVIFTNVCISTAVLHALQGNVLVAS
                     VAIATAGYLSLYPLLLVFPLFAIFETRSSRVKAAAITSFTVAVLLTLSYTACGNNWAF
                     LDATYGSLVRFDKLFPNLGLWWYFFAEMFDAYVPFFKAVFNIVVVSFIAPLTVRFYRQ
                     PCYAFVLCVGWITLTKPYPTLGDAGFLLGFLPLFHPLFGYLRYSALSCLLFLHAVVLS
                     PIFYHLWVDLGSGNSNFFYAITLVYALAIASIVADLCWAMLRFEYDHGKPNYQLKVTQ
                     I"
     gene            <51772..>54045
                     /gene="TDEL0H00340"
                     /locus_tag="TDEL_0H00340"
                     /db_xref="GeneID:11500899"
     mRNA            <51772..>54045
                     /gene="TDEL0H00340"
                     /locus_tag="TDEL_0H00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683056.1"
                     /db_xref="GeneID:11500899"
     CDS             51772..54045
                     /gene="TDEL0H00340"
                     /locus_tag="TDEL_0H00340"
                     /inference="similar to DNA sequence:INSDC:YPR181C"
                     /note="similar to Saccharomyces cerevisiae SEC23
                     (YPR181C); ancestral locus Anc_7.537"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683104.1"
                     /db_xref="GeneID:11500899"
                     /db_xref="GOA:G8ZZ49"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ49"
                     /translation="MDFETNEDINGVRFSWNVFPSTRTDANKNVVPVGCLYTPLKEYD
                     ELQVAPYNPVVCAGPQCKGILNPYCAIDPRNNSWTCPICNSRNHLPAQYANMTQENMP
                     IELQHATVEYITNRPVQIPPIFFFVVDITAEQENLDALKESIVTSLSLLPPNAYVGLI
                     TYGNVVQLHDLSSQVIDRCNVFRGDREYQLEQLVEMLTGQKPTNSMGAMPNAKITPFS
                     LNRFFLPLEQVEFKLNQLLENLTPDQWTVHAGHRPLRATGSALNIASLLLQGCYKNVA
                     ARIILFASGPCTVSPGLIVSSELKDPLRSHHDIDSDRASHYKKASKYYNQLAERVALN
                     GHTVDVFAGCYDQIGMSEMKQLTDSTGGILLLTDAFSTAIFKQSYMRLFSKDEEGYLK
                     MAFNGNMSVKTSKELKLQGLIGHASAVKKSDGNNISDSEIGIGGTSTWKMSALSPNHT
                     YAVFFEIANTAATTPVVADRPRLAYTQFITNYQHSSGTNRVRVTTVANQLLPFGAPAI
                     AASFDQEAAAVLMARIAVYKAESDDGADVIRWIDRTLIKLCQKYADYNKDDPSSFRLA
                     PNFSLYPQFTYYLRRSQFLSVFNNSPDETAFYRHIFTREDTTNSLIMIQPTLTSFSME
                     DDPQPVLLDSVSVKPNTILLLDTFFFILIYHGEQIAQWRKAGYQDDPQYAAFKSLLEE
                     PKLEAAELLVDRFPLPRFIDTEAGGSQARFLLSKLNPSDSYQDATHGGSTIVLTDDVS
                     LQNFMTHLQQVAVSGQT"
     gene            complement(<54237..>55271)
                     /gene="TDEL0H00350"
                     /locus_tag="TDEL_0H00350"
                     /db_xref="GeneID:11500900"
     mRNA            complement(<54237..>55271)
                     /gene="TDEL0H00350"
                     /locus_tag="TDEL_0H00350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683057.1"
                     /db_xref="GeneID:11500900"
     CDS             complement(54237..55271)
                     /gene="TDEL0H00350"
                     /locus_tag="TDEL_0H00350"
                     /inference="similar to DNA sequence:INSDC:YPR180W"
                     /note="similar to Saccharomyces cerevisiae AOS1 (YPR180W);
                     ancestral locus Anc_7.536"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683105.1"
                     /db_xref="GeneID:11500900"
                     /db_xref="GOA:G8ZZ50"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ50"
                     /translation="MSISTNGQKLTEDEIALYDRQIRLWGMAAQARMRSARVLLINLS
                     SIGTEICKNIVLSGFGSLTILDSHKATEEDLSSQFFLSKDNVGSYRLDAAKDRILEMN
                     PRVNIVFDIDEFSSKQPNYFSNFDLVIGTELKCDEMARLNEITRKYNIPLYIAGSNGL
                     FAYIFVDLIQFDAKEKKVKSFKPTEVGKVSPNTEIIDVEVQVDEEEASKIYEVITTRN
                     YYKTFGDMLKTATLQGKLNRRQMKRLSSAVPLTIALFSEKPLNNSEDLKCEALSACRQ
                     LQVPETVLNDQYVEQFFNQVGVEFTPVAAVIGGAVAQDVINILGKRQSPLNNLVIFDG
                     ITLDMPIYEF"
     gene            <55498..>57438
                     /gene="TDEL0H00360"
                     /locus_tag="TDEL_0H00360"
                     /db_xref="GeneID:11500901"
     mRNA            <55498..>57438
                     /gene="TDEL0H00360"
                     /locus_tag="TDEL_0H00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683058.1"
                     /db_xref="GeneID:11500901"
     CDS             55498..57438
                     /gene="TDEL0H00360"
                     /locus_tag="TDEL_0H00360"
                     /inference="similar to DNA sequence:INSDC:YPR179C"
                     /note="similar to Saccharomyces cerevisiae HDA3 (YPR179C);
                     ancestral locus Anc_7.535"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683106.1"
                     /db_xref="GeneID:11500901"
                     /db_xref="GOA:G8ZZ51"
                     /db_xref="InterPro:IPR021006"
                     /db_xref="InterPro:IPR026216"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ51"
                     /translation="MDLLKILDTKPVPAIVDARTLGIADDTSGDYWLPTTMSLYQKEL
                     TDQIVSLHYSDILRYFETNDYKEDVIVESMKTMCLNSAYVATHPCLLIDHCMPKSLIT
                     KDIPNHLAEMSGKFAALRDLINLVQEYETNTAIICRPGRTMDLLEALLLGNKVCIKRY
                     DNHSVKSKQRPRSFPCTCHLFPSSGLKLDKNSFKASGIFDMLICLDPTVNTEQEEVDR
                     ILRHERNPKSEEAVAPIVRLVTINSVDHCELYFGRLYDKKSREFLESVTAAVVVLRDR
                     VGTLPPDLRPIYSQNLRYLVEWLENPSISWPLPSVYRIKKYTPLDVERSLLTEVHYSQ
                     IEDELEAAFSNVRKRGRTKIEKEASQSAEINSYYLSKRLNKDYTTNPSKQDMAKLTGI
                     STANKSSQAGYHLSSGMLTHRLIQSMGQTYVFLNNLMKEHNSYDRMNDIQEEHKSLLE
                     KEVGTMDEKLSGAIGKQQENISKSEATDKSNLEKHQSIQRYEADMEILMNQLDSKRDR
                     YSELKQLFLRHSDLQERINREKGFSLSKDAEKEYTSKECERADQSVKESANEIEKITE
                     EVTRLQNLMKNEFAQTAYKSAEVSQNISSLKPLIEAEKLRCRELKNKCQLVEKQLSNV
                     QTPRVRLSNEKNGSGRRFKNSV"
     gene            complement(<57487..>58884)
                     /gene="TDEL0H00370"
                     /locus_tag="TDEL_0H00370"
                     /db_xref="GeneID:11500902"
     mRNA            complement(<57487..>58884)
                     /gene="TDEL0H00370"
                     /locus_tag="TDEL_0H00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683059.1"
                     /db_xref="GeneID:11500902"
     CDS             complement(57487..58884)
                     /gene="TDEL0H00370"
                     /locus_tag="TDEL_0H00370"
                     /inference="similar to DNA sequence:INSDC:YPR178W"
                     /note="similar to Saccharomyces cerevisiae PRP4 (YPR178W);
                     ancestral locus Anc_7.534"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683107.1"
                     /db_xref="GeneID:11500902"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR027106"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ52"
                     /translation="MKPHNSITYEELEVRLDDKPNKDGFNVRESLQRFDFRKDPRINL
                     VPTEDLEVRRTLLLLNEPESNDGEDVFTRRERLIELLLANKTYMEIFEGSLLKDNKIE
                     EEDEEEDEDFFTPASEELKNARRFLVQYSTDRAKRRLHKERQEAIYFDISKEIKYRRT
                     LAHQLENIGLLGSQIASSRPISSVKFSPDDKHLAVGSWDGGIKTISAGSLNIKSSVEN
                     AHTGKVGEVDWNSSGDLLATGGEDGLVKLFTVQSGELRQVADLQGHERRVAGCRFHPF
                     GRYIASASFDNTWRLWDAETNHELLLQEGHGKEVFCLAFQSDGSLLCSAGLDCTGMIW
                     DIRSGNCAMVLSGHTKPIYSVDWSPRGFEVATASGDGTVNIWDIRKTNQPQVLLAHNS
                     IVSGIRFEKHNGKFLMSCGYDKNINVYSGDSWNKITILKGHTDKILALDLGTHDGSVV
                     SAGWDRSVKSWNVDN"
     gene            <59004..>59978
                     /gene="TDEL0H00380"
                     /locus_tag="TDEL_0H00380"
                     /db_xref="GeneID:11500903"
     mRNA            <59004..>59978
                     /gene="TDEL0H00380"
                     /locus_tag="TDEL_0H00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683060.1"
                     /db_xref="GeneID:11500903"
     CDS             59004..59978
                     /gene="TDEL0H00380"
                     /locus_tag="TDEL_0H00380"
                     /inference="similar to DNA sequence:INSDC:YPR176C"
                     /note="similar to Saccharomyces cerevisiae BET2 (YPR176C);
                     ancestral locus Anc_7.533"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683108.1"
                     /db_xref="GeneID:11500903"
                     /db_xref="GOA:G8ZZ53"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR026873"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ53"
                     /translation="MVGELVLLKAKHIHYIEALDKKQESYEYWLTEHLRLNGVYWGLT
                     ALCLLDAKETFNKNEVIDFVMKCYVEATGGFAAFPRHDAHLLTTLSAVQILKTYDSLD
                     VLSSSQLEKCVKFVKSNQLSDGSFQGDKFGEIDIRFVYTALSTLSILELLTPEVVDPA
                     VNFILRCYNFDGGFGLYPGAESHAAWAFTSLGALAIVGRLNDLSENQINEIGWWLCER
                     QVPEGGLNGRPGKLPDVCYSWWVLSSLALIDKLDWIDYDKLREYILKCQDEKGGISDR
                     PDNEVDVFHTLFGIAGLSLMGFGNLIPVDPVYCMPVSVTKTIKKYPYN"
     gene            complement(<60025..>62088)
                     /gene="TDEL0H00390"
                     /locus_tag="TDEL_0H00390"
                     /db_xref="GeneID:11500904"
     mRNA            complement(<60025..>62088)
                     /gene="TDEL0H00390"
                     /locus_tag="TDEL_0H00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683061.1"
                     /db_xref="GeneID:11500904"
     CDS             complement(60025..62088)
                     /gene="TDEL0H00390"
                     /locus_tag="TDEL_0H00390"
                     /inference="similar to DNA sequence:INSDC:YPR175W"
                     /note="similar to Saccharomyces cerevisiae DPB2 (YPR175W);
                     ancestral locus Anc_7.532"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683109.1"
                     /db_xref="GeneID:11500904"
                     /db_xref="GOA:G8ZZ54"
                     /db_xref="InterPro:IPR007185"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ54"
                     /translation="MLNTGNVLPAKIQPPLLRPMAYRVLSKKYGLNIKSDGLATLAGF
                     VGNMFGMNWKKDPDTLQFLERFALLWRQQERGLFVDDQGVRDVVNEMKERERATVSAS
                     LQQEPSKKSKSVTIDKMLNREIPASSPIRISTENDQILVENETIEDQIDNEVASDEEQ
                     LDWRNYFKVINSSEQAKYSYDPVKLQFTFTPVKKSTPSEEFRSLIKDRVPDINSNTSI
                     FSNRFYLIRDRLLRNDSFQNADDFNPLSSIAAMQQDLNNGSGEISRAMSVTQIKNLLG
                     RDGQNFLLLGLLSKNAKGGWSLEDPSGCIEIDISQAYPTKGLYYVPGCVVLAEGIYFT
                     VGHKFHVSSVTHPPGERRENTLEAIGNLDLLGLHGQASSNYVARLDKELKIRLHLLEK
                     ELTDHRFIILGGVFILGWNLIPWKHSSKVLTTISDDPPTAIILHGSFTAVPVHASMSS
                     RNVSSTTLYQSIFDDLADLISSFDEIAQNSTFVFVPGINDPWGSTVSMGSAHAWPQQP
                     VPSRFTQKLKRVCKDVIWASNPTRLAYLSQEIVVVRDDITDRLKRHSIAFPMEELTQG
                     IKLMEPKSDDATSISQLVKENDQLPTRIRESRKLVKTILDQGHLSPFVTSVRPLVWNQ
                     DNALTLHPVPSTLIFCDTTAPYFDVTYNGCKTINPGKFITGRRARYLEYNLSQKKASL
                     EELYF"
     gene            <62382..>63365
                     /gene="TDEL0H00400"
                     /locus_tag="TDEL_0H00400"
                     /db_xref="GeneID:11500905"
     mRNA            <62382..>63365
                     /gene="TDEL0H00400"
                     /locus_tag="TDEL_0H00400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683062.1"
                     /db_xref="GeneID:11500905"
     CDS             62382..63365
                     /gene="TDEL0H00400"
                     /locus_tag="TDEL_0H00400"
                     /inference="similar to DNA sequence:INSDC:YLR457C,YPR174C"
                     /note="similar to Saccharomyces cerevisiae NBP1 (YLR457C)
                     and YPR174C; ancestral locus Anc_7.531"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683110.1"
                     /db_xref="GeneID:11500905"
                     /db_xref="InterPro:IPR013743"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ55"
                     /translation="MLESMKRYLGDVLGNDPRKREYGDLEDVRRERQERSPIRDRSRA
                     RVGPRSKNRPTANFAGNGSRRMLRKERMARSNGIVKKKPPVRDNSGGLKSIWRSLKTV
                     FSSEDQDLDLMQRACSNVTSMIPSKNKISGPEERRQLKERIARSEAFKRKVLQVKYDD
                     KMLQELRRGRSRQRSEDPVGSNLTDDQVTLLQKKITHLETRLKNALEDLQITQKRLKF
                     AKEKNTLLESLLDDANIDREYVKSRRDIKNIQRDNLKPDTELPPSPRRTVNPLFTSSP
                     MRNIATREEPASSTTDFYNKYPKIPETETLANNQRSDSLSPIRIDYSKYSI"
     gene            <63535..>64839
                     /gene="TDEL0H00410"
                     /locus_tag="TDEL_0H00410"
                     /db_xref="GeneID:11500906"
     mRNA            <63535..>64839
                     /gene="TDEL0H00410"
                     /locus_tag="TDEL_0H00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683063.1"
                     /db_xref="GeneID:11500906"
     CDS             63535..64839
                     /gene="TDEL0H00410"
                     /locus_tag="TDEL_0H00410"
                     /inference="similar to DNA sequence:INSDC:YPR173C"
                     /note="similar to Saccharomyces cerevisiae VPS4 (YPR173C);
                     ancestral locus Anc_7.530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683111.1"
                     /db_xref="GeneID:11500906"
                     /db_xref="GOA:G8ZZ56"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR007330"
                     /db_xref="InterPro:IPR015415"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ56"
                     /translation="MSTGDFLTKGIELIQKAIDLDTATQYEDAYTAYYNGLDYLMLAL
                     KYEKNAKSKELIRAKFTEYLNRAEQLKQHLETEEENKKKGSEASSTDGGSKGGAKKLS
                     DDDNSEDSKKLRGALSSAILTEKPNVKWEDIAGLEGAKDALKEAVILPVKFPHLFKGN
                     RKPTSGILLYGPPGTGKSYLAKAVATEANSTFFSISSSDLVSKWMGESERLVKQLFAM
                     ARENKPSIIFIDEVDALTGQRGEGESEASRRIKTELLVQMNGVGTDSDGVLVLGATNI
                     PWQLDSAIRRRFEKRIYIPLPDLTARTKMFEINVGETPCALNKEDYRTLGQMTDGYSG
                     SDIAVAVKDALMQPIRKIQMATHFKDISEDPNQKKLIPCSPGDEDAVELSWTDIEADE
                     LQEPELTIKDFLKAIKTTRPTVNEEDLRKQEEFTNDFGQEGN"
     gene            complement(<64914..>65513)
                     /gene="TDEL0H00420"
                     /locus_tag="TDEL_0H00420"
                     /db_xref="GeneID:11500907"
     mRNA            complement(<64914..>65513)
                     /gene="TDEL0H00420"
                     /locus_tag="TDEL_0H00420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683064.1"
                     /db_xref="GeneID:11500907"
     CDS             complement(64914..65513)
                     /gene="TDEL0H00420"
                     /locus_tag="TDEL_0H00420"
                     /inference="similar to DNA sequence:INSDC:YLR456W,YPR172W"
                     /note="similar to Saccharomyces cerevisiae YLR456W and
                     YPR172W; ancestral locus Anc_7.529"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683112.1"
                     /db_xref="GeneID:11500907"
                     /db_xref="GOA:G8ZZ57"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ57"
                     /translation="MPLVGKFPDHLIDLIKTSKYVHVATASKEGIPSVSLMNYIYVPS
                     SDTYAESDKSDDYIVFATLDNTEKYENILVNPTVSLLFHDWVTAKNLSLRKHSLSETP
                     ATDPSQATTTGVPQSSKLLNLLQELNQAELFQMSATIRGHGTIINPTSEESKHYKDLL
                     LRANPDAHCFILSDKTVIVKVKIESAKVTDNENNTSIYK"
     gene            complement(<65746..>66684)
                     /gene="TDEL0H00430"
                     /locus_tag="TDEL_0H00430"
                     /db_xref="GeneID:11500908"
     mRNA            complement(<65746..>66684)
                     /gene="TDEL0H00430"
                     /locus_tag="TDEL_0H00430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683065.1"
                     /db_xref="GeneID:11500908"
     CDS             complement(65746..66684)
                     /gene="TDEL0H00430"
                     /locus_tag="TDEL_0H00430"
                     /inference="similar to DNA sequence:INSDC:YLR455W"
                     /note="similar to Saccharomyces cerevisiae YLR455W;
                     ancestral locus Anc_7.528"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683113.1"
                     /db_xref="GeneID:11500908"
                     /db_xref="InterPro:IPR000313"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ58"
                     /translation="MAKGLKTGDLVLCKVGSFPPWPAVVYPQRLLRKDVYRKRRPNCV
                     AVCFFNDPTYYWEQPHRLTTLESSVIETFLSQNGRGKSQQDLVEAYRQAQDFGSLNDF
                     IVNRAMEEDRMDELKRGMGKEHIESGEDPFQSKDITKKVKSTPSPSSSASPTLKSRRK
                     RLRDSEDGNIHEDSDEDKATRKAHYKRKQAHVDGHRDKNHGLDPSRKIEISLLFRRKL
                     QKNLVQREDLPTDAEIAESHKMLSRILENLDNDPPYFDIEALRQSKLHKLLKVIVNDP
                     DLEEFHPASKQILVNWSDYIAELKAEKALQEGQDIN"
     gene            complement(<67031..>68674)
                     /gene="TDEL0H00440"
                     /locus_tag="TDEL_0H00440"
                     /db_xref="GeneID:11500909"
     mRNA            complement(<67031..>68674)
                     /gene="TDEL0H00440"
                     /locus_tag="TDEL_0H00440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683066.1"
                     /db_xref="GeneID:11500909"
     CDS             complement(67031..68674)
                     /gene="TDEL0H00440"
                     /locus_tag="TDEL_0H00440"
                     /inference="similar to DNA sequence:INSDC:YPR171W"
                     /note="similar to Saccharomyces cerevisiae BSP1 (YPR171W);
                     ancestral locus Anc_7.527"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683114.1"
                     /db_xref="GeneID:11500909"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ59"
                     /translation="MQVDTMRNPDTQRFLKRVEEYDSQRNSMTKPQVKGKPDHLSLER
                     ARQLLQGDSPADLHRANSNNCGPEIASTELAYRSAYNYEKSFSPERSKNQTSPKTFVI
                     SEEDYKLLQQLKSGDKPVVIEPKKHYPSRGRPRNVTHAFEDTPSSPTWKVRNEVPDEA
                     PLLPNRKVISAFPDEEAPSLPTRRVKKVEQVPSLPTRRYREPQVSQEEPVARPVKDES
                     TEIKEKKKAPPVPRKRNEKLKSEPTTFISSLGKNKLTVIPQVDTARKIQPVTASHIDY
                     LDSVHLTPKSPEQTKSNPQKQISPGTSGGSFISSALRTISPSPSQSNIRIEKPALPSK
                     PAKLKNSTITTSKTSDNDELQNLKLNTTEKTKPKVPAKKDGLTIPRLRPVASAERKTS
                     KQDDSPQNSMLEGLKKVERDKVQQRVVTPPEALTKMSQLKKGAPNGSAKDEKTISEVE
                     AKLRGLKSPPPVPKRNISMPEALKKAEKLKNTKQSSKPSNKNDFRSDLSAILTAPPKA
                     ATSSKQIAKESPSSSTSSLVHHTKSRARGPKRKLPTKIQ"
     gene            complement(<68889..>69286)
                     /gene="TDEL0H00450"
                     /locus_tag="TDEL_0H00450"
                     /db_xref="GeneID:11500910"
     mRNA            complement(join(<68889..68997,69063..69193,69269..>69286))
                     /gene="TDEL0H00450"
                     /locus_tag="TDEL_0H00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683067.1"
                     /db_xref="GeneID:11500910"
     CDS             complement(join(68889..68997,69063..69193,69269..69286))
                     /gene="TDEL0H00450"
                     /locus_tag="TDEL_0H00450"
                     /inference="similar to DNA sequence:INSDC:YPR170W-B"
                     /note="similar to Saccharomyces cerevisiae YPR170W-B;
                     ancestral locus Anc_7.526"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683115.1"
                     /db_xref="GeneID:11500910"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ60"
                     /translation="MKPVVSTGNAWFCTILSAFGVVILSVIAHLFNTNHESFVGSIND
                     PENGPAVAHTVFLAALVYLVFFAFCGFQVYLSRRKQSIALR"
     gene            69972..70045
                     /gene="TDEL0Htrna4I"
                     /locus_tag="TDEL_0Htrna4I"
                     /db_xref="GeneID:11500911"
     tRNA            69972..70045
                     /gene="TDEL0Htrna4I"
                     /locus_tag="TDEL_0Htrna4I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:11500911"
     gene            complement(<70147..>71544)
                     /gene="TDEL0H00460"
                     /locus_tag="TDEL_0H00460"
                     /db_xref="GeneID:11501721"
     mRNA            complement(<70147..>71544)
                     /gene="TDEL0H00460"
                     /locus_tag="TDEL_0H00460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683068.1"
                     /db_xref="GeneID:11501721"
     CDS             complement(70147..71544)
                     /gene="TDEL0H00460"
                     /locus_tag="TDEL_0H00460"
                     /inference="similar to DNA sequence:INSDC:YPR169W"
                     /note="similar to Saccharomyces cerevisiae JIP5 (YPR169W);
                     ancestral locus Anc_7.525"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683116.1"
                     /db_xref="GeneID:11501721"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ61"
                     /translation="MGKRSRSKKGATVELACLGEPLAELRFTEPLFQMALHPTKPIIL
                     SGLATGFVYCHSYDAGKLQETVNENKKKVIVEGENKPFWTSIDVEKQETTDAITLMWR
                     TRRHKGSVRCLCLDPEGEYVYSVGTDNVLKKAVTGTGKVVKKTSFKDQKLKFTKMIRS
                     PTHAYLLLGDEDGNVMVLNSDTLELTNKVHKIHGGDAINDIFQFAKRSVHKYISVGQT
                     TMGYWDARESNESDLQIPDDDEDAKRKVLLSDDQEDEILCGTFVDPEAGDTIVCGMGE
                     GVLTVWKPQKNDLEDQVNRIKICPNESIDCIVPTLQDDNGVWCGGSSGNLYRADVKGG
                     RVVEVRRHSDIDEVTFLDLDYEYRVVSGGMDKIVLWHSVSEDEDQKENESSDEDQSNE
                     EEIEVDTSDDESASDDSDTMVGLSRVELIAELDKDLQGSSEEEEEKKEKPKNKKRRVP
                     GKLAASHGITKFEGL"
     gene            complement(<71637..>72107)
                     /gene="TDEL0H00470"
                     /locus_tag="TDEL_0H00470"
                     /db_xref="GeneID:11500912"
     mRNA            complement(<71637..>72107)
                     /gene="TDEL0H00470"
                     /locus_tag="TDEL_0H00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683069.1"
                     /db_xref="GeneID:11500912"
     CDS             complement(71637..72107)
                     /gene="TDEL0H00470"
                     /locus_tag="TDEL_0H00470"
                     /inference="similar to DNA sequence:INSDC:YPR168W"
                     /note="similar to Saccharomyces cerevisiae NUT2 (YPR168W);
                     ancestral locus Anc_7.524"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683117.1"
                     /db_xref="GeneID:11500912"
                     /db_xref="GOA:G8ZZ62"
                     /db_xref="InterPro:IPR019145"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ62"
                     /translation="MSPKEDLEGIQQELGTVEQQLAAVIESFIELGVSVYDFPGTSEA
                     TQGMVTNLKRNVDRLANLNKQSNDPDSQLQNVNVPLEVVQYIEDGRNPDIYTREFVEA
                     IRRSNQYQRAKMHGLRQLRDSLADKIVEEFPDLEPSVHNIAQRAGLSDDTVQIT"
     gene            <72421..>73227
                     /gene="TDEL0H00480"
                     /locus_tag="TDEL_0H00480"
                     /db_xref="GeneID:11500913"
     mRNA            <72421..>73227
                     /gene="TDEL0H00480"
                     /locus_tag="TDEL_0H00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683070.1"
                     /db_xref="GeneID:11500913"
     CDS             72421..73227
                     /gene="TDEL0H00480"
                     /locus_tag="TDEL_0H00480"
                     /inference="similar to DNA sequence:INSDC:YPR167C"
                     /note="similar to Saccharomyces cerevisiae MET16
                     (YPR167C); ancestral locus Anc_7.523"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683118.1"
                     /db_xref="GeneID:11500913"
                     /db_xref="GOA:G8ZZ63"
                     /db_xref="InterPro:IPR002500"
                     /db_xref="InterPro:IPR004511"
                     /db_xref="InterPro:IPR011800"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ63"
                     /translation="MTGATKVYKLNEGIVVTQEQLDHWNWSLANASHPVEVLKWALST
                     FPRLYQTTAFGLTGLATIDMLARLRDQDAELKVPLIFIDTLHHFPQTLDLLKKVQDRY
                     YTPVGQQVAVFRPEGCLSEQQFAQKHGDFLWEKDEDKYDFLVKVEPARRAYQSLGCLA
                     VLTGRRKSQGASRSNLQFVEVDELNNIIKINPLANWTFDQVKNYIDEHEVPYNELLDL
                     GYRSIGDYHSTSPVKEDEDERAGRWKGKTKTECGIHETSRFAQYLKDSTA"
     gene            <73483..>73830
                     /gene="TDEL0H00490"
                     /locus_tag="TDEL_0H00490"
                     /db_xref="GeneID:11500914"
     mRNA            <73483..>73830
                     /gene="TDEL0H00490"
                     /locus_tag="TDEL_0H00490"
                     /product="mitochondrial 37S ribosomal protein MRP2"
                     /transcript_id="XM_003683071.1"
                     /db_xref="GeneID:11500914"
     CDS             73483..73830
                     /gene="TDEL0H00490"
                     /locus_tag="TDEL_0H00490"
                     /inference="similar to DNA sequence:INSDC:YPR166C"
                     /note="similar to Saccharomyces cerevisiae MRP2 (YPR166C);
                     ancestral locus Anc_7.522"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRP2"
                     /protein_id="XP_003683119.1"
                     /db_xref="GeneID:11500914"
                     /db_xref="GOA:G8ZZ64"
                     /db_xref="InterPro:IPR001209"
                     /db_xref="InterPro:IPR018271"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ64"
                     /translation="MGNFRFPIKTKLPPGFLNARVIRDNFKRQQFAENEVTTKALKFI
                     ARNTTLPPRTRLEAQLKLTTMPNYTRLTQVRNRCVETGHARFVLSDFRLCRTQFREKA
                     RSGDLPGVKKGVW"
     gene            complement(<74047..>74679)
                     /gene="TDEL0H00500"
                     /locus_tag="TDEL_0H00500"
                     /db_xref="GeneID:11500915"
     mRNA            complement(<74047..>74679)
                     /gene="TDEL0H00500"
                     /locus_tag="TDEL_0H00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683072.1"
                     /db_xref="GeneID:11500915"
     CDS             complement(74047..74679)
                     /gene="TDEL0H00500"
                     /locus_tag="TDEL_0H00500"
                     /inference="similar to DNA sequence:INSDC:YPR165W"
                     /note="similar to Saccharomyces cerevisiae RHO1 (YPR165W);
                     ancestral locus Anc_7.520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683120.1"
                     /db_xref="GeneID:11500915"
                     /db_xref="GOA:G8ZZ65"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ65"
                     /translation="MSQQVGTSIRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVF
                     ENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQE
                     KWIAEVLHFCQGVPIILVGCKVDLRNDPQTIEALRAEGQQPVASAEGQSVADQIGATG
                     YYECSAKTGYGVREVFEAATRASLMGKSKTNGKTKKNNADKKKKKKCVLL"
     gene            complement(<75081..>78944)
                     /gene="TDEL0H00510"
                     /locus_tag="TDEL_0H00510"
                     /db_xref="GeneID:11500916"
     mRNA            complement(<75081..>78944)
                     /gene="TDEL0H00510"
                     /locus_tag="TDEL_0H00510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683073.1"
                     /db_xref="GeneID:11500916"
     CDS             complement(75081..78944)
                     /gene="TDEL0H00510"
                     /locus_tag="TDEL_0H00510"
                     /inference="similar to DNA sequence:INSDC:YPR164W"
                     /note="similar to Saccharomyces cerevisiae MMS1 (YPR164W);
                     ancestral locus Anc_7.519"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683121.1"
                     /db_xref="GeneID:11500916"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ66"
                     /translation="MTFGDAEVPLTYRAALWYEAGELTVTGEYDKPLFYSGKDGSIDL
                     ISLLKEDPQLILRPDSSKQEFFWESTIVGKYPVKCLTFRTTVDSVNQWDIIVSLTNSN
                     SGTSVKSYAPHNSMEEVFGVTKDPETLDDSEIEDLMNKPLHEDDHEKIVIEKVETKSR
                     QTYLIVTPNSIYKVGDALPTLLYGGIDDCQVFDTNENVLSSLILVTTPTGYILTIVLN
                     AQDTSSFVTQYWDLGYDGPWRVVRHDCNRQFLAINSKEGVLRFFEFTSSIHFEMINNL
                     NIDNADILDCTFFPNQARSHFLLFVATLQNERLVYYCIEWEKDTPTLKKVHYLTYFTK
                     QDFKRCAPIGHQRILIFFDTAVELVTANQLMSGETDFERVDMKSLGGICDTFPAPKLL
                     KKLKAQNEDFFGRFEYCMVMGTSTGHINVAVVDSSNKIETYSLTRFKGLKSLCAVEKQ
                     NDHYEQYDIIVVSYGRTLRLSIDISQIQHLADDAPVASFSALTFKHTMDSSMEESSEI
                     VIVQPSKISGRYISELWLTSSTSITNLQTNAPTQKLYSVCSLHQSHVFERFKIIHWDA
                     IANDFRSRLSKVEDSGMDLYLITGCDKAFHPKSFMLDFSIDEPELVEISDLLTSEEEC
                     REYFLTARNAVQITDKKVYVEPLDFEPTDDSPVRFSPTWIIEGATYFDIFVLIWNARE
                     RQVWYTANIDQLTSYQPFKRTSVFDDALKQVGPDEPVQFQIMKDDQDRLLIYMAGNDI
                     LLQIPWGALESEVCELKQICSGRIKSIVSLSKGLCFIRHDGDIMAVSHIDLSIQYLDF
                     DFDGRDIQLRKVDKDTCLIFSTQEVMILTLSNVENWRCWFYDLRLPYQWKLNPILDVQ
                     IDKAHQRAFISYSTGLQVFDMSYFSWNRAKYLLHSTRDPNKKFIFIKSINRMIVANFD
                     SRKWDCIKLTDGKTRSLDATVLQEKCGPPRAIVDISNEGKEIALLLSFGNMIKLVHLL
                     PQKGNIAVIESVRHQFDEQLFPSIEVGTNGKFYLLLMKHDDPPKSDIGTFIEAKFDES
                     GFSITNEFKFSIKDIKKFKDFKLLGTDLIINHASHNRVFILKQIFKRVVKRKVELISL
                     RISPQVKFSLMYPLTDDSFVVVILEEKGTSYVSELHFYHRCDINSPVYTFDASECERL
                     DIFDQAASDTVAEIPTEVEQEREDEVMDEMDEQDAFGTPTENSVMPPNNTDQPEDSKS
                     SSQPYRTIKLDKGVKDIKYDRVAEKLYVLATDDSVIVFRPRQDSSQTNWPNSGYEIPT
                     PRPIAQANRTACATGLFRIDKDGQI"
     gene            complement(<79507..>87273)
                     /gene="TDEL0H00520"
                     /locus_tag="TDEL_0H00520"
                     /db_xref="GeneID:11500917"
     mRNA            complement(<79507..>87273)
                     /gene="TDEL0H00520"
                     /locus_tag="TDEL_0H00520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683074.1"
                     /db_xref="GeneID:11500917"
     CDS             complement(79507..87273)
                     /gene="TDEL0H00520"
                     /locus_tag="TDEL_0H00520"
                     /inference="similar to DNA sequence:INSDC:YLR454W"
                     /note="similar to Saccharomyces cerevisiae YLR454W;
                     ancestral locus Anc_7.518"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683122.1"
                     /db_xref="GeneID:11500917"
                     /db_xref="InterPro:IPR019409"
                     /db_xref="InterPro:IPR019415"
                     /db_xref="InterPro:IPR019439"
                     /db_xref="InterPro:IPR019441"
                     /db_xref="InterPro:IPR019443"
                     /db_xref="InterPro:IPR019449"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ67"
                     /translation="MESQQTMFYDGSLAVRVIAVVLVGGVLINLLLKAFFGLSVAYIN
                     PFTLKIHGIGYRDALKIDSIRFLPLDKRVVVRGLTIRAVPASQKSSQPKSPWLKRYYS
                     FMMRVVDGLKVSFFDVNVEPANITFATLEVTFKAPKVQNLFIANLIMVQFGWKGQILC
                     EDASFTSKCEVISQDIGHKFPLRDLSLDLKVGDLTVPMDVLSRLQVEKGKKNMVQDAL
                     NLEDQIKIATDNLLSIIGQVRHSLHPVARLTASVDKITVDHVPMTTHPDLMELNQFLS
                     LNLFAENLSFNAVRFEKHMPGFKLLFQDEDTPFKFNITMTGFCISMNMRGKCAKGGQQ
                     TLKMCEIPNVSIFGSTNLISQKFDYERISELQNAICTIKGHISSPTVDIDVDHLSLFK
                     CFKKNIKVFSSTLVAPECSHESKSYSALVVRKKVLLNYFKSLLPLISVKLTLEDPRVI
                     ISDQGDFMMHKLSALMLDYNTERFMKEGAEKGSEAHYGVNCNIEMLAFKSQHVMRKKD
                     YKGPILAIDNIGIKNQVDLVPEPVIAVKVNVDTFKVDLSELPTMIMMNNIIKKLDSRV
                     LDVEENYFMSYYEKFAERLKNTEAECSKIGESLKCQQMLPSELMFRRLPDFLDYVKID
                     LRNVSFMLGARSVFMPPCVFSNIDSQSPEDLVDNKLRKYFHETDKIQIALFGNKTQWH
                     SKIETGRTTMVQSGQSSDYDRLHDQALDDISTSDETEIEHQWNFNILINEMSSTIVCE
                     TPNAPNTLSTKAISKVSVMSIKVFPDVSSFEPQEERRIIVQIDNKRAKSVISIMNIFL
                     VISGIHTLKLIFGRDVCSHNRESLAKKHFMAVSLTRRKRFYHYISWKELKSIVQFNFS
                     SEVMSQIFVLPNGLTARVQTSSIFMTIKNFSDIAMNGSNFRLCVESPLFPNYWVRLIT
                     VLRFRILADIHQTIDQMKSDSDKFDSLPPAIVLENETWHFSIPHKFELYTLVDNIPTF
                     YKSMKQIIHSFKTSKDDCVIYPHPVKTPSLPKINLKSKRVLFSIDDDPFEAEISMICQ
                     IGLEEQKSRLAKLEEFEKRTAADLLKRNKSRLSKTQTMAPYKACELMQAVHAIKRKFR
                     LKRSASVTNLGDKRVNSEDAKPDDLNEDENLIPPEIEEAYHRLLENASTSWIRRIKEY
                     KQKEKQTFENNFAFLWGDVNYSALPEVFNHKVLPFDTHPFLTNLIIEGVDIDVFRPSF
                     GTEGVPNFIHDVGKGVPKSSQYSIMIPMYLDAKFKEIRWHLKDYPLPMVYIPRLGKSQ
                     TDNGKNIQIHGNLILAEDMIQSKKEIRRIFVPLVPSLTKEGDEYYSLMVPRTLTTPKI
                     FTDLRFDINSNGTTQVTWGGGYQPAIQQTMQCLDNFSKPPIDPSPKIGFWDKMRYIFH
                     ARVKVSWKEKGKFEVCLKGGRSPHKIGQDAAGFIIGFSDDVVLNCNESDDPLNFLSCT
                     AEKVHFSIPNHFAKPLLVWCQPSDQTVFIPSHSNTNLQQYASFYYMLDLEKSRRHASE
                     AAAMRSHYIEKTGISLAGGIALNVGIVLERLKLGTKDRTISSRPHYDTRLCNPKAVED
                     KGSHDSYAGFRSDFIHMSFLLLSNGVNAYNKMQLSPAGLHTFMTWWRSFAGGLPVRRG
                     PLFGLQSISPKFGEHLYTISYHADVAPLYITHIAHSIHSSHELKKNNGEAVEFAGLKA
                     KTEHFVMDLHQRKEVMLKYQEGLDKTKKIMNLKFLEGDVSTAAIDIRAVEATFKSAKF
                     VEEKEDSNIQIPDNDLAWYDPTDFEDTDFIDIDSYVPNLRMLRLLYSCQFKYRRRASY
                     GDKFQVDPNTHKRIVPFKNNISHKCVFGEPLKLPFKALRERKERLIEYKDKLEQKLSG
                     NDDESDVTFIKRHIKKTNTAIEKVELLLKDFETLKRKQDCENFEPSFNYPMINMVQNS
                     VIAANEYENRYHVCEMLLKWNEGTRNAVFKYLHYLSLSRQLSSLSEQQCSKLIDEIIR
                     RKNAPGDTDRNSIDSQNRDGSQFEAELNRSNEENFNEVLEKIFKEGISELGVDIDYEV
                     HHNHIVHFISPQIQLITEQEPDSCVVVAAPSIMMKVMSFGNKEAQYSDEAFLKRYAVH
                     FIKGNVFHFRKDEYHVDREGFHEVFFSLSGYGQEDETQWPPWLSLDLCYDPEPLASNA
                     VVKELSAVSLYDNVSQRPTLYNMNQGKVRDTLSAYVPLIVVESNSERYITLYRLVTNL
                     IMYMEPESAELRKQIEKLTIGLDTEDGAQLNQMLSKIQTNLKVLSAVEQEFLYRRHIL
                     DSADTQEFAAIRNEKADHWLRLYIMMRVFGSNQGWAANPDHCLLWNFHAKEIILHMLE
                     SDSTSFLDVAIAKLHFQREETSSGFNRNRATVDMAQTFDLQKGATYKSIFGPYLSTSL
                     KRSQHRSQDQPLIDINWAMNSPVGGIKVIQYIETNLADLSMALEEETLKKIITWLFPT
                     EFNANISGKDGGKETDEPDDTYDPELTEDYVNLAGEKSPDLHEMVQRSVDFFIMENLT
                     INSFQLCISFRGKGAMRIANVTNFIFHFPQLTFENQTMRMIDLLMELKKVVFKDVLKH
                     TAKFLETKVRNRPEEAREREVAPLRQLSHYNSYTKIEDMQDESSNMRRLS"
     gene            complement(<88314..>89990)
                     /gene="TDEL0H00530"
                     /locus_tag="TDEL_0H00530"
                     /db_xref="GeneID:11500918"
     mRNA            complement(<88314..>89990)
                     /gene="TDEL0H00530"
                     /locus_tag="TDEL_0H00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683075.1"
                     /db_xref="GeneID:11500918"
     CDS             complement(88314..89990)
                     /gene="TDEL0H00530"
                     /locus_tag="TDEL_0H00530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683123.1"
                     /db_xref="GeneID:11500918"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ68"
                     /translation="MLHSLSSILLLLLASEAASGVAAVAVAIPDSQALERRHQDSTVE
                     PECDEWEETIPTSTTSCDEWEETIPTSTTSCDEWEETIPTSTTSCDEWEETIPTSTTS
                     CDEWEETIPTSTTSCDEWEETIPTSTTSCDEWEETIPISTTSCDEWEDTIPISTTSCD
                     EWEETIPIGTTSCDETPTSTSSKPTTSISSPSTENSKPPTSGPSTSLPPTSKPSTSQP
                     PTSKPSTSQPPSSGPSTSLPPSSKPSTSQPPSSKPSTSQPPSSKPSTSQPPSSKPSTS
                     QPPSSKPSTSQPPSSKPSTSQPPSSGPSTSLPPTSKPSTSQAPASSPSSSGPSSSGPT
                     TLMPSTATTYQSTTETETTTVPCSTSTYVTTSNGTPVTQTTTYTVPCESCETSTSVFT
                     SNGTPVTETETTTVPCETSTYVSTSNGTPVTHTTTYTVPCVTETYVSTSNGVPVTYTK
                     TYTAPRETKTYVTTSEGTPVTYVTILPITEGTTEAAAQPTEEATSAYETVSNGVTVTS
                     YSSGTLASSTIEGTAAPGESTASSVPIYEGAANRLGAGISGLFFAAFLLL"
     gene            <91123..>92361
                     /gene="TDEL0H00540"
                     /locus_tag="TDEL_0H00540"
                     /db_xref="GeneID:11500919"
     mRNA            <91123..>92361
                     /gene="TDEL0H00540"
                     /locus_tag="TDEL_0H00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683076.1"
                     /db_xref="GeneID:11500919"
     CDS             91123..92361
                     /gene="TDEL0H00540"
                     /locus_tag="TDEL_0H00540"
                     /inference="similar to DNA sequence:INSDC:YPR163C"
                     /note="similar to Saccharomyces cerevisiae TIF3 (YPR163C);
                     ancestral locus Anc_7.517"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683124.1"
                     /db_xref="GeneID:11500919"
                     /db_xref="GOA:G8ZZ69"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ69"
                     /translation="MAPPKKTVKMDLNSFLQDDTFGSSWAEEDVDLNKITIPIESLKA
                     NTIPLEELAAAKHAGAGGSGSGFRGSRLDPALGGGRNDFQERVEYPVPTHPPYRAIIN
                     NIPWDISPEGVQAWVEDGLHKEGAVAEVDLPRSMKDPTRLKGIAFLTLKEREDLVHAL
                     TFNGTKLNERTVYVSVAAPRRDGYGSGGGDFDWNGARGSNYQASGDSAGPDLDWGAAR
                     GSNYQERRERREEPNLDWGVARGSNYEEKRERREEPNLDWGVARGSNYEERRERREEP
                     NLDWSAARGSQYQERKPRREEPNLDWSAARGSQFRERKPRKEEPQLDWGAARSGQAPE
                     KKTRANFTKKPVAAEKTEDKPKIQRSAFDVLSNDDDEEETADEETKKETKEEPQVAQL
                     AQDTSKLNVEDNDEWETVGK"
     gene            <92537..>94252
                     /gene="TDEL0H00550"
                     /locus_tag="TDEL_0H00550"
                     /db_xref="GeneID:11500920"
     mRNA            <92537..>94252
                     /gene="TDEL0H00550"
                     /locus_tag="TDEL_0H00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683077.1"
                     /db_xref="GeneID:11500920"
     CDS             92537..94252
                     /gene="TDEL0H00550"
                     /locus_tag="TDEL_0H00550"
                     /inference="similar to DNA sequence:INSDC:YPR162C,YLR453C"
                     /note="similar to Saccharomyces cerevisiae ORC4 (YPR162C)
                     and RIF2 (YLR453C); ancestral locus Anc_7.516"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683125.1"
                     /db_xref="GeneID:11500920"
                     /db_xref="GOA:G8ZZ70"
                     /db_xref="InterPro:IPR011579"
                     /db_xref="InterPro:IPR016527"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ70"
                     /translation="MKEIDADFGPLRKSKAKVDSKRILKDSAIDHEQNSVLQKITLLP
                     IRRDSTNSVTKPKKLKDTDILNDKETEILQKIRLVTKSPSTEKVETLDPEFRRFRQYL
                     LRSICQELPPEENKLLSHLREPEQEIDRILRQAIVQKESHSSIIIGPRESYKSFLLNR
                     ELNLLSQKYKDQFITIRLNGFIHSEQAAINGIATQLEQQLQNLRNTPIPTRKGSDISS
                     GSLTEVFEKILRVLDSTSTTHHQKRNKNNATTKLTVIFIFDEIDTFAGPVRQSLLYNL
                     FDMVEHARVPVCILGCTTKLNILEFLEKRVKSRFSQRIIFMPQIENLEQFVKITGELL
                     RLDRPSAYKYGEDWNRKIDETLSDEKSELHRLVKVNYETFRSIPYFKNSIIPLIYGAP
                     DFENLCHLIDTSGPIKEYMNNQLGNSLTSLVQSLSDLELAILICAARTALKAKDETIN
                     FNLTYAEYESMTKALNAKIPTVAKTGKSVEGSSVLFDNAIKLWKKKDVKNVWETLINL
                     NFLTEKSAVGLRESAIAVFYASNYQLQGTTIPFDLRLYQTHVTLSDLRRIVPRSSLHY
                     PWTQL"
     gene            <94614..>96500
                     /gene="TDEL0H00560"
                     /locus_tag="TDEL_0H00560"
                     /db_xref="GeneID:11500921"
     mRNA            <94614..>96500
                     /gene="TDEL0H00560"
                     /locus_tag="TDEL_0H00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683078.1"
                     /db_xref="GeneID:11500921"
     CDS             94614..96500
                     /gene="TDEL0H00560"
                     /locus_tag="TDEL_0H00560"
                     /inference="similar to DNA sequence:INSDC:YPR161C"
                     /note="similar to Saccharomyces cerevisiae SGV1 (YPR161C);
                     ancestral locus Anc_7.515"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683126.1"
                     /db_xref="GeneID:11500921"
                     /db_xref="GOA:G8ZZ71"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ71"
                     /translation="MMGDNPQDAAKKGDFKYKIGKVKQTPSVKTDPKTGNSYIELKAT
                     PEEKVYGCTKFSGHYKEEKKLGQGTFGEVYKGIHLETQRQVAMKRIIVNVEKDLFPIT
                     AQREITILRRLDHKNIIKLIEVVYDQSPSATSRPDQAQASRNNSPAKSFYMILPYIVS
                     DLSGILHNPRINLKLGDIKNMMLQLLESINYIHCQKFMHRDIKTANILIDHNGVLKLA
                     DFGLARIYYGAPPNSRYPGGAGSGAKYTSVVVTRWYRAPELVLGDKTYTTAVDIWGAG
                     CVFAEFFEKKPILQGSSDIDQGHVIFKLLGTPSEADWPLARYLPGAELTRTKYPGTLK
                     ERFGSFLNDTGLDFLQQLLALDPYKRLTAMSAVHHPFFKEEPLPSTKLELPCEESHES
                     DIKRYKEEMQQAMSQKAPSAPQGHVTESLNVPRAPKGNLPKAPARNLFPKGPAAMPGS
                     HATTRNPAVPPPFNRTSSRYENGSNSTVNPGFRSNGANGYRAGEASSRYGHETASRNP
                     NVAARLPTGPQGSRYNGRPVETTGANTNRPRVEFSTAKNSNYVQRQSDKSGDSKRWGQ
                     RQERQLHAGLPARPRSDTRNTPAQPRQSQQQEERQSPSAPTEQKKPGEEVGKKEASNL
                     ADLY"
     gene            <96867..>98975
                     /gene="TDEL0H00570"
                     /locus_tag="TDEL_0H00570"
                     /db_xref="GeneID:11500922"
     mRNA            <96867..>98975
                     /gene="TDEL0H00570"
                     /locus_tag="TDEL_0H00570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683079.1"
                     /db_xref="GeneID:11500922"
     CDS             96867..98975
                     /gene="TDEL0H00570"
                     /locus_tag="TDEL_0H00570"
                     /inference="similar to DNA sequence:INSDC:YLR452C"
                     /note="similar to Saccharomyces cerevisiae SST2 (YLR452C);
                     ancestral locus Anc_7.514"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683127.1"
                     /db_xref="GeneID:11500922"
                     /db_xref="GOA:G8ZZ72"
                     /db_xref="InterPro:IPR000342"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ72"
                     /translation="MTDIIPCTTLHELASKTFSRTPNGVIFTDDIKMIYSTFLICLKL
                     KEESPELKRWYSPFGKSHHAFSFSMEEGVERMGNLKLSVDMTTTSIEICYNIQPELAY
                     HLIRTFMEAKLLHTPADRTRSMPKNKSILQPTPKGVGILQKYVRRIGLKSLPPILLSD
                     FNSMEIFTFERSPVTDSIIYSNRLICILLNKMMGSGPNVWSPEKSPDKIPSLSKLLEY
                     NSDIFSFETVDYKAFGGFERELEGHQHTSWFDQLSTERLHDENRTSPLAHRFFTNPDS
                     DSHVQYYSTDCGLRISKSKIFGSPKVLFDYCFTTKAIWQWVMDCTDIMYPKEAVSAAA
                     LFLKAGLVVPILFPPSENLNRKFCISRTSYYTLSRRAWDVVQWNTEKGIRRSICNFSN
                     LLSDDPNKHNSDATSINYKGEMVMTERPGSSLSDSDRTTVQIRSQVKDIDEILRDPGM
                     KYLFRQHLENEFCAENLDAFVDIRKFLKKMSLLKNLIESKHASDFKTKKTRPRCSDSN
                     IQAAIESALVRQANECLELGYHIYSSYIVVNAPYQLNIDHNLRESINRVMLHASTPSA
                     IESKLGNELLKTCSSIELSATSAQLSNSLSICRYSYLNQSEMNFQSGVHTPKVVKSTT
                     SIQANEEKKRRSTLALKAKNLLTMKENKLQKTFKILKTLYPLLENVNQDLHRLMRKDS
                     LQKFVTSDLYQDAVTFLEVS"
     gene            complement(<99196..>100767)
                     /gene="TDEL0H00580"
                     /locus_tag="TDEL_0H00580"
                     /db_xref="GeneID:11500923"
     mRNA            complement(<99196..>100767)
                     /gene="TDEL0H00580"
                     /locus_tag="TDEL_0H00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683080.1"
                     /db_xref="GeneID:11500923"
     CDS             complement(99196..100767)
                     /gene="TDEL0H00580"
                     /locus_tag="TDEL_0H00580"
                     /inference="similar to DNA sequence:INSDC:YER025W"
                     /note="similar to Saccharomyces cerevisiae GCD11
                     (YER025W); ancestral locus Anc_7.513"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683128.1"
                     /db_xref="GeneID:11500923"
                     /db_xref="GOA:G8ZZ73"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR015256"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ73"
                     /translation="MSDLQDREPSIIINGNLEPEQEEIYEEDQVMEEQLGQLEDEKPK
                     KKVTFGGLDEADDEETRKREFEEGGGLPEQPENPDFTQLNPCSPEIINRQATINIGTI
                     GHVAHGKSTVVRAISGVQTVRFKDELERNITIKLGYANAKIYKCQEPSCPEPDCYRSF
                     KSDKEINPKCQRPGCPGRYKLVRHVSFVDCPGHDILMSTMLSGAAVMDAALLLIAGNE
                     SCPQPQTSEHLAAIEIMKLKNVIILQNKVDLMREESALEHEKSILKFIRGTIADGAPI
                     VPISAQLKYNIDAVNEFIVKTIPVPPRDFMISPRLIVIRSFDVNKPGAEIEDLKGGVA
                     GGSILNGVFKLGDEIEIRPGIVTKDERGKIQCKPIFSNIVSLFAEQNDLKFAVPGGLI
                     GVGTKVDPTLCRADRLVGQVVGAKGHLPNIYTDIEINYFLLRRLLGVKTDGQKQAKVR
                     KLEPNEVLMVNIGSTATGARVVAVKADMARLQLTSPACTEVNEKIALSRRIEKHWRLI
                     GWATIKRGTTLEPIF"
     gene            complement(<101024..>103477)
                     /gene="TDEL0H00590"
                     /locus_tag="TDEL_0H00590"
                     /db_xref="GeneID:11500924"
     mRNA            complement(<101024..>103477)
                     /gene="TDEL0H00590"
                     /locus_tag="TDEL_0H00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683081.1"
                     /db_xref="GeneID:11500924"
     CDS             complement(101024..103477)
                     /gene="TDEL0H00590"
                     /locus_tag="TDEL_0H00590"
                     /inference="similar to DNA sequence:INSDC:YLR451W"
                     /note="similar to Saccharomyces cerevisiae LEU3 (YLR451W);
                     ancestral locus Anc_7.512"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683129.1"
                     /db_xref="GeneID:11500924"
                     /db_xref="GOA:G8ZZ74"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ74"
                     /translation="MSPSQSESDLSAFEGNGNSKRGSIRESGSSRKKFACVECRQQKS
                     KCDAHERAPEPCTKCAKKDVPCILKRDFRRTYKRARNEAIEKRFKELTRTLTNLSSED
                     ILKKIEQEQKDLLSGQNFTKEKLKIKKLSTTQSNVSSSVPSWDIEEITNGDADATEDN
                     KVENEQCSISDQQLVCSPKSLGEVYMSSDDIAELFQEFATKYHPFLPVVDISRGAESI
                     YSLSPCLFWVILLIGLRRKSGAIDLMTKLSSLVKSILAEITISPIIRYTPSENDEPVL
                     NVASVYSVQAFLLYTFWPPLTSSLSADTSWNTIGTAMFQAIRVGLNCAEFSKEYESAN
                     SELISEQVRTWVCCNVVSQIIASSFGFPAYVSFDHAVIIATAENQDKNERHRVPLPIK
                     QMAQIAHFENQVISTMNSNPSNELGMVGGEQKQPLLHVLNQQLSQLEMNLEENNLDSM
                     RKFLLLVAKVHLLTYYFTDTFPKHKKESTDVRLMSLSEIASNFETKRGLVRVFNAAID
                     LLGHSTKMWQTDPAIIKYFPGVFVLNIWQSACIISKLVHSSLSAVLDIDRGKKAYQDA
                     VSLTFNASVLKHDMAYRSSAIMKSIWSMFANMHGDWKRDKVCQVDKFANDFNLGISIK
                     SRMSVSVFFDCLYILREKCGMAKIRREAQQLEDEEDYDEEDENNSEEQRAAQRRTLSR
                     IRHPEESARKIIKTTPLDPNPINAANTSSGSSLASPNSQPADVLSLNGILNKSSPRNI
                     PMALEEPNALTNNPSLQEEDQQSLVPSLFGLPERSIDPSPGHNPQLALPEHWDNWESD
                     SVWRDVDILMNEFAFNPTV"
     gene            <103728..>105044
                     /gene="TDEL0H00600"
                     /locus_tag="TDEL_0H00600"
                     /db_xref="GeneID:11500925"
     mRNA            <103728..>105044
                     /gene="TDEL0H00600"
                     /locus_tag="TDEL_0H00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683082.1"
                     /db_xref="GeneID:11500925"
     CDS             103728..105044
                     /gene="TDEL0H00600"
                     /locus_tag="TDEL_0H00600"
                     /inference="similar to DNA sequence:INSDC:YJR124C"
                     /note="similar to Saccharomyces cerevisiae YJR124C;
                     ancestral locus Anc_7.511"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683130.1"
                     /db_xref="GeneID:11500925"
                     /db_xref="GOA:G8ZZ75"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ75"
                     /translation="MNVLKEISSASRDIKLLWASVFFRLFAYGLTNQVLTLFLNDLHL
                     SESKIGWFMSLTLIGDVGCSYVLTWHADSWGRRRILVYGSVMMVLSGFIFAYSENFQL
                     LLLFAIFGVISPSSDEVGPFKSIEESMIAHLTPHNKRPEVYAIHSLVGTTGAALGAIA
                     CGAFIDLLKYANLATTDLECYKLVFLLYAVFAMAKVIIMLLLSENTELEANHEEVSSP
                     EALVNDEMAPLLQTAENRKRGLSKETIAVLLKLLAIFMLDSLGSGFMTSGWMVYYYAK
                     VFLMSSFALGALFFVSKIVMASSTIPSSVMARTFGPVKATLLVQVPSGIFSILIPFAE
                     ACLPLSVILLNLHFATTAMDVIPRQVLLTNIIAAKDLTKVMGIVNIGKTLARCIGPIF
                     TGLLASMDRLWCCYIISGVLVILADCLLAFWFLPVDFKLSKQLNTS"
     gene            complement(<105097..>107748)
                     /gene="TDEL0H00610"
                     /locus_tag="TDEL_0H00610"
                     /db_xref="GeneID:11500926"
     mRNA            complement(<105097..>107748)
                     /gene="TDEL0H00610"
                     /locus_tag="TDEL_0H00610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683083.1"
                     /db_xref="GeneID:11500926"
     CDS             complement(105097..107748)
                     /gene="TDEL0H00610"
                     /locus_tag="TDEL_0H00610"
                     /inference="similar to DNA sequence:INSDC:YER024W"
                     /note="similar to Saccharomyces cerevisiae YAT2 (YER024W);
                     ancestral locus Anc_7.510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683131.1"
                     /db_xref="GeneID:11500926"
                     /db_xref="GOA:G8ZZ76"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ76"
                     /translation="MSAVPSIITSQVSKDVETFTYEKDLPKLPVPDLEETLNELHRSL
                     EPLYYADGYYNHPLEPEQLEKFSGAVQEFLLSDAAVKLQNKLKEFDSVNDCYLDNLHL
                     DINNNTLSDGQDDVLPRNPFLVLAEDAVPEISQADRSAVLVHSALRFVSALRHGVLPP
                     DINSKSGNPLSMRPYMNLFGTTRCPVFFPGEIENFDLNKPYASSDLDEGWKFTSSEAN
                     DSEDESDDELPTPPLTAESAGSDQDNEVFARQGIGLKSHPDSRHILVISKGQYYTIEV
                     LDENDDILYNDSILATAFAHILEDSQEPNTFKKSTALGSLTSHSFRNWKYARKRLQKR
                     YQDELQLIDSALFVLVLDDSSSRVSDGQNPSSDDCKRLFYGTSVIDERGHQVGSCVSR
                     WYDKLQLVVTADSKAAVIWDSFTCDGSVVLRFTSETYTESILRLARDVNAGDPRFSLW
                     PSIRDSERPASKSPTLELDPRTFTNKIAWDFSNILNTHVHLSETKLADLISKHDLFHV
                     SIPFGRRSAQRLGINPDSMIQVALQVAHYALYGRMVYGLEPISTRGFKNSRSCFINIQ
                     SQELLELCQHFISNSLDEQGKLEKFRKACESHSEKIKRAKLGNGYEKHFNALKYLFKF
                     HDHFGIELNAKDKKITENVFEDPLVKPFSAPELIVANCGNAATTTFGITPAVSQGFGV
                     GYIIKDDQSDLTVTSQFRQGDRLIYMLNWVLTEIRNYWKGSNEKAFNKNGVKISPVVD
                     KLYEMDNALNNLKLSKSYGSGKIIGGYGFFDLQAHLDSRSSSRVHSHSNSSVHLSELG
                     NSSHGSGNLLKHLNFALSVPTDKDKQDTGHEIQQIQPSNKNESDEDLLFTGSRPDTKK
                     RSNVINSKFDIDFDRGGVGRKVKAAFE"
     gene            complement(<108234..>108911)
                     /gene="TDEL0H00620"
                     /locus_tag="TDEL_0H00620"
                     /db_xref="GeneID:11500927"
     mRNA            complement(<108234..>108911)
                     /gene="TDEL0H00620"
                     /locus_tag="TDEL_0H00620"
                     /product="40S ribosomal protein S5"
                     /transcript_id="XM_003683084.1"
                     /db_xref="GeneID:11500927"
     CDS             complement(108234..108911)
                     /gene="TDEL0H00620"
                     /locus_tag="TDEL_0H00620"
                     /inference="similar to DNA sequence:INSDC:YJR123W"
                     /note="similar to Saccharomyces cerevisiae RPS5 (YJR123W);
                     ancestral locus Anc_7.509"
                     /codon_start=1
                     /product="40S ribosomal protein S5"
                     /protein_id="XP_003683132.1"
                     /db_xref="GeneID:11500927"
                     /db_xref="GOA:G8ZZ77"
                     /db_xref="InterPro:IPR000235"
                     /db_xref="InterPro:IPR005716"
                     /db_xref="InterPro:IPR020606"
                     /db_xref="InterPro:IPR023798"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ77"
                     /translation="MSDTEAPVEVQEEFEVVEEFTPVTLATPIPEEVQQAQREIKLFN
                     KWSFEDVEVKDASLVDYVQVRQPIFVSHTAGRYANKRFRKAQCPIIERLTNSLMMNGR
                     NNGKKLKAVRIVKHTLDIINVLTDQNPLQVVVDAITNTGPREDTTRVGGGGAARRQAV
                     DVSPLRRVNQAIALLTIGAREAAFRNIKTIAETLAEELINAAKGSSTSYAIKKKDELE
                     RVAKSNR"
     gene            complement(<109274..>110623)
                     /gene="TDEL0H00630"
                     /locus_tag="TDEL_0H00630"
                     /db_xref="GeneID:11500928"
     mRNA            complement(<109274..>110623)
                     /gene="TDEL0H00630"
                     /locus_tag="TDEL_0H00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683085.1"
                     /db_xref="GeneID:11500928"
     CDS             complement(109274..110623)
                     /gene="TDEL0H00630"
                     /locus_tag="TDEL_0H00630"
                     /inference="similar to DNA sequence:INSDC:YJR122W"
                     /note="similar to Saccharomyces cerevisiae CAF17
                     (YJR122W); ancestral locus Anc_7.508"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683133.1"
                     /db_xref="GeneID:11500928"
                     /db_xref="InterPro:IPR017703"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ78"
                     /translation="MILRNRCLLLTRRGLSTSNDRGLLRFSRTNNKSYLKVRGPDSPK
                     FLNGLLTSKVIPFFVKKNLTTINPDEEELTNTVFEFDETQTNWGVYNEMSYNGAYISR
                     FGQYAGILNSKGKLITDTILYPAPLSSADAKVMRYPTYLLEFDASIVDYIQDLFNIHK
                     LTSKVKIKKANDLISWDLSLQLPPEPTNPWVTNLLDPSTTTKTPEDALAFAQELVSAF
                     FQGSEDQIIALYIERRTDEILETNGKAPQMLRVVTTSDTQNVSKIFNPVGLPYPCSIE
                     EVDQSFFRESRFEAGFVDSTSDFKPESLLPLELNFDYLPNAVSADKGCYMGQELTART
                     LATGILRKRLVPVTLTNTDALTSNAKYHDIMLDSQLTTTTTTTTSSSSPFGVAPSKPR
                     QRPAGSLIAHQGNLGVAILRTEHFKLAFDQPQDKVLFHIAGTPVGVIPKKPFWLEEQ"
     gene            complement(<110893..>112389)
                     /gene="TDEL0H00640"
                     /locus_tag="TDEL_0H00640"
                     /db_xref="GeneID:11500929"
     mRNA            complement(<110893..>112389)
                     /gene="TDEL0H00640"
                     /locus_tag="TDEL_0H00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683086.1"
                     /db_xref="GeneID:11500929"
     CDS             complement(110893..112389)
                     /gene="TDEL0H00640"
                     /locus_tag="TDEL_0H00640"
                     /inference="similar to DNA sequence:INSDC:YJR121W"
                     /note="similar to Saccharomyces cerevisiae ATP2 (YJR121W);
                     ancestral locus Anc_7.507"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683134.1"
                     /db_xref="GeneID:11500929"
                     /db_xref="GOA:G8ZZ79"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005722"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR024034"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ79"
                     /translation="MVLIPKTSRVALQAATRFASVRGLATAAPLAGKVRAVIGAIVDV
                     QFEQENLPAILNALEIERPGGKLVLEVAQHMGENTVRTIAMDGTEGLVRGEKVSDTGA
                     PISVPVGPETLGRIINVIGEPIDERGPINSKETRPIHAEPPSFVEQSTNAEVLETGIK
                     VVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDL
                     YREMRETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDVEGQDVLLFI
                     DNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVP
                     ADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVA
                     TKVQETLQAYKSLQDIIAILGMDELSEGDKLTVERARKIQRFLSQPFAVAEVFTGIQG
                     KLVRLKDTISSFKAVLDGKYDHLPENAFYMVGGIEDVVAKAEKMAASD"
     gene            complement(<113092..>113946)
                     /gene="TDEL0H00650"
                     /locus_tag="TDEL_0H00650"
                     /db_xref="GeneID:11500930"
     mRNA            complement(<113092..>113946)
                     /gene="TDEL0H00650"
                     /locus_tag="TDEL_0H00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683087.1"
                     /db_xref="GeneID:11500930"
     CDS             complement(113092..113946)
                     /gene="TDEL0H00650"
                     /locus_tag="TDEL_0H00650"
                     /inference="similar to DNA sequence:INSDC:YER023W"
                     /note="similar to Saccharomyces cerevisiae PRO3 (YER023W);
                     ancestral locus Anc_7.506"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683135.1"
                     /db_xref="GeneID:11500930"
                     /db_xref="GOA:G8ZZ80"
                     /db_xref="InterPro:IPR000304"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028939"
                     /db_xref="InterPro:IPR029036"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ80"
                     /translation="MGYTLVILGCGVMGQALLSAIYNAPKADSEEIAKLYPSTIITCN
                     HDEPSAKQVDKLLATFDESPNAIKVSSTYGQNQDAIDKASVVILATKPFLVEKVLSGV
                     QEQIKGKLIISLAAGWTIDQLTQYTEKVSRVMTNTPAKYGYGCAVVSHSSGINNDDKA
                     IVSQLVSHVGKYIELPEKNMDAATALVGSGPAFVLLMIESLMESGIQMGIPLKESKEC
                     ALKVLEGTVKMVEKSGEHPSVLKHQVCTPGGTTIAGLCVMEDKGVKSGIIRGVEEAAK
                     VAAKLGKK"
     gene            <114128..>116440
                     /gene="TDEL0H00660"
                     /locus_tag="TDEL_0H00660"
                     /db_xref="GeneID:11500931"
     mRNA            <114128..>116440
                     /gene="TDEL0H00660"
                     /locus_tag="TDEL_0H00660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683088.1"
                     /db_xref="GeneID:11500931"
     CDS             114128..116440
                     /gene="TDEL0H00660"
                     /locus_tag="TDEL_0H00660"
                     /inference="similar to DNA sequence:INSDC:YJR119C"
                     /note="similar to Saccharomyces cerevisiae JHD2 (YJR119C);
                     ancestral locus Anc_7.505"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683136.1"
                     /db_xref="GeneID:11500931"
                     /db_xref="GOA:G8ZZ81"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR003349"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ81"
                     /translation="MESIPTLRPTIREFANPIEYLSESKVQRLGHKYGMVKIVPPEGF
                     HPHFSINRDSFKFNVRVQNLAELNILNRSRMFFMKQLNNFNRAKRIKKSERLVKPYIE
                     ATENQKIYLYDLFIMVVKGSGTLSSDSTPTQVSRRKRGRGSPEETSAQAHASLPPLTD
                     IMSDGNLWRAISRKLRIPVKLLQDAFEQYISSYYNYLAAQTKAHGSSQFSKLLYNEEY
                     PKSLLSDDDVEPSGSDDDESEDEGCLVCDRSNKPTKIILCDACDKPFHLYCLSPPLTS
                     IPKGEWICNNCIVGNGYYGFKEESHFYTLSEFQKRCNSRETELTVDPVSGRKLSVEKL
                     EQKFWNYVDDMEKSITVKYGADINGVSPGEISGFPSSHYIPEDLPISEREDFNQYTKH
                     PMNLLNLPNAKGSLLPMFDRRISGMTVPWIYVGSTFSTFCWHLEDQYTLSANYQHEGA
                     PKIWYSIPEYACHQFNSLMKSLAPDLFDKQPDLLHQLVTLVSPYDKRFQDAKITCFKA
                     VQNPNEYIVTFPKCYHAGFNSGYNFNEAVNFTLDSWVPYGIEAIGDYQLTGKQCVFDM
                     FELMLNVVIEFLKGKSSFQEELVRTCYLELLNVLNSKNKMIKQLPEVSVNPSFLKRIV
                     RNDDWKLKENNLPSPKAEEDQSMLSDLHNMPDSVDFDVFCSKCHTICFLAFMIHYKRP
                     NPRKRRKLHSFTVTQINELKGDKDLEVLCLKDYLALVEQSYGTHDNDKFNDNDNDDPF
                     KNDELNYIRDPQEVRDILSAASPKIERARI"
     gene            <116622..>117173
                     /gene="TDEL0H00670"
                     /locus_tag="TDEL_0H00670"
                     /db_xref="GeneID:11500932"
     mRNA            <116622..>117173
                     /gene="TDEL0H00670"
                     /locus_tag="TDEL_0H00670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683089.1"
                     /db_xref="GeneID:11500932"
     CDS             116622..117173
                     /gene="TDEL0H00670"
                     /locus_tag="TDEL_0H00670"
                     /inference="similar to DNA sequence:INSDC:YJR118C"
                     /note="similar to Saccharomyces cerevisiae ILM1 (YJR118C);
                     ancestral locus Anc_7.504"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683137.1"
                     /db_xref="GeneID:11500932"
                     /db_xref="InterPro:IPR018815"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ82"
                     /translation="MAAISSFNGLFFRVAMLFALAFFCFKNVNSILQNSYMAVFTQAM
                     NLPALSMSQYSAQLGLFGILFLFAAVSDLIPLLERNQKYFNSVVPFRLFMFFTLAGLA
                     YLWESNLYLHNNVVFTYCFIEVWVNFIVLGALREERNEQFKSSNQFSSQAIIVEESEN
                     NDEDSEVLTSVQEIEQIVEIMDE"
     gene            complement(<117237..>119249)
                     /gene="TDEL0H00680"
                     /locus_tag="TDEL_0H00680"
                     /db_xref="GeneID:11500933"
     mRNA            complement(<117237..>119249)
                     /gene="TDEL0H00680"
                     /locus_tag="TDEL_0H00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683090.1"
                     /db_xref="GeneID:11500933"
     CDS             complement(117237..119249)
                     /gene="TDEL0H00680"
                     /locus_tag="TDEL_0H00680"
                     /inference="similar to DNA sequence:INSDC:YER022W"
                     /note="similar to Saccharomyces cerevisiae SRB4 (YER022W);
                     ancestral locus Anc_7.503"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683138.1"
                     /db_xref="GeneID:11500933"
                     /db_xref="GOA:G8ZZ83"
                     /db_xref="InterPro:IPR019313"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ83"
                     /translation="MSEGADDSREVNKAIEEGIQLALDPNLISLPLNGSTATSQPATA
                     TANSTDADSLKDANVNPGDADPSKGKPPNGKPLFKNPYEIFGQMPMQQLVPLLLQQRG
                     PGFKFADLSEEGLINEIESSQDNSEQAANDNSTSDFTMIAEDDESLTDNANKPPIDED
                     SKLDLQQKEDASRAKFENEAEAMTQEQFVGIRKSMIEHVDLALNESSLALEFLSLLLS
                     SVRESAATASMSPFLRKTAPVGSLNSDKVPLVPHTHEEKTNAEILSRGWKLRSLNESR
                     LLLKEKYMLLNEIMTKEHLYWSNIARHISNKDVIFKMRDKNNRTRLLGIKYGYEDSGS
                     NYRHDRGVAVLRNNPEQNKLELEPFSGADAGGSLNNERFVRVRIFTKIASEDDYILTG
                     ESSVSEVLFSADSGIDDLEDVKNQIKRLKAFAFEQELMYQLKKESSLLISYGVTIENE
                     NKVVMELPNEKFEMELVSLDDDSVVNHVQDAPKVNDKRATLTLVTLRLLLIAMFKKNL
                     KQRLTSLGKASPKGAKDILLLRPLLGRLRHHNYKILLRKIVKDYILDVAENATMRETA
                     VRSPSLIEQNELDFNVAKLSKEINAFSGLLNICKTKFEINLPDNGELRLVLESPNYCN
                     AVVTVTYVNKAKDVSFDTNFSEFKEIEEFLHFIFIEYIKNKDGVKE"
     gene            complement(<119438..>120955)
                     /gene="TDEL0H00690"
                     /locus_tag="TDEL_0H00690"
                     /db_xref="GeneID:11500934"
     mRNA            complement(<119438..>120955)
                     /gene="TDEL0H00690"
                     /locus_tag="TDEL_0H00690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683091.1"
                     /db_xref="GeneID:11500934"
     CDS             complement(119438..120955)
                     /gene="TDEL0H00690"
                     /locus_tag="TDEL_0H00690"
                     /inference="similar to DNA sequence:INSDC:YER021W"
                     /note="similar to Saccharomyces cerevisiae RPN3 (YER021W);
                     ancestral locus Anc_7.502"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683139.1"
                     /db_xref="GeneID:11500934"
                     /db_xref="GOA:G8ZZ84"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="InterPro:IPR013586"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ84"
                     /translation="MVADLMEVDSHAEMGQEDVKYAEERNVNEIVAVLREVAKTSLTL
                     DPYFVWKGLKELGNLRAHHLNEETLLALINLLYPDSSVFKMSLLKAVNGERKCSVPNA
                     QEIRAGYPASFYEVVSDKTIEVAPEINSFIHLLVVRYLFDAKKLQELEAFNKKVILPK
                     VLAFYNQRSTDLISAKLWFYVVLCDEARRERANLETRSTMIKSLKIASLRHNSETKAM
                     LITLLLRSFLATGEVETAADFMAKVEFPNSADVSSPLEARFYYYLSKINAIQLDYSTA
                     NEYIIAAIRKAPNTPNSLGFLQQANKLHCVIELLMGDIPELSFFHQAGMQRSLEPYYD
                     LSKAVKLGDLKKFTSAIAKYKPQLIKDGNYQLYVRLRSNVIKTGIRIISLTYKKISLR
                     DICLKLRLDSEQTGEYMVSRAIRDGVIEAKINHEQGYIETSELLNVYDTKEPQDVFDE
                     RIQFVNQLHDESVVAMRYPEDNKGKNNTNEEDDFIDGELLDDLSDFSDIDGLGFL"
     gene            complement(<121130..>122506)
                     /gene="TDEL0H00700"
                     /locus_tag="TDEL_0H00700"
                     /db_xref="GeneID:11500935"
     mRNA            complement(<121130..>122506)
                     /gene="TDEL0H00700"
                     /locus_tag="TDEL_0H00700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683092.1"
                     /db_xref="GeneID:11500935"
     CDS             complement(121130..122506)
                     /gene="TDEL0H00700"
                     /locus_tag="TDEL_0H00700"
                     /inference="similar to DNA sequence:INSDC:YJR117W"
                     /note="similar to Saccharomyces cerevisiae STE24
                     (YJR117W); ancestral locus Anc_7.501"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683140.1"
                     /db_xref="GeneID:11500935"
                     /db_xref="GOA:G8ZZ85"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="InterPro:IPR027057"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ85"
                     /translation="MTVFDQLQGFLDRPDIPFKSIIAGITVGKFAFETYLTYRQYRVL
                     SKKKLPKVLENEIDDATFLKSEEYSRAKARFSVVVDIYELVQKLAFIKFDAFPRLWNL
                     SVQVANVLLPAKFKVLSTVAQSLCFLSVLTNLATIVDLPTSYYQHFVLEEKFSFNKLT
                     IKLWVTDMFKSVALSHALGGPILYGFLKIFEKFQTNFLWYICLFVFVVQILAMTLIPV
                     YIMPLFNKFTPLEDGELKTSIETLAKRVGFPLDQIFVIDGSKRSSHSNAYFTGLPYMS
                     KRIVLFDTLVNESSVDEITAVLAHEIGHWQKKHIMNMVVFSQVHIFVIFSLFTGVYRN
                     LSLYNDFGFYIGTSDSLLSSATKVFTPEWPIIVGFMLFSDLLTPMECFMQFIMSLVSR
                     LHEYQADTYAKGLGLSKNLCQALINLQIKNLSTMNVDPLYSSYHYSHPTLPERLTNLG
                     YVSEKKQH"
     gene            complement(<122669..>123496)
                     /gene="TDEL0H00710"
                     /locus_tag="TDEL_0H00710"
                     /db_xref="GeneID:11500936"
     mRNA            complement(<122669..>123496)
                     /gene="TDEL0H00710"
                     /locus_tag="TDEL_0H00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683093.1"
                     /db_xref="GeneID:11500936"
     CDS             complement(122669..123496)
                     /gene="TDEL0H00710"
                     /locus_tag="TDEL_0H00710"
                     /inference="similar to DNA sequence:INSDC:YJR116W"
                     /note="similar to Saccharomyces cerevisiae YJR116W;
                     ancestral locus Anc_7.500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683141.1"
                     /db_xref="GeneID:11500936"
                     /db_xref="GOA:G8ZZ86"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ86"
                     /translation="MKFLVEEDPFLRFSLFSGSDNLYLLHAHEILGAFVFYQLIYAYF
                     APWFNRLVFRGGYTSIGDRKTKINFDIHTVSNVQCVITFWSIAPTLLLPMNLSVVSYQ
                     NDLASMASALAVGYFLWDLFICMRYYSLYGFEFLAHALSSLYVFTLGLKPFCQSWIGK
                     FLLFEASTPFVNNNWFIAQLSKSSSKSIVPEWFNIVNGVLLLGTFFSVRILWGFIAIS
                     ILLCQMWKERHEIPLAQSGILLLLNVLLNTLNLFWFNKMLRLAKKMVSRSSASAKNM"
     gene            <123831..>124862
                     /gene="TDEL0H00720"
                     /locus_tag="TDEL_0H00720"
                     /db_xref="GeneID:11500937"
     mRNA            <123831..>124862
                     /gene="TDEL0H00720"
                     /locus_tag="TDEL_0H00720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683094.1"
                     /db_xref="GeneID:11500937"
     CDS             123831..124862
                     /gene="TDEL0H00720"
                     /locus_tag="TDEL_0H00720"
                     /inference="similar to DNA sequence:INSDC:YJR105W"
                     /note="similar to Saccharomyces cerevisiae ADO1 (YJR105W);
                     ancestral locus Anc_7.499"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683142.1"
                     /db_xref="GeneID:11500937"
                     /db_xref="GOA:G8ZZ87"
                     /db_xref="InterPro:IPR001805"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ87"
                     /translation="MSATAKPQLICLGNPLLDYQATVQPEYLEKYGLKPDDAILVDAA
                     SNEPRMAIFEEMLGFDDVKFVAGGAAQNTARGAAYFLGAGQVGYFGSVGEDKYSEKLL
                     EENKAAGVLSLYQFQKDIGTGKCAAMINGHYRSMVTDLGAANYFTPDHLDKHWDFVEQ
                     AKFFYVGGFHLTVSPEAILKLAKHAQEKGKPFVLNLSAPFIPQFFKAPLEQVLPYTTY
                     VIGNESEAASYAESFGLPSDKRDLLSIAKQIVGDSQDRTVIFTQGLDPTIVYSAKNSK
                     TYPVRPLAGDKIVDTNGAGDAFAGGFMAGLTQGKPIDTAIDMGQWLASLSIQEVGPSY
                     PKSKVEYQA"
     gene            <125009..>126994
                     /gene="TDEL0H00730"
                     /locus_tag="TDEL_0H00730"
                     /db_xref="GeneID:11500938"
     mRNA            <125009..>126994
                     /gene="TDEL0H00730"
                     /locus_tag="TDEL_0H00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683095.1"
                     /db_xref="GeneID:11500938"
     CDS             125009..126994
                     /gene="TDEL0H00730"
                     /locus_tag="TDEL_0H00730"
                     /inference="similar to DNA sequence:INSDC:YJR106W"
                     /note="similar to Saccharomyces cerevisiae ECM27
                     (YJR106W); ancestral locus Anc_7.498"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683143.1"
                     /db_xref="GeneID:11500938"
                     /db_xref="GOA:G8ZZ88"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ88"
                     /translation="MLWIVNLAHPYLLYPDASLSVGFVVTSVLYVILCFVLLGITASE
                     YLCPNVAKIADFNDHGTGTLMAVLLAWCNSSPDLFSNFMSWTSTITSNGAALSIGEVL
                     GACGIILCIVEGSIFMIMSSTALDISYSQKVNVLRDLAFTLVAMLFMWYVCIFNRVTA
                     IDCVLMIAVYISYLAVKFIWRPGGTQEDEEYNQNEAFPRESLEGATLSHRIKPSLISA
                     MDFNNLLSMLENSRGDDLQTFQEELVTMNDEPFTFQQQIRPFTEPAKKSNFSETHPVP
                     QTSPAAFAPYHDNPDEPSFEPEVLLMQPSRTIHSGKIKKIKRGLVQLFVPHLLNFRQK
                     STIDAILSVATVPFVIFLRLSCPQSTNILEFDETLGKYTVSNTDVMLLFTQALICPLI
                     PFAILSCLLVQNIAWIFWMLAVFLSATLLCLSLAFYRTLLSYNRFSLLEPSLDTESYE
                     LTDERRALEKIGNILIIIYLLIGIVNAILCISLIANSLIEMLEIYQKITKASQAILGL
                     TVFALGNSVSDLISNIAMCKLYRKMPSNEQDVRKMATKFFMISCTSCIGGVLLNSMGG
                     IGLSGLISMIFVHKSSNNWAILRSVKLHDSDDSHDYKFTISCIAIIVQILLLAIFFGS
                     PQVIHNWCKSRMKGIGLAMCIIWGIATIFNVSSEVFF"
     gene            complement(<127211..>128476)
                     /gene="TDEL0H00740"
                     /locus_tag="TDEL_0H00740"
                     /db_xref="GeneID:11500939"
     mRNA            complement(<127211..>128476)
                     /gene="TDEL0H00740"
                     /locus_tag="TDEL_0H00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683096.1"
                     /db_xref="GeneID:11500939"
     CDS             complement(127211..128476)
                     /gene="TDEL0H00740"
                     /locus_tag="TDEL_0H00740"
                     /inference="similar to DNA sequence:INSDC:YER020W"
                     /note="similar to Saccharomyces cerevisiae GPA2 (YER020W);
                     ancestral locus Anc_7.496"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683144.1"
                     /db_xref="GeneID:11500939"
                     /db_xref="GOA:G8ZZ89"
                     /db_xref="InterPro:IPR001019"
                     /db_xref="InterPro:IPR002975"
                     /db_xref="InterPro:IPR011025"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ89"
                     /translation="MGICGSKVEESSKTNVSRQNKTNGAPEKDPAKATSNVTSSTSAD
                     TKVDKLNNNGDAVADSSKSKKNQEVKVLLLGAGESGKSTIIQQLKILHQNGFTPEELL
                     EYRSVVFKNLLDVGKQLKEARSKFNVPLEPDCSITEEDLALFNSFDASDDTVVLKTDE
                     VTNNETQSAGGQAKENRSLSSITQFPPELTRILGTLWSLQSTQDLIDGKHRSEFYLMD
                     SASYYMENLPRISKADYIPDEQDILRSRQKTSGIFDNVFDMGGNLKFHIYDVGGQRSE
                     RKKWIHCFDNVTLIIFCVSLSEYDQILLEDREQNRFQESLVLFDNIVNSRWFARTSVV
                     LFLNKIDLFAEKLQKVPLETYFPDYSGGQDINKAAKYILWRFIQLNRANLSIYPHVTQ
                     ATDTSNIKLVFAAIKETILENTLKDSGVL"
     gene            complement(<129015..>129263)
                     /gene="TDEL0H00750"
                     /locus_tag="TDEL_0H00750"
                     /db_xref="GeneID:11500940"
     mRNA            complement(<129015..>129263)
                     /gene="TDEL0H00750"
                     /locus_tag="TDEL_0H00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683097.1"
                     /db_xref="GeneID:11500940"
     CDS             complement(129015..129263)
                     /gene="TDEL0H00750"
                     /locus_tag="TDEL_0H00750"
                     /inference="similar to DNA
                     sequence:INSDC:Scer_YGOB_Anc_7.495"
                     /note="similar to Saccharomyces cerevisiae Anc_7.495
                     (Scer_YGOB_Anc_7.495); ancestral locus Anc_7.495"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683145.1"
                     /db_xref="GeneID:11500940"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ90"
                     /translation="MGCEDPYEEWYAERSAGSAGSLVEQERERQEAQRRQTEMNEEVW
                     RRSLPSEKFPSLGSLDYEVRMPKRAGEVDRGEFKRPRP"
     gene            <129458..>130045
                     /gene="TDEL0H00760"
                     /locus_tag="TDEL_0H00760"
                     /db_xref="GeneID:11500941"
     mRNA            <129458..>130045
                     /gene="TDEL0H00760"
                     /locus_tag="TDEL_0H00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683098.1"
                     /db_xref="GeneID:11500941"
     CDS             129458..130045
                     /gene="TDEL0H00760"
                     /locus_tag="TDEL_0H00760"
                     /inference="similar to DNA sequence:INSDC:YKR065C"
                     /note="similar to Saccharomyces cerevisiae PAM17
                     (YKR065C); ancestral locus Anc_1.196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683146.1"
                     /db_xref="GeneID:11500941"
                     /db_xref="InterPro:IPR013875"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ91"
                     /translation="MITQCAKSVCGRKLVVVSRVPGTFFGLRSLATSTSSSNGGSTNL
                     NALTWTDFFQMRKQQRRINVGSSIFTAFLGCNASWAYLSTMEIDPTQTILGFDPLVVI
                     SGALAASGALGYLFGPLIGSQIFTLSNKKKLPEFDAKNKEFLRKISTNRVDASSQSFS
                     NPVPDYYGEKIGSIGEYRQWLRDCHAYRRKAKEFL"
     gene            complement(<130132..>130503)
                     /gene="TDEL0H00770"
                     /locus_tag="TDEL_0H00770"
                     /db_xref="GeneID:11500942"
     mRNA            complement(<130132..>130503)
                     /gene="TDEL0H00770"
                     /locus_tag="TDEL_0H00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683099.1"
                     /db_xref="GeneID:11500942"
     CDS             complement(130132..130503)
                     /gene="TDEL0H00770"
                     /locus_tag="TDEL_0H00770"
                     /inference="similar to DNA sequence:INSDC:YJL151C"
                     /note="similar to Saccharomyces cerevisiae SNA3 (YJL151C);
                     ancestral locus Anc_1.197"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683147.1"
                     /db_xref="GeneID:11500942"
                     /db_xref="GOA:G8ZZ92"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ92"
                     /translation="MNSRKLSINRSDGWLLLLSVFVPPVPVLIRKGFFSRDFLLNVLL
                     FVILFIPAIAHAAYVIIETSDERNKDYEPVPVPSQDDEEGPGNGDFDVDLESNALPLY
                     DDVVASSEQPTDAPTDNKIQK"
     gene            <130702..>132444
                     /gene="TDEL0H00780"
                     /locus_tag="TDEL_0H00780"
                     /db_xref="GeneID:11500943"
     mRNA            <130702..>132444
                     /gene="TDEL0H00780"
                     /locus_tag="TDEL_0H00780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683100.1"
                     /db_xref="GeneID:11500943"
     CDS             130702..132444
                     /gene="TDEL0H00780"
                     /locus_tag="TDEL_0H00780"
                     /inference="similar to DNA sequence:INSDC:YJL149W"
                     /note="similar to Saccharomyces cerevisiae YJL149W;
                     ancestral locus Anc_1.198"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683148.1"
                     /db_xref="GeneID:11500943"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ93"
                     /translation="MDVAGYCLFPLEKLPDELILEVFSHLAQPDRLTVSLLSHRCCEI
                     ATKLVYRRIYLNDSNVVRSSYMNLAINWTLLNIPSSLNEDESRKIANAKLRKLIYALE
                     MNQRALESVEWIRINWDLDPALQKTVLAILCSRGTSLQRLENITDPSCNDIIAGGAVS
                     SRKVISLDMAPPNSLPEIAVPSDYIPNLQRYLRSRISTSLSHMTLFIDPIKLFNYLYP
                     LTHKLQIIDLKLHWRREFYDPAYFTRRLKTRPIEKLSEVFEVRTLKTLTIISWNETLV
                     SREIQMIKDFKEFVYLEDLSLISIKQNFDVLVTLFYNLPRLKRLKMDFLEDFMPETKN
                     TEIFLTILLVCKKLQFIDMRFEGLDPQMIAIHETKFELHQKCYCDACIHVFEDILKKK
                     FFLFPEDQYLTDIHDIAAKDIFKMMRYLSLLPYSKACDCYPSVRTQPMNLDEFVSRMN
                     KNLLFYRQSRGQLLSPEHQVHDPQNSEFSTLGLPHALLTKQDVIECYHALIHHYRATY
                     VAFLRGFPHLRFLMLNDIPTIVVEEEKERIFQPIFYHENYKTNLTCWSQIEKKPKGSH
                     GEATDSVNRKVSVF"
     gene            complement(<132519..>135002)
                     /gene="TDEL0H00790"
                     /locus_tag="TDEL_0H00790"
                     /db_xref="GeneID:11500944"
     mRNA            complement(<132519..>135002)
                     /gene="TDEL0H00790"
                     /locus_tag="TDEL_0H00790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683101.1"
                     /db_xref="GeneID:11500944"
     CDS             complement(132519..135002)
                     /gene="TDEL0H00790"
                     /locus_tag="TDEL_0H00790"
                     /inference="similar to DNA sequence:INSDC:YKR064W"
                     /note="similar to Saccharomyces cerevisiae YKR064W;
                     ancestral locus Anc_1.199"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683149.1"
                     /db_xref="GeneID:11500944"
                     /db_xref="GOA:G8ZZ94"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ94"
                     /translation="MGGKEDQSQQPVRKRNRLTVVCSNCRRRKSKCDRQTPCGNCVRL
                     GDKDTCVYIKEAKGDRNSMDLRITKKLPTSKRKNSVTNTKKSVSFDSVQEYVPEYISL
                     IPNGRFIEVKRSTMTIFSLLTDIAIEHRDPYLKSLITFRMIAIEMTVKRLRGNKEEAN
                     SNPSLPQSFAPLSIFDSDGDPLSSEGSFKQHQLIHKSLFDKFGKYRKDDSAKFDERED
                     FIGDNLPPATVFFEDILPFFENYILSIAPIFSMELLKHEINEFYKSWDSTRKLSIKGF
                     DHIVYCIVLLITKLCQLSINFSKYSSKLQSRIQTLNTNKYIAIVNHFLFEMKTLRKCT
                     LMQLQCLLLLRLYHWCGPEDGDGEVLQHGQILLGTIISSCKEMGITWLSLLTPDDYFF
                     KLDPACRPSPAIMSRDDYKKILGMIWSFVLYWDRKMCLINGQECYIEKSFAYHASDPD
                     STWHQRMTMLDVSIYRINNLLNDMPGEVDAKMLDQEINQALEMFEQIKPEQDAHMNLE
                     FELMIHLCHVTILHAKMVYYEYQIDVDHFHEAIQALWDQIILLTQICYKYCNDDDPKF
                     DPFTRFYTNKIVGIVLNRICVLIPAMILRLNRFPQFGFTERNLMVKFLFGISSMYFNE
                     FGFDYYRCFKKMFTAKISYKILNRPAEKEPWQIILHFLLHDLEKIRNGKKMDDVDIVR
                     RIPLLVDLQETLRKLPDDADVDVLETWNSTIYPIGKLSESFVLDLHPDQLQFLLIDRY
                     ANSFNIFASFYDHASSRLADSAEDANAELNIPSSQNQWASTPNIGLSKIGLPQNGTGY
                     APTTNSDLELANFELIQEMFEPLDFISFF"
     gene            <135222..>136631
                     /gene="TDEL0H00800"
                     /locus_tag="TDEL_0H00800"
                     /db_xref="GeneID:11500945"
     mRNA            <135222..>136631
                     /gene="TDEL0H00800"
                     /locus_tag="TDEL_0H00800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683102.1"
                     /db_xref="GeneID:11500945"
     CDS             135222..136631
                     /gene="TDEL0H00800"
                     /locus_tag="TDEL_0H00800"
                     /inference="similar to DNA sequence:INSDC:YKR063C"
                     /note="similar to Saccharomyces cerevisiae LAS1 (YKR063C);
                     ancestral locus Anc_1.200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683150.1"
                     /db_xref="GeneID:11500945"
                     /db_xref="InterPro:IPR007174"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ95"
                     /translation="MVHARITPWSYPAELDDLKKWFYAAKTGSGPKDERTRAIQRVKC
                     YQSKGSQYLPHVVDSTAQITSAILLDEKRCAEKSSDILAVRLSYTMALIRFVNGLLDP
                     TQQSQFAIPLHTLARRVGLSSWFVDLRHWGTHERELPSLDMLRTAAKEALEWLWDHYW
                     NDEELEEEESSSDEQEDTDTVKEIEGLILTGIGIEDALIENRWVWDSGNRNLISNSNF
                     EVNESTGQKKFMAISPSERINDYVARIRGLWRQEPNRKSFVEACIKNYSSILLELFMA
                     KLSRFELELLSSVAQSYEKQVNGEKTSLKQKFPNWNELKRKLLKKFVATINLGMLATQ
                     WGNWESTIEAHPSYVVLWLCASILKRLHETNNQLPMRKKRKKRQNENLIELETKLSQL
                     IQRLSKRFNDSDAKLYDLSSFKTTVSHTPKNPNDGTSDILDDLAKLRQRLTKPKTPAQ
                     EIKLWNRYPQWEPKPFGIL"
     gene            <137315..>137959
                     /gene="TDEL0H00810"
                     /locus_tag="TDEL_0H00810"
                     /db_xref="GeneID:11500946"
     mRNA            <137315..>137959
                     /gene="TDEL0H00810"
                     /locus_tag="TDEL_0H00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683103.1"
                     /db_xref="GeneID:11500946"
     CDS             137315..137959
                     /gene="TDEL0H00810"
                     /locus_tag="TDEL_0H00810"
                     /inference="similar to DNA sequence:INSDC:YJL148W"
                     /note="similar to Saccharomyces cerevisiae RPA34
                     (YJL148W); ancestral locus Anc_1.201"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683151.1"
                     /db_xref="GeneID:11500946"
                     /db_xref="InterPro:IPR013240"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ96"
                     /translation="MSKLSREYVVESEDENGEETTEFAPPTGFSKIKHLKKFHKKKAD
                     EQLWLIKVPASLDISKLKNLPVDFSGKEGSEAMIMSDEGRSYNVSEDVTQREGQDHSN
                     LTLLVPDESRDFLRVGNEKHGSLGFDRVFSVSEVASIPNIEYEELRVPRSDVVKVKGL
                     KVRHFATGYDEEKKSKKRSAPESSEEPSKKHKKDKKDRKDKKDKKDKKEKKSKK"
     gene            complement(<137992..>138915)
                     /gene="TDEL0H00820"
                     /locus_tag="TDEL_0H00820"
                     /db_xref="GeneID:11500947"
     mRNA            complement(<137992..>138915)
                     /gene="TDEL0H00820"
                     /locus_tag="TDEL_0H00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683104.1"
                     /db_xref="GeneID:11500947"
     CDS             complement(137992..138915)
                     /gene="TDEL0H00820"
                     /locus_tag="TDEL_0H00820"
                     /inference="similar to DNA sequence:INSDC:YKR062W"
                     /note="similar to Saccharomyces cerevisiae TFA2 (YKR062W);
                     ancestral locus Anc_1.202"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683152.1"
                     /db_xref="GeneID:11500947"
                     /db_xref="GOA:G8ZZ97"
                     /db_xref="InterPro:IPR003166"
                     /db_xref="InterPro:IPR016656"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ97"
                     /translation="MSKNNDPLLANLNAFKNKVKSAPVVTTKSSTPSSNGSTTSPRKR
                     LASQRENGKKTEVKVESARDEEDLDDEDEDGSPSKKVRPGSLAAAALQANQTDISKSH
                     DSSKLLWATEYVQKKGKPVLVNELMDYLSMKKDDKVLELLKKLDKIQHDPKKGTFKYM
                     STYDVHSAQELIHLLRSQVTFKGISCKELKDGWPQCDETINELEEDSKILVLRTKKDK
                     TPRYVWYNNGGELNRIDEDFVKMWENVQLPQFAELPRKLQDLGLKPASVDPATVKRQT
                     TRVEVKKKKQRRGKITNTHMAGILKDYSHKA"
     gene            complement(<139676..>140815)
                     /gene="TDEL0H00830"
                     /locus_tag="TDEL_0H00830"
                     /db_xref="GeneID:11500948"
     mRNA            complement(<139676..>140815)
                     /gene="TDEL0H00830"
                     /locus_tag="TDEL_0H00830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683105.1"
                     /db_xref="GeneID:11500948"
     CDS             complement(139676..140815)
                     /gene="TDEL0H00830"
                     /locus_tag="TDEL_0H00830"
                     /inference="similar to DNA sequence:INSDC:YJL147C"
                     /note="similar to Saccharomyces cerevisiae YJL147C;
                     ancestral locus Anc_1.203"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683153.1"
                     /db_xref="GeneID:11500948"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ98"
                     /translation="MMKRAFSRLSSRLLKQSESDELQSTIRFLTRSSQPPISSLLESN
                     KDSTIVSPDGEEDGKHVERILKVLNSTLPEVESGKVRVEAHYDVLFSQLKNIVETSIK
                     ATDQNIVKEGPVKAVDSAVPSDVLYDKLMLLQYTNQLTNAGQMARIVLSKNFTAWDKV
                     WGKISLFQESQRRDLSLLLYFRSGNKQIRETYENEWLGHYHELHIIVQRLFWRCICRE
                     IGPTDDFASVILQNVRKIQNWQGKDVVVLYQSLFAKAHLVPETLTQGVRSAVSKNQEL
                     FIQALRELSRHDSAEKKIKKWMVRLVKMSIENKIALEKSETQSGLSIYQYRFIRSLDL
                     TIQELHTACEGKKHLVELQRHLELILRRIHNEEQEVKSQMSLKFI"
     gene            <141268..>142509
                     /gene="TDEL0H00840"
                     /locus_tag="TDEL_0H00840"
                     /db_xref="GeneID:11500949"
     mRNA            <141268..>142509
                     /gene="TDEL0H00840"
                     /locus_tag="TDEL_0H00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683106.1"
                     /db_xref="GeneID:11500949"
     CDS             141268..142509
                     /gene="TDEL0H00840"
                     /locus_tag="TDEL_0H00840"
                     /inference="similar to DNA sequence:INSDC:YJL146W"
                     /note="similar to Saccharomyces cerevisiae IDS2 (YJL146W);
                     ancestral locus Anc_1.204"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683154.1"
                     /db_xref="GeneID:11500949"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8ZZ99"
                     /translation="MERSLETFPDDFNIELDDAVRKSWSEPQEMTTQTVDIFSPVGTP
                     PVRNESGSSSGSMGSSFNQSSLVTPPNGLNESFEDNGQRYRRRERHYSLTENTHESIS
                     DIMVDLDLGVGNVEEAQLEILPVPIRRGSVQDVQRVRQLLNPRSSFSGVSSDEPETSK
                     QENTGWVTILVDDKPETIKPVIILHKSLLAVNSKYRLHVLHNKYTDAAELAACGIRTL
                     CFDEPLPRLLQQAVDSSSILSLFVALVDKFELACYLSPTCMVMENVDELLESEEICNE
                     IDNETCVLLTKEAPEKAGKNYIQIAISRPCNEVAMCIKELFTEYGDDQEVKKGKVCCK
                     DDFDVLRTLFNETWGHLSSEEYCGTPFVRSATIGNYKIIDYKLLKPWNDPEDISDDSI
                     NERWHLAWQEFEHSSRKLNGL"
     gene            <142647..>143531
                     /gene="TDEL0H00850"
                     /locus_tag="TDEL_0H00850"
                     /db_xref="GeneID:11500950"
     mRNA            <142647..>143531
                     /gene="TDEL0H00850"
                     /locus_tag="TDEL_0H00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683107.1"
                     /db_xref="GeneID:11500950"
     CDS             142647..143531
                     /gene="TDEL0H00850"
                     /locus_tag="TDEL_0H00850"
                     /inference="similar to DNA sequence:INSDC:YJL145W"
                     /note="similar to Saccharomyces cerevisiae SFH5 (YJL145W);
                     ancestral locus Anc_1.205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683155.1"
                     /db_xref="GeneID:11500950"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:G8ZZA0"
                     /translation="MLKFANSEEEKTFEKVFQVLPDLIKNKCGGYDELYGYKMNPEDK
                     DENTKKFYDEVTAKALIYKLCKATNFNYQETVDRFVEIMKWRSKFNPLSAAFLESHNK
                     ELKDVGILTSYPTEESNKKVVTWNLYGQLVKKKHLFKDADKFIRYRIGLMERGLRLLN
                     FTDDTNCFMTQVHDYKGVSVLRMDSDIKKCTKQVIAIFQQYYPELLFAKFFINVPTLL
                     SWVYDLVRAFVDKETMKKFVVLNDGSKLGTYLSSCPKDPYGGKDVNNSLQGENVADVR
                     PTEYALFLLESQNNIDIE"
     gene            complement(<143586..>144770)
                     /gene="TDEL0H00860"
                     /locus_tag="TDEL_0H00860"
                     /db_xref="GeneID:11500951"
     mRNA            complement(<143586..>144770)
                     /gene="TDEL0H00860"
                     /locus_tag="TDEL_0H00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683108.1"
                     /db_xref="GeneID:11500951"
     CDS             complement(143586..144770)
                     /gene="TDEL0H00860"
                     /locus_tag="TDEL_0H00860"
                     /inference="similar to DNA sequence:INSDC:YGR286C"
                     /note="similar to Saccharomyces cerevisiae BIO2 (YGR286C)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683156.1"
                     /db_xref="GeneID:11500951"
                     /db_xref="GOA:G8ZZA1"
                     /db_xref="InterPro:IPR002684"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010722"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR024177"
                     /db_xref="UniProtKB/TrEMBL:G8ZZA1"
                     /translation="MLVRSVRAFSAGRALFIKADPAKAAAAATASATSISPDPISSKT
                     ALEYALSLDEPCHSWTKEQLSSIYHTPLIELVHSAQLQHRKWQDPSKVQLCTLMNIKT
                     GGCSEDCKYCSQSSRNDTGLKAEKMVKVDEVLKEAEEAKRNGSTRFCLGAAWRDMNGR
                     KSAMKRISEMISKVNEMGLETCVTLGMVNEEQSKQLKEAGLTAYNHNIDTSREHYKNV
                     ITTRSYDERLSTIKNVQNSGIKACTGGILGLGETRDDHIGFLYTLSNMSPHPESLPIN
                     RLVAIKGTPMAEELAKPQTKKLEFDEIVRTIATARIVIPQAIIRLAAGRYTMKEHEQF
                     LCFMAGCNSIFTGKKMLTTMCNGWDEDKAMLTKWGLKPMEAFQYDALEEQRKRRLQEA
                     AA"
     gene            <145841..>146128
                     /gene="TDEL0H00870"
                     /locus_tag="TDEL_0H00870"
                     /db_xref="GeneID:11500952"
     mRNA            <145841..>146128
                     /gene="TDEL0H00870"
                     /locus_tag="TDEL_0H00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683109.1"
                     /db_xref="GeneID:11500952"
     CDS             145841..146128
                     /gene="TDEL0H00870"
                     /locus_tag="TDEL_0H00870"
                     /inference="similar to DNA sequence:INSDC:YJL144W"
                     /note="similar to Saccharomyces cerevisiae YJL144W"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683157.1"
                     /db_xref="GeneID:11500952"
                     /db_xref="UniProtKB/TrEMBL:G8ZZA2"
                     /translation="MRDQGFTPTAIHLFLHPTTIMRRTLRCRRQENRIGKTVEAVEQA
                     VGNQEFPRPQSNIIYYFLELRSPPIHRDNNAHEQEYRWASGWSSGLDEEHD"
     gene            <146319..>146795
                     /gene="TDEL0H00880"
                     /locus_tag="TDEL_0H00880"
                     /db_xref="GeneID:11500953"
     mRNA            <146319..>146795
                     /gene="TDEL0H00880"
                     /locus_tag="TDEL_0H00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683110.1"
                     /db_xref="GeneID:11500953"
     CDS             146319..146795
                     /gene="TDEL0H00880"
                     /locus_tag="TDEL_0H00880"
                     /inference="similar to DNA sequence:INSDC:YJL143W"
                     /note="similar to Saccharomyces cerevisiae TIM17
                     (YJL143W); ancestral locus Anc_1.206"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683158.1"
                     /db_xref="GeneID:11500953"
                     /db_xref="GOA:G8ZZA3"
                     /db_xref="InterPro:IPR003397"
                     /db_xref="InterPro:IPR005678"
                     /db_xref="UniProtKB/TrEMBL:G8ZZA3"
                     /translation="MSADHSRDPCPIVILNDFGGAFAMGAIGGCVWHGIKGFRNSPLG
                     ERGPGAMSAIKARAPVVGGNFGVWGGLFSTFDCAVKAVRKREDPWNAIIGGFFTGGAL
                     AIRGGWRHTRNSAITCACLLGVIEGVGLMFQRYAAWQAKPMAPPLPETSSPQPLQA"
     gene            complement(<146908..>149088)
                     /gene="TDEL0H00890"
                     /locus_tag="TDEL_0H00890"
                     /db_xref="GeneID:11500954"
     mRNA            complement(<146908..>149088)
                     /gene="TDEL0H00890"
                     /locus_tag="TDEL_0H00890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683111.1"
                     /db_xref="GeneID:11500954"
     CDS             complement(146908..149088)
                     /gene="TDEL0H00890"
                     /locus_tag="TDEL_0H00890"
                     /inference="similar to DNA sequence:INSDC:YJL141C"
                     /note="similar to Saccharomyces cerevisiae YAK1 (YJL141C);
                     ancestral locus Anc_1.207"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683159.1"
                     /db_xref="GeneID:11500954"
                     /db_xref="GOA:G8ZZA4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZZA4"
                     /translation="MQQGAEATGNEEANNGNQSIWNPLFMSQEENVQQLPPPQGRQQV
                     QFNFVNPWGVANGENAQVNQDNVPDETAYLTPSDKENVDSFARRKSSLVIPPARAPGP
                     NPFEYDDAKAYPNMYSQRQRPMFFPQQQQQLPQQTYNSGRFVPSGFYNPQDSQRRQSV
                     AVVHYPTTAPNTSNASTMIPATGATHMNSPNRRLSAYPPSTSPTTSLQPPYKQLRRDQ
                     GTAPPQQIIIPQMQRCTSKTDLSPMVNATPKFRRASLNSTTMSPLIALTKNLITTYSL
                     CSPDFSYQTSKNPKRVLTKPSEAKCNSGFDNVNSDYILYVNDVLGTEQNRRYLVLDIL
                     GQGTFGQVVKCQNVHTKEIVAVKVVKSRAEYLNQSITEAKILELLNTKVDPMNEHHFL
                     RLHDTFIHKNHLCLVFELLSNNLYELLKQNQFHGLTIHLIRSFTTQLLDSLCVLKDSK
                     LVHCDLKPENVLLCSPDKPDLKIIDFGSSCEERRTIYTYIQSRFYRAPEVILGIPYST
                     SIDMWSLGCIVAELFLGIPIFPGSSEFNQLTRIINCLGYPPTWMMDMGKNTTKFLKKT
                     DNNDLQNIGTYKDSQKFTLKTVDEYNLEYSAQEQPSKQYFKWDKLPDIIKHYRLSKKI
                     KNYSNLVEREMQDRQCLTHFLSGILNLNPLERWTPQQASLHPFITQQPFTGEWYPPGS
                     FQGSTSTGAETTPAPTIKRPGNVRYPSFQEGTAREFNKLRIVED"
     gene            <149601..>150311
                     /gene="TDEL0H00900"
                     /locus_tag="TDEL_0H00900"
                     /db_xref="GeneID:11500955"
     mRNA            <149601..>150311
                     /gene="TDEL0H00900"
                     /locus_tag="TDEL_0H00900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683112.1"
                     /db_xref="GeneID:11500955"
     CDS             149601..150311
                     /gene="TDEL0H00900"
                     /locus_tag="TDEL_0H00900"
                     /inference="similar to DNA sequence:INSDC:YJL140W"
                     /note="similar to Saccharomyces cerevisiae RPB4 (YJL140W);
                     ancestral locus Anc_1.208"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683160.1"
                     /db_xref="GeneID:11500955"
                     /db_xref="GOA:G8ZZA5"
                     /db_xref="InterPro:IPR005574"
                     /db_xref="InterPro:IPR006590"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="UniProtKB/TrEMBL:G8ZZA5"
                     /translation="MNVPVSTVQTRRRLKKVEEEENAATLQLGQEFQMRQLNHQGEEE
                     ELIALNLSETRLVIKEALVERRKAFKRSQNKRKSKKRNAVSKNETDSTLVEGRENGTG
                     SEGQVDHHGADADMEDDDDDEDDNDFMHTETREKELESLDALLEQTTGGNNKDLKNTM
                     EYLTNFSRFRDQETVSAVIQLLKSVGLHPFEVAQLGSLACDTADEAKTLIPSLNNKIS
                     DDDLERILKELSNLETLY"
     gene            complement(<150340..>151608)
                     /gene="TDEL0H00910"
                     /locus_tag="TDEL_0H00910"
                     /db_xref="GeneID:11500956"
     mRNA            complement(<150340..>151608)
                     /gene="TDEL0H00910"
                     /locus_tag="TDEL_0H00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683113.1"
                     /db_xref="GeneID:11500956"
     CDS             complement(150340..151608)
                     /gene="TDEL0H00910"
                     /locus_tag="TDEL_0H00910"
                     /inference="similar to DNA sequence:INSDC:YJL139C,YKR061W"
                     /note="similar to Saccharomyces cerevisiae YUR1 (YJL139C)
                     and KTR2 (YKR061W); ancestral locus Anc_1.209"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683161.1"
                     /db_xref="GeneID:11500956"
                     /db_xref="GOA:G8ZZA6"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8ZZA6"
                     /translation="MRKYLVYVALLVLSVISGSLSQSITSIVQLCYHKHKLEKSLFQR
                     SENAVKKYDSVRRRSLFKPLKLSTNTYNDDILVVENENENVPDRENATLLMLVRNFEL
                     PGALKSMRSLEDRFNKDYHYDWVFLNDVPFSMEFIEATTAMASGKTYYSLIPSKDWDR
                     PDWIDEKKFEDRLQLLHDKGVLYGSSKSYRNMCRFNSGFFYKQKILESYDYYFRVEPD
                     VEYFCDFPYDPFKVMKKNNKKYGFVISLHEYEDTITSLWDAVDEYIEENSRDIDMERN
                     SYDFITNSDIIGKFSPIVDSNSDYNLCHFWSNFEIGDLNFFRSERYNRYFDFLDSKGG
                     FYYERWGDAPVHSIGVSLLLNRDEIIHFDELGYYHAPFGTCPGAYYLRLQQRCQCDAH
                     AQSNIDISPNSCLMRWWKYGDGKRFVKYEQ"
     gene            complement(<151793..>152611)
                     /gene="TDEL0H00920"
                     /locus_tag="TDEL_0H00920"
                     /db_xref="GeneID:11500957"
     mRNA            complement(<151793..>152611)
                     /gene="TDEL0H00920"
                     /locus_tag="TDEL_0H00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683114.1"
                     /db_xref="GeneID:11500957"
     CDS             complement(151793..152611)
                     /gene="TDEL0H00920"
                     /locus_tag="TDEL_0H00920"
                     /inference="similar to DNA sequence:INSDC:YKR060W"
                     /note="similar to Saccharomyces cerevisiae UTP30
                     (YKR060W); ancestral locus Anc_1.210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683162.1"
                     /db_xref="GeneID:11500957"
                     /db_xref="GOA:G8ZZA7"
                     /db_xref="InterPro:IPR016094"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="UniProtKB/TrEMBL:G8ZZA7"
                     /translation="MASSVKVDRDGLATKALESLLSHCDTDPKLKQDKNVHMILYMGK
                     KMGAKKDNVPRIIPLQSCKLDKPKDLRVLLISKDPSTNYRQALTDHEATSDLFKEIIS
                     VKNLKRRFRGAKMNQLYKEFDLIVADFRVHHLLPDVLGSRFYHGNKKLPFVIRMSKAL
                     PMKGQKMADECDPPYVRAQLRSICKNTSYVPNNDNCLSVRIGQVQKTSVGEMVENIQD
                     VISFLSDKTKRPQGGVIKGGIVSIFVKTSNSPSLPIYEKPQEVAEQIHEETLRL"
     gene            complement(<152864..>154051)
                     /gene="TDEL0H00930"
                     /locus_tag="TDEL_0H00930"
                     /db_xref="GeneID:11500958"
     mRNA            complement(<152864..>154051)
                     /gene="TDEL0H00930"
                     /locus_tag="TDEL_0H00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683115.1"
                     /db_xref="GeneID:11500958"
     CDS             complement(152864..154051)
                     /gene="TDEL0H00930"
                     /locus_tag="TDEL_0H00930"
                     /inference="similar to DNA sequence:INSDC:YJL138C,YKR059W"
                     /note="similar to Saccharomyces cerevisiae TIF2 (YJL138C)
                     and TIF1 (YKR059W); ancestral locus Anc_1.211"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683163.1"
                     /db_xref="GeneID:11500958"
                     /db_xref="GOA:G8ZZA8"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZZA8"
                     /translation="MSEGITEVEESQIQTNYDKVVYKFDDMNLKNELLRGVFGYGFED
                     PSAIQQRAILPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDSALKSPQALILAPTREL
                     ALQIQKVVIALAFHMDIKVHACIGGTSFQEDAEGLRDAQIVVGTPGRVFDNIQRRKFK
                     TDSIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPKDVLEVTTKFMRN
                     PVRILVKKDELTLEGIQQFYINVEQELYKYDCLTDLYDSISVTQAVIFCNTRRKVEEL
                     TQKLKADNFTVSSIYSDLPQQERDIIMKEFRSGSSRILISTDLLARGIDVQQVSLVIN
                     YDLPTNKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRELETFYSTQIEELPSNIAE
                     LFT"
     gene            complement(<154307..>155845)
                     /gene="TDEL0H00940"
                     /locus_tag="TDEL_0H00940"
                     /db_xref="GeneID:11500959"
     mRNA            complement(<154307..>155845)
                     /gene="TDEL0H00940"
                     /locus_tag="TDEL_0H00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683116.1"
                     /db_xref="GeneID:11500959"
     CDS             complement(154307..155845)
                     /gene="TDEL0H00940"
                     /locus_tag="TDEL_0H00940"
                     /inference="similar to DNA sequence:INSDC:YJL137C,YKR058W"
                     /note="similar to Saccharomyces cerevisiae GLG2 (YJL137C)
                     and GLG1 (YKR058W); ancestral locus Anc_1.212"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683164.1"
                     /db_xref="GeneID:11500959"
                     /db_xref="GOA:G8ZZA9"
                     /db_xref="InterPro:IPR002495"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8ZZA9"
                     /translation="MSKPRYAVATLLYTTEYLPGVFTLGYQLNKILRNRKEVATCLVI
                     SKDLYNNTMSDLSKKLLRRLYDYIYEVNPLDDHEYCVRKNAENLKLLGRPELSFTLIK
                     ARLWELTQFDQVLYLDGDTLPLNEEFLNIFDLIPEQKSSQIGGAPDIGWPDMFNSGVL
                     MLAPDKQLASRLQKFIRRQTSIDGADQGVFNQFFNPYCAAQNSSTYEWVRLPFIYNVT
                     MPNYGYQNSPALKYFKSQVKLVHFIGENKPWKGWVSSENNAYHTRWNRLYRDFQEEYG
                     LLHFFEEMSIEPPSAPCGPNAVDDETQVVDWEGLSARIMQDEPERNETYEEGPRSAQP
                     ERVFPKNEPVLEVSPKVEPINDTPSRTFPKMETLEPTPDVERIFPNNNSSLESVERVF
                     PREDGRYDNTTPEKLPKDDAPTREIAIASEVPAALPSNDCQRVFPEESVEGLVRPPNI
                     ETERQNPASQESNSLDPSGNVSKIGKVLEMIKEESEEASIPETIFQWEKTNYLQEVER
                     TFPD"
     gene            complement(<156149..>156604)
                     /gene="TDEL0H00950"
                     /locus_tag="TDEL_0H00950"
                     /db_xref="GeneID:11500960"
     mRNA            complement(join(<156149..156388,156581..>156604))
                     /gene="TDEL0H00950"
                     /locus_tag="TDEL_0H00950"
                     /product="40S ribosomal protein S21"
                     /transcript_id="XM_003683117.1"
                     /db_xref="GeneID:11500960"
     CDS             complement(join(156149..156388,156581..156604))
                     /gene="TDEL0H00950"
                     /locus_tag="TDEL_0H00950"
                     /inference="similar to DNA sequence:INSDC:YJL136C,YKR057W"
                     /note="similar to Saccharomyces cerevisiae RPS21B
                     (YJL136C) and RPS21A (YKR057W); ancestral locus Anc_1.213"
                     /codon_start=1
                     /product="40S ribosomal protein S21"
                     /protein_id="XP_003683165.1"
                     /db_xref="GeneID:11500960"
                     /db_xref="GOA:G8ZZB0"
                     /db_xref="InterPro:IPR001931"
                     /db_xref="InterPro:IPR018279"
                     /db_xref="UniProtKB/TrEMBL:G8ZZB0"
                     /translation="MENDKGQLVELYVPRKCSATNRIIKAKDHASVQINVAKVDEEGR
                     AIPGEYITYALSGYVRARGESDDSLNRLAQNDGLLKNVWSYSR"
     gene            complement(<156862..>158532)
                     /gene="TDEL0H00960"
                     /locus_tag="TDEL_0H00960"
                     /db_xref="GeneID:11500961"
     mRNA            complement(<156862..>158532)
                     /gene="TDEL0H00960"
                     /locus_tag="TDEL_0H00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683118.1"
                     /db_xref="GeneID:11500961"
     CDS             complement(156862..158532)
                     /gene="TDEL0H00960"
                     /locus_tag="TDEL_0H00960"
                     /inference="similar to DNA sequence:INSDC:YKR056W"
                     /note="similar to Saccharomyces cerevisiae TRM2 (YKR056W);
                     ancestral locus Anc_1.214"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683166.1"
                     /db_xref="GeneID:11500961"
                     /db_xref="GOA:G8ZZB1"
                     /db_xref="InterPro:IPR001566"
                     /db_xref="InterPro:IPR002792"
                     /db_xref="InterPro:IPR010280"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR025795"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZZB1"
                     /translation="MTSMGTNETVKRSLTASPQPKRLKKPKLRKYKAKKVDETSPLGV
                     LQLEIEEIVKEHGWDRSIIQNDVSAILNDTSREGPVTTAYHREVQGVEVLKIVSNGDG
                     LGVIDNPVEEGKKQVVVIPFGLPGDIVDIKVFKTHPLYVESDLLSVTKKSEMRKDELI
                     NCKYFGKCSGCQFQFLQYDDQLELKRNTIVRAFQHFAPRLCSEGLLPEIGKTIGSPID
                     YNYRTKLTPHFDVPRKVTEMKTRPPLGFGQKGRPKWRQETLEVGGNASILDIEECPIG
                     TQIVNVGMHNERQRFEKDFQKYKKGATILLRENTSVLESSQELSDELIKEGSKDSDDK
                     TSYFESTDEQNSKKLVKTCVTNTRQVVTEYIDGFTFQFSAGEFFQNNNSILPLVTKYV
                     RENLQIPNSKPEEEHNLVDAYCGSGLFSICSSKGVTRVIGVEISADSVSFAERNAEAN
                     GVKNCRFIVGKAERLFESIDTPSDRTSVVLDPPRKGCDEPFLKQLAEYRPAKIVYISC
                     NVHSQARDVEYFLKETPNGKNYKVESLRGFDFFPQTHHVEGVCVLTRI"
     gene            complement(<158769..>159638)
                     /gene="TDEL0H00970"
                     /locus_tag="TDEL_0H00970"
                     /db_xref="GeneID:11500962"
     mRNA            complement(<158769..>159638)
                     /gene="TDEL0H00970"
                     /locus_tag="TDEL_0H00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683119.1"
                     /db_xref="GeneID:11500962"
     CDS             complement(158769..159638)
                     /gene="TDEL0H00970"
                     /locus_tag="TDEL_0H00970"
                     /inference="similar to DNA sequence:INSDC:YKR055W"
                     /note="similar to Saccharomyces cerevisiae RHO4 (YKR055W);
                     ancestral locus Anc_1.215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683167.1"
                     /db_xref="GeneID:11500962"
                     /db_xref="GOA:G8ZZB2"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZZB2"
                     /translation="MRADDAVGLVSSSEQRSELSSDLTREESAFTAPYDVSSSTLEEK
                     SVQRLPTAFARTLSSIPSYAQARKGNKAPDSHLKFVVVGDGGVGKTCLLISYVQRQFP
                     TDYVPTVFENYVTKIEGPRNMIIELALWDTAGQEEYNRLRPLSYSEVDILMVCYSIDN
                     KTSLQNVQDLWIPEVKHFCPDVPIMLIGLKSDLYARENIDDLVDPRRAESLAKSLGAF
                     VHVQCSAKLRSDIDAVFNVALTTGLRDVLAEQKDVPQLLKNPFKKKPALNRTKETNKT
                     KKKKASRFSCTVL"
     gene            <159829..>172068
                     /gene="TDEL0H00980"
                     /locus_tag="TDEL_0H00980"
                     /db_xref="GeneID:11500963"
     mRNA            <159829..>172068
                     /gene="TDEL0H00980"
                     /locus_tag="TDEL_0H00980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683120.1"
                     /db_xref="GeneID:11500963"
     CDS             159829..172068
                     /gene="TDEL0H00980"
                     /locus_tag="TDEL_0H00980"
                     /inference="similar to DNA sequence:INSDC:YKR054C"
                     /note="similar to Saccharomyces cerevisiae DYN1 (YKR054C);
                     ancestral locus Anc_1.216"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683168.1"
                     /db_xref="GeneID:11500963"
                     /db_xref="GOA:G8ZZB3"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013594"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZZB3"
                     /translation="MSSLIQEFVEYCVGLVGGTRGLDDAGRLRLFKDFSSQWENEVNS
                     FLFDECKRTIIIRLTGDSNDLCVGIDGLTSGNLQSTLLVLKNQRSIDYNVPVRSQFSV
                     MWLSDSSMIDSLTSLIDDGLSTVIDLLIKHESGPSDSLRMTKSKLKNVSYTLHNMQYT
                     ICTPEIVSMAHPRVQDLVKEGKHEADFESTLLKDSNFLNALQSIVNQWLELSRGLCDT
                     DRDVRDGSAYDEIQFWSDLQKSLMSLAQQLRSPEVRTTMSILVATKRWNSVSGFVAET
                     GVTDRLKIVREYNQFISSIPLKVLSSAEKVEDVIKCIDLLASALKKFRFTSFPEQRFA
                     LLMSKISQEVHGKLLEVIPNLFTAADEDFENYMRLISVALVKWNDTIQENKIQLREVI
                     RRRGHSFSTAIDIRPNAEDLQESLKQLSEFRDRHAILKASLETIRYDGYFQDLEFLFE
                     PIGTLPNTSIASWATEEALYRQRLSVIEEKLIVVWRTALDRGSSSEEMINQYATFAPL
                     MASHPKLRSVMRDCQEGLLSIVKEEITALSLKVEGMHQVEEVLLLKGLTPITAFILQC
                     LQIRDRILILRKRSSILLGLNWETLPEGKTLSSRFIELTQKTDCTAAFHTWKEKASQL
                     KLDKLDTPMLKVLSNHDDHYELLVNFDFSAGSIFKEVRDLGSMGFNIPNGVIRTALKF
                     GDIQCSASIILEQLQTFLSVVSGLNSRTYTAVLLRKNVDAVWRLIGRATVAVWSNSAV
                     DPRLKGHENTSFNHIKDLEMAVSLVLKDFEVLEESEMLLKRAFEALVNAPSNTKLASE
                     AIASIQSILVGMTTLQFETLNELTSLLNRHIEEIILSKTREELRSMQLGRQALVVTLK
                     GTSLSCSPELIQIKSSWIKKIEQIVTKVAGQPKIHLKSSKAPKETFSSLTDSLSGTVA
                     KVLKRLEKEYQLTKRYLEHLKKTEALWLLKDSDLHDTIRGDITICYNLWEQLANLRDY
                     LERPSEAYNVNGLLIFRFEDSLLQIYGKLDYWQKLLSEVLLALYLNTASSLSSDIRKD
                     LEELEGHDAKFSSFEHLSSLLISVHRMRSYNHERRKTVEFLSLCEPVFLETRLRLPTE
                     YLYIDQLENDMRNAEHCLEEKEVLVETKRALFITVLEDKLTSINSHIRMVSDEWRMKQ
                     SLIQEELPEEALNILLNFETSLANIREEVRVVSLCSRIILHPIVIEDCLKKASNEVQD
                     SIMMCKRLKEILKLVDNSMQKDWASANIDIISRDVATIAGTIAGLSSNFRQYKLFEEL
                     ETKVRKLKGCMGLFKEMKSSAMKSRHWKAIFAKSPQTTPPAAVLESQTFSLKDIVALN
                     IEANEASMKEIIYSARREGVLEESLCRMQSFWKYAQYELFEHSSGMALVKDWISIRQS
                     CSDDLDELISMKNSICFKFFEHDCTDLETKLAAFLEIQHNWMEAQFHWLDLFGVVGEG
                     GKLSSLLPHETAKFHSVTVDLRAISSRAFQMGSIIELTSFSGGKKKFKDLEDQLKVIK
                     TSLTVYLEQQRRNYPRYFFLGNDDLLKLLGTGSDLGQMSRFMPKLFGSISHIQFLGSI
                     ITGICSIEGEVLNLDTSVPIEDHLTPDVWLNILELQIKKTISNNVHSCLKRIAEGIDF
                     TSLLYSHSFQVLLLTWQVIWTKRVDRSIEEGEFSGIQQYIDRQLDFLMSILKDCKEGH
                     DKQKVRSLIIECIHGAAIVTKLCNASSAAMVKLEWSKIQKFYYQDDEPNLLERVITVQ
                     CGRQLKYGFTYIGVPERLIYTSTLDRSFAALGEALSQKYGGCLFGPAGTGKTETIKAL
                     AQNLGRMVLVFNCDKSFDFLAMSRLLSGITQVGAWGCFDELNRMNETTLSSVTSHVEK
                     IQLALLKKCDQVHLMNQSIPLNADAGLFITFNPGYGGRSVLPENLKKRFREYSVRKAE
                     TDTISEVIMRIMGFQKAQSLSKKLVCLFETLRTDCSSQKHYDFGLRSFKKVFKTCAEL
                     AGKRGHHANEECLLTESMSQIILPSLNKADEVVFMSHTNRLFSHHESMIFSHEFNQKL
                     LEACKECFIEPTKEFAMKCAQLFNLQRSQQAIILMGPAGFGKTAVWRTTLMAIKKLGA
                     LHIFAYVIDTKTLTKNSLYGRLNEATLEWKDGIFTSILRKVNDDMAGTFKDAMVWVVF
                     DSDLDPEYIEVLNSALDDNKLLTLPTGERIAMPQNLRLLFEAPDLDYATPATITRCAI
                     IWFPEPLYADYEQLNCSLTKAAQEVQARSGISEDFVKHMGLILRELLSPVDFSCISAE
                     AKLFHHILSFDSSRTVTAISKIIIQGIRSFHHLLLVAHDKQQYVFTLIRLYQALINAM
                     AADTSSKDREKIVEFVDTIFETRSRELLDGSRPESLCITTKTLEPIPFSDLVEQNKLE
                     PHDVMKPDVFIPTLDTLKQESYVFDLLNAGQPVILCGPPGSGKTMILTNALRKSAQLL
                     LVAMNFSKDTTISSILKSLKRHTIYADGPKGLVLCPKLPDKCVVLFCDEINLPKLDKY
                     GSQSVILFLRLLIEKNGFWRTDDNRWVSIERIRIVGACNPSSDPGRLPLSPRFLRHTP
                     ILSIDYPSEQSLMTIYQNLFEATFSLLPHLKSYARTFCDASIYLYHQCKKNFTPSMRA
                     HYLFSPRELTRWIRGLQTAIVSGLQQEFGCVFHAWAYEASRIFADRLVDDADTQVFLT
                     LLRETSKKYFAKHGKLPPDSSEILFSSLLSQGYEQVQKVDLLAFVKQRLTSFAKEQLD
                     SQLIVHEEMLNHILAIDRILKQRQGHAMLIGARRTGKTTLVKFVSWINGLTVLQPGIH
                     KNYDIHEFDAFLRKVLLRCTMDGQRVCLIIDESSILESSFLERMNTLLANSDVPDLFQ
                     EEQYETLIFSLRQKIDSLGLVMNSEQELYDWFVGQISKNLHVVFTICDPCGIGSTNLT
                     TSPALFNRCVINWMGSWSTSVLRQISNEIIQSMSLESSIVAPSEKSLLKSFNIHPNKI
                     SNAFVRFHIEFHVEQENTKSPGMFLDALKLFKKLHLKKGIELDENQRFFSNGLQKLDE
                     SVLKFQEMSALLTTKGKELKRKEMEARQTLDKMLLEQNEAERKQEATLEIKTILTQRE
                     SEASQRRQSVRMELDAFEPIMLEAQRGVKNIKKQQLTEIRSMINPPVAVKITIEAVCS
                     VLGYRSSSWRNIQQFIRSDEFIYDIVHFDPDTMLPKDLKMMIENEFLSIPDFTYEKVH
                     RASKVCGPLYQWVYAQIKYSEVLDKVGPLRDEAKQIEEEALHAKARLLAAEDMISELE
                     EGIKELKDTYRVIIRDIEVIKGKMEEVQAKLDRSKALVENLSSEKSRWKRYILSYQQE
                     LEEMNGNCLITAIYFSYCGVLNEKQRKQTFEVIAGILDGLSIRFDRNYEFVAFNIDVD
                     SQIRWIAHGIPNETFYIENFLLALEPDVIPYIVDPNSQVPQILSSFFDGKLEVISFDE
                     RNFVKKLANAVKFGGTVLVQNAENFDPIMNNVLAGVCRKSHGHRIVQIGDLEVDVSPE
                     FRMLLYSNNARRPLSNFVQSRVRVVDFSINEVSVEMQAVRMALTYDVPEIERENEELS
                     KLNGIYKVQLKTFEHQLLEELNQSKGNILENDELITTLERVKAEAILVEGKLQKNQDL
                     MEKLATFITSYSTFGYHCSSLYSMMKKLSRLHWFYELPLWLFVGCLEAVLVPEQAIES
                     DVATRVKSLSWRLYQKVYSTFSAYLTKDYKMVLAIIFHLMFHFTGDIKRIKQTLQSVL
                     NIMEPEIARVHETKDEVVINCSESIKNMIGLIGNQTYFPAIELLANEFPNEETLENMT
                     LSSEKNYIVVASERDFDSSFKVIELANKQKQELSVIALGSPESENYAEQEVIRSMLEG
                     RWVLLQNIQMSMSWVESFLARKLELQPEGVRSPKKRFKIFMTCSLLGALLPLPLLQNS
                     YKKVFESTPSILGSVRDLWSNASLKSENEDKGLISAWLIFLLAWFHAIIEARNGLNPI
                     GFSKKYDFNECDFASGLSHIKQFVSRLDDESSLFDCAELHFTIGRIIYGGKIDEDEDL
                     AVLQNICSRIFSPEAIKSLQNPDKSHDLLPGVSIPQGFIDEQVMSDILNNSCEPIDSY
                     SSWLGLPADAIQQYERIKTRELLIKTENLLTES"
     gene            <172415..>173620
                     /gene="TDEL0H00990"
                     /locus_tag="TDEL_0H00990"
                     /db_xref="GeneID:11500964"
     mRNA            <172415..>173620
                     /gene="TDEL0H00990"
                     /locus_tag="TDEL_0H00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683121.1"
                     /db_xref="GeneID:11500964"
     CDS             172415..173620
                     /gene="TDEL0H00990"
                     /locus_tag="TDEL_0H00990"
                     /inference="similar to DNA sequence:INSDC:YJL134W,YKR053C"
                     /note="similar to Saccharomyces cerevisiae LCB3 (YJL134W)
                     and YSR3 (YKR053C); ancestral locus Anc_1.217"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683169.1"
                     /db_xref="GeneID:11500964"
                     /db_xref="GOA:G8ZZB4"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:G8ZZB4"
                     /translation="MTVNERRRSRGLSNPNDFQEEHLLQHPGNYPRERYMKRMTRIRY
                     AMRQYLIQFTDNQSLALFEWQARHRTQFRDVYFAYTALLGSHTFYVLCLPIPAFLGAF
                     DLVRDMVYILGYSIYLSGFFKDYWCLPRPQSPPLHRITLSAYTALEYGAPSSHSANAT
                     GVTLLLLWNTWTSPTLSLPVKLGCSFLSLFYYFTLVVGRIYCGMHGMLDITSGAAIGI
                     VCFVVQLLAKSFLSGYDLTTRWWFPICSVGWGLLILLNHVRPIDECPCFEDSVAFIGV
                     VSGVECGDWFLHRFGKVAGADMGLQRGFRFFIYRLCVGIPCIVIWKYVISKPLAYNFL
                     IKVLRFKDDRDEKAAVHAKKNEDVKCPLYIGEAKIDIFGRFIIYAGIPITVVIICPAM
                     FELLNIMSY"
     gene            complement(<173727..>173942)
                     /gene="TDEL0H01000"
                     /locus_tag="TDEL_0H01000"
                     /db_xref="GeneID:11500965"
     mRNA            complement(<173727..>173942)
                     /gene="TDEL0H01000"
                     /locus_tag="TDEL_0H01000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683122.1"
                     /db_xref="GeneID:11500965"
     CDS             complement(173727..173942)
                     /gene="TDEL0H01000"
                     /locus_tag="TDEL_0H01000"
                     /inference="similar to DNA sequence:INSDC:YJL133C-A"
                     /note="similar to Saccharomyces cerevisiae YJL133C-A;
                     ancestral locus Anc_1.218"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683170.1"
                     /db_xref="GeneID:11500965"
                     /db_xref="UniProtKB/TrEMBL:G8ZZB5"
                     /translation="MLPQTVKLAAMKTATTNSARVISSAIAVPVFKRSPGDSFSSFKE
                     YRENAKTYGPLSASLAAKRHLTHISRV"
     gene            <175044..>175955
                     /gene="TDEL0H01010"
                     /locus_tag="TDEL_0H01010"
                     /db_xref="GeneID:11500966"
     mRNA            <175044..>175955
                     /gene="TDEL0H01010"
                     /locus_tag="TDEL_0H01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683123.1"
                     /db_xref="GeneID:11500966"
     CDS             175044..175955
                     /gene="TDEL0H01010"
                     /locus_tag="TDEL_0H01010"
                     /inference="similar to DNA sequence:INSDC:YJL133W,YKR052C"
                     /note="similar to Saccharomyces cerevisiae MRS3 (YJL133W)
                     and MRS4 (YKR052C); ancestral locus Anc_1.219"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683171.1"
                     /db_xref="GeneID:11500966"
                     /db_xref="GOA:G8ZZB6"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8ZZB6"
                     /translation="MNTSEVITAGEIDYESLPANAPLASQLMAGAFAGIMEHSVMFPI
                     DALKTRIQSASGGAASSGMLSQISKISTAEGSLALWKGVQSVILGAGPAHAVYFATYE
                     YTKSQLIDPQDYQTHQPLKTALSGTAATIAADALMNPFDTIKQRMQLSTTSSMTSVAK
                     QIYQKEGIMAFYYSYPTTIAMNIPFAAFNFVIYESSTKVFNPSNDYNPLIHCLCGGIS
                     GATCAAVTTPLDCIKTVLQVRGSETVSLPIFRNADTFSKATKAVYKIHGWNGFWRGLK
                     PRVIANMPATAISWTAYECAKHFFNPN"
     gene            complement(<176166..>177437)
                     /gene="TDEL0H01020"
                     /locus_tag="TDEL_0H01020"
                     /db_xref="GeneID:11500967"
     mRNA            complement(<176166..>177437)
                     /gene="TDEL0H01020"
                     /locus_tag="TDEL_0H01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683124.1"
                     /db_xref="GeneID:11500967"
     CDS             complement(176166..177437)
                     /gene="TDEL0H01020"
                     /locus_tag="TDEL_0H01020"
                     /inference="similar to DNA sequence:INSDC:YKR051W"
                     /note="similar to Saccharomyces cerevisiae YKR051W;
                     ancestral locus Anc_1.220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683172.1"
                     /db_xref="GeneID:11500967"
                     /db_xref="InterPro:IPR005178"
                     /db_xref="UniProtKB/TrEMBL:G8ZZB7"
                     /translation="MLPEGCLPVWWQNLSFVCTFASLAISGFAITKHFLNYRKPFEQR
                     LAVRIQLLVPIFSITCLAATIIPQVSQLYLDPVREVYEAFVIYTFFSLLTLILGGEHR
                     IITEICLEHVPATHAIPLVGRFLRKIDLSDPADFLMVKRGILQYVWFKPFYCLGSFVC
                     LIWNLPTFETILLVLYNVSVTWSLYNLAIFWKCLYNDLKRFNPWSKFLCVKLIIFASY
                     WQGIVIRILHSLGKLKSDSDVDAGYIYQNGLLCVEMIGFAILHWVAFSWENYTTKNLP
                     QCARFEYLTAIKDCFGCGDLVWDFKSALMGPTYYNYRNFEPLAGSSQMARADSLSRMR
                     RLNQGFRFENRGEQSHWVDYGSISSGNTGKNNVEENHDQLNEWDDGIAKQRYIPTDPN
                     YPVVSDIGSSHRYSSDIDRLRRDVHSRSNLV"
     gene            <177680..>179890
                     /gene="TDEL0H01030"
                     /locus_tag="TDEL_0H01030"
                     /db_xref="GeneID:11500968"
     mRNA            <177680..>179890
                     /gene="TDEL0H01030"
                     /locus_tag="TDEL_0H01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683125.1"
                     /db_xref="GeneID:11500968"
     CDS             177680..179890
                     /gene="TDEL0H01030"
                     /locus_tag="TDEL_0H01030"
                     /inference="similar to DNA sequence:INSDC:YJL132W"
                     /note="similar to Saccharomyces cerevisiae YJL132W;
                     ancestral locus Anc_1.221"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683173.1"
                     /db_xref="GeneID:11500968"
                     /db_xref="InterPro:IPR013519"
                     /db_xref="InterPro:IPR029002"
                     /db_xref="UniProtKB/TrEMBL:G8ZZB8"
                     /translation="MLCGLLRIGLLFAILSLGVRGAGVTTHLTYVTRVASEKFDDYYP
                     WLKAGAFFPDSLYSCKPSKQLSEFAEATHWPPFLMSGLKLWQERYGSIPSKKYSQDSV
                     RLQAFLTGVFSHQIVDSSWHSLVDGFRSHGLLRVLAETEFHGQIDDAHDFLDTIGDFI
                     GLSNIFSDITDLNWKYYVNSNWTIPKEEDMTELLSRNGLSPGKISYKELEVCVSRGLS
                     ASVSETFVMLSRRHEVLSLAYKISPASRDIMQEYWLGGEFDLIAMLQKCLPVYQNLFD
                     TNSLDQNSIRQIQLCGNLPNTLSSSHGALRIDTNQDVSIVRPVTSLSNFGTSIALGQF
                     KSDGKLYMAVSAPTQNSEGCVYLILFSQVSSRTDSAAVMEPFTPMRGSTVHTFSTHGV
                     DFLVISEPGSNSIHFYHGGRRYLTIRDGMTSDAFQLQLYAVADIDGDSEPDLLLSGPF
                     YGKNETGRAIVIPGIELVRYLRLSSTNNTDVDISSLSIVSLNGGPYNRAYQHFGAAMA
                     ASHLYSGKGFLYVTCQSLGAVFVYPLFGLQPSSLPKYVMTYKGLLTPEEEPPIDIKVI
                     PSAVHGMFGKGMLSFGYKGNNYLAISQHLFNYVFIYREDDYLPKFLLKIRLEDDQQTA
                     AWSIGFGTAIAYDVRSETLHISSPGSFDNKGAIWKISMQELLAAAEAWKTDTFYVNVV
                     NHLDLVNPWDDTKGFSNFGKVLQIAPNKSVIIGAPQYGNGNLHDKQLTGAVFVR"
     gene            complement(<179980..>181044)
                     /gene="TDEL0H01040"
                     /locus_tag="TDEL_0H01040"
                     /db_xref="GeneID:11500969"
     mRNA            complement(<179980..>181044)
                     /gene="TDEL0H01040"
                     /locus_tag="TDEL_0H01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683126.1"
                     /db_xref="GeneID:11500969"
     CDS             complement(179980..181044)
                     /gene="TDEL0H01040"
                     /locus_tag="TDEL_0H01040"
                     /inference="similar to DNA sequence:INSDC:YJL131C"
                     /note="similar to Saccharomyces cerevisiae YJL131C;
                     ancestral locus Anc_1.222"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683174.1"
                     /db_xref="GeneID:11500969"
                     /db_xref="InterPro:IPR029427"
                     /db_xref="UniProtKB/TrEMBL:G8ZZB9"
                     /translation="MWRIAIVKCSGRIAPCGEARREFHHGLSQLNWMLSNDIVRNALT
                     PKNVSLETHNNGKGSSQRRGLPKSGPKNRTTNKNKGSGKKNVAVTWSTGSDRDKEAAN
                     SVLSQIFRMNRAGNIKIINSETSKPEETNIRTFGKGINLEENGLVIVNFEEVGTLKIP
                     LVKLVERKVALKRFSDEKARQKEKELIDMGVLKKKPAKLGDSDKGEDSVKQIKVSWQI
                     KDDDLSKQKSHEIINQLKKGYKVHLYIADKAHINSKNLAADFDNVQKPNTKKLSNKDL
                     QQRSSVYEKLQEIFEEYSAQPVIEGSVETKMLIKLTPKVSPAGDKDSKQALKEQRKKE
                     RQEKLMMRLERKKQRSAETD"
     gene            complement(<181351..>188019)
                     /gene="TDEL0H01050"
                     /locus_tag="TDEL_0H01050"
                     /db_xref="GeneID:11500970"
     mRNA            complement(<181351..>188019)
                     /gene="TDEL0H01050"
                     /locus_tag="TDEL_0H01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683127.1"
                     /db_xref="GeneID:11500970"
     CDS             complement(181351..188019)
                     /gene="TDEL0H01050"
                     /locus_tag="TDEL_0H01050"
                     /inference="similar to DNA sequence:INSDC:YJL130C"
                     /note="similar to Saccharomyces cerevisiae URA2 (YJL130C);
                     ancestral locus Anc_1.223"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683175.1"
                     /db_xref="GeneID:11500970"
                     /db_xref="GOA:G8ZZC0"
                     /db_xref="InterPro:IPR002082"
                     /db_xref="InterPro:IPR002474"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005480"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005483"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /db_xref="InterPro:IPR006274"
                     /db_xref="InterPro:IPR006275"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:G8ZZC0"
                     /translation="MSSIIPTAPVTPPMEATGDRMIALELKDGTSLLGYSFGAPKSTA
                     GELVFQTGMVGYPESVTDPSYEGQILVITFPLVGNYGVPDRQLIDEYVEGLPRYFESN
                     RIHVAGLVISHYTEEYSHWLAKSSLGRWLQEEGVPAVYGVDTRALTKHLRDKGSMLGR
                     LALQKNNSKDIDVGSAQWKDAFDVPEWVDPNVQNLVAKVSRKEPHLYLPPTDHEGVTL
                     QKGPDGKTLRILAIDVGLKFNQIRCFVKRGVELKVVPWDYDFTQEQYDGLFISNGPGD
                     PSVLTDLCNRLAQVIQAKKTPIFGICLGHQLLARASGSSTLKLKFGNRGHNIPCTSTI
                     SGRCYITSQNHGFAVDADSLTDGWKPLFTNANDFSNEGIYHSELPYFSVQFHPESTPG
                     PRDTEFLFDVFIQAVKEHKASGVLKPVEFPGGKLEDNRNAHPRVEPKKVLVLGSGGLS
                     IGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVYFLPVTAEFVRKV
                     ILHERPDAIYVTFGGQTALSVGIEMKDEFETLGVKVLGTPIETVITTEDRELFAQAMN
                     QIDEKCAKSQAANSVEEALAAVKEIGFPVIVRAAYALGGLGSGFAYNEKELVDLCNVA
                     FASSPQVLVERSMKGWKEVEYEVVRDAFDNCITVCNMENFDPLGIHTGDSIVVAPSQT
                     LSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKA
                     TGYPLAYTAAKLGLNIPLNEVTNSVTKSTCACFEPSLDYCVVKMPRWDLKKFTRVSTA
                     LSSSMKSVGEVMSVGRTFEEAIQKAIRSTDYSNLGFNQTDMEIDIDFELNNPSDLRIF
                     AIANAFAKLGYSVDKVWEMTNIDKWFLNKLYDLVTFSNKVADFGTKEKLPSIVLKQAK
                     QLGFDDRQIASFLNSNEVAIRRLRKEYGITPFVKQIDTVAAEFPAYTNYLYMTYNAAT
                     HDVDFNDNGVMVLGSGVYRIGSSVEFDWCAVTAVRTLRANKVKTIMVNYNPETVSTDY
                     DEADRLYFETINLERVLDIYEIENSAGVIVSMGGQTSNNIAMSLHRENVKILGTSPEM
                     IDSAENRYKFSRMLDQIEVDQPAWKELTSMEEAEEFAENVGYPVLVRPSYVLSGAAMN
                     TVYSRDDLESYLNQAVEVSRDYPVVITKYIENAKEIEMDAVAKDGELVMHVVSEHVEN
                     AGVHSGDATLIVPPQDLAPETVDRIVVATAKIGKALKITGPYNIQFIAKNNEIKVIEC
                     NVRASRSFPFISKVVGVNLIELATKAVMGIPFTPYPVEKLPEDYVAIKVPQFSFPRLA
                     GADPVLGVEMASTGEVATFGHSKYEAYLKSLLSTGFKLPKKNILLSVGSYKEKQELLP
                     SVKKLYNMGFKLFATAGTADFISEHGIPVQYLEVLNQEDNEKSEYSLTQHLANNKIDL
                     YINLPSANRFRRPASYVSKGYQTRRMAVDYSVPLVTNVKCAKLLIEALSRNLTLDVSE
                     RDAQTSHRTVTLPGFINIATFAPNCSNVIKGPEELKEVSRLSLESGFTYCQLMARSTT
                     GPIISDATSLKAAYSASQDSSYTNFSFTVAGTANNNDSIAQTAKDVSALFLPFRELTN
                     KVSTVAELLKNWPVDKQVITEAKTSDLASVMLLASLQNRSIHITGVSNKEDLSLIMTV
                     KDKDSKVTCDVNIHALFVSQNDYPEAQFLPSKEDQDFFWQNLDAIDAFSIGALPTKLA
                     QITGNKIDTGLGIKDALPLLLSAVDEGKLTIDDIVERLHENPAKIFNIPEQLDSVVEI
                     DLDYSFVHTKRWSPYTKGGLNGGVERVLIDGETVVLSGELVAAEPKGKVMTTANVPPT
                     PVTANETPLSMPPLNVKRRFSFSNERHNSFTSIDGEAEGEYDQPLEQRLMSSRPPKEL
                     VAPGAIHNLIRSNNPFKGRHVLSVRQFKRSDFHALFAVAQELRAAVEREGVLDLMKGR
                     VITTIFYEPSTRTSSSFIAAMERLGGRTVNINPSSSSVKKGETLQDTIRTLACYSDAI
                     VMRHPDEMSAHIAAKYSPIPIVNGGNGSREHPTQAFLDLFTIREELGTVNGITVTFMG
                     DLKYGRPVHSLCRLLQHYQVRINLVSPNELRLPTALRKELAEAGLLGVESEMITPDII
                     SKSDVLYCTRIQQERFENKDEYERLKDVYVVDNKILSHAKKHMAVMHPLPRVNEIKEE
                     VDYDHRAAYFRQMRYGLFVRMALLAMVMGVDL"
     gene            complement(<188716..>192357)
                     /gene="TDEL0H01060"
                     /locus_tag="TDEL_0H01060"
                     /db_xref="GeneID:11500971"
     mRNA            complement(<188716..>192357)
                     /gene="TDEL0H01060"
                     /locus_tag="TDEL_0H01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683128.1"
                     /db_xref="GeneID:11500971"
     CDS             complement(188716..192357)
                     /gene="TDEL0H01060"
                     /locus_tag="TDEL_0H01060"
                     /inference="similar to DNA sequence:INSDC:YJL129C,YKR050W"
                     /note="similar to Saccharomyces cerevisiae TRK1 (YJL129C)
                     and TRK2 (YKR050W); ancestral locus Anc_1.224"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683176.1"
                     /db_xref="GeneID:11500971"
                     /db_xref="GOA:G8ZZC1"
                     /db_xref="InterPro:IPR003445"
                     /db_xref="InterPro:IPR004773"
                     /db_xref="InterPro:IPR015958"
                     /db_xref="UniProtKB/TrEMBL:G8ZZC1"
                     /translation="MLAKKLSHVPTLASLNIRYKKTFGHKFRDVIAACGSYLKPVRKY
                     IFPNFLAVHYCYIIFVTIIASILMYPVRNQKYIDILFLAAGATTQGGLNTVDTNTLSL
                     YQQIIVYITCVFCTPIVIHGCLAFVRLYWFERYFDGIRDSSKKNYKMRRTKTILGREM
                     TSRTMSKMPQRPTHILSMLPTSSRNDENFQDKLFSGKEFFRKEGEDDVDNDKPDTTKP
                     KDKNGFDSNGSSWSSSNTVKENGNPNTHVRGDLVFKEPGIKKPTKPRERFAGRRSSAD
                     ISPEDMYRSIQMMQGQHQEAREDEGPALVIGAPTDRPVARNEEAKQKQAPEDGTKDDH
                     HSILTENQSKHTSALNSSIDPHHTQTPPVQKVQSSPIASLKTIDEETKMGRKDYDEPE
                     ANKPTIQFDVSAQPKRPSSKIVKDSTIRIPRRGNQYRTKSNRGLLKHLPKGKELRQKL
                     KRRLSSNSADGLNSEKRRSYTDDDEPTDKDNMEEYFADNESDEDDEEHPNVYGEGKRL
                     SKVPTTGEVEEPRRSQLAEMPRSLTMDARQAKDLNQLAQTREFQKMIYKDWKKKHRKP
                     NPLRRKSWNAKKFENEYSAGFPWMQEAFNADEDLSSDHDSGEVNSGHGSSFDNVKGNV
                     ASDSDDAANQEPSSPRDRDSLDEEQGYYGLTIDPEFTSNARPAIARTMSTNYLSWEPT
                     IGRNSAFTGLSKAQREELGGIEYTSIKLLCRILVIYYAGFLILSFVLIVPWVLHQSHY
                     KAIIRENGVSPTWWGFFTAMSAFTDLGITVTRDSMLSFNKAVYPLVVMMWFIIVGNTG
                     FPVLLRFIIWVLFKLSPELSQFKENLGFLLDHPRRCFTLLFPSAATWWLLATLVALNG
                     IDLVLFIILDFGSAVLRPLARGFRVLDGLFQAVSTRTAGFTVVDLSKLHPAIQVSYML
                     MMYVSVLPLAISIRRTNVYEEQSLGLYGEMTTEDTSSTDYSTDSEGSSDSGSRRKKKK
                     KKQGKDSNESFIGAHLRRQLSFDIWFLFLGLFIICLCEGGKIQDTSKPEFNVFAVLFE
                     IVSAYGTVGLSLGFPNTNTSFSGQFTTLSKLVIIAMLIRGRHRGLPYALDRAIMLPSD
                     RLEHIDHIEDLKLKRTTRNSTNNVDPVTAYFKKRTGKLHRGFDRLRRSVAEPEEAHLE
                     AYGQHNNSPDYNLPGEDERDYQLETVSQATHSAPSSVHSPGSIDSEQLTDRDSNHDSM
                     HLTHPISYS"
     gene            complement(<192834..>194624)
                     /gene="TDEL0H01070"
                     /locus_tag="TDEL_0H01070"
                     /db_xref="GeneID:11500972"
     mRNA            complement(<192834..>194624)
                     /gene="TDEL0H01070"
                     /locus_tag="TDEL_0H01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683129.1"
                     /db_xref="GeneID:11500972"
     CDS             complement(192834..194624)
                     /gene="TDEL0H01070"
                     /locus_tag="TDEL_0H01070"
                     /inference="similar to DNA sequence:INSDC:YJL128C"
                     /note="similar to Saccharomyces cerevisiae PBS2 (YJL128C);
                     ancestral locus Anc_1.225"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683177.1"
                     /db_xref="GeneID:11500972"
                     /db_xref="GOA:G8ZZC2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZZC2"
                     /translation="MNEQFSKLSLGQEGRKADGSSAGTPGQVSSSSSSHYGNINANLH
                     ARVKAFQEQRALKRTGSVGSNKSETDSSGKVKNAQEMQQIVNKPLPPLPAADQAEAQA
                     VLEQRSERKEGSLDNKAQFNPSRRAPRRPPTARPVAQGISSQPAQSLSARRGLKLPMG
                     GMSLKLPGKTEKPTHSTQEFASTPSNSNHIIASTTTVSGGVGGNRSNPGSLVNGIQST
                     STSSSNEEQRDTEGTAPRNTNSNSGGLFANFSKYVDIKSGSLNFAGKLSLSSEGIDFG
                     NGNSSRITLDELEFIEELGHGNYGNVSKVLHKPNNVIMAMKEVRLELDEAKFRQILME
                     LEVLHKCQSPYIVDFYGVFFIEGAVYMCMEFMDGGSLDKIYDASPEMGGIDEPQLAYI
                     THAVIEGLKELKDVHNIIHRDVKPTNILCSAKHGTVKLCDFGVSGNLVASLAKTNIGC
                     QSYMAPERIRSLNPDRVTYTVQSDIWSLGLSILEMALGRYPYPPETFDNIFSQLSAIV
                     DGPPPKLPREKFSSDAQDFVSVCLQKIPERRPTYAALLEHQWLKKYKDVDVEMSNYIT
                     TRLHKRKELLAERGEKELPKHLPALHMGGL"
     gene            complement(<194901..>195059)
                     /gene="TDEL0H01080"
                     /locus_tag="TDEL_0H01080"
                     /db_xref="GeneID:11500973"
     mRNA            complement(<194901..>195059)
                     /gene="TDEL0H01080"
                     /locus_tag="TDEL_0H01080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683130.1"
                     /db_xref="GeneID:11500973"
     CDS             complement(194901..195059)
                     /gene="TDEL0H01080"
                     /locus_tag="TDEL_0H01080"
                     /inference="similar to DNA sequence:INSDC:YJL127C-B"
                     /note="similar to Saccharomyces cerevisiae YJL127C-B;
                     ancestral locus Anc_1.226"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683178.1"
                     /db_xref="GeneID:11500973"
                     /db_xref="UniProtKB/TrEMBL:G8ZZC3"
                     /translation="MIFFFKQIRDIFAKSHSTLQQIQLSRRAFFQLLGYLASCALLSL
                     LSQSKHLP"
     gene            complement(<195164..>196858)
                     /gene="TDEL0H01090"
                     /locus_tag="TDEL_0H01090"
                     /db_xref="GeneID:11500974"
     mRNA            complement(<195164..>196858)
                     /gene="TDEL0H01090"
                     /locus_tag="TDEL_0H01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683131.1"
                     /db_xref="GeneID:11500974"
     CDS             complement(195164..196858)
                     /gene="TDEL0H01090"
                     /locus_tag="TDEL_0H01090"
                     /inference="similar to DNA sequence:INSDC:YJL127C"
                     /note="similar to Saccharomyces cerevisiae SPT10
                     (YJL127C); ancestral locus Anc_1.227"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683179.1"
                     /db_xref="GeneID:11500974"
                     /db_xref="GOA:G8ZZC4"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR015416"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G8ZZC4"
                     /translation="MFSQNGSALGAEERFQDQLLTPLHPHTILLKDGETVATMYPIPA
                     NADLLPMGLLAFLLDEFNMEIEKGDSFPYYETLSLEQFKDAWFHPDGHIAIMVLGEIP
                     ELDYSMENDLTDLENNYGTDIETMRHTSQYKKRKERRNLSLNIQWEKQCLGIFSLQPA
                     YPGRSSHVVTGTFLVNAGIRGKRIGRTLVETFIEWSKRLGFTSCYFPLVYGTNVGIRR
                     ILEGLNFKRIGKLPEAGILKGFDVPVDSFIYGKEFTHITRSIDLLRDPQKTNDIAKYE
                     RLKFYLETGKYPANCDRNEKARLRVSSRTHSLLNGKLMTRGREIVFEPDKQRQIALDM
                     HAVEHQGINKITTRIVERYHWKGVKNTVSEVIAQCQKCKLRHQDGVGVIVKPNKSVKQ
                     AHMFATSASPLDEDLDHSAQLSRMAAVVVGSLQADADNEDSKDDDRGSTPPDGHDTAD
                     PSTVTPQIDTIDFDKSPENLMQPILNGDQSMNAFNRFMEEENHRKRRKVTNSSPVEFD
                     KNNQSLMEDAMLGLPENVIAAVQLAHKQQSEPQESSQDHQQGDSEDEDQEDSNVFY"
     gene            <197021..>197944
                     /gene="TDEL0H01100"
                     /locus_tag="TDEL_0H01100"
                     /db_xref="GeneID:11500975"
     mRNA            <197021..>197944
                     /gene="TDEL0H01100"
                     /locus_tag="TDEL_0H01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683132.1"
                     /db_xref="GeneID:11500975"
     CDS             197021..197944
                     /gene="TDEL0H01100"
                     /locus_tag="TDEL_0H01100"
                     /inference="similar to DNA sequence:INSDC:YJL126W"
                     /note="similar to Saccharomyces cerevisiae NIT2 (YJL126W);
                     ancestral locus Anc_1.228"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683180.1"
                     /db_xref="GeneID:11500975"
                     /db_xref="GOA:G8ZZC5"
                     /db_xref="InterPro:IPR001110"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="UniProtKB/TrEMBL:G8ZZC5"
                     /translation="MSGISRIAIGQLCSSSSLNRNLETVKRLIGKAIDSDAQMIFFPE
                     ATDYISRDAAHSKKLAYGSPLFVEELRGEIRNVYEKTSKKIDVAVGVHLPPTVFEMEK
                     GENRVKNVLLYINYKGDIVQSYQKMHLFDVDVPNGPIMLESKSVQPGHSYADIVESPA
                     GKLGLAICYDIRFPEQSMELRSRGAEILCFPSAFTMRTGEAHWELLGKARAMDTQCFV
                     VMPAQSGQHRVYEDEEDDEAGKRDDSQPRRSWGHSMVIDPWGRIIAQSSQGSDTELII
                     ADLDFTILQSVRTNMPLWQQRSILNKSLQNE"
     gene            complement(<197953..>199092)
                     /gene="TDEL0H01110"
                     /locus_tag="TDEL_0H01110"
                     /db_xref="GeneID:11501055"
     mRNA            complement(<197953..>199092)
                     /gene="TDEL0H01110"
                     /locus_tag="TDEL_0H01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683133.1"
                     /db_xref="GeneID:11501055"
     CDS             complement(197953..199092)
                     /gene="TDEL0H01110"
                     /locus_tag="TDEL_0H01110"
                     /inference="similar to DNA sequence:INSDC:YJL125C"
                     /note="similar to Saccharomyces cerevisiae GCD14
                     (YJL125C); ancestral locus Anc_1.229"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683181.1"
                     /db_xref="GeneID:11501055"
                     /db_xref="GOA:G8ZZC6"
                     /db_xref="InterPro:IPR014816"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZZC6"
                     /translation="MSAFSEYRDVIKEGELVLVWISRDNIKPIKVDSNETFNTRYGSF
                     PHKLMIGKPYGSQIAIRTKGSNKFAFIHVLQPTPELWTLSLPHRTQIVYTPDSSYIME
                     RLNCSPRTKAIEAGTGSGSFSHAFARTVGHLYSYEFHKPRYEEALAEFEEHGLIHHDK
                     NVTITHRDVCANGFSIRSSDVTSHKFNEGEGSVTIGANAVFLDLPAPWDAIPHLDSVI
                     SKNEKVGLCCFSPCIEQVDRTIEALNKHGWDDLQMVEIQGRQYESRRQMVRTMDDAIE
                     RLRDVKRRKNEGLERRKRMCDNILNDQPQEEINDEKRPTTEKTKFNPFGKGSRIKEGD
                     TAYKWKQVTKIEPEIKSHTSYLTFAFKVVNKTRDEDQVKSELDSL"
     gene            complement(<199218..>199715)
                     /gene="TDEL0H01120"
                     /locus_tag="TDEL_0H01120"
                     /db_xref="GeneID:11501056"
     mRNA            complement(<199218..>199715)
                     /gene="TDEL0H01120"
                     /locus_tag="TDEL_0H01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683134.1"
                     /db_xref="GeneID:11501056"
     CDS             complement(199218..199715)
                     /gene="TDEL0H01120"
                     /locus_tag="TDEL_0H01120"
                     /inference="similar to DNA sequence:INSDC:YJL124C"
                     /note="similar to Saccharomyces cerevisiae LSM1 (YJL124C);
                     ancestral locus Anc_1.230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683182.1"
                     /db_xref="GeneID:11501056"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:G8ZZC7"
                     /translation="MSTVDIKKPQMGAGGPKKITEGEADLYLDQYNFTTTAAIVGSVD
                     RKIFVLLRDGKMLFGVLRTFDQYANVILEHCVERIYVPESNQYAEETRGLFMVRGENV
                     VMLGEVDIDREDGPLESMERIPFAEASKRRRDGDEARYRHETAKGKQLARYGLLYDFH
                     KSDMY"
     gene            <199931..>200332
                     /gene="TDEL0H01130"
                     /locus_tag="TDEL_0H01130"
                     /db_xref="GeneID:11501057"
     mRNA            <199931..>200332
                     /gene="TDEL0H01130"
                     /locus_tag="TDEL_0H01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683135.1"
                     /db_xref="GeneID:11501057"
     CDS             199931..200332
                     /gene="TDEL0H01130"
                     /locus_tag="TDEL_0H01130"
                     /inference="similar to DNA sequence:INSDC:YKR049C"
                     /note="similar to Saccharomyces cerevisiae FMP46
                     (YKR049C); ancestral locus Anc_1.231"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683183.1"
                     /db_xref="GeneID:11501057"
                     /db_xref="GOA:G8ZZC8"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR012882"
                     /db_xref="UniProtKB/TrEMBL:G8ZZC8"
                     /translation="MSMFKTLQHQPRVISLFTHNLENNRATEAILQLLRCDADSKYNV
                     ELDTKFPTLDQLKYMNGINSQLLQKQVPTLSQLLKQKPHDPVFHSELKDCVAKGIWNS
                     KTPLWVDWEKKQMGNDTKGIAGLLEPQEKSE"
     gene            complement(<200361..>201608)
                     /gene="TDEL0H01140"
                     /locus_tag="TDEL_0H01140"
                     /db_xref="GeneID:11501058"
     mRNA            complement(<200361..>201608)
                     /gene="TDEL0H01140"
                     /locus_tag="TDEL_0H01140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683136.1"
                     /db_xref="GeneID:11501058"
     CDS             complement(200361..201608)
                     /gene="TDEL0H01140"
                     /locus_tag="TDEL_0H01140"
                     /inference="similar to DNA sequence:INSDC:YJL123C"
                     /note="similar to Saccharomyces cerevisiae YJL123C;
                     ancestral locus Anc_1.232"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683184.1"
                     /db_xref="GeneID:11501058"
                     /db_xref="InterPro:IPR018814"
                     /db_xref="UniProtKB/TrEMBL:G8ZZC9"
                     /translation="MADRKSTDADDVFEFLESLPKNGDPKESKVAEGKNKNDSDIMDF
                     LDELEKSNLSLNKKGEAKQEKAPVVEKVQEKAPEVEQAPEVEQAPEVEKAQEKIPQEK
                     APQEEAHEIEATNREDTPLHDPITSISNWWSSSGSATVSSFWNKTTEQASNIKTKLAQ
                     DQLELTSKINAATITELARNLQKIVAGETDEVLRIHLVHDLVNFPHLRYNIEQKFDQV
                     LSSQVQGGIRIFVDQWGHPNKSEIDEDPAGQRRLNLFNGKITDGEKLAFANLDNAIKL
                     FDKAHQEILKQQKDAQDQEESSSTEANISDVFISILPIGVPQDSKSTKGDIVTTDSRH
                     PGNFSFTVILKDITNDISTITRSQGFPMKWVSWLEKPTEQTDSEEEVVDPSDWVKEWV
                     EDGLSLSLGVAAQNYVIERMGFS"
     gene            <202095..>202577
                     /gene="TDEL0H01150"
                     /locus_tag="TDEL_0H01150"
                     /db_xref="GeneID:11501059"
     mRNA            <202095..>202577
                     /gene="TDEL0H01150"
                     /locus_tag="TDEL_0H01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683137.1"
                     /db_xref="GeneID:11501059"
     CDS             202095..202577
                     /gene="TDEL0H01150"
                     /locus_tag="TDEL_0H01150"
                     /inference="similar to DNA sequence:INSDC:YJL122W"
                     /note="similar to Saccharomyces cerevisiae ALB1 (YJL122W);
                     ancestral locus Anc_1.233"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683185.1"
                     /db_xref="GeneID:11501059"
                     /db_xref="GOA:G8ZZD0"
                     /db_xref="InterPro:IPR015218"
                     /db_xref="InterPro:IPR022784"
                     /db_xref="UniProtKB/TrEMBL:G8ZZD0"
                     /translation="MPSKNSINRPKLTVNVARKTQSLAHKRDQRERAGLLKPARSSEK
                     SKSGQIKSVPLDLYFQEKEGKVSGNGLTTKTLSKKRAKKIERNIKYAEQRKLLAELQD
                     KVVNEDGMEVDLPAKTKKKEEKKSTLKDALWKILDDTSSQGLVISNGQGTTLGGPVSS
                     "
     gene            complement(<202608..>203318)
                     /gene="TDEL0H01160"
                     /locus_tag="TDEL_0H01160"
                     /db_xref="GeneID:11501060"
     mRNA            complement(<202608..>203318)
                     /gene="TDEL0H01160"
                     /locus_tag="TDEL_0H01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683138.1"
                     /db_xref="GeneID:11501060"
     CDS             complement(202608..203318)
                     /gene="TDEL0H01160"
                     /locus_tag="TDEL_0H01160"
                     /inference="similar to DNA sequence:INSDC:YJL121C"
                     /note="similar to Saccharomyces cerevisiae RPE1 (YJL121C);
                     ancestral locus Anc_1.234"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683186.1"
                     /db_xref="GeneID:11501060"
                     /db_xref="GOA:G8ZZD1"
                     /db_xref="InterPro:IPR000056"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR026019"
                     /db_xref="UniProtKB/TrEMBL:G8ZZD1"
                     /translation="MVKPIIAPSILASDFANLGCECHKVINAGADWLHIDVMDGHFVP
                     NITLGQPIVTSLRKAVPRPGDSTSDKPKAFFDCHMMVENPEKWVEDFVKCGADQFTFH
                     YEATKNPLELVKLIKSHDCRAACAIKPGTPVDVLFELAPHLDMALVMTVEPGFGGQKF
                     MVDMMPKVETLRNQFPNLDIQVDGGLGKETIPQAAKAGANVIVAGTSVFTAADPSEVI
                     QFMKNEVSHNLEARGLLN"
     gene            <203763..>205049
                     /gene="TDEL0H01170"
                     /locus_tag="TDEL_0H01170"
                     /db_xref="GeneID:11501061"
     mRNA            <203763..>205049
                     /gene="TDEL0H01170"
                     /locus_tag="TDEL_0H01170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683139.1"
                     /db_xref="GeneID:11501061"
     CDS             203763..205049
                     /gene="TDEL0H01170"
                     /locus_tag="TDEL_0H01170"
                     /inference="similar to DNA sequence:INSDC:YKR048C"
                     /note="similar to Saccharomyces cerevisiae NAP1 (YKR048C);
                     ancestral locus Anc_1.235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683187.1"
                     /db_xref="GeneID:11501061"
                     /db_xref="GOA:G8ZZD2"
                     /db_xref="InterPro:IPR002164"
                     /db_xref="UniProtKB/TrEMBL:G8ZZD2"
                     /translation="MSAPIRTKPKSSMKIDNAPTPHNTPASVLNSSFLKNGNPVKNES
                     KGETIPQTISEEDLQSALSKQPFLLQSIQDKLGTLVGQDSGYLDQLPESVKERIYGLK
                     AIQKNLFALEKDFQVEMFELEQKYLEKYAPLHERRYKMVTGKEEPTSEEVAKGKELEG
                     EEEEQAQEAEQEAQEAQEPVKGIPSFWLTALENLPVVSDTITDRDAEVLDFLQDIKLQ
                     YLTDGRPGFQLVFVFDPDTPFFKNKTLTKTYYYQNELGYSGDFIYDHAEGEEIQWADN
                     ESNTTIAVEMRKQRNKATKQVRTIEKITPVDSFFNFFDPPKVPARDNTQEEDQDDQED
                     DELQELEERLALDYSIGEQLKDKLIPRAIDWFTGAALEFEFDNELLDDEDEQFDDEDD
                     DDDEDDDEEEEEQDEAEQEEHDDFAGKENPPDCKQS"
     gene            <205253..>206200
                     /gene="TDEL0H01180"
                     /locus_tag="TDEL_0H01180"
                     /db_xref="GeneID:11501062"
     mRNA            <205253..>206200
                     /gene="TDEL0H01180"
                     /locus_tag="TDEL_0H01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683140.1"
                     /db_xref="GeneID:11501062"
     CDS             205253..206200
                     /gene="TDEL0H01180"
                     /locus_tag="TDEL_0H01180"
                     /inference="similar to DNA sequence:INSDC:YKR046C"
                     /note="similar to Saccharomyces cerevisiae PET10
                     (YKR046C); ancestral locus Anc_1.236"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683188.1"
                     /db_xref="GeneID:11501062"
                     /db_xref="UniProtKB/TrEMBL:G8ZZD3"
                     /translation="MTGSNVKVVVNKDTTDRFARNSPTLNHLYKYPVVSRTLNQVVST
                     PVISQLLSVIVLVVASVRHTLVDSEYSPKFVKIGYNAISGFGLRFDELVNVLFLREGI
                     DAFLRGWDSHSHKPGFWLLFFWVDYVANVSNILLKQFVVQPFKLNVEDKREEDTKSDG
                     TLPHVSELSSTTKSISKDLQSKLQSDYIGPTTDFARQKYDSLVKPTADKLQSEYIEPT
                     RAQLNKVTEPTRAQAMETYKMVSNAYENNFNKSESVPRAVVNTGIDLKNFTIENLRSN
                     KSELERDAQHAKELYENKKETLGQGVDEKLDALGNTLKK"
     gene            <206375..>206929
                     /gene="TDEL0H01190"
                     /locus_tag="TDEL_0H01190"
                     /db_xref="GeneID:11501063"
     mRNA            <206375..>206929
                     /gene="TDEL0H01190"
                     /locus_tag="TDEL_0H01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683141.1"
                     /db_xref="GeneID:11501063"
     CDS             206375..206929
                     /gene="TDEL0H01190"
                     /locus_tag="TDEL_0H01190"
                     /inference="similar to DNA sequence:INSDC:YKR045C"
                     /note="similar to Saccharomyces cerevisiae YKR045C;
                     ancestral locus Anc_1.237"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683189.1"
                     /db_xref="GeneID:11501063"
                     /db_xref="UniProtKB/TrEMBL:G8ZZD4"
                     /translation="MSHHDHTFQGRKKKLSGWVKRIIQPRDPGISPLASAETTDEEDD
                     SVSMKVLWDAEPIRAKSEPLERDLPSEATDNVSITPLFSMCSSSVKSSTFSDSHSIQS
                     TRATVLSGRTVETNSSTMAIPPASIIGRTRASSATQPSSSASSAGPSAVAHHLHQSRP
                     ASIRHTQLQRDPSSTTVNSSSTIK"
     gene            <207118..>208038
                     /gene="TDEL0H01200"
                     /locus_tag="TDEL_0H01200"
                     /db_xref="GeneID:11501064"
     mRNA            <207118..>208038
                     /gene="TDEL0H01200"
                     /locus_tag="TDEL_0H01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683142.1"
                     /db_xref="GeneID:11501064"
     CDS             207118..208038
                     /gene="TDEL0H01200"
                     /locus_tag="TDEL_0H01200"
                     /inference="similar to DNA sequence:INSDC:YJL117W"
                     /note="similar to Saccharomyces cerevisiae PHO86
                     (YJL117W); ancestral locus Anc_1.238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683190.1"
                     /db_xref="GeneID:11501064"
                     /db_xref="InterPro:IPR024297"
                     /db_xref="UniProtKB/TrEMBL:G8ZZD5"
                     /translation="MSKSKEVSGKKHVEQVDASLNEPLNMEAPPTIYGTTIKPELATA
                     ALNLAIDFIKQQQSLANRGMIHHYITKIVMTVVAIIYLTPQATIPRNLRAGSVSGFLY
                     QLFMFNWYPMATTAAIASVAFVCLLTTYSRISETFFKSRIHEVAKDSGHSTFGIDLRE
                     LVLKSKPVLKDPQAQNTYVVVYREAPIALISLTENKTLTSKESLVMSVSTIGCRKVYL
                     KSGIIEDMLDWAMLRTKTLAKENNHGESMKVLIDVYSFDDHMKKTLKAKGFSPVASAK
                     IKESRLLGGLFGFQKELWGVQFHVEQPKKN"
     gene            complement(<208056..>209342)
                     /gene="TDEL0H01210"
                     /locus_tag="TDEL_0H01210"
                     /db_xref="GeneID:11501065"
     mRNA            complement(<208056..>209342)
                     /gene="TDEL0H01210"
                     /locus_tag="TDEL_0H01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683143.1"
                     /db_xref="GeneID:11501065"
     CDS             complement(208056..209342)
                     /gene="TDEL0H01210"
                     /locus_tag="TDEL_0H01210"
                     /inference="similar to DNA sequence:INSDC:YKR044W"
                     /note="similar to Saccharomyces cerevisiae UIP5 (YKR044W);
                     ancestral locus Anc_1.239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683191.1"
                     /db_xref="GeneID:11501065"
                     /db_xref="GOA:G8ZZD6"
                     /db_xref="InterPro:IPR005052"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:G8ZZD6"
                     /translation="MRSDGVFKLVLAVSIAAIFALFQVGANHLFKESDSESSHFVRES
                     QIRKLHNQDASLNIPFLDKISKYWYVGGETEIRNAGSIRLTRAGGTDQYGLILSNGMG
                     DNTIDNFETIVTLKISPKEGSKPRALMGDGVAVVVTAEKDFLRQDLTSSYARKQYEIN
                     SGGVMVGDTSMMGLPLNLPGMAVIIDTFKNQGRTRVAVPFLDVILNTSPKTQAYDLES
                     DGARTTALKLNQGKIKLKKSLMQGDTTKLRLIYLESENFLKIDIQYAEEGDYWIELFQ
                     THLKEPLPRNDETNQRYIGISALTGELSQTVDILSVETNEFHLKDKDDTSNDFAKEIE
                     LYFIQEYNEKIALEEDSEQRWKMSKSQPRYEVNEINEMPAKKQVHGKSQFLKNFIVFF
                     IIITTLYLASVYVRVSMKHVISSKRHRSKSVGLLPH"
     gene            <209775..>210587
                     /gene="TDEL0H01220"
                     /locus_tag="TDEL_0H01220"
                     /db_xref="GeneID:11501066"
     mRNA            <209775..>210587
                     /gene="TDEL0H01220"
                     /locus_tag="TDEL_0H01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683144.1"
                     /db_xref="GeneID:11501066"
     CDS             209775..210587
                     /gene="TDEL0H01220"
                     /locus_tag="TDEL_0H01220"
                     /inference="similar to DNA sequence:INSDC:YKR043C"
                     /note="similar to Saccharomyces cerevisiae YKR043C;
                     ancestral locus Anc_1.240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683192.1"
                     /db_xref="GeneID:11501066"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G8ZZD7"
                     /translation="MGPTPRCVIVRHGQTEWSKSGQYTGLTDLPLTPYGVGQMKRTAS
                     SIYANNFIDPTHITYVFTSPRTRARQTVELMLAPLTAEQRSKIKVVVDDDLREWEYGD
                     YEGLLTHEIIELRKSRGLDQERPWNIWRDGCENGETTQEIGLRLSRALARIQNLHRQH
                     QAQGIASDIMVFAHGHALRYFAALWFTPGVIKNCETEHEKAQPKSYDDDSVPYVALDK
                     YKYLNDNPNFLLDAGGIGVLSYSHHNIDEPALALAGAFVPPPEEESQHGDVK"
     gene            complement(<210760..>211917)
                     /gene="TDEL0H01230"
                     /locus_tag="TDEL_0H01230"
                     /db_xref="GeneID:11501067"
     mRNA            complement(<210760..>211917)
                     /gene="TDEL0H01230"
                     /locus_tag="TDEL_0H01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683145.1"
                     /db_xref="GeneID:11501067"
     CDS             complement(210760..211917)
                     /gene="TDEL0H01230"
                     /locus_tag="TDEL_0H01230"
                     /inference="similar to DNA sequence:INSDC:YJL116C,YKR042W"
                     /note="similar to Saccharomyces cerevisiae NCA3 (YJL116C)
                     and UTH1 (YKR042W); ancestral locus Anc_1.241"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683193.1"
                     /db_xref="GeneID:11501067"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="UniProtKB/TrEMBL:G8ZZD8"
                     /translation="MKLSSVLLLSATALAAPAVHHKDRHNEKRDVVVVTQYVDQNGQA
                     VAHQGVATGATAPVATTSSTVSAVGAASSAPAASKASSASSAPAASSASSASSSASSA
                     STGSSGGSSGGVNGDLADFSGPNEEFQDGVIPCSSLPSGQGVVSLDWVGLDGWASIMD
                     LAGNTASTCQDGFYCSYACQAGMSKTQWPTEQPSDGRTVGGLLCKNGLLYRANQGSKY
                     LCEWDNNSAQAVNKKSQSIAMCRTDYPGSENMVVPTVVEAGGSKPVCAVKEDSYYMWQ
                     GKKTSAQYYVNNAGVSVEDGCIWGTDGSGVGNWAPIVLGSGYTNGITYLSIIPNPNNK
                     TPPNYNIKIVANEGSSINGDCKLENGVYSGGSGSDGCTVSVTSGSASFVFY"
     gene            complement(<212751..>214208)
                     /gene="TDEL0H01240"
                     /locus_tag="TDEL_0H01240"
                     /db_xref="GeneID:11501068"
     mRNA            complement(<212751..>214208)
                     /gene="TDEL0H01240"
                     /locus_tag="TDEL_0H01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683146.1"
                     /db_xref="GeneID:11501068"
     CDS             complement(212751..214208)
                     /gene="TDEL0H01240"
                     /locus_tag="TDEL_0H01240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683194.1"
                     /db_xref="GeneID:11501068"
                     /db_xref="InterPro:IPR001959"
                     /db_xref="InterPro:IPR010095"
                     /db_xref="InterPro:IPR021027"
                     /db_xref="UniProtKB/TrEMBL:G8ZZD9"
                     /translation="MTISSQNQAKKRKTSKKTTSRPFWNEKTAHHSKQWSLYTISPMS
                     ARKLSQKINSDSWFSVVKHPQAPITNHSLNLPLSSGVKEEITRARKIRIYPTNSQKET
                     LKKWFGCHRYIYNKALKMHKDGVLMNIKILREKLLNKKTSVLKPEEQWLTEYHYDLKD
                     EALRDLVKNYSSNMARFKKMGVPFKLKFKTKSAPVQTLSVLKKHWNKGKKTFYSNIDP
                     SSSMRAAEPLPEEFPRDSRLQRTGRNKYYLIVPTAGEEIVRKSPAEKFKFIDPGVRTF
                     LTGYDSNQTVVEIGKDVVVRIEKLKRRRPQLQSKLAKLRKHKKRQNHRKTLHRLDGKI
                     SHIVQNMHKKSALFLCKSYDSIFLPKLDYQCTKLTRKSRSSMVTLAHCCFHDRLTMKA
                     EQIHGANVHEVKEDYTSKTCSSCGNLKDDLSSAKVYSCMKCASVFDRDFNAEKNIMLK
                     YICEPLIASGKSSISSALSVGNGGFAMMGPGTFVR"
     gene            <215067..>215879
                     /gene="TDEL0H01250"
                     /locus_tag="TDEL_0H01250"
                     /db_xref="GeneID:11501069"
     mRNA            <215067..>215879
                     /gene="TDEL0H01250"
                     /locus_tag="TDEL_0H01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683147.1"
                     /db_xref="GeneID:11501069"
     CDS             215067..215879
                     /gene="TDEL0H01250"
                     /locus_tag="TDEL_0H01250"
                     /inference="similar to DNA sequence:INSDC:YJL115W"
                     /note="similar to Saccharomyces cerevisiae ASF1 (YJL115W);
                     ancestral locus Anc_1.242"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683195.1"
                     /db_xref="GeneID:11501069"
                     /db_xref="GOA:G8ZZE0"
                     /db_xref="InterPro:IPR006818"
                     /db_xref="InterPro:IPR017282"
                     /db_xref="UniProtKB/TrEMBL:G8ZZE0"
                     /translation="MSIVSLLGIKVLNNPANFSNPYEFEITFECLEPLKSDLEWKLTY
                     VGSSRSLEHDQELDSILVGPVPVGVNKFVFTADPPSPELIPASELVSVTVILLSCSYD
                     GREFVRVGYYVNNEYDNEELRENPPAKVQVEHVVRNILAEKPRVTRFNIVWDNENEGE
                     MYPPEQPGVDEEEEEEEEEEEEEEEEEEEDEENEDDDEQEEEAEEEGEQQELEAQEAE
                     EEDEEAAEEGLDAADQHAGEDDDEPEIDDDGAPSLKKQKIEMDDAQTPQDSQ"
     gene            complement(<215882..>216571)
                     /gene="TDEL0H01260"
                     /locus_tag="TDEL_0H01260"
                     /db_xref="GeneID:11501070"
     mRNA            complement(<215882..>216571)
                     /gene="TDEL0H01260"
                     /locus_tag="TDEL_0H01260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683148.1"
                     /db_xref="GeneID:11501070"
     CDS             complement(215882..216571)
                     /gene="TDEL0H01260"
                     /locus_tag="TDEL_0H01260"
                     /inference="similar to DNA sequence:INSDC:YKR041W"
                     /note="similar to Saccharomyces cerevisiae YKR041W;
                     ancestral locus Anc_1.243"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683196.1"
                     /db_xref="GeneID:11501070"
                     /db_xref="UniProtKB/TrEMBL:G8ZZE1"
                     /translation="MSDSNDYEDDLEVSTSFCQFERPLFLRQRNVEKKSNKRKRVQKP
                     VKKDVPKQSTPLVLIHEDPVIRKKEQKSTSLKLPTKGRYVEYGDPVSGYKFILTEQEY
                     SKLKKNEQPIESFDPHAYDCVKPSAKVSSKSNIMIYWDQERTLRLPLVCAVAIDEIDI
                     EDITTDSVKEFYLRSSSEQGLDYGTILKGERVKWHPDRLVGQKADVLRKVTRLFQIIN
                     ELWESHTYSST"
     gene            complement(216666..216738)
                     /gene="TDEL0Htrna5A"
                     /locus_tag="TDEL_0Htrna5A"
                     /db_xref="GeneID:11501071"
     tRNA            complement(216666..216738)
                     /gene="TDEL0Htrna5A"
                     /locus_tag="TDEL_0Htrna5A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:11501071"
     gene            complement(<217085..>219490)
                     /gene="TDEL0H01270"
                     /locus_tag="TDEL_0H01270"
                     /db_xref="GeneID:11501722"
     mRNA            complement(<217085..>219490)
                     /gene="TDEL0H01270"
                     /locus_tag="TDEL_0H01270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683149.1"
                     /db_xref="GeneID:11501722"
     CDS             complement(217085..219490)
                     /gene="TDEL0H01270"
                     /locus_tag="TDEL_0H01270"
                     /inference="similar to DNA sequence:INSDC:YJL102W"
                     /note="similar to Saccharomyces cerevisiae MEF2 (YJL102W);
                     ancestral locus Anc_1.264"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683197.1"
                     /db_xref="GeneID:11501722"
                     /db_xref="GOA:G8ZZE2"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZZE2"
                     /translation="MLGRLCGSSRRYATRTPVSKLRNIGIIAHIDAGKTTTTERMLYY
                     SGKINRIGNVDQGDTITDFLPQEKSRGITIQSAAISFNWQRDHKINLIDTPGHADFTF
                     EVIRAVKVLDGCVTILDAVAGVEAQTEKVWKQSQGSPKVCFINKMDRVGAGFSRTVKE
                     LIVKMKTRVVLINIPLFAKDSSGQESKQEGVIDILNMKMLKWNPEDHDKIDVVDISES
                     DTEVYDQLLKCRESMIETLGESDDELVEYFLDQAEGDYLKVPANILNGSIRKATLNHF
                     VTPVLCGASFRNIGVQPLLDAVVNYLPSPVEATFPQINHPSLPMKVDPNSGIILNNNK
                     NLCVALAFKVITDPIRGIMVFVRVYSGKLHNGNTVYNSSTEKKFKIGKLVVMHANIYE
                     EVSSLNAGEIGVLVGATVAENVSTGDTIVTHSLKKDGLRSLDRKKELTLKINPIAIPP
                     PVFSVCIEPRTLGNKKSMEDALATLIREDPSFHVTYDEETGQTLLSGMGELHLEIAKY
                     KLINELHADVEIGRVMVSYKETLNLPTKEETTKTDSGYSFTLSIVPLPLHEDTLDVVA
                     RAQHETWYPLGSDNNYLIMENHQNYTAEEDWNFQISYQAVINALVSSSIVALQKGGKI
                     ANFPLHSCAVRLKGNWTLPLDIENPSEILSLSRKLSLKIISEVSQNDFSVLEPVMNLE
                     ISVPQRDMGSIIQDLTGSRNANILSIDDDSADPNGDKTGVEYQEIAQHQYLPPDLTLK
                     SANLGDESASMKSIKAQVPLRDMVSYTSKFRSLTQGRGTFHMDYCGMDKVNADRLNSI
                     INE"
     gene            <219833..>220756
                     /gene="TDEL0H01280"
                     /locus_tag="TDEL_0H01280"
                     /db_xref="GeneID:11501072"
     mRNA            <219833..>220756
                     /gene="TDEL0H01280"
                     /locus_tag="TDEL_0H01280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683150.1"
                     /db_xref="GeneID:11501072"
     CDS             219833..220756
                     /gene="TDEL0H01280"
                     /locus_tag="TDEL_0H01280"
                     /inference="similar to DNA sequence:INSDC:YKR026C"
                     /note="similar to Saccharomyces cerevisiae GCN3 (YKR026C);
                     ancestral locus Anc_1.263"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683198.1"
                     /db_xref="GeneID:11501072"
                     /db_xref="GOA:G8ZZE3"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:G8ZZE3"
                     /translation="MSEFSITETYLKFLKEDPDMTMPIAAIESLVTLLRVKNPETAAE
                     MINTIKSAANELTQSIPNSISLKAGCDIFMRFVLRNTHLYGDWENCKEHLIENGQLFV
                     SRAKLTRDKVAQIGVDFISDDDIILVHGFSRAVYSLLKHAAEKFIRFRCVVTECRPTS
                     QGEQLYSLLQEKGIPVIMVVDGAVGAVIDQVDKVFVGAEGVAESGGIINVVGTYSVGV
                     LAQNARKPFYVVTECHKFVRMFPLSPDDLSMQGKSLDFTRKSDEEDQQEILRGPRLDY
                     TAQEYITALITDLGVLTPSAVSEELIKMWYD"
     gene            complement(<220805..>221578)
                     /gene="TDEL0H01290"
                     /locus_tag="TDEL_0H01290"
                     /db_xref="GeneID:11501073"
     mRNA            complement(<220805..>221578)
                     /gene="TDEL0H01290"
                     /locus_tag="TDEL_0H01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683151.1"
                     /db_xref="GeneID:11501073"
     CDS             complement(220805..221578)
                     /gene="TDEL0H01290"
                     /locus_tag="TDEL_0H01290"
                     /inference="similar to DNA sequence:INSDC:YKR025W"
                     /note="similar to Saccharomyces cerevisiae RPC37
                     (YKR025W); ancestral locus Anc_1.262"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683199.1"
                     /db_xref="GeneID:11501073"
                     /db_xref="GOA:G8ZZE4"
                     /db_xref="InterPro:IPR006886"
                     /db_xref="UniProtKB/TrEMBL:G8ZZE4"
                     /translation="MSSENQLFVTDEDDKVQDDEVMDESENIVPQAKSEETYIDDEED
                     PVIQEFPLNVAGRDETLHILQYANKPKKMGGKAADHPLIGAARYKPNSSVWELDVPVD
                     EAAFYNKSRAEENWGEANIQTLRGVGVENEGQYAGFVSNGQIYLLSVEKVAQLRPFFK
                     YIDKVSTERKQDDAKRNANPASQKSQVVTMSVRSVNDQTQNRLAGSLLAHKVADEEEA
                     TEMSWVENTFEAFKESVVADAAAHVLQPVGDAKEYEEYS"
     gene            <221815..>223962
                     /gene="TDEL0H01300"
                     /locus_tag="TDEL_0H01300"
                     /db_xref="GeneID:11501074"
     mRNA            <221815..>223962
                     /gene="TDEL0H01300"
                     /locus_tag="TDEL_0H01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683152.1"
                     /db_xref="GeneID:11501074"
     CDS             221815..223962
                     /gene="TDEL0H01300"
                     /locus_tag="TDEL_0H01300"
                     /inference="similar to DNA sequence:INSDC:YKR024C"
                     /note="similar to Saccharomyces cerevisiae DBP7 (YKR024C);
                     ancestral locus Anc_1.261"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683200.1"
                     /db_xref="GeneID:11501074"
                     /db_xref="GOA:G8ZZE5"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZZE5"
                     /translation="MSDDDGMLLNFDTSGGTEERKSAKVTGGRWKDRRKLRMMMDGKA
                     PSKRRRVEQGDEGREQTKRRTEKEPSAVNTAAQEIKKAAPVANAQIVSSLFTSNREIS
                     TSVNTNAHDEDAVKKPSNAPLSMETFESLGVQEMLVSHLKDKMRIQKPTSIQKLVFSH
                     MLLSGKSADGDLFINAQTGSGKTLAYLLPIVSRILRMNVRVDRKSGCFALIVAPTREL
                     ASQIYSVASMLTNCCHYLVPCLLIGGERKKSEKARLRKGCNFIIGTPGRILDHLQNTK
                     VIREQLSHSLRYFVMDEGDKLMELGFEETIRDILNIIHEVPVNTERFPQLPTRIVHIL
                     CSATMQNGAAKLGDVALQNYKLISSRKIENDDAITEAPEQLLQKIVVVPPKLRLVTLA
                     AELDEIHRKHKQLQDGVTSRTMVFLSCSDSVEFHHETFSTNDLYHRNLVGESVRLLDK
                     GNNILPSFKSDEEPGVIFYKLHGSLSQPIRTSTLESFAKDTPTTKGKHLIMFCTDVAS
                     RGLDLPHVGTVLEVDPPFSTEDHLHRVGRTARAGQGGEALLFLLPGEEEGYLGKIKSY
                     HPKGWKLLKYDDDLLKPAFEQVNVRRSDKDDKQDDTVLEWDTNATTWHLNVERRVLED
                     SNFKSLAIKAFTSHIRAYATHISEEKPFFNIKFLHLGHLAKSFGLRERPKGIGAQHSK
                     DRDSVKKPKENSKNKMFRLARMAVKESASEFNY"
     gene            <224588..>226165
                     /gene="TDEL0H01310"
                     /locus_tag="TDEL_0H01310"
                     /db_xref="GeneID:11501075"
     mRNA            <224588..>226165
                     /gene="TDEL0H01310"
                     /locus_tag="TDEL_0H01310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683153.1"
                     /db_xref="GeneID:11501075"
     CDS             224588..226165
                     /gene="TDEL0H01310"
                     /locus_tag="TDEL_0H01310"
                     /inference="similar to DNA sequence:INSDC:YJL103C"
                     /note="similar to Saccharomyces cerevisiae YJL103C;
                     ancestral locus Anc_1.260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683201.1"
                     /db_xref="GeneID:11501075"
                     /db_xref="GOA:G8ZZE6"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8ZZE6"
                     /translation="MTKKLPVGQKQVRKPIQTACGFCHEKHLQCDVGRPCQNCLKRNI
                     GYLCRDKVRKSRKRSSTWNATTGNTKILKKESSDLPKDDQPQSDDPVDSAPMCQESSG
                     ENEKSIGNLKLKSDDKVEEKVSVLPVPKMHSFTNLLSNNSNSFLHDPLIPNMLSSSID
                     IKHSNPQIYHAHRSLDFDSMWTNDEYMKLNDITGLDDKKSAEHPEDPLSTEKLPPIKR
                     SSSSQLFKYLNVDGSIPRTDSRPYISLDMTKSGSISRFDNGKGDQSSHTDSSGPSPEN
                     IRKAELTPYKLRQLIKNPKDLFEKQHLITPHDYRTAYKDLLRCLHRMFLGSYVHSTID
                     DAALTNDEEFNHKRLLRKNQLKHIARSIVDRYAPIFVTLTSNMIEDDLLLQEIILQRT
                     LLEFESMAKLLNCTPICIWRRSGEICFVSNEFASLTGFSKKEVLNERRFIAEFLDHQS
                     VVNYYDLFHEYLAFGSNQCGKSTTTSDGQAIFGKCNLLLHSGSFLKCACCWTVKRDSF
                     NISLLVMGQFLPIFEVD"
     gene            complement(<226237..>227724)
                     /gene="TDEL0H01320"
                     /locus_tag="TDEL_0H01320"
                     /db_xref="GeneID:11501076"
     mRNA            complement(<226237..>227724)
                     /gene="TDEL0H01320"
                     /locus_tag="TDEL_0H01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683154.1"
                     /db_xref="GeneID:11501076"
     CDS             complement(226237..227724)
                     /gene="TDEL0H01320"
                     /locus_tag="TDEL_0H01320"
                     /inference="similar to DNA sequence:INSDC:YKR023W"
                     /note="similar to Saccharomyces cerevisiae YKR023W;
                     ancestral locus Anc_1.259"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683202.1"
                     /db_xref="GeneID:11501076"
                     /db_xref="GOA:G8ZZE7"
                     /db_xref="InterPro:IPR009349"
                     /db_xref="UniProtKB/TrEMBL:G8ZZE7"
                     /translation="MTKSQAIQYALKKVPQILPLEEDDVKNLCEQVLKASESNSESIA
                     QGFLEFLGHDDLAFEFVIGFNDIFSQEEAKPQVTPHPRVEQKKVSSVEPIKEVKQEKK
                     LQHVPQEKPKKYEKSKLKAKRNQLIHEIDEVWKFLELEHNEKDVKKYACDCQGNIHPL
                     FEAAPNCLSCGKIICAKEGLHLGRCTFCATEFIPLEERLKIVQLLKKEKEELSKESTH
                     KEQTTQRPIHKKKYANAFKISSGMGTNLFSEQDKLFDLIERQRERERKREEVLRDKEE
                     EEKKEVEAQKRQQRESETDPELLEAQDRLDKLLHFQDTSAERTKIIDNASDFSISNDS
                     GVWGSAQERALMLKKQQRNLRKWEKLENERNGKRDKYVVSMDIGANGKVVMKEVLKNN
                     GKSTADSDDDIEEISDEEDSNDLKEIHQLKGAIDSTKNEQKSALQSKVWDYEKDKKQF
                     EPPKYIEDSRLEEQTNHEDDKTTTRERAPRVQIDQEGENLWDMIA"
     gene            <227891..>228343
                     /gene="TDEL0H01330"
                     /locus_tag="TDEL_0H01330"
                     /db_xref="GeneID:11501077"
     mRNA            <227891..>228343
                     /gene="TDEL0H01330"
                     /locus_tag="TDEL_0H01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683155.1"
                     /db_xref="GeneID:11501077"
     CDS             227891..228343
                     /gene="TDEL0H01330"
                     /locus_tag="TDEL_0H01330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683203.1"
                     /db_xref="GeneID:11501077"
                     /db_xref="UniProtKB/TrEMBL:G8ZZE8"
                     /translation="MSQARKKSVQDIEPWKQETTEMEHAKLLKSVKSLSAKIDEYLKR
                     YPMADDAELPATTTEKFGLKPSYKANKPRPHSAVESSSNQLTDHRSISSTIDSNSLPL
                     SDDPHTTKDLKERPKRLRNSFKNDQTAPKIRKTSKQDEDILNADFIAL"
     gene            complement(<228513..>229532)
                     /gene="TDEL0H01340"
                     /locus_tag="TDEL_0H01340"
                     /db_xref="GeneID:11501078"
     mRNA            complement(<228513..>229532)
                     /gene="TDEL0H01340"
                     /locus_tag="TDEL_0H01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683156.1"
                     /db_xref="GeneID:11501078"
     CDS             complement(228513..229532)
                     /gene="TDEL0H01340"
                     /locus_tag="TDEL_0H01340"
                     /inference="similar to DNA sequence:INSDC:YKL193C"
                     /note="similar to Saccharomyces cerevisiae SDS22
                     (YKL193C); ancestral locus Anc_4.298"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683204.1"
                     /db_xref="GeneID:11501078"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:G8ZZE9"
                     /translation="MNVASTPVEGKKRGNGSLEVQQVDDPNVDYITADSELTEDLPDD
                     AESIDLIHLKIQSLEDLKLYRFTRLASLCLRQNLIESISEVEVLPVDTFKDLDLYDNR
                     IKHISSNISKLVNLENLDLSFNKIKHIKNVEQLINLKNLYFVQNKISVIENLSTLKKL
                     VNLELGGNRIDEILPDSFIGLENLEELWLGKNSIRTLVHLNPLKSLKILSIQANRLTK
                     IEGLEELENLEELYISHNFVTKIDGLSNNHKLTTLDVTSNKITKVENLSHLKNLTDLW
                     ASFNQIDQTFEEVGDELRGLPAFETIYLEGNPIQRNNETSYRRKLVMNLGPSLQKIDA
                     TFVRG"
     gene            complement(<229829..>230212)
                     /gene="TDEL0H01350"
                     /locus_tag="TDEL_0H01350"
                     /db_xref="GeneID:11501079"
     mRNA            complement(<229829..>230212)
                     /gene="TDEL0H01350"
                     /locus_tag="TDEL_0H01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683157.1"
                     /db_xref="GeneID:11501079"
     CDS             complement(229829..230212)
                     /gene="TDEL0H01350"
                     /locus_tag="TDEL_0H01350"
                     /inference="similar to DNA sequence:INSDC:YKL192C"
                     /note="similar to Saccharomyces cerevisiae ACP1 (YKL192C);
                     ancestral locus Anc_4.297"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683205.1"
                     /db_xref="GeneID:11501079"
                     /db_xref="GOA:G8ZZF0"
                     /db_xref="InterPro:IPR003231"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="UniProtKB/TrEMBL:G8ZZF0"
                     /translation="MFRTTLRAASPIASRAISRPLVAKSAFIGASKFVAPIRFYTAAP
                     VDKKEITSRVIDVIKAFDKTAASSEVTGQTYFHKDLGLDSLDTVELLVAIEEEFDIEI
                     PDKVADDLKSVGETVDYIASNPEAN"
     gene            complement(<230410..>236187)
                     /gene="TDEL0H01360"
                     /locus_tag="TDEL_0H01360"
                     /db_xref="GeneID:11501080"
     mRNA            complement(<230410..>236187)
                     /gene="TDEL0H01360"
                     /locus_tag="TDEL_0H01360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683158.1"
                     /db_xref="GeneID:11501080"
     CDS             complement(230410..236187)
                     /gene="TDEL0H01360"
                     /locus_tag="TDEL_0H01360"
                     /inference="similar to DNA sequence:INSDC:YLR422W"
                     /note="similar to Saccharomyces cerevisiae YLR422W;
                     ancestral locus Anc_4.296"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683206.1"
                     /db_xref="GeneID:11501080"
                     /db_xref="GOA:G8ZZF1"
                     /db_xref="InterPro:IPR010703"
                     /db_xref="InterPro:IPR026791"
                     /db_xref="InterPro:IPR027357"
                     /db_xref="UniProtKB/TrEMBL:G8ZZF1"
                     /translation="MIEADESGWKPTDRVTRGIVVKSYLPLKRHPELRTHDDHFFNLY
                     VGDEVYVFEESKDRKWFRGYLCWTPLPEAYVSGMVSVDDQFPHLRNRLVVIPRKFVHL
                     NLNRHVVENPFVRLPALADFHSVISESCTSPSLYDSLAMGEDSNETQAVTTSKPPRPS
                     FPYYRYEDRPFAEELAPILGLLSSHIYGVYSSGDFALFEKLTNAFYELDAIRSRLQFS
                     LLTSYELIKVRRLASALLASIGKLIASKHKSFAGATSFNQVTEDPSGAEGIFGRNVET
                     GELLSYEEDNLQSLVLNSMLHGLLKDFPAASCNLLRSKPSANDLFEPTESHILVDVND
                     VKSDASIGNPMLNNISASMYLCSKNERLTEPFTVNMDSDQISSLNSISAALFKNIPAG
                     QIKRCNTYLAVVLTEKVPVTVGSIQSEYTSPPDSPFQPFEKTKEGRISSIRRGIAAGA
                     VDITRVFARYNESNTDLSQAFKFKVHLFGSYLSKTASMQSKSGADIWDNESVGWGELI
                     DRILTNSHKGVAINPRATSLEVNIKEIRSSDAGNSVQTSVGAIKSVPTYFYDILSGSS
                     ERIYLSLGKVSLLGNLQTNVESITIKLSCSNDRIRFSSSANENLQNTWKMVSVRPGES
                     IGDTIRINGLKHMRENETINVAAYLNGFLMGKLTFYIRKGGQIMSFKKYTNVQLLNSV
                     KEPLVNLELATEYVGKKYNLDSVLKEFLELPYTDSSAWDAMSTKHCIGILIGLTKVSV
                     DQLQKFFRELLLTYLHCFDIFENKHPDRFSDEIRRQLFVTFVDSIDKLMARSDRLRRS
                     FNVFYEESSRSLKELPHVGSIILQHMSDLFGNCSKEWGKVGGAVSRTSLYLIMISVIS
                     SKGSPDEWRLSFQLFFSQVCQFLASTSEPVAKDQILVLQTYDMWLGAINRLYDSEMLV
                     QFSLGLLQSCRNKEENREYATKGLSPMDARYLNTKLSLLRRILAHKDLHDYLFDFGES
                     KMVRLAFLSKCIDWALLPYTYTPLHISSIRLGNGVLISLIENAKDRKLRRNLIRLLPT
                     LCRAFILTRKYCKENNLFKPKITFTELFPRSIPCSIYPMDSLIRSEVLVEVLVELITI
                     ICELTKAGEAIYGARDISFVDILSECEGDKEFHTDFCLKQITNNHVTTLYHMVKIVAR
                     GQFFPANKWLGVSAMFNRSFMTLVRMYRDYMIQQNLPNGSGELDIKLWTAYLKAIFTL
                     ANNKLTYLIKLGIIARKGVYRIMGNVKERAADLLNSSWDALACQKYEVDCGTRFGIEK
                     IGPYQMQILEDNVGLMQEIFLFAFHRHIECIKVSCRLLWCSAITCWSTYGNLQPLLNI
                     AIPELYNAYQTGRLYLTDYDLQRFKICTLYTVHIARDDPIYQLVLALMEELFAFLHTV
                     ANAYKISDQEEFDDDRTAVHMEMFTYLLNADRPELFHKMIYDLFIHFLRKKDHVQAAL
                     SLELLANTYDWNTNNALASISYPPLPEQSSFERKEYLYKESAKNFAKGLKLEKALSIY
                     KDLIAAYDQINYDLSGLAYVYGEMSNIYTSLQTVDRLVPTYFKVSFTGLGFPSSLRNK
                     RFIFEGLPFEHITSMHDRLLRVYHGTTIVQSQERMDELFINSSVGRFIHVSSVEPQFE
                     LSEHFQRNADKNHFLNNKTWMYIENRNLRTFSNSRRLPGATGVTDLWVNEMTYRTTST
                     FPTLMNRSEIIEVTQRKLSPLQNALRSLRIKVQELNGLENMCWKVIKEHGDRSEIFGE
                     LSRNMTGTIDAPVNGGITQYREFLNPDMASDFEDGDLQTLTAAFADLATILARCLILH
                     RELLPSEKLKESHNMLIVLFKKNFELEIIENNISLEGVNSSAPIRFGSFLHGNPMHSS
                     RNQLQLTLQQSFNRLNETQAASVDSRESSHSRTDTMDTTPAKASPSRHGLFPTESGTS
                     IGTRATSKNSFKFTLSGITSRSNNQ"
     gene            complement(<236369..>236920)
                     /gene="TDEL0H01370"
                     /locus_tag="TDEL_0H01370"
                     /db_xref="GeneID:11501081"
     mRNA            complement(<236369..>236920)
                     /gene="TDEL0H01370"
                     /locus_tag="TDEL_0H01370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683159.1"
                     /db_xref="GeneID:11501081"
     CDS             complement(236369..236920)
                     /gene="TDEL0H01370"
                     /locus_tag="TDEL_0H01370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683207.1"
                     /db_xref="GeneID:11501081"
                     /db_xref="InterPro:IPR008136"
                     /db_xref="UniProtKB/TrEMBL:G8ZZF2"
                     /translation="MVAFPPLEAVELVTEISVILKRRGETIAVCEAACGGLISSYLVS
                     VPGASEWFYGGTMVYSLKSRLKLSGWDSQDIDSYTGPSTNVALRLARNLRLELGATWT
                     LSETGYASQSPLAVANDPEAANKTGTVYFGISGPDRDLSKVYATGSTERCQNMQAFAL
                     QGLQFLLRELRRGEESTKTQHGQ"
     gene            <237141..>237563
                     /gene="TDEL0H01380"
                     /locus_tag="TDEL_0H01380"
                     /db_xref="GeneID:11501082"
     mRNA            <237141..>237563
                     /gene="TDEL0H01380"
                     /locus_tag="TDEL_0H01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683160.1"
                     /db_xref="GeneID:11501082"
     CDS             237141..237563
                     /gene="TDEL0H01380"
                     /locus_tag="TDEL_0H01380"
                     /inference="similar to DNA sequence:INSDC:YLR421C"
                     /note="similar to Saccharomyces cerevisiae RPN13
                     (YLR421C); ancestral locus Anc_4.295"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683208.1"
                     /db_xref="GeneID:11501082"
                     /db_xref="GOA:G8ZZF3"
                     /db_xref="InterPro:IPR006773"
                     /db_xref="UniProtKB/TrEMBL:G8ZZF3"
                     /translation="MSGEVLKIRAGVCDYDEETKVCTPVPCQGEIVVKPNEEEEAMGF
                     WDFEWRPLEKPVGRELEAIPLILIPGETLWVPVKSCKNGRIFALVFSSNQRYMFWLQE
                     KNSGSLGLNELSEKDQKLYDKMINILNVDDDDVEMKDA"
     gene            complement(<237599..>238696)
                     /gene="TDEL0H01390"
                     /locus_tag="TDEL_0H01390"
                     /db_xref="GeneID:11501083"
     mRNA            complement(<237599..>238696)
                     /gene="TDEL0H01390"
                     /locus_tag="TDEL_0H01390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683161.1"
                     /db_xref="GeneID:11501083"
     CDS             complement(237599..238696)
                     /gene="TDEL0H01390"
                     /locus_tag="TDEL_0H01390"
                     /inference="similar to DNA sequence:INSDC:YLR420W"
                     /note="similar to Saccharomyces cerevisiae URA4 (YLR420W);
                     ancestral locus Anc_4.294"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683209.1"
                     /db_xref="GeneID:11501083"
                     /db_xref="GOA:G8ZZF4"
                     /db_xref="InterPro:IPR002195"
                     /db_xref="InterPro:IPR004721"
                     /db_xref="UniProtKB/TrEMBL:G8ZZF4"
                     /translation="MASELNLGVTCDMHVHLREGSMMELVAPTVREGGVSVAYVMPNL
                     QPPVTTIDRVVEYKKKIQGLAPQTTFLMSFYLSKELTPELIHEAASRKAIRGVKCYPA
                     GVTTNSAAGVDPNDFSAFYPVFEAMEKENLVLNLHGEKPSVNDGKQAEDIHVLNAEES
                     FLPALKKLHSDFPNLKIILEHCTTEAAIKAIEDINKDVKDSKDIKVAATITAHHLYLT
                     IDDWAGNPINFCKPVAKLPKDKRALVSAAISGKPYFFFGSDSAPHPLESKSRHMGVCA
                     GVFSQSLAIPYLAQIFEEQQSLDKLKGFVTDFPTQFYQVPHSDLKSLDEAVVYKQKQV
                     VPPTISDKQGLLVAPFLAGSKLNWSVKWIAK"
     gene            <238841..>240478
                     /gene="TDEL0H01400"
                     /locus_tag="TDEL_0H01400"
                     /db_xref="GeneID:11501084"
     mRNA            <238841..>240478
                     /gene="TDEL0H01400"
                     /locus_tag="TDEL_0H01400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683162.1"
                     /db_xref="GeneID:11501084"
     CDS             238841..240478
                     /gene="TDEL0H01400"
                     /locus_tag="TDEL_0H01400"
                     /inference="similar to DNA sequence:INSDC:YKL191W"
                     /note="similar to Saccharomyces cerevisiae DPH2 (YKL191W);
                     ancestral locus Anc_4.293"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683210.1"
                     /db_xref="GeneID:11501084"
                     /db_xref="GOA:G8ZZF5"
                     /db_xref="InterPro:IPR002728"
                     /db_xref="InterPro:IPR010014"
                     /db_xref="UniProtKB/TrEMBL:G8ZZF5"
                     /translation="MSSEEIATASVAPALSTAQNEDTFGLQKYDSVAIERACYLGPHA
                     ASDERNSVGNYHAVDEIVDFLKQNEKYRNITLQFPDSLIQDSSIVVQLLQEKLNMDSG
                     TVKRRFWALADTAYSACCVDEVAAEHAKGDLVIHFGDACFKAVQSLPVVYSLGRPYLD
                     LEEVAKKFSGIFDDKCRKICLLADAPHTYILSSLYEKLEEEGYENLIYGVVDEILVAD
                     TSVILQQKNDDNHSAKRIGNLGNRVLMTNKRDSKALEEDIIREEFALFHITIPQDPHL
                     LFLVTKFESVILYDPKDNTITEGPYPSLMKRYKNMHVARTAGCIGILVNTLSLRNTKE
                     MINTLVKLIRDNGKKHYLFVVGKPNVAKLANFEPVDIWCILGCGQAGIILDQYNEFYK
                     PIITPYELTMALKEEVTWTGQWVVDFEKVLNEIAVNETEPCEERNESDEPEFDAVTGK
                     YVSTSRPLRHIQHLEIEGPKETESRSLIQKVNGGVIIKGTVSTAAASIQNREWTGLGS
                     DFTAQDDYEEEGATVQEGISGVASSYEFDKLNSRNQS"
     gene            <240642..>241274
                     /gene="TDEL0H01410"
                     /locus_tag="TDEL_0H01410"
                     /db_xref="GeneID:11501085"
     mRNA            join(<240642..240693,240799..>241274)
                     /gene="TDEL0H01410"
                     /locus_tag="TDEL_0H01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683163.1"
                     /db_xref="GeneID:11501085"
     CDS             join(240642..240693,240799..241274)
                     /gene="TDEL0H01410"
                     /locus_tag="TDEL_0H01410"
                     /inference="similar to DNA sequence:INSDC:YKL190W"
                     /note="similar to Saccharomyces cerevisiae CNB1 (YKL190W);
                     ancestral locus Anc_4.292"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683211.1"
                     /db_xref="GeneID:11501085"
                     /db_xref="GOA:G8ZZF6"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:G8ZZF6"
                     /translation="MGVASSKVIDNLLEDTNFDGDEIERLRKRFMKLDRDSSGSIDKN
                     EFMMIPGVSSNPLAGRIMEVFDADNNGSVDFQEFISGLSIFSGRGSKDEKLKFAFKIY
                     DIDKDGYISNGELFIVLKIMVGNNLDDEQLQQVVDRTIVENDSDGDGHLSFEEFKNAI
                     ETTEVAKSLTLQYDV"
     gene            complement(<242027..>243880)
                     /gene="TDEL0H01420"
                     /locus_tag="TDEL_0H01420"
                     /db_xref="GeneID:11501086"
     mRNA            complement(<242027..>243880)
                     /gene="TDEL0H01420"
                     /locus_tag="TDEL_0H01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683164.1"
                     /db_xref="GeneID:11501086"
     CDS             complement(242027..243880)
                     /gene="TDEL0H01420"
                     /locus_tag="TDEL_0H01420"
                     /inference="similar to DNA sequence:INSDC:YDL185W"
                     /note="similar to Saccharomyces cerevisiae TFP1 (YDL185W);
                     ancestral locus Anc_7.300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683212.1"
                     /db_xref="GeneID:11501086"
                     /db_xref="GOA:G8ZZF7"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005725"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR022878"
                     /db_xref="InterPro:IPR024034"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZZF7"
                     /translation="MAGALENARKEIQRLSLEEHDETEYGYIYSVSGPVVVAERMIGC
                     AMYELVKVGHDNLVGEVIRIDGDKATIQVYEETAGVTVGDPVLRTGKPLSVELGPGLM
                     ETIYDGIQRPLRAIKEQSGSIYIPRGVEVPALSREIKWKFTPGSYKVGDHITGGDIFG
                     TVFENSLIEDHKILLPPRARGKVTWIAPAGEYTVDEKVLEVEFEGKKSDFPMYHTWPV
                     RVPRPVAEKKSADYPLLTGQRVLDALFPCVQGGTTCIPGAFGCGKTVISQSLSKYSNS
                     DAIIYCGCGERGNEMAEVLMEFPELHTEKNGKMEPIMKRTTLVANTSNMPVAAREASI
                     YTGITLAEYFRDQGRDVAMIADSSSRWAEALREISGRLGEMPADQGFPAYLGAKLASF
                     YERAGKAVALGSPDRVGSVSIVAAVSPAGGDFSDPVTTATLGITQVFWGLDKKLAQRK
                     HFPSINTSVSYSKYTNVLNKYYDVNYPEFASLRDRIREILSNAEELEQVVQLVGKSAL
                     SDSDKITLDVANLIKEDFLQQNGYSTYDAFCPIWKTFDMMRAFVGYHDESQKAIANGA
                     NWSKLSEATADVKHAVSSSKFFEPSRGQEEVHAEFEKLLSNMQERFAESTD"
     gene            246759..246829
                     /gene="TDEL0Htrna4G"
                     /locus_tag="TDEL_0Htrna4G"
                     /db_xref="GeneID:11501087"
     tRNA            246759..246829
                     /gene="TDEL0Htrna4G"
                     /locus_tag="TDEL_0Htrna4G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11501087"
     gene            <246955..>248634
                     /gene="TDEL0H01430"
                     /locus_tag="TDEL_0H01430"
                     /db_xref="GeneID:11501720"
     mRNA            <246955..>248634
                     /gene="TDEL0H01430"
                     /locus_tag="TDEL_0H01430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683165.1"
                     /db_xref="GeneID:11501720"
     CDS             246955..248634
                     /gene="TDEL0H01430"
                     /locus_tag="TDEL_0H01430"
                     /inference="similar to DNA sequence:INSDC:YJR052W"
                     /note="similar to Saccharomyces cerevisiae RAD7 (YJR052W);
                     ancestral locus Anc_1.492"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683213.1"
                     /db_xref="GeneID:11501720"
                     /db_xref="UniProtKB/TrEMBL:G8ZZF8"
                     /translation="MYRSRNRGKKSGEDGGVKGPSSALTQFLKDQGISAQAIKSRWEK
                     RQKEEAESSVTPESTPDVSKVKPEDVEDEQLDQVSSESTETDDELTSTPFDKRLRSVG
                     ADSDEEEYDVDDTSVKKPRIMPRQTVKDEKKKTQILQNRRKKRRKAADILDRRTDILP
                     TLQDMCIRRISENIYKLEKDTNEDKSISFDHIRKVLGGISTDNLKNLAKALSKNRALN
                     DHTLQLFLKTDLHELTFHDCSKLSSEGYRILSIFSPHLTKLSLQMCGQLNNEALLYIA
                     EKLTNLTSINLDGPFLINEETWDLFFQKMKGRLREFHVSNTHRFIDLSLSSLLRNCGA
                     DLVSLGLSRLDSVFNYSLLPQYLNNKEFHTLSIKNPFNEEDFSDEVIINILGQIGSTL
                     RHLSLSGCTELTDSTLINGMAAFLEKRGNLETLELEELTSITTDGLVYLCSKVSMPLL
                     KRCSFRRCIQIDDAATIELFLNSAKDSLEYINLNSLNKLTEETFAIMSCPNLTHLDLS
                     FVRAIDDLLVEQISRQNPKLRLMEVFGDNLITSNAKIPSTLTLTGRESDTL"
     gene            <248966..>253210
                     /gene="TDEL0H01440"
                     /locus_tag="TDEL_0H01440"
                     /db_xref="GeneID:11501088"
     mRNA            <248966..>253210
                     /gene="TDEL0H01440"
                     /locus_tag="TDEL_0H01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683166.1"
                     /db_xref="GeneID:11501088"
     CDS             248966..253210
                     /gene="TDEL0H01440"
                     /locus_tag="TDEL_0H01440"
                     /inference="similar to DNA sequence:INSDC:YLR419W"
                     /note="similar to Saccharomyces cerevisiae YLR419W;
                     ancestral locus Anc_4.291"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683214.1"
                     /db_xref="GeneID:11501088"
                     /db_xref="GOA:G8ZZF9"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZZF9"
                     /translation="MAKKGKTSSKASPTPPPDVGKKKNRNKVEEPSELELKKSKQQAN
                     RAKVTSTASWTGKLPHTLLHEFCQKRKWNKVEYDMKKIGDKGMVAIAILSYTDAKSKE
                     TLTVKMNDPTYDKASGKGAVVPQETPNEARHYAATVALHRVAYNTNMHMMLPPNHKNV
                     WYELNDYRTAISKENSYRSQRLFDSDPFKTMVEDQKLKKQREKEQAGKNKQAEKEHTQ
                     TVVVSLPNNSNRVDKPSDLRSKRLAKLQNSTHFPKKVWENAPFIDLEESSRQMMESTM
                     KLNIDWKSRRLDTAKSLTGDREVLKNGLLSLKFREAHVEEAMSYKDPLSFLLLNLPED
                     DLPPFFHKRKEDTKNILQISSLPLVVRNMIDRLMESGVSKDEAVFALEGSEMDENEAA
                     GKLTQAAYPSLTAISDSMPSEQESVEIWNQELESLRCIYEDSVTVIKENSCYSIDLFK
                     EMKLKAKFYRTKHYPQALPGIIVSTFERGYKLPDYIKQQILVKLLQYISESKLLGDML
                     VFHVYEWLQENVKQLIENPGPLLSNAILHETSSNQSGEYSPMQNNKLNRRQRSGQKSE
                     INGETLKMLEKEYFERLKSAAYKNMCNSRAKLPAWKKQDLIVNLVESNDVILITGETG
                     SGKSTQVVQFILDSLASIKKDFATKIICTQPRRISAIGLAERVADERCVECGDEVGYV
                     IRGVNKSKITTRIKFMTTGVLVRILQGDKTFLQNTIVVIDEVHERSIDTDLIVILLKN
                     LRGKIPGLKIVLMSATVNVDVFKNFFGTLGTCHIEGRTFPIKDHYLDDILEDLDFTIK
                     SDKSHNYWDDDDGDEKLLKPTADCNFFRSGQINYDLISQVVTYADQQLCNEGNDGSII
                     VFLPGVAEINRCCSLISARNDTFVVLPLHSALTPEEQRRVFKKYPRKRKIVVSTNIAE
                     TSITIDDCVATIDTGRGKTMIYNPRDNTTRLTESFISRAEAKQRRGRAGRVREGISYK
                     LFSKRLYEEDMVSMPEPEIKRISLESLYISVKAMGIKDVEKFLGGGLDPPPTESIGKA
                     ARILTTVGLLDEFDGSLTELGKFISLMPTMDSKHGKLLIYSIIFGVADMGILLASILS
                     AGTMPFVGGFENKDKIKRLLSKYENKGDLIAVCEIFQQYLSIKGESARNKFIKENLLS
                     YNKVKEILSSQTQYQSILKDIGFLPFKKDEKLSAYLNRNCDNYDIVRAVITGAFYPQV
                     ARVQLPDAKYLKTSMGAIEKDPELSSIKLWIRNEEYIDQLLNPKETGHENKPLPATRA
                     FLHPSSVLFKGNNLSAEETRALVEDEQPMLRQSNTNPLLRNPFIAFNSAHVTSKLYLR
                     EVTPISALSLLLVGGPLSYDVNEKEHSYGIIVDNWLPIRTWCKNAVLIKELRTLLDQA
                     IKDKLENPRYVVVNSNQPQTRADQVLKLVEDIFSLE"
     gene            complement(253312..253395)
                     /gene="TDEL0Htrna7L"
                     /locus_tag="TDEL_0Htrna7L"
                     /db_xref="GeneID:11501089"
     tRNA            complement(253312..253395)
                     /gene="TDEL0Htrna7L"
                     /locus_tag="TDEL_0Htrna7L"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUA"
                     /db_xref="GeneID:11501089"
     misc_feature    complement(254156..254233)
                     /note="Short protein (TDEL_0H01450, CCE94004.1) was
                     converted to a misc_feature."
     gene            complement(<254642..>255523)
                     /gene="TDEL0H01460"
                     /locus_tag="TDEL_0H01460"
                     /db_xref="GeneID:11501090"
     mRNA            complement(<254642..>255523)
                     /gene="TDEL0H01460"
                     /locus_tag="TDEL_0H01460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683168.1"
                     /db_xref="GeneID:11501090"
     CDS             complement(254642..255523)
                     /gene="TDEL0H01460"
                     /locus_tag="TDEL_0H01460"
                     /inference="similar to DNA sequence:INSDC:YDL183C"
                     /note="similar to Saccharomyces cerevisiae YDL183C;
                     ancestral locus Anc_7.298"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683216.1"
                     /db_xref="GeneID:11501090"
                     /db_xref="InterPro:IPR018786"
                     /db_xref="UniProtKB/TrEMBL:G8ZZG1"
                     /translation="MKVLGPGCIRCYATKIPSVTVQQFLRDPVKIIVIPVTNKKVFIY
                     HKHTADLLNEDSSVIRLERWVTKKAADIWGKLNSSPKSYNKKIVLWVNKLLMNTPWTE
                     NSLKTIPGENYLLKRVSKKDEPNDETKLSLTEYLSSNIPLEPKPLNVYLPGSILSEEE
                     VKLQFEKEYRTGMQYHKKQMLLCLLGLPLTLPVILVPIIPNVPGFYLTYRAYCNYKAY
                     AGAQHLKTIMEKQSPKLEFRDIEEYDKIFNTQETLLLNDKTLPKIIELLEIPEMKIDL
                     EKVVIQEKARIEEIQRD"
     gene            <255800..>257110
                     /gene="TDEL0H01470"
                     /locus_tag="TDEL_0H01470"
                     /db_xref="GeneID:11501091"
     mRNA            <255800..>257110
                     /gene="TDEL0H01470"
                     /locus_tag="TDEL_0H01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683169.1"
                     /db_xref="GeneID:11501091"
     CDS             255800..257110
                     /gene="TDEL0H01470"
                     /locus_tag="TDEL_0H01470"
                     /inference="similar to DNA sequence:INSDC:YDL133W"
                     /note="similar to Saccharomyces cerevisiae YDL133W;
                     ancestral locus Anc_7.297"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683217.1"
                     /db_xref="GeneID:11501091"
                     /db_xref="UniProtKB/TrEMBL:G8ZZG2"
                     /translation="MVTDSSSPTSSTGDTRTKADGSSSNSSESHVARGGTNDHDPLNT
                     YGFYPTTVPPFVLDSQIEKVNTRVTHTPSKAEINDCSQFNLKDPFLVTYDGKWGDFAQ
                     NIGSNVAYPKQAHARLSLDQNSTSSNNSDIEKQSNTDGSSLIEREKAGKQVLKDLNGE
                     WGGGKRLEKLFNTPIAGNYEFKNNEDRKAWYDYVTKIKQFYYGEGSNWNPTDNKSRLE
                     QMERGTAGRRNPDWVEELNRDRLKFKQVKQQKLQQWMPALKRLLLDNQYLPLGLRIVV
                     GVLSVVSLGLAVRIFQNSSSRVAAIQSSVDQQPSTIMAICVNAIAVVYIVCIAHDEFS
                     GKPLGLRNPFGKLRLILLDLLFIIFCSANLALAFNTLFDPQWVCTNEGGSTGHTRQYP
                     KIPYICEKQRALSSFLFVMLFMWILTFTVSIVRVVEKVSSSPRD"
     gene            <257519..>259963
                     /gene="TDEL0H01480"
                     /locus_tag="TDEL_0H01480"
                     /db_xref="GeneID:11501092"
     mRNA            <257519..>259963
                     /gene="TDEL0H01480"
                     /locus_tag="TDEL_0H01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683170.1"
                     /db_xref="GeneID:11501092"
     CDS             257519..259963
                     /gene="TDEL0H01480"
                     /locus_tag="TDEL_0H01480"
                     /inference="similar to DNA sequence:INSDC:YDL132W"
                     /note="similar to Saccharomyces cerevisiae CDC53
                     (YDL132W); ancestral locus Anc_7.296"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683218.1"
                     /db_xref="GeneID:11501092"
                     /db_xref="GOA:G8ZZG3"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016157"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:G8ZZG3"
                     /translation="MTDILPRSDDLEATWSFIEPGIAQILGRDGLTTTTNKRVNKVLS
                     PTMYMEVYTAIYNYCVNKSKSSGQFNADKQENQSSILVGSEIYEKLKKYLKDHISGFE
                     RNSNESFLQFYVRRWKRFTVGTIFLNHAFDYMNRYWVQKERSDGKRHIFDVNTLCLMT
                     WKNVMFDPNSDTLVNEILDQITLERGGNIIQRSNVTAAIKSFVALGIDPQDLKKLNLN
                     VYIPVFEKPFLKRTEEYYKQYSADYLTTHSVTEYIFKAREVISAEEKGMVIYWDEHTK
                     KPLSETLNAVLITQHAEELKAEFVTLLDSRENAKISAVYNLMQRDITLLPELANAYEE
                     YIRKSGENEVSQLISLQKAAITNGSEEGLQHNKKANLMALHSLSPKDYVKKLLEVYRT
                     FRSMTNDCFLSDPLFTKALDNACRAYVNNNAFALPAGAPRSATSKTPEMLAKYSDQLL
                     KKSTKPEVAHDMSVDDIMMLFKFLTDKDAFESYYRRLFAKRLIHGTSISDSDEESVIQ
                     RLQSENSMEYTGKITKMFQDVRLSKVLEEDFDQMIKGLPNYTKEKYPDSQPFILAETM
                     WPFSYQEVDFKLPKELEPSHTKLEGLYSSKHNGRVLKWLWPLCRGEIRADIGKPGRPP
                     FLFTVTLFQISILLLYNDADVLTLEKIQEGTNLSIQNIAAAMVPFLKFKLMQQVPPGL
                     ENLVKAETQFKISRPYKALKSKINFAGGVKNDVLNALNSSSDSQRTGQELTETEKIEK
                     ELSAERQIFLEACIVRIMKANRKLPHTTLVNECIAQSHQWFNAKVSLIKKAIDSLIQK
                     EYLQRCDDGESYKYLA"
     gene            <260285..>261586
                     /gene="TDEL0H01490"
                     /locus_tag="TDEL_0H01490"
                     /db_xref="GeneID:11501093"
     mRNA            <260285..>261586
                     /gene="TDEL0H01490"
                     /locus_tag="TDEL_0H01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683171.1"
                     /db_xref="GeneID:11501093"
     CDS             260285..261586
                     /gene="TDEL0H01490"
                     /locus_tag="TDEL_0H01490"
                     /inference="similar to DNA sequence:INSDC:YDL182W,YDL131W"
                     /note="similar to Saccharomyces cerevisiae LYS20 (YDL182W)
                     and LYS21 (YDL131W); ancestral locus Anc_7.295"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683219.1"
                     /db_xref="GeneID:11501093"
                     /db_xref="GOA:G8ZZG4"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR011872"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G8ZZG4"
                     /translation="MSENFQKVTESAAEPQQANPYGPNPADYLSNVNNFQLIDSTLRE
                     GEQFANAFFTTEKKIEIAKALDAFGVDYIELTSPVASEQSRQDCEAICKLGLKAKILT
                     HIRCHMDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGI
                     EIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLRSVVS
                     CDIECHFHNDTGCAIANAYTALEGGARLIDTCVLGIGERNGIVPLGGLMARMIVASPD
                     YVKSKYKLHKLRDLENLVAESVEVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEI
                     LDPHDFGMKRYIHFANRLTGWNAIKSRVDQLNLNLTDDQCKEVTTKIKKLGDVRPLNI
                     DDVDSIIKDFHAEIATPKIAAMKRDPQDLELEDSQLKKPKN"
     gene            <261751..>262005
                     /gene="TDEL0H01500"
                     /locus_tag="TDEL_0H01500"
                     /db_xref="GeneID:11501094"
     mRNA            <261751..>262005
                     /gene="TDEL0H01500"
                     /locus_tag="TDEL_0H01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683172.1"
                     /db_xref="GeneID:11501094"
     CDS             261751..262005
                     /gene="TDEL0H01500"
                     /locus_tag="TDEL_0H01500"
                     /inference="similar to DNA
                     sequence:INSDC:YDL181W,YDL130W-A"
                     /note="similar to Saccharomyces cerevisiae INH1 (YDL181W)
                     and STF1 (YDL130W-A); ancestral locus Anc_7.294"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683220.1"
                     /db_xref="GeneID:11501094"
                     /db_xref="GOA:G8ZZG5"
                     /db_xref="InterPro:IPR007648"
                     /db_xref="UniProtKB/TrEMBL:G8ZZG5"
                     /translation="MFVARPSVVRSLRLQKAIRCYTDSNGPIGSGGTDNSFTKREKAN
                     EDYFVRQHEKEQLQRLRQQLKEHQDKVDTIKNKIESLSKK"
     gene            <262313..>262633
                     /gene="TDEL0H01510"
                     /locus_tag="TDEL_0H01510"
                     /db_xref="GeneID:11501095"
     mRNA            <262313..>262633
                     /gene="TDEL0H01510"
                     /locus_tag="TDEL_0H01510"
                     /product="60S acidic ribosomal protein P1"
                     /transcript_id="XM_003683173.1"
                     /db_xref="GeneID:11501095"
     CDS             262313..262633
                     /gene="TDEL0H01510"
                     /locus_tag="TDEL_0H01510"
                     /inference="similar to DNA sequence:INSDC:YDL130W"
                     /note="similar to Saccharomyces cerevisiae RPP1B
                     (YDL130W); ancestral locus Anc_7.293"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P1"
                     /protein_id="XP_003683221.1"
                     /db_xref="GeneID:11501095"
                     /db_xref="GOA:G8ZZG6"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR001859"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:G8ZZG6"
                     /translation="MSDAIISYAAFILADAGLEVSAENLQNITKAAGAKIDSVWAEVF
                     AQALEGKDLKQILSGFHNAGPATGSAAAASGSGAGAEAAAAEEPAEEEKEESDDDMGF
                     GLFD"
     gene            <262751..>263179
                     /gene="TDEL0H01520"
                     /locus_tag="TDEL_0H01520"
                     /db_xref="GeneID:11501096"
     mRNA            <262751..>263179
                     /gene="TDEL0H01520"
                     /locus_tag="TDEL_0H01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683174.1"
                     /db_xref="GeneID:11501096"
     CDS             262751..263179
                     /gene="TDEL0H01520"
                     /locus_tag="TDEL_0H01520"
                     /inference="similar to DNA sequence:INSDC:YDL129W"
                     /note="similar to Saccharomyces cerevisiae YDL129W;
                     ancestral locus Anc_7.292"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683222.1"
                     /db_xref="GeneID:11501096"
                     /db_xref="UniProtKB/TrEMBL:G8ZZG7"
                     /translation="MDRKRLLVTPEEPRELLPSVRDTRELEEEILECVKALQRREHVE
                     SECIVSLLNRSLTAMAHWSLQAQLSQLSQTTDREVVETKLLRKENELLRKRDTPLRTP
                     PSPRVKKRLVENKKPHPRMRRTGDNPSKNSYVRVFHLQQD"
     gene            <263280..>264653
                     /gene="TDEL0H01530"
                     /locus_tag="TDEL_0H01530"
                     /db_xref="GeneID:11501097"
     mRNA            <263280..>264653
                     /gene="TDEL0H01530"
                     /locus_tag="TDEL_0H01530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683175.1"
                     /db_xref="GeneID:11501097"
     CDS             263280..264653
                     /gene="TDEL0H01530"
                     /locus_tag="TDEL_0H01530"
                     /inference="similar to DNA sequence:INSDC:YDL180W"
                     /note="similar to Saccharomyces cerevisiae YDL180W;
                     ancestral locus Anc_7.291"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683223.1"
                     /db_xref="GeneID:11501097"
                     /db_xref="UniProtKB/TrEMBL:G8ZZG8"
                     /translation="MVRISHAASYFMPLFCSSQPYVVLVACITTTGIFVAFYMSSYLL
                     AKQYDDPGLFKPVAQDYFRTSLLGVFSPILYYFVKTFLFNVNRRYLILNLLIDFPLND
                     WFILFIIVCLAYPQQEQTSPGESYNLWHIIPRQSYIFGLAWALGEFIICVTGNLFNYQ
                     ELDTNPGEPLQPDSDVRDNITLAKCVGLRSISSTISQNVYCADYGSIRKPVDDTVVID
                     PTDNSMRMTSADDDEEQLKDANDWRATDAQLISRTFAPIKTKKELFIEVSLLFLVLTS
                     NILLTIGESLIFCIFFIYMPHHEELFTKVVNYFGNKSLRFFLFTVLIPFTTANLLVNT
                     MIYLWNDIDEWFNHSPETSPNPVADDYTNFYESDLSLQRSANSFAEENQPTLMLMSSP
                     SELHYYNNNTGSENYDTDSLKILVIAKDVINAWRSAARKDSFVLSIMFIWGVTVFLTG
                     LISTVLG"
     gene            <264818..>266035
                     /gene="TDEL0H01540"
                     /locus_tag="TDEL_0H01540"
                     /db_xref="GeneID:11501098"
     mRNA            <264818..>266035
                     /gene="TDEL0H01540"
                     /locus_tag="TDEL_0H01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683176.1"
                     /db_xref="GeneID:11501098"
     CDS             264818..266035
                     /gene="TDEL0H01540"
                     /locus_tag="TDEL_0H01540"
                     /inference="similar to DNA sequence:INSDC:YDL128W"
                     /note="similar to Saccharomyces cerevisiae VCX1 (YDL128W);
                     ancestral locus Anc_7.290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683224.1"
                     /db_xref="GeneID:11501098"
                     /db_xref="GOA:G8ZZG9"
                     /db_xref="InterPro:IPR004713"
                     /db_xref="InterPro:IPR004798"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="UniProtKB/TrEMBL:G8ZZG9"
                     /translation="MDASQPLLSTNVSRHSRLQKLSVYESVKLDCESMLLSSPVNVLL
                     VFVPLGLIWGYAGWSHTWVFTFNFLAIVPLAAILANATEELADKAGSTIGGLLNATFG
                     NAVELIVSVIALREGQVRIVQASMLGSLLSNLLLVLGFCFVFGGYNRVQQTFNQTAAQ
                     TMSSLLAISCASLLIPAAFRATIPHSKKDIIVDDKILALSRGTAIILLIVYVLFLIFQ
                     LGSHHSLFEQQEQETDEVISQISQKPKHSLSIKSALTFLLISTVIVSICADFLVGTID
                     NIVESTGLSKTFIGLIIIPIVGNAAEHVTSVMVAMKNKMDLALGVAIGSSLQIALFVT
                     PFMVLVGWAIGVPMSLNFSTFETATLFISIFLSNYLILDGESNWLEGCMSIAMYLLIA
                     IAFYYYPDEQALV"
     gene            <266510..>267439
                     /gene="TDEL0H01550"
                     /locus_tag="TDEL_0H01550"
                     /db_xref="GeneID:11501099"
     mRNA            <266510..>267439
                     /gene="TDEL0H01550"
                     /locus_tag="TDEL_0H01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683177.1"
                     /db_xref="GeneID:11501099"
     CDS             266510..267439
                     /gene="TDEL0H01550"
                     /locus_tag="TDEL_0H01550"
                     /inference="similar to DNA sequence:INSDC:YDL179W,YDL127W"
                     /note="similar to Saccharomyces cerevisiae PCL9 (YDL179W)
                     and PCL2 (YDL127W); ancestral locus Anc_7.289"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683225.1"
                     /db_xref="GeneID:11501099"
                     /db_xref="GOA:G8ZZH0"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR012104"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:G8ZZH0"
                     /translation="MSDYEALLQFNKRAVSAEMIQYLASSTACIIQVKNSNNLVDVGL
                     PAPSLTNFIKGLVLHSNVQTPTLMATAVYLAKLRSIIPGNVYGIETTRHRIFLGCLIL
                     AAKTLNDSSPLNKHWALYTDGLLHIHEVNTIERELLEYFDWNVTVTTKDLITCLAPFL
                     QPIKEQFIRQKQQNYLLFNAPMQGNLREYITSTSTSGTDSHARSSSNLSIPSLASTAT
                     LSTLGSRRSRLAYNRIGSIDEMDERSPQATRRYSPYRSPLSDVENVTYVSPVIKKGTH
                     ASGGTRPVILDKSMKPSPQNFTTKRSRWHSIFT"
     gene            complement(<267940..>270456)
                     /gene="TDEL0H01560"
                     /locus_tag="TDEL_0H01560"
                     /db_xref="GeneID:11501100"
     mRNA            complement(<267940..>270456)
                     /gene="TDEL0H01560"
                     /locus_tag="TDEL_0H01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683178.1"
                     /db_xref="GeneID:11501100"
     CDS             complement(267940..270456)
                     /gene="TDEL0H01560"
                     /locus_tag="TDEL_0H01560"
                     /inference="similar to DNA sequence:INSDC:YDL126C"
                     /note="similar to Saccharomyces cerevisiae CDC48
                     (YDL126C); ancestral locus Anc_7.288"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683226.1"
                     /db_xref="GeneID:11501100"
                     /db_xref="GOA:G8ZZH1"
                     /db_xref="InterPro:IPR003338"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR004201"
                     /db_xref="InterPro:IPR005938"
                     /db_xref="InterPro:IPR009010"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029067"
                     /db_xref="UniProtKB/TrEMBL:G8ZZH1"
                     /translation="MKEEHKPLLDASGADQAKEDATATAILRRKKKDNMLLVDDAIND
                     DNSVIAINSNTMDKLELFRGDTVLVKGKKRRDTALIVLIDDELDDGACRVNRVVRNNL
                     RIRLGDLVTIHPCPDIKYASRISVLPIADTIEGLTGNLFDVFLKPYFVEAYRPVRKGD
                     HFVVRGGMRQVEFKVVDVEPDEYAVVAQDTIIHWEGEPINREDEENNMNDVGYDDIGG
                     CRKQMAQIRELVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVANETGAFF
                     FLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEIDSIAPKRDKTNGEVERRV
                     VSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEVLR
                     IHTKNMKLAEDVDLESLASETHGYVGADIASLCSEAAMQQIREKMDLIDLDEDEIDAE
                     ILDSLGVTMDNFRFALGNSNPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVL
                     HPDQYTKFGLAPSKGVLFYGPPGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESE
                     SNIRDIFDKARAAAPTVVFLDELDSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAK
                     KNVFVIGATNRPDQIDPAILRPGRLDQLIYVPLPDEMARLSIMKAQLRKAPLEPGLDL
                     NAISKATQGFSGADLSYIVQRAAKFAIKDSIEAQRQLEAKKAVKNEEDVEMDGETKQD
                     SKEEEQEEDLVPYITKEHFAEAMKTAKRSVSDAELRRYEAYSQQMKASRGQFSNFSFN
                     DAALGVNGAANGPGAGNSGAPSGAGAAFGGDAEEDDDLYS"
     gene            complement(<270746..>271192)
                     /gene="TDEL0H01570"
                     /locus_tag="TDEL_0H01570"
                     /db_xref="GeneID:11501101"
     mRNA            complement(<270746..>271192)
                     /gene="TDEL0H01570"
                     /locus_tag="TDEL_0H01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683179.1"
                     /db_xref="GeneID:11501101"
     CDS             complement(270746..271192)
                     /gene="TDEL0H01570"
                     /locus_tag="TDEL_0H01570"
                     /inference="similar to DNA sequence:INSDC:YDL125C"
                     /note="similar to Saccharomyces cerevisiae HNT1 (YDL125C);
                     ancestral locus Anc_7.287"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683227.1"
                     /db_xref="GeneID:11501101"
                     /db_xref="GOA:G8ZZH2"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019808"
                     /db_xref="UniProtKB/TrEMBL:G8ZZH2"
                     /translation="MSIKQDAACIFCKIIKGEIPSFKLIETAHAFSFLDIQPTSEGHA
                     LIIPKYHGGKLHSVPDEFLADVLPIAKKLAKALELDTDGIDSPVGYNLLQNNGKIAHQ
                     VVDHVHFHLIPKRDEKTGLIVGWPAQETDFEKLGQLHKKLLAKLEN"
     gene            <271672..>273279
                     /gene="TDEL0H01580"
                     /locus_tag="TDEL_0H01580"
                     /db_xref="GeneID:11501102"
     mRNA            <271672..>273279
                     /gene="TDEL0H01580"
                     /locus_tag="TDEL_0H01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683180.1"
                     /db_xref="GeneID:11501102"
     CDS             271672..273279
                     /gene="TDEL0H01580"
                     /locus_tag="TDEL_0H01580"
                     /inference="similar to DNA sequence:INSDC:YDL178W"
                     /note="similar to Saccharomyces cerevisiae DLD2 (YDL178W);
                     ancestral locus Anc_7.286"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683228.1"
                     /db_xref="GeneID:11501102"
                     /db_xref="GOA:G8ZZH3"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="UniProtKB/TrEMBL:G8ZZH3"
                     /translation="MIRSTVTRQLVRTVALRQCRYAPVVLRTACVSPNVHNHRFYATK
                     IQPKLTSENYPSVKRNPNYKQLSSEDLNFFKSILTENEILQASESEDLAFYNEDWMRK
                     YKGQSKIVLKPKSVEKIAKIVKYCNEQKLAVVPQGGNTGLVGGSVPVFDEIILSVANL
                     NQIRHFDPVSGILKCDAGVILENADNFLAEHGYIFPLDLGAKGSCHVGGVVATNAGGL
                     RLLRYGSLHGSVLGLEVVMPNGDIVNSMDALRKDNTGYDLKQLFIGSEGTIGIITGVS
                     IMTPTRPKAFNVSFLAVESYEAVQQVFVKAKKDLSEILSAFEFMDSNSQELTKQHLPD
                     SPHPFEDKYPFYVLIETSGANKEHDDAKLEAFLESAMEEELVVDGVVAQDETELKNLW
                     QWREMIPESSQAGGGVYKYDVSLPLKDLYSLVEAANTKLAEAGLVGEAPKPVIQAIGY
                     GHVGDGNLHLNVAVREYSKDVEKALEPFVYEFVSSKHGSISAEHGLGFQKKNYIGYSK
                     NAEEVKLIKDLRTHYDPNAILNPYKYV"
     gene            complement(<273298..>273663)
                     /gene="TDEL0H01590"
                     /locus_tag="TDEL_0H01590"
                     /db_xref="GeneID:11501103"
     mRNA            complement(<273298..>273663)
                     /gene="TDEL0H01590"
                     /locus_tag="TDEL_0H01590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683181.1"
                     /db_xref="GeneID:11501103"
     CDS             complement(273298..273663)
                     /gene="TDEL0H01590"
                     /locus_tag="TDEL_0H01590"
                     /inference="similar to DNA sequence:INSDC:YDL177C"
                     /note="similar to Saccharomyces cerevisiae YDL177C;
                     ancestral locus Anc_7.284"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683229.1"
                     /db_xref="GeneID:11501103"
                     /db_xref="InterPro:IPR001498"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020569"
                     /db_xref="InterPro:IPR023582"
                     /db_xref="UniProtKB/TrEMBL:G8ZZH4"
                     /translation="MNESELLVDRKSKFQGRCCTLTNRTKIDEILQNLLENDKRVRKA
                     SHPHMYAWRIGATEQGSSDNGENGAGQRLLTLLHQANVVNVLVIVTRWYGGIPLGSSR
                     FRHISSTAVASLKKGGFLP"
     gene            complement(<273692..>275506)
                     /gene="TDEL0H01600"
                     /locus_tag="TDEL_0H01600"
                     /db_xref="GeneID:11501104"
     mRNA            complement(<273692..>275506)
                     /gene="TDEL0H01600"
                     /locus_tag="TDEL_0H01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683182.1"
                     /db_xref="GeneID:11501104"
     CDS             complement(273692..275506)
                     /gene="TDEL0H01600"
                     /locus_tag="TDEL_0H01600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683230.1"
                     /db_xref="GeneID:11501104"
                     /db_xref="GOA:G8ZZH5"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8ZZH5"
                     /translation="MIDPELLKKDHVEEDDDKSSSLSQTNEPPLSNGVRRMDAVNATL
                     SRAGSFTAFGVRFQTLKIALLIALFLQGYCTGLGGQISQSIQTYAANAFKKQPQIGSI
                     NTVKSVVAAAVAVPYARLSDRFGRIECWIFALVLYTVGDIISAATPTFGGLFAGVVIQ
                     QFGYSGFRLLATALTADISGLRDRTFAMNIFLIPVIINTWVSGNIVDSLAGVKVPYEW
                     RWGYGIFCIIVPFSTLLLILPYAYAQYLAWREGRLPQFEFRKQGQSWKQALWKLTEDV
                     NLIGIVLFTAFLVLVLLPLTLAGGASTKWKEGHIIAMIVVGGCCGILFFVWELWLAKK
                     PFIPRVYLGDATIYVALLMEFAWRLALQIELEYLITVLMVAFGESKLSAQRIGQLYNF
                     LQSCTNVVVGIMLHFYPHPKPFIVAGSLLGVLGMGLLYKYRVAYDGISGLIGAEVVVG
                     IAGSMVRFPMWTLVHASTSHEEMAVATGLLMSVYQIGNAVGASIAGAIWTQRLAKELI
                     KRLGSKVGLAVYNSPLSYLTKYPLGSEVRNEILESYSEIQRLLIIVSISFAALNAVLC
                     FFLPGYTVSEKQSFTQEEREKKKLEMKQQWPLRRLIGY"
     gene            <277887..>279956
                     /gene="TDEL0H01610"
                     /locus_tag="TDEL_0H01610"
                     /db_xref="GeneID:11501105"
     mRNA            <277887..>279956
                     /gene="TDEL0H01610"
                     /locus_tag="TDEL_0H01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683183.1"
                     /db_xref="GeneID:11501105"
     CDS             277887..279956
                     /gene="TDEL0H01610"
                     /locus_tag="TDEL_0H01610"
                     /inference="similar to DNA sequence:INSDC:YDL176W"
                     /note="similar to Saccharomyces cerevisiae YDL176W;
                     ancestral locus Anc_7.283"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683231.1"
                     /db_xref="GeneID:11501105"
                     /db_xref="UniProtKB/TrEMBL:G8ZZH6"
                     /translation="MILRKSRGIYVKKISFAVSTPCNAKGKPSGYRLVEYSDKGLSIL
                     PHEKDDLRSDIDINVQAFCYLKPRDRTIVPSYVNESLMDSSDYMVVAKSSGFVEIIQD
                     FNYKSQNGLTLSPDYVLKCTPEGFPELRCDSMVAGLQYLEGLLYCCMCSGKIYVYVLN
                     LPHDYVQAESSIVTGQHPELFYRNRNPDSSLGRDSRSLEEATFYLNMRFTGRSRLKHI
                     CYYLLPMEPDHVSTSPSVFVFGQSYKDSFIYKPSIYVELDQGLTVFRLNPLDRLSFFT
                     VSPRSALMIRKIMLPMVYVDFFVSFVSKKKIYQEMKPEEIVSWDKVAQSMGYECLTTW
                     IQQDPLHELENTGSFAWEELARYAGISTLRTIIVWIQRQGHDKDDISKLFRRDDVPNG
                     REGGPSSTSESSLPRRLRADMVFRRYDLREPVDLPCSGNWRLDSFVRGIRKNTFTVDF
                     KVVQSFSYLAQDDVQLEAVGDERTRTSFLTDSYRHMDIVCIDRYLSLSVFRPRYDDVA
                     LIKIDTFQGDLPHKLPFTNETMALRSVLSNFSSFKKLFMLTDAHCMVLDTHGVLLIDR
                     LAFADTKNTEVPTHAIKVAPFDIGLISDAILVVTRLDISPCDAEVVYQLIITCIPGQI
                     LALEGTFSHNSNIGKLVCSDSLRLKRKDRFVDQICLINYESQGAERKRISGEVDYPII
                     TKRSRWE"
     gene            complement(<280044..>280442)
                     /gene="TDEL0H01620"
                     /locus_tag="TDEL_0H01620"
                     /db_xref="GeneID:11501106"
     mRNA            complement(<280044..>280442)
                     /gene="TDEL0H01620"
                     /locus_tag="TDEL_0H01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683184.1"
                     /db_xref="GeneID:11501106"
     CDS             complement(280044..280442)
                     /gene="TDEL0H01620"
                     /locus_tag="TDEL_0H01620"
                     /inference="similar to DNA sequence:INSDC:YDL123W"
                     /note="similar to Saccharomyces cerevisiae SNA4 (YDL123W);
                     ancestral locus Anc_7.282"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683232.1"
                     /db_xref="GeneID:11501106"
                     /db_xref="GOA:G8ZZH7"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="UniProtKB/TrEMBL:G8ZZH7"
                     /translation="MCCCTVSDIILYVIAFFIPPVAVLLRAGFCSSDFLLNVLLTLLG
                     VVPGMLHAFYFIAVTSPLRRDAEYAYFYQQGWVDHERQAPRRAENQQPSVQNVPDTQT
                     PLLQGQPVSHVPHTGGKMEPSAPPPYAELP"
     gene            complement(<280704..>281774)
                     /gene="TDEL0H01630"
                     /locus_tag="TDEL_0H01630"
                     /db_xref="GeneID:11501107"
     mRNA            complement(<280704..>281774)
                     /gene="TDEL0H01630"
                     /locus_tag="TDEL_0H01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683185.1"
                     /db_xref="GeneID:11501107"
     CDS             complement(280704..281774)
                     /gene="TDEL0H01630"
                     /locus_tag="TDEL_0H01630"
                     /inference="similar to DNA sequence:INSDC:YIL079C,YDL175C"
                     /note="similar to Saccharomyces cerevisiae AIR1 (YIL079C)
                     and AIR2 (YDL175C); ancestral locus Anc_7.281"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683233.1"
                     /db_xref="GeneID:11501107"
                     /db_xref="GOA:G8ZZH8"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR016713"
                     /db_xref="UniProtKB/TrEMBL:G8ZZH8"
                     /translation="MSSMLSEVETMDTLPFVKDTTPSREKSQDNKIPAPSIEEVDTNP
                     EGLRALRGQGRYFGVGADEDGGIREAEPKCNNCSQRGHFKRNCPHVICTYCGSMDDHY
                     SQHCPKAITCSNCNDGGHYRSQCPQKWKRVFCTLCNSKKHSRDRCPSIWRVYLLKDDS
                     KNLKEKVLPMHKLYCYNCGGKGHFGDDCTGRRSSRVPNDDGSAFSGDNLSTNLKKQYQ
                     KNLKKQRREEYSSSRYDDFDYNDYEFDDALYDDPQVSSKSKSKKRKRSNLNTPPYQSN
                     KRGKVVQPVQRGNTLPPARDRTHPLDFPRSNQNSSYSSSNMEHSRYGRASSNRNSNQS
                     SNQGNYKNYNSYKPFRSGTLKR"
     gene            <282205..>284400
                     /gene="TDEL0H01640"
                     /locus_tag="TDEL_0H01640"
                     /db_xref="GeneID:11501108"
     mRNA            <282205..>284400
                     /gene="TDEL0H01640"
                     /locus_tag="TDEL_0H01640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683186.1"
                     /db_xref="GeneID:11501108"
     CDS             282205..284400
                     /gene="TDEL0H01640"
                     /locus_tag="TDEL_0H01640"
                     /inference="similar to DNA sequence:INSDC:YIL078W"
                     /note="similar to Saccharomyces cerevisiae THS1 (YIL078W);
                     ancestral locus Anc_7.280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683234.1"
                     /db_xref="GeneID:11501108"
                     /db_xref="GOA:G8ZZH9"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002320"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="UniProtKB/TrEMBL:G8ZZH9"
                     /translation="MSSEEATGQVKNLSLKDNKGEAKAAKPNKKSKQQSLYLEPQPGF
                     IDDRIQLFEDLKKKYDEKVASMPRVPLKIVLKDGSVKEGTAWETTPMDIAKEIAKSLP
                     DRLCIAKVNNQLWDLDRPFEGEEGEEIKVQLLDFESEEGKKVFWHSSAHVLGEACECN
                     LGAHICLGPPTDDGFFYEFAVRDSMKPVEGEERTVSQNDFPALEGVAKNVIKQKQKFE
                     RLVMSKEDLLKMFHYSKYKTYLVNTKIPDGGSTTVYRCGSLIDLCTGPHIPNTGRIKA
                     FKLLKNSSCYFLGESDNDSLQRVYGIAFPDKKLMDAHLKFLAEASMRDHRKIGKEQEL
                     FLFHEMSPGSCFWLPHGTRIYNKLVDLMRGEYNKRGYEEVITPNMYNSKLWETSGHWG
                     NYKDNMFTFEVEKDTFGLKPMNCPGHCLMFKSRERSYRELPWRVADFGVIHRNEFSGA
                     LSGLTRVRRFQQDDAHIFCTQDQIGQEIEDIFDFLKFVYGVFGFEFKMELSTRPEKFV
                     GEIETWNKAESTLEAALRNWGGDWELNPGDGAFYGPKIDIKISDALRRWHQCATIQLD
                     FQLPSRFELEFKAKDNEVGGENYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSP
                     RQVLLVPVGVKYQQYAQEVRDKLHNAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVG
                     EQEMNENSVNIRNRDVMEQQGKNATVEVNVVLDQLKKLAEEKRADNMLS"
     gene            complement(<284498..>285433)
                     /gene="TDEL0H01650"
                     /locus_tag="TDEL_0H01650"
                     /db_xref="GeneID:11501109"
     mRNA            complement(<284498..>285433)
                     /gene="TDEL0H01650"
                     /locus_tag="TDEL_0H01650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683187.1"
                     /db_xref="GeneID:11501109"
     CDS             complement(284498..285433)
                     /gene="TDEL0H01650"
                     /locus_tag="TDEL_0H01650"
                     /inference="similar to DNA sequence:INSDC:YIL077C"
                     /note="similar to Saccharomyces cerevisiae YIL077C;
                     ancestral locus Anc_7.279"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683235.1"
                     /db_xref="GeneID:11501109"
                     /db_xref="InterPro:IPR012470"
                     /db_xref="UniProtKB/TrEMBL:G8ZZI0"
                     /translation="MSDNSSPKESAAMMKQPWFREAYKAAMEFYKIDDQLDSRDRLEL
                     SKAYQSITRAEFLGGWVGFSGVFLTPFAYRFYKTNAIKGVKVPRNFMLGLLVMFGSSQ
                     LAGNYMFSRQLSNLDPDGTLANRNSYDDEGSSPEHKTNAQRQYEMMRLLNNGSAARWA
                     AYFHMTHQDPGRRLPNPEEKLKALKQGLNVQNSSFMNQRDPMGLYSGPAFDKKEGIPD
                     YKRKTSTDDTNGETTNASDLTNSWETIRREGNAPGSSWDRVRQNNGANDNGTQSPTEY
                     QHDEEDDPFDTVVQPSQSDFDQLLEKERNGEDTYQ"
     gene            <285603..>286490
                     /gene="TDEL0H01660"
                     /locus_tag="TDEL_0H01660"
                     /db_xref="GeneID:11501110"
     mRNA            <285603..>286490
                     /gene="TDEL0H01660"
                     /locus_tag="TDEL_0H01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683188.1"
                     /db_xref="GeneID:11501110"
     CDS             285603..286490
                     /gene="TDEL0H01660"
                     /locus_tag="TDEL_0H01660"
                     /inference="similar to DNA sequence:INSDC:YIL076W"
                     /note="similar to Saccharomyces cerevisiae SEC28
                     (YIL076W); ancestral locus Anc_7.278"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683236.1"
                     /db_xref="GeneID:11501110"
                     /db_xref="GOA:G8ZZI1"
                     /db_xref="InterPro:IPR006822"
                     /db_xref="UniProtKB/TrEMBL:G8ZZI1"
                     /translation="MNYFTVKQSYYTGDYKQTLQEVAKFNKVSDDQLTFYKNSASLAL
                     GQLASTGGSSPLERAFETYANFLQSRDITQLQESISKEASSPFELHVLASAEAVLGNF
                     EDSLQTCVAGIDNDEQLGTPELLLLAVEVALLNGQASIASTMLDNYISANEDHISSED
                     ELILNQAESYVKYATNKETTRSNFYYFEELAQTFPTWKTQLGLLNLHLQQGNIPEAEA
                     VVDLLQSEYYTEGQKEVAKLYRPQFLASKITLSIARKDGKADELRAELAQLAPESSYQ
                     KLHNEANAKFDEVVGKHSL"
     gene            <286654..>287586
                     /gene="TDEL0H01670"
                     /locus_tag="TDEL_0H01670"
                     /db_xref="GeneID:11501111"
     mRNA            <286654..>287586
                     /gene="TDEL0H01670"
                     /locus_tag="TDEL_0H01670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683189.1"
                     /db_xref="GeneID:11501111"
     CDS             286654..287586
                     /gene="TDEL0H01670"
                     /locus_tag="TDEL_0H01670"
                     /inference="similar to DNA sequence:INSDC:YER083C"
                     /note="similar to Saccharomyces cerevisiae GET2 (YER083C);
                     ancestral locus Anc_7.277"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683237.1"
                     /db_xref="GeneID:11501111"
                     /db_xref="GOA:G8ZZI2"
                     /db_xref="InterPro:IPR014802"
                     /db_xref="InterPro:IPR028143"
                     /db_xref="UniProtKB/TrEMBL:G8ZZI2"
                     /translation="MSELSDAEKRRLLRERRQQKFNNGGATSRLNKITGQVPDSQLDN
                     TSPLDSRPAPRAAASVSGTPTPPVSKGSAVGNEASTLEMDELIASISKPASPAVLPKK
                     TKSPAAPEKSSSGSEANDPQFDLFKNLMNAQQPQDGSTPDLLSLFGSMNGEGANDLPN
                     PFASEPVDQKMLDYHNYAVNLLKSWSILLKWLVLFPYIYLITRSSAEISLPLPRWMIE
                     PSNFFSVFIAFEIIATSVYYQRLQSIEKNNKVNTLQNSSKIARLVSFIPAQGLPIPNL
                     RGKILMALQYWDVLSMLITDICFVLIAMGLCSYL"
     gene            complement(<287640..>288959)
                     /gene="TDEL0H01680"
                     /locus_tag="TDEL_0H01680"
                     /db_xref="GeneID:11501112"
     mRNA            complement(<287640..>288959)
                     /gene="TDEL0H01680"
                     /locus_tag="TDEL_0H01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683190.1"
                     /db_xref="GeneID:11501112"
     CDS             complement(287640..288959)
                     /gene="TDEL0H01680"
                     /locus_tag="TDEL_0H01680"
                     /note="ancestral locus Anc_7.276"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683238.1"
                     /db_xref="GeneID:11501112"
                     /db_xref="GOA:G8ZZI3"
                     /db_xref="InterPro:IPR001295"
                     /db_xref="InterPro:IPR005719"
                     /db_xref="InterPro:IPR012135"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G8ZZI3"
                     /translation="MFARNGFQLATKRFIFKGSPRRQTLKSNAAPRALLYATGLLGAS
                     AACFFLMDSRSAVHQYMFCPLIRLLTPDAEDGHKVGIWLMKWGLAPRLFFDKDPESLH
                     VNVFGKTLTNPIACAAGLDKDGVAVDAILATGFGYAEVGSVTPEAQPGNPKPRFFRLP
                     QDDAVINRYGFNSSGHNAVYENLAERVLKFVRSYASDKETIQNLSLNKGKLLAINLGK
                     NKNGDTVKDYLKGVERFQSLADVLVINVSSPNTPGLRKLQDSSTLTNLLTQVVAKRDS
                     LVNNGNALGQSAHKPPILVKVAPDLTKTELQSIVDSAKKSKVDGIIVCNTTIQRPKCL
                     ITQEKSTKDQVGGLSGKPLKPIALDALRTVAKYSKDSDLVLIGCGGISNGKDAIEFAK
                     AGATFVQLYTAFAYAGPGLVAKIKDEVAEELKKEGKTWTEIIGQDNK"
     gene            <289748..>291382
                     /gene="TDEL0H01690"
                     /locus_tag="TDEL_0H01690"
                     /db_xref="GeneID:11501113"
     mRNA            <289748..>291382
                     /gene="TDEL0H01690"
                     /locus_tag="TDEL_0H01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683191.1"
                     /db_xref="GeneID:11501113"
     CDS             289748..291382
                     /gene="TDEL0H01690"
                     /locus_tag="TDEL_0H01690"
                     /inference="similar to DNA sequence:INSDC:YER082C"
                     /note="similar to Saccharomyces cerevisiae UTP7 (YER082C);
                     ancestral locus Anc_7.275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683239.1"
                     /db_xref="GeneID:11501113"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012952"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8ZZI4"
                     /translation="MPPNRKVKDNQGKYERSTGGNVNKPKKQTRDKKLRAGMKKIDDQ
                     YKEAVSAAAATQYLLPESAGYLEAEDEMEKTFKVKQDEIKEGVDVGTANKALDLSLKE
                     FGPYHINYSRNGTSLLIAGRKGHIASMDWRKGDLRAELNVNETCHGATYLQNDQFFAV
                     AQKKYTFIYDHEGVELHRLKQHIEARHLQFLPYHYLLATAGETGWLKYQDVSTGQLVS
                     ELRTKLGPTTAMTQNPWNAIMHLGHSNGTVTLWSPSMPQPLVKLLSARGPITSVAIDR
                     AGYNMVTTGADKSMKIWDIRNFKELHVANLPTPASNISISDTGLVAVSRGPHVTIWNN
                     ALKAGFENRPFFGSMGQNNRNTPYMSHLIPGNKINNMQFVPFEDLLGTGHNDGVTNLI
                     IPGAGEANYDALEINPFETTKQRQEQEVRTLLNKLPADTITLDPNVIGTIEKNASSRR
                     LTAKDLAEISNASLDKAKFNKDIPKIQPDVKGKNSGLRSFLRKKTRNVIDERKVRVQR
                     QMEKEKNTRKRNHQIKEGHITEDHKDLVDEALERFS"
     gene            complement(<291489..>294305)
                     /gene="TDEL0H01700"
                     /locus_tag="TDEL_0H01700"
                     /db_xref="GeneID:11501114"
     mRNA            complement(<291489..>294305)
                     /gene="TDEL0H01700"
                     /locus_tag="TDEL_0H01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683192.1"
                     /db_xref="GeneID:11501114"
     CDS             complement(291489..294305)
                     /gene="TDEL0H01700"
                     /locus_tag="TDEL_0H01700"
                     /inference="similar to DNA sequence:INSDC:YIL075C"
                     /note="similar to Saccharomyces cerevisiae RPN2 (YIL075C);
                     ancestral locus Anc_7.274"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683240.1"
                     /db_xref="GeneID:11501114"
                     /db_xref="GOA:G8ZZI5"
                     /db_xref="InterPro:IPR002015"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016642"
                     /db_xref="UniProtKB/TrEMBL:G8ZZI5"
                     /translation="MSSTTAAPLLALLKEKDDSVKSYALKSINDVVDELWSEISNGIT
                     EIEALYDDGNFSDRQMAALIASKVYYNLGEYESAVKFALAAGDCFDIDEKSQYVETIV
                     SQSIEMYIKSSKEEFESKDSKFEGDEKLKAIFERMISKCVAAGEYKLALGIALEAFRL
                     DLVNDILKSRLKEDTEANGLKLINYVLTATTTIVANRKFKESMLRSLFEILNSMKSAD
                     YFTVSKVVVNLNEAALAIKLFEKLHSTEDIEVSYQIALDMVSSGSQELLDTLLRDLTE
                     KGYDSRLLDILSGLPTCDYYNTFLFNNKNIDIGLLNKSKSSLDGKFSLFHTAVSVANG
                     FMHAGTTDNTFIRTNLTWLGKAQNWAKFTATASLGVIHRGNLADGKKVMAPYLPGSRS
                     TSRYIRGGSLYALGLIYAGFGRDIIDYLKVHIVENSAATGDEDIDVLLHGASLGIGLA
                     AMGSASTDVYESLKEVLYNDSAVSGEAAAMGMGLTMLGTGNESAIRDMLTYAQETQHG
                     NITRGLAVGLSLVSYGRQETADGLISSMLDSEEALLRYGGAFTIALAYAGTGNNKAVK
                     KLLHIAVSDSNDDVRRAAVIALGFVLLRDYTTVPRIVELLSKSHNAHVRCGTAFALGI
                     ACAGRVLPSAIDVLEPLTKDPVDFVRQAAMIALSMILIQQTDKLNSKVAEVNQNFLNV
                     ITNKHQEGLAKFGACIAQGIMNAGGRNVTIHLENAEMGTLDARAVVGLAMFSQFWYWF
                     PLAHFLSLSFTPTTVIGVRGSDLNIPKFELNCHAKQDIFGYPKMYEEAADKEVEKVAT
                     AVLSTTARAKARAKKTKKEKDAGEGEKVKIAEGKATSTKEQEGTKEKDEEVSKVKYSS
                     KPYKIENMSRVLPQQARYISFNKDDRFVPIRKYKGGNDVIILTDKKPEEPVSLIETVR
                     QSKDVNAPLPTPFKVEDNLDYPDI"
     gene            complement(<294674..>296083)
                     /gene="TDEL0H01710"
                     /locus_tag="TDEL_0H01710"
                     /db_xref="GeneID:11501115"
     mRNA            complement(<294674..>296083)
                     /gene="TDEL0H01710"
                     /locus_tag="TDEL_0H01710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683193.1"
                     /db_xref="GeneID:11501115"
     CDS             complement(294674..296083)
                     /gene="TDEL0H01710"
                     /locus_tag="TDEL_0H01710"
                     /inference="similar to DNA sequence:INSDC:YER081W,YIL074C"
                     /note="similar to Saccharomyces cerevisiae SER3 (YER081W)
                     and SER33 (YIL074C); ancestral locus Anc_7.273"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683241.1"
                     /db_xref="GeneID:11501115"
                     /db_xref="GOA:G8ZZI6"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029015"
                     /db_xref="InterPro:IPR029752"
                     /db_xref="InterPro:IPR029753"
                     /db_xref="UniProtKB/TrEMBL:G8ZZI6"
                     /translation="MSALDINNLQNTFQNAINLSGSAGAVSTSPTQSFMDTLPRRMST
                     SKHAKVLKPFSTGDMKILLLENVNETAVSIFKEQGYQVEFNKSSLPEDELIKKIEDVH
                     AIGIRSKTKLTSNVLKHAKNLVVIGCFCIGTNQVDLEYATTHGIAVFNSPFSNSRSVA
                     ELVIAEIISLARQLGDRSIELHTGTWNKVSNKCWEVRGKTLGIIGYGHIGSQLSVLAE
                     AMGMHVFYYDTVTIMALGTAKQVPTLDELLKKSDFVTCHVPATAETKNMLSAPQFAAM
                     KDGAYVINASRGTVIDIPALVQACKANKIAGAALDVYPNEPGKNGAGAFNDDLNSWTS
                     ELVSLPNIILTPHIGGSTEEAQSAIGVEVATSLTKYINEGNSVGSVNFPEVSLRSLDY
                     DQENTVRVLYIHHNVPGVLKTVNNILSNHNIEKQFSDSNGDIAYLMADISSVDQSDIK
                     DIYTQLNETDPKISIRLLY"
     gene            complement(<296525..>299416)
                     /gene="TDEL0H01720"
                     /locus_tag="TDEL_0H01720"
                     /db_xref="GeneID:11501116"
     mRNA            complement(<296525..>299416)
                     /gene="TDEL0H01720"
                     /locus_tag="TDEL_0H01720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683194.1"
                     /db_xref="GeneID:11501116"
     CDS             complement(296525..299416)
                     /gene="TDEL0H01720"
                     /locus_tag="TDEL_0H01720"
                     /inference="similar to DNA sequence:INSDC:YIL073C"
                     /note="similar to Saccharomyces cerevisiae SPO22
                     (YIL073C); ancestral locus Anc_7.272"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683242.1"
                     /db_xref="GeneID:11501116"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013940"
                     /db_xref="UniProtKB/TrEMBL:G8ZZI7"
                     /translation="MAVITEAANWISDRLSKSDALRSAKSNCTQEIENRIDTLYPIAE
                     KYDRSLRTNRPVTDDVLNGSLEHAATDLWNSTEIAIKVESDNESGYLLCRCKMFASIL
                     LSMYEALRPSNERKTMTLKCYLVIFKLIIDRNWIQLKKNVQEHMDDALKSLVAAVDPT
                     SNANTAIVKRLQFEYFLTNFQSSAKEGDLETARIFSSKADIKNSYESLDASTILELCR
                     IIYNAATLLKDSADGICRINAISLLRDVQDYMDLPVTGLNSRSEFSSLRYSSLLLLTS
                     CLIESDPQECRKYLELVQNLYPRKVDPFVLGIRYCRKNVGDNCDSAIEDVLMKMIMSV
                     DIASSFDAIVSTINDFAATSPKKAANALDYIFLNKLNPQNNQQCLEKIAVSRFFLTTQ
                     AKKMTILEIIESLEDFSGSFERRFKCQISKTTMSSIITLLWNSGKKLEKNGNYHESIR
                     FFKLALKDVLSQNYEDKAKLQRALQNAYLMTEDYIEAEKVYESMDSRDKTSPLTQLML
                     LRICIHRRGEHAALECLNNIRNSEQENAVDVLILAATECKRSTQLAVRAMSLLFEAME
                     SRQATREISSNWCFPTMSLLRYTLQMIMKMAEDDRQQIFTHYSTTVKSLLNNGVEFLT
                     RSKVLGSLTCRSEKSPMSQGSISVHEIEWFAATSYNIALQCQKYNMEPHQSDFASLSL
                     RYIEMIPFQQFTASKAAHYMFWKYRASILCIISKKITFASGNDVALRDLQKHSFCLVD
                     EIARTTKDQALLNGCTQEQVELFNECYLDALMSAYEVALHTRDQTKITEVLRLTANSL
                     TAQIEILLIDTATSSAELPSGMLAEIMEAIIERNIGNTNLEDYLLCSWLRKLIDASFN
                     TEKNCLKNLAERLLARLRTTFNENEANVAVFKQEAEMLATLTWNEGVRSIIKGSKNVG
                     ADWCQISIDFARFVNEALESHLKSLWKSLASSADMEDREDRIHDYSQDA"
     gene            complement(<299733..>301586)
                     /gene="TDEL0H01730"
                     /locus_tag="TDEL_0H01730"
                     /db_xref="GeneID:11501117"
     mRNA            complement(<299733..>301586)
                     /gene="TDEL0H01730"
                     /locus_tag="TDEL_0H01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683195.1"
                     /db_xref="GeneID:11501117"
     CDS             complement(299733..301586)
                     /gene="TDEL0H01730"
                     /locus_tag="TDEL_0H01730"
                     /inference="similar to DNA sequence:INSDC:YER080W"
                     /note="similar to Saccharomyces cerevisiae YER080W;
                     ancestral locus Anc_7.271"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683243.1"
                     /db_xref="GeneID:11501117"
                     /db_xref="GOA:G8ZZI8"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8ZZI8"
                     /translation="MLRSSRNCKQLASVLSRVAQNPLRQVVATRFISEKPPQTFTKLS
                     DENDPERDAFFKYSWGSWLKNDKQEKDRRVTRFSIEGLTDILNDLYAQSRELTKVTKD
                     GQIKPPSYNPNLTVSLPHNLTAKQVGSVNPNEKVRITSMASIHEGKHHRIYKVDTNLD
                     RAFVLRIPYALDNEKTVAYRLKSEVATLDFADLKLGLKVPKVFCYGANALNPVRQPFV
                     LQEYIDGQLLMRDWSPLAEDSEAGKPDESLRKVIEKISDLQKNLLSAEFNEFGSLYFA
                     KDCDTSDKPAYQGESNPDLQNRWRVGPTVERCFWRSKSALKFDEQKKFLGPWSIDSPM
                     DIIKNTGLIEAENARARLALKEAGSSPEAVDEVSLKEQITTFENLARLAPSLFNRNTR
                     AIPNVQDLLKPRLNHPDLDPLNVLISKEGTPYLLDFEGTSIKPFIIQNAPQFVAYDGL
                     KVYNLKEDVPDYEKLSDGEKVQYDFMYKRTRNQYLWESALNERLPKLISAVAPPVKLL
                     RSPYIAAVEKKIDEEYLLVDEALIQLKEVWEILAKNGLVPTEKYPLEYTKEQIEKHTK
                     DLNSFHEKLVSTPFAATRGWIPQDMFDNLVKAGILVKDASGDYSIKQQGTV"
     gene            complement(<301883..>302590)
                     /gene="TDEL0H01740"
                     /locus_tag="TDEL_0H01740"
                     /db_xref="GeneID:11501118"
     mRNA            complement(<301883..>302590)
                     /gene="TDEL0H01740"
                     /locus_tag="TDEL_0H01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683196.1"
                     /db_xref="GeneID:11501118"
     CDS             complement(301883..302590)
                     /gene="TDEL0H01740"
                     /locus_tag="TDEL_0H01740"
                     /inference="similar to DNA sequence:INSDC:YER079W"
                     /note="similar to Saccharomyces cerevisiae YER079W;
                     ancestral locus Anc_7.270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683244.1"
                     /db_xref="GeneID:11501118"
                     /db_xref="UniProtKB/TrEMBL:G8ZZI9"
                     /translation="MNESNNSLSSKDVSSTVSLYEPSSTADFVDNLSTKAVYEMDPED
                     SISRPLSRGSVTSGVSMMATKDGVEGERVKRLGIPQYSLNILNSMAHNQYKKQHNHSH
                     SHVSLTKSHASGATEDSLVYGKFQTLYPDLPSAPPMTLREKMRLLNHDRQLLPSSAIN
                     STDNLDELSTKSTPVRNHGGYPNENENTLSVHGRWGGTSDVDSNASTVGDDVSFSQNM
                     RNLSPAISVSERIAGNK"
     gene            <302899..>304689
                     /gene="TDEL0H01750"
                     /locus_tag="TDEL_0H01750"
                     /db_xref="GeneID:11501119"
     mRNA            <302899..>304689
                     /gene="TDEL0H01750"
                     /locus_tag="TDEL_0H01750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683197.1"
                     /db_xref="GeneID:11501119"
     CDS             302899..304689
                     /gene="TDEL0H01750"
                     /locus_tag="TDEL_0H01750"
                     /inference="similar to DNA sequence:INSDC:YIL072W"
                     /note="similar to Saccharomyces cerevisiae HOP1 (YIL072W);
                     ancestral locus Anc_7.269"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683245.1"
                     /db_xref="GeneID:11501119"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="UniProtKB/TrEMBL:G8ZZJ0"
                     /translation="MSTHQLLATKTTISSDTKTGLTTEQSQKLIQTMLTMSFGCLAFL
                     RGLFPDESFVDQRFVPEKVEKNYKKCNGSQGNSIKIKTLVRGRSSEVDLLLNWLEKGV
                     FQSIKLKYLKALSLGIFLNEDDPTDLLENYTFTFEYGSGDNFRMKIGSSEHDEAESIS
                     LLDSRKMAQQLMRRFIIITQSLEPLPQKKFLTLRLMFNENAPTSYQPHLFKDATYDKP
                     AVVKVPQSTDSDSFTVGSLDTKHHKISLKVLSSAEYDTNMDPSEFLDIDPFDLIDQEP
                     KQIPSDEGENNRYVNSQTTNILGDLLKSSQPNVQPTQAVRTNAEVVCECGQNCPPGST
                     SFRTCRECRKQVHGICYGNSNRVQKCLTCLYGPELDTESVDFKDLMMLRKCYRFIART
                     RNRSFPSSVSFFFSQLLGNVEIDKEIEERIAFCISTLFRDEVLAINNGNRASASQTNK
                     SSSSSVINDWPGIKTPNQGELQQNREYVWSFCYNSPNAHQCYIDVLAVSRGQINAWLS
                     DMREMKNDGLGSLPSSCDIQSLDITDTMTQERSPLGQKRKHVNLDQYLNEPSSSIAND
                     TMDMRNVGAFETPKKIRKISVSKKSLRSAW"
     gene            <304961..>306490
                     /gene="TDEL0H01760"
                     /locus_tag="TDEL_0H01760"
                     /db_xref="GeneID:11501120"
     mRNA            <304961..>306490
                     /gene="TDEL0H01760"
                     /locus_tag="TDEL_0H01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683198.1"
                     /db_xref="GeneID:11501120"
     CDS             304961..306490
                     /gene="TDEL0H01760"
                     /locus_tag="TDEL_0H01760"
                     /inference="similar to DNA sequence:INSDC:YER078C"
                     /note="similar to Saccharomyces cerevisiae YER078C;
                     ancestral locus Anc_7.268"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683246.1"
                     /db_xref="GeneID:11501120"
                     /db_xref="GOA:G8ZZJ1"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001131"
                     /db_xref="InterPro:IPR007865"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:G8ZZJ1"
                     /translation="MFLTVLPKAQLKQGIRSLLTARHLSNRRRSPIQAGQALHETRPN
                     LLKAGELTPGITALEYHERRVRLANKMPAKSCAIIAGSQVKYASGAVFYPFQQSNNLF
                     YLTGWNEPDSVAIIEKQTDNLDDVTLHMVVPPKDSFSEQWEGFRTGVEGVKEIFNADE
                     ATETSVLPLYLNKIINRNDNLYFDIPKDKTSVSNSALFSTFFTTQSGADGHQTIHDII
                     RQSSGNKRVFGLNKLLTELRKIKSPAELRVMRKAGQISGRAFNQAFAQRFKNERTLQA
                     FLEYKFISGGCDKSAYLPVVATGSNALCIHYTRNDDVMYNDELVLVDAAGSIGGYCSD
                     ISRTWPVCGKFTQAQKDLYEAVLNVQRKCIELCKASEGFSIHEIHEKSLDFMKMELRN
                     VGFSAIQKWDVNKLYPHYIGHHLGLDVHDVPSASRSESIQDGMVITIEPGIYVPDEPN
                     YPSYFRNVGIRIEDDIAVGQDTYTNLTAEAVKEIADLENVMEYGVSTKVPEDVPNPLQ
                     D"
     gene            complement(<306536..>307846)
                     /gene="TDEL0H01770"
                     /locus_tag="TDEL_0H01770"
                     /db_xref="GeneID:11501121"
     mRNA            complement(<306536..>307846)
                     /gene="TDEL0H01770"
                     /locus_tag="TDEL_0H01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683199.1"
                     /db_xref="GeneID:11501121"
     CDS             complement(306536..307846)
                     /gene="TDEL0H01770"
                     /locus_tag="TDEL_0H01770"
                     /inference="similar to DNA sequence:INSDC:YIL071C"
                     /note="similar to Saccharomyces cerevisiae PCI8 (YIL071C);
                     ancestral locus Anc_7.267"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683247.1"
                     /db_xref="GeneID:11501121"
                     /db_xref="UniProtKB/TrEMBL:G8ZZJ2"
                     /translation="MLKRLESPICVERAHFLITSGLGSLTERGECAKDAINYLLRLGY
                     TKSPHWDELVAQSGLEAIEPIEVANSGSKRHLAFCKAVAHEYPEAISVIEATPTLSAE
                     FYRNLELVAHFLVLSKNFKGLEELEYRLSAIPNANVAKEELEALSRIQILVLCGSYMQ
                     CKYLEFCKGFFKLERSDPDFMRVLECEHESRFITHDELSLMVTVSSIVAIPFDNYDDF
                     LSVEDAASIERRFPQLVRCLKLLTNTSFGSFLKMWHGSIDEECKKSLLLAHGWDCARS
                     TMRHKIYFFYLRISNKLTISYLSRTLNIEEKLVEEEVRVLIENAHLNFEIIGDLIRYK
                     SDHFLAAVTSKLKENHELINQSLHFQVSNNRSLKNMVQESIIGNNASESAGNDETVYQ
                     SPKIDRARYAFDDNMDIDEINDISDVDSASFILGNESFSRTSGC"
     gene            <308025..>309929
                     /gene="TDEL0H01780"
                     /locus_tag="TDEL_0H01780"
                     /db_xref="GeneID:11501122"
     mRNA            <308025..>309929
                     /gene="TDEL0H01780"
                     /locus_tag="TDEL_0H01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683200.1"
                     /db_xref="GeneID:11501122"
     CDS             308025..309929
                     /gene="TDEL0H01780"
                     /locus_tag="TDEL_0H01780"
                     /inference="similar to DNA sequence:INSDC:YER077C"
                     /note="similar to Saccharomyces cerevisiae YER077C;
                     ancestral locus Anc_7.266"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683248.1"
                     /db_xref="GeneID:11501122"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:G8ZZJ3"
                     /translation="MLKTNWRCCYRYFHTFRKLEESQVKEKLKSFEKRDILMNKSSKE
                     LARLNERKLAKLKKLRKTAYTKQQAVHLLKEKHGVANEGIQEIEIGPTSQSDLKFINI
                     TKDRRMLYTILGVNGEQLRDSKLIAEDVKKFLKRGQVEKAVFLARLAKTKGAAAMNSI
                     MEYYFYELKYPQSAIKMFNWRKKWGVPSNEYTNTILFKGLAQQEQHASKAAASLVMKI
                     IDGLISREELSQIEYNAALGALTNCIDVTHAFELFEKRVKGVKPDAITYLWMLRACSR
                     IKTDKLFNEVLNDLVESIPSRCVDSRLIFEFCKTLHSRSDKESKQLALVALNTYFDFE
                     VDEKLSPKIPEGLRLLPLSHWSIHKKYPINKHIIGFFLQTCLQTGNWDLGIETFLEMK
                     RKNEKLIDVDMFHKYMELIMKKDPAVCGEECLKAFEEMESMKNIPFSKHTLVLVYASF
                     EKQASKRIINNDEVRINALLKACQDFITQQEGRYSKEFESKVYPVEAWQFLVSIIKNA
                     TASNKVSVIRLKQLTDEFMKTLCQGLLEFKNLRKREQARFVELEFVRLLKAFSLKLEM
                     PHMENVDTSVEGPERETFLLRRLVLRLKDKLLQHIKLIETGKHDGEDVDELEWSIKQI
                     ARRILSSKMP"
     gene            complement(<310090..>310902)
                     /gene="TDEL0H01790"
                     /locus_tag="TDEL_0H01790"
                     /db_xref="GeneID:11501123"
     mRNA            complement(<310090..>310902)
                     /gene="TDEL0H01790"
                     /locus_tag="TDEL_0H01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683201.1"
                     /db_xref="GeneID:11501123"
     CDS             complement(310090..310902)
                     /gene="TDEL0H01790"
                     /locus_tag="TDEL_0H01790"
                     /inference="similar to DNA sequence:INSDC:YIL070C"
                     /note="similar to Saccharomyces cerevisiae MAM33
                     (YIL070C); ancestral locus Anc_7.265"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683249.1"
                     /db_xref="GeneID:11501123"
                     /db_xref="GOA:G8ZZJ4"
                     /db_xref="InterPro:IPR003428"
                     /db_xref="UniProtKB/TrEMBL:G8ZZJ4"
                     /translation="MSLRLVSQAARRNFSVVQRASFAAQRALRTPCLPVLAHGYSQRR
                     TFFSTPNRWDQQKENVHEILKSEIKVESEVAADTSAQSFQEFLDKFGFSIVQTSGKNL
                     AEITKKTDGETVHVFFDVAQVANLPYDNALAESAAQEGENANEDDYDSLSDNFANVNV
                     VVVKDADQSSISLELLMNLQEGSFYVDSVTPFKSAQEALDQSADAEVKRELVYHGPPF
                     SNLDEELQESLEVYLESRGVTEELASFIGAYSEFKENQEYIQWLNNMKQFFN"
     gene            311192..311264
                     /gene="TDEL0Htrna6A"
                     /locus_tag="TDEL_0Htrna6A"
                     /db_xref="GeneID:11501124"
     tRNA            311192..311264
                     /gene="TDEL0Htrna6A"
                     /locus_tag="TDEL_0Htrna6A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCA"
                     /db_xref="GeneID:11501124"
     gene            <311716..>314175
                     /gene="TDEL0H01800"
                     /locus_tag="TDEL_0H01800"
                     /db_xref="GeneID:11501724"
     mRNA            <311716..>314175
                     /gene="TDEL0H01800"
                     /locus_tag="TDEL_0H01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683202.1"
                     /db_xref="GeneID:11501724"
     CDS             311716..314175
                     /gene="TDEL0H01800"
                     /locus_tag="TDEL_0H01800"
                     /inference="similar to DNA sequence:INSDC:YER075C"
                     /note="similar to Saccharomyces cerevisiae PTP3 (YER075C);
                     ancestral locus Anc_7.264"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683250.1"
                     /db_xref="GeneID:11501724"
                     /db_xref="GOA:G8ZZJ5"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G8ZZJ5"
                     /translation="MKEARASSEHQSASHDVQFRISNESEILSQNSFTATSNNPILMS
                     AAGIPIKSRCTGLPEKLAVPAPFSPVLLKSVSAPVLPSYKPQDQRLQKPANCSLISAD
                     EFAKIIDGSIDRGLLVFDVRPFNDYSRSSVKRSVHVCLPSTLLRRKNFTFQKLLGNLP
                     PEEQSVVRERTVDSENVKIVIYDNVPNQKDDSVSLACSGIATKIIDHYNQNIAVGSVS
                     ILSCGFPQFEEAFPQYTMSELDSPTSQSNSSTMDLGVQVCGDIIQESQQGLMPPQLGS
                     LDSPISASSPISALSKFKLPTLDNSPSQVFKIAQNEQLMDLESYLSAVKIKEETDHSS
                     MKTFQFPKPDQKVSTLVQQNKLRFQTKYEELEDVCGQSYIEAFIPLWFRKLMDRSKIE
                     FISQFQKLDFLERKRLNRTVKQHRSSHSASFYPGKTFNGVSRPIEGQLRSYSQPSTIT
                     ARRSSLQHFYAVNSDDEDDSITISSGVELGIKNRYKDIFPYEHSRVVLKKHSISSIPS
                     CSVKSDDYSQTWENYINANYLNVPTFPLLPKSHQKNPQRVRYIATQAPLSSTVYDFFT
                     CILNNDVPLVVTLTDSFENGVEKCFPYWNQGDYDGIKVDVLEAVSIPVVTKSYGRAEI
                     YLRRLQLSYDNDKTFETLQLHIKDWPDLGTLLDPTQIIQTINLKNLVIKGLLDRKVYA
                     EDSVPVILVHCSAGCGRTGTWCTVDSIISNLDVYDVLQRQFEEEDIHTTKLFDPIVWT
                     INTFRKQRISIVQNVNQFLFIYDCLLYHFMLNLNGKDHMNGALPIEGCSMQNLLHQIK
                     ELKIVQNMIDVKIHEQAPSFA"
     gene            complement(<314269..>314652)
                     /gene="TDEL0H01810"
                     /locus_tag="TDEL_0H01810"
                     /db_xref="GeneID:11501125"
     mRNA            complement(join(<314269..314324,314386..314493,
                     314562..>314652))
                     /gene="TDEL0H01810"
                     /locus_tag="TDEL_0H01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683203.1"
                     /db_xref="GeneID:11501125"
     CDS             complement(join(314269..314324,314386..314493,
                     314562..314652))
                     /gene="TDEL0H01810"
                     /locus_tag="TDEL_0H01810"
                     /inference="similar to DNA sequence:INSDC:YER074W-A"
                     /note="similar to Saccharomyces cerevisiae YOS1
                     (YER074W-A); ancestral locus Anc_7.263"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683251.1"
                     /db_xref="GeneID:11501125"
                     /db_xref="InterPro:IPR013880"
                     /db_xref="UniProtKB/TrEMBL:G8ZZJ6"
                     /translation="MFFGLGRLFYVILLLINAVAVLSEERFLIRIGLGRSSNDGPAFG
                     QEESSTKSKVVQLIGAVQTLLRIPLIGINILVIVYELLLG"
     gene            complement(<314954..>315601)
                     /gene="TDEL0H01820"
                     /locus_tag="TDEL_0H01820"
                     /db_xref="GeneID:11501126"
     mRNA            complement(join(<314954..315358,315599..>315601))
                     /gene="TDEL0H01820"
                     /locus_tag="TDEL_0H01820"
                     /product="40S ribosomal protein S24"
                     /transcript_id="XM_003683204.1"
                     /db_xref="GeneID:11501126"
     CDS             complement(join(314954..315358,315599..315601))
                     /gene="TDEL0H01820"
                     /locus_tag="TDEL_0H01820"
                     /inference="similar to DNA sequence:INSDC:YER074W,YIL069C"
                     /note="similar to Saccharomyces cerevisiae RPS24A
                     (YER074W) and RPS24B (YIL069C); ancestral locus Anc_7.262"
                     /codon_start=1
                     /product="40S ribosomal protein S24"
                     /protein_id="XP_003683252.1"
                     /db_xref="GeneID:11501126"
                     /db_xref="GOA:G8ZZJ7"
                     /db_xref="InterPro:IPR001976"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR018098"
                     /db_xref="UniProtKB/TrEMBL:G8ZZJ7"
                     /translation="MSDAITIRTRKVISNPLLARKQFVIDVLHPNRANVSKDELREKL
                     SAVYKTEKDAVSVFGFRTQFGGGKSTGFGLVYNSVAEAKKFEPTYRLVRYGLAEKVEK
                     PSRQQRKQKKNRDKKIFGTGKALAKKVARRNAD"
     gene            complement(<316147..>317697)
                     /gene="TDEL0H01830"
                     /locus_tag="TDEL_0H01830"
                     /db_xref="GeneID:11501127"
     mRNA            complement(<316147..>317697)
                     /gene="TDEL0H01830"
                     /locus_tag="TDEL_0H01830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683205.1"
                     /db_xref="GeneID:11501127"
     CDS             complement(316147..317697)
                     /gene="TDEL0H01830"
                     /locus_tag="TDEL_0H01830"
                     /inference="similar to DNA sequence:INSDC:YER073W"
                     /note="similar to Saccharomyces cerevisiae ALD5 (YER073W);
                     ancestral locus Anc_7.261"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683253.1"
                     /db_xref="GeneID:11501127"
                     /db_xref="GOA:G8ZZJ8"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR015657"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:G8ZZJ8"
                     /translation="MLSRATIAQFTSRRLLRLYSHVPLRVPITLPNGSTYEQPTGLFI
                     NGEFIPSKQRKTFEVINPSTEEEITHVYEAREDDVDIAVAAAKRAFEGGWSTADPEFR
                     ARALFKLADLVEQHAETLAAIESLDNGKSLLCSRGDVALVSKYLRSCGGWTDKIYGNV
                     IDTGKDHFAYSLREPIGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPAEATPLSA
                     LYASTLCQEAGIPAGVVNIVSGFGRIVGERLCNHPDVKKIAFTGSTNTGRHIMKTAAD
                     SIKKITLELGGKSPNIVFADADLEKAVKSIAFGIFFNSGEVCCAGSRIYVQDSVYEEV
                     LEKLKEYTETLSVGDPFDENTFQGAQTSQMQMEKILKYVQIGTDEGARVVSGGERKGE
                     RGYFIKPTIFADVDENMQIVKDEIFGPIVTVSKFSTVDEVIAKANDSVYGLAAGIHTK
                     DVNKAIDVSNRIKAGTIWINTYNAFHQNVPFGGFGQSGIGSEMGAAALDNYTQVKSIR
                     MSIDKAQY"
     gene            complement(<318217..>318597)
                     /gene="TDEL0H01840"
                     /locus_tag="TDEL_0H01840"
                     /db_xref="GeneID:11501128"
     mRNA            complement(<318217..>318597)
                     /gene="TDEL0H01840"
                     /locus_tag="TDEL_0H01840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683206.1"
                     /db_xref="GeneID:11501128"
     CDS             complement(318217..318597)
                     /gene="TDEL0H01840"
                     /locus_tag="TDEL_0H01840"
                     /inference="similar to DNA sequence:INSDC:YER072W"
                     /note="similar to Saccharomyces cerevisiae VTC1 (YER072W);
                     ancestral locus Anc_7.260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683254.1"
                     /db_xref="GeneID:11501128"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="UniProtKB/TrEMBL:G8ZZJ9"
                     /translation="MSSAPLLQKTPGKKIALPTRVEPKVFFANERTFLSWLNFTVMLG
                     GLGIGLLNFGDSVGKISAGLFTLVAMGTMVYALVTYHWRAAAIRRRGSGPYDDRLGPT
                     LLCFFLLIAVVINFILRLRYSKDV"
     gene            <318950..>319297
                     /gene="TDEL0H01850"
                     /locus_tag="TDEL_0H01850"
                     /db_xref="GeneID:11501129"
     mRNA            <318950..>319297
                     /gene="TDEL0H01850"
                     /locus_tag="TDEL_0H01850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683207.1"
                     /db_xref="GeneID:11501129"
     CDS             318950..319297
                     /gene="TDEL0H01850"
                     /locus_tag="TDEL_0H01850"
                     /inference="similar to DNA sequence:INSDC:YER071C"
                     /note="similar to Saccharomyces cerevisiae YER071C;
                     ancestral locus Anc_7.259"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683255.1"
                     /db_xref="GeneID:11501129"
                     /db_xref="InterPro:IPR005334"
                     /db_xref="UniProtKB/TrEMBL:G8ZZK0"
                     /translation="MEFQTGQDKVANAPVSQDKLVELIETSYVAAGASPGEGSVKDKF
                     LTKVLEQLVQHSSQYKYVISMTSLKGEAKDNDVSMSNDIGAAWNSKKDGFYNYTLANN
                     DEKFLVTVFWISK"
     gene            complement(<319313..>321703)
                     /gene="TDEL0H01860"
                     /locus_tag="TDEL_0H01860"
                     /db_xref="GeneID:11501130"
     mRNA            complement(<319313..>321703)
                     /gene="TDEL0H01860"
                     /locus_tag="TDEL_0H01860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683208.1"
                     /db_xref="GeneID:11501130"
     CDS             complement(319313..321703)
                     /gene="TDEL0H01860"
                     /locus_tag="TDEL_0H01860"
                     /inference="similar to DNA sequence:INSDC:YIL068C"
                     /note="similar to Saccharomyces cerevisiae SEC6 (YIL068C);
                     ancestral locus Anc_7.258"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683256.1"
                     /db_xref="GeneID:11501130"
                     /db_xref="GOA:G8ZZK1"
                     /db_xref="InterPro:IPR010326"
                     /db_xref="UniProtKB/TrEMBL:G8ZZK1"
                     /translation="MSSEALQKISTLLKDDLSPERVRDIKDQLTKQKSTVEYQLNKES
                     SKYYGNVEKSLSLLNLSQKSVKDIQGRLQDVNQLSHKNKTAISRYDIIFSATKIYEKI
                     DMTSSIYDKISSFNELVIKIDQTLDQEMAEDALDTGCPSLLHIHYMLTTARDFQDQML
                     AMSLVSTDDVQRTVLKLFSQMNQLVSKFDKLLESLVYDLVEIVRSEQISLAIRFFKIL
                     TLEESEDLKINAIRNILKKKEIELDRTAIKKLPSRNSVPQQNATEYPTSKGIYEEILS
                     GTITTRTQSRGYRNFFFNKVKQSVRDMFVEVRNEYQGEKRFDVLNNLDWVFNELLMIK
                     EHLTKYCPPHWDIFGEYFELYYQELHSLVSELVESEPETLIILDILDYDKRFQETLVK
                     DFGFSKKEKRSIIGDKQKEQLFADYLSMILVKMSEWIGNLEKAEFEVFLERKTPPHVD
                     SEGLLYLDGTRTCFQMFTQQAEVAAGSSQAKILVGVINRFCDLLKQRQKKWMQMIEVD
                     VQKLLRFNHRDEDAPEPDSSEQCPGGLVEYIVAVANDQMKAADYSVAISSKYGKLVTK
                     TYERAITQDIEEALDGFAEVAKFCSNELIKIIFADLASPFSEIFSKAWYSGSQAQQIA
                     DTLYEYLVEIKSQMNSVVFASLLEIVVEETILSFISALKYEHSFKNKNNKFLDCMKRD
                     FEIFYKVFVQLLPESEDKTMIIDDKFKLMEYFMDFSCGEVDNITAIWSNCLSVYWDTP
                     IKLLAAILNCRKDVDKSDTKKILQTATQLCNDPARLNQLNEAEVQPTFISRVNILI"
     gene            complement(<321865..>323835)
                     /gene="TDEL0H01870"
                     /locus_tag="TDEL_0H01870"
                     /db_xref="GeneID:11501131"
     mRNA            complement(<321865..>323835)
                     /gene="TDEL0H01870"
                     /locus_tag="TDEL_0H01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683209.1"
                     /db_xref="GeneID:11501131"
     CDS             complement(321865..323835)
                     /gene="TDEL0H01870"
                     /locus_tag="TDEL_0H01870"
                     /inference="similar to DNA sequence:INSDC:YIL067C"
                     /note="similar to Saccharomyces cerevisiae YIL067C;
                     ancestral locus Anc_7.257"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683257.1"
                     /db_xref="GeneID:11501131"
                     /db_xref="InterPro:IPR004043"
                     /db_xref="UniProtKB/TrEMBL:G8ZZK2"
                     /translation="MAGASGNSLVDEDSYVQLDDLTHEGLAVPQNTSPKEEWLMLKRS
                     NPFMRLLRRIWSGPEEPSDLKPKFVSKWTWLQYIDDFPKKKFQVRYSSWSTRLSILIV
                     YCTLWAGILFFLLYPYLIRAPYFYPNDGSDRLPIYSLTCNSYWNWEGKNNACGKDASD
                     CQPFSNVDYMIRCPALCDRGGWTYSAIAVGDQRVKYQSYEIGGGPLEATEDSRSLSFP
                     YRADSFACDSAVHAGVVSPFFGGCARISMEGSQNSFPSRLGRYGHWSVAFDTFFPSSF
                     SFKDLRDGISTGCYDPRIIVVIINALMGIPVFYLCDSLIGFWIVTIVGYWTIALALDP
                     PLLTDPHDPTSVYELISVAVQRLLPLCFVLYVEWKCAAKRTLEDGSPAAKILLWYPTF
                     WLGVLNNVTFDRLPVDRLTAKDLKEQAGALTAVGSIAATILTCAVIQAYSLWKSGRFR
                     KYFKIYISIIAGLVFLGSIPGLNLRIHHYILGMMLVPGCATRGSSAYLFQGILIGLIL
                     SGVSRWDFASIIETDFALLRGEAGSSLEPPVFLFDPSKPHQVSWTLNSNLTINDSPEG
                     IDGFSLLANDFEIYVGQNLTVDLDVLLEEDEVLSSMLEASVSQSNGNTKIYLRVARAS
                     TENPNFERGDYTNAGILEWPQGIWHEPSPGVS"
     gene            complement(<324197..>326857)
                     /gene="TDEL0H01880"
                     /locus_tag="TDEL_0H01880"
                     /db_xref="GeneID:11501132"
     mRNA            complement(<324197..>326857)
                     /gene="TDEL0H01880"
                     /locus_tag="TDEL_0H01880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683210.1"
                     /db_xref="GeneID:11501132"
     CDS             complement(324197..326857)
                     /gene="TDEL0H01880"
                     /locus_tag="TDEL_0H01880"
                     /inference="similar to DNA sequence:INSDC:YER070W,YIL066C"
                     /note="similar to Saccharomyces cerevisiae RNR1 (YER070W)
                     and RNR3 (YIL066C); ancestral locus Anc_7.256"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683258.1"
                     /db_xref="GeneID:11501132"
                     /db_xref="GOA:G8ZZK3"
                     /db_xref="InterPro:IPR000788"
                     /db_xref="InterPro:IPR005144"
                     /db_xref="InterPro:IPR008926"
                     /db_xref="InterPro:IPR013346"
                     /db_xref="InterPro:IPR013509"
                     /db_xref="UniProtKB/TrEMBL:G8ZZK3"
                     /translation="MFVYKRDGRKEHVRFDKITARISRLCYGLDPAHIDAVKITQRII
                     SGVYEGVTTVELDNLAAETCAYMTTVHPDYATLAARIAISNLHKQTTKQFSQVVSELF
                     NYVNPKNGVHSPMISQEVMDIVNKHKDELNSAIVYDRDFNFNYFGFKTLERSYLLRIN
                     GEVAERPQHMIMRVAVGIHGDDIESAIETYNLMSLRYFIHASPTLFNAGTPRPQMSSC
                     FLIAMKDDSIEGIYDTLKECAMISKTAGGIGLHIHNIRSTGSYIAGTNGTSNGLIPMV
                     RVFNNTARYVDQGGNKRPGAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFPALWI
                     PDLFMKRVQENGEWTLFSPSEAPGLSDVYGDEFEALYERYVAEGRGRKTIKAQKLWYA
                     ILESQTETGTPFMLYKDACNIKSNQKNLGTIKSSNLCCEIVEYSAPDETAVCNLASIA
                     LPSCIQVADDGKTQWYDFAKLHKIAKVITRNLNKVIDRNYYPVPEARNSNMRNRPMAL
                     GVNGLADVFMMLRVPFESQEAKDLNIQIFETIYHASLEASCELAKKDGPYSTYEGSPI
                     SQGILQYDLWNTKPSDLWDWDTLKKSIKEYGVRNSLLLAPMPTASTSQILGYNECFEP
                     YTSNMYSRRVLSGEFQIVNPYLLRDLVDLGIWDDSMKQHIITDNGSIQNLPNIPQELK
                     DLYKTVWEISQKTIIEMAADRAVYIDQSQSLNIHIRAPTMGKLTSMHFYGWKKGLKTG
                     MYYLRTQAASAAIQFTIDKSVADQAAHNIADIANLHRPQYVPRKVNPGEVNLGLDDDL
                     RRAGVSREESPAPSSTASSIINSVASLKIQDSQPVTPVTSAPQSALPEKPKEEVTKTD
                     DSKDSEFDIYNSKVIACAIDNPEACTMCSG"
     gene            complement(<327312..>327779)
                     /gene="TDEL0H01890"
                     /locus_tag="TDEL_0H01890"
                     /db_xref="GeneID:11501133"
     mRNA            complement(<327312..>327779)
                     /gene="TDEL0H01890"
                     /locus_tag="TDEL_0H01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683211.1"
                     /db_xref="GeneID:11501133"
     CDS             complement(327312..327779)
                     /gene="TDEL0H01890"
                     /locus_tag="TDEL_0H01890"
                     /inference="similar to DNA sequence:INSDC:YIL065C"
                     /note="similar to Saccharomyces cerevisiae FIS1 (YIL065C);
                     ancestral locus Anc_7.255"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683259.1"
                     /db_xref="GeneID:11501133"
                     /db_xref="GOA:G8ZZK4"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR016543"
                     /db_xref="InterPro:IPR028058"
                     /db_xref="InterPro:IPR028061"
                     /db_xref="UniProtKB/TrEMBL:G8ZZK4"
                     /translation="MTKINFLPTLQDAFEPLLPQQVEILRQQVLSEGGDSASIQSRFN
                     YAWGLIKSEDVSDQRLGVKLLTDIYKESSARRRECLYYLGIGCYKLGEYSMAKRYVDT
                     LYEHEPNNKQAQALKSMVEDKVQRETVRGLAMATGVIAGAATIAAIFFRGRRK"
     gene            <327933..>328619
                     /gene="TDEL0H01900"
                     /locus_tag="TDEL_0H01900"
                     /db_xref="GeneID:11501213"
     mRNA            <327933..>328619
                     /gene="TDEL0H01900"
                     /locus_tag="TDEL_0H01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683212.1"
                     /db_xref="GeneID:11501213"
     CDS             327933..328619
                     /gene="TDEL0H01900"
                     /locus_tag="TDEL_0H01900"
                     /inference="similar to DNA sequence:INSDC:YIL064W"
                     /note="similar to Saccharomyces cerevisiae YIL064W;
                     ancestral locus Anc_7.254"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683260.1"
                     /db_xref="GeneID:11501213"
                     /db_xref="GOA:G8ZZK5"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="InterPro:IPR026635"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8ZZK5"
                     /translation="MEDTTRLNVSKLGTKKYWDDFYALERENFSKNPEDTGECWFDDN
                     GAEERMVEFLVDNDGELRISTQSKMIDLGTGNGHLLFELCENDFDGPMVGVDYSEESV
                     QFASHISKAKGYDTNTSFMAADIFDSSWSPGKFDIVLDKGTLDAIALSGKKFANDKTV
                     IDVYSTVIEKLLESGGIFLITSCNFTEQELINIVQTDRLKVWKRINYPVYEFGGVKGT
                     TICSVAFVKQ"
     gene            complement(<328653..>329579)
                     /gene="TDEL0H01910"
                     /locus_tag="TDEL_0H01910"
                     /db_xref="GeneID:11501214"
     mRNA            complement(<328653..>329579)
                     /gene="TDEL0H01910"
                     /locus_tag="TDEL_0H01910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683213.1"
                     /db_xref="GeneID:11501214"
     CDS             complement(328653..329579)
                     /gene="TDEL0H01910"
                     /locus_tag="TDEL_0H01910"
                     /inference="similar to DNA sequence:INSDC:YIL063C"
                     /note="similar to Saccharomyces cerevisiae YRB2 (YIL063C);
                     ancestral locus Anc_7.253"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683261.1"
                     /db_xref="GeneID:11501214"
                     /db_xref="GOA:G8ZZK6"
                     /db_xref="InterPro:IPR000156"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G8ZZK6"
                     /translation="MSDTKDQKVPVTEKGEKSVHGHSKPLKRTRSTEDGKDIENPETT
                     TDEKLANKKAKTVKETEQDGKIAETPKREDKAVEKPKHVFGSSTAFGSGFGLSKKTSE
                     GSSGQEKGDKKASPKPFAFGSGLSFGGGFGVLKKADDKAPDRKVDDSKDKEETPILED
                     KKEKTQELEATPSSADNSGVKLQKQEVKSGEEAEETIFQVNAKAYQLSDLKAGWKERG
                     VGVIKVNKDTATGKSRLVMRSRGLLKVILNLPLIKGFKIQQGFPGSLQSEKFVRITTV
                     DDNKAPLQYAVKTGKEETVQELYEKIVDLVPK"
     gene            complement(<329771..>330232)
                     /gene="TDEL0H01920"
                     /locus_tag="TDEL_0H01920"
                     /db_xref="GeneID:11501215"
     mRNA            complement(<329771..>330232)
                     /gene="TDEL0H01920"
                     /locus_tag="TDEL_0H01920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683214.1"
                     /db_xref="GeneID:11501215"
     CDS             complement(329771..330232)
                     /gene="TDEL0H01920"
                     /locus_tag="TDEL_0H01920"
                     /inference="similar to DNA sequence:INSDC:YIL062C"
                     /note="similar to Saccharomyces cerevisiae ARC15
                     (YIL062C); ancestral locus Anc_7.252"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683262.1"
                     /db_xref="GeneID:11501215"
                     /db_xref="GOA:G8ZZK7"
                     /db_xref="InterPro:IPR006789"
                     /db_xref="UniProtKB/TrEMBL:G8ZZK7"
                     /translation="MDNWRRIDIDAFDPESGRLSAQDLIPPNETVVTLQELQPKISQL
                     RSLASSGSMDSAVKLATSDPPYGADNSTKATYFQAVLEALTQVRQSDIANIIQQLSSE
                     QQDVLVKYLYKGMSVPEGQKQGGILLAWFEKLTQKAGVNPIVRYLSDRRTI"
     gene            complement(<330412..>332994)
                     /gene="TDEL0H01930"
                     /locus_tag="TDEL_0H01930"
                     /db_xref="GeneID:11501216"
     mRNA            complement(<330412..>332994)
                     /gene="TDEL0H01930"
                     /locus_tag="TDEL_0H01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683215.1"
                     /db_xref="GeneID:11501216"
     CDS             complement(330412..332994)
                     /gene="TDEL0H01930"
                     /locus_tag="TDEL_0H01930"
                     /inference="similar to DNA sequence:INSDC:YER069W"
                     /note="similar to Saccharomyces cerevisiae ARG5,6
                     (YER069W); ancestral locus Anc_7.251"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683263.1"
                     /db_xref="GeneID:11501216"
                     /db_xref="GOA:G8ZZK8"
                     /db_xref="InterPro:IPR000534"
                     /db_xref="InterPro:IPR000706"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR004662"
                     /db_xref="InterPro:IPR006855"
                     /db_xref="InterPro:IPR011241"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023013"
                     /db_xref="UniProtKB/TrEMBL:G8ZZK8"
                     /translation="MSSTRVLLSTRGFNPSRVQQITSILARAAACSSASAGRTSSSTF
                     AKKKVGYSKRYVSSVSGVGSTGTRSTVIQLLNNISSKREVEQYLKYFTSVNQQQFAVI
                     KVGGAIISDNLQELASCLAFLYHVGLYPIVLHGTGPQVNGRLEAEGIEPDYIDGIRIT
                     DEHTMTVVRKCFLEQNLKLVTALEQLGVRARPITSGVFTADYLDKDKYQLVGDITGVT
                     KDAIEASIKAGALPILTSLAETPSGQMLNVNADVAAGELARVFEPLKIVYLNEKGGII
                     NGDTGEKVSMINLDEEYEGLMQQAWVKYGTKLKIREIKELLDFLPRSSSVAIINVQDL
                     QKELFTDSGAGTMIRRGYKLSKRTALSEFPSADTLRQVLQRDSDIAQRKQTVASYLRG
                     LEQSDFVIYSDEPLDALAVIKKESVVPSLDKFICTTSAWLNNVTDNVFSAIRRDLPSL
                     QWIVNEDDANIAWHFDKSQGSYLKNGKVLFWYGIEDLNTVSQLIDDFVKKASGGSGSA
                     VKSGAFSGQSKRSYSTRSTPKPEGTSKSPGRVALIGARGYTGKNLISLIDNHPHLEVA
                     HVSSRELKGQKLDYYNKANLVYEALQIDDIKNLESQGDVDFWVMALPNKVCEPFVEAI
                     ESVHGKSKIVDLSADHRFVPEAEWAYGLPELNDRNKIAAAKKIANPGCYATGSQVALA
                     PLSQYITGLPTVFGVSGYSGAGTKPSPKNDPSFLSDNLIPYALTNHIHEREISTRLGH
                     EVAFVPHVGQWFQGISLTVSVPIKQGSLTSEDVSALYKKFYKGERLIHIADDIPLVKD
                     ISGTHGVVVGGFKVNESKDRVVLCATIDNLLKGAATQCLQNINLALNYGEYDGIPKNK
                     IIGL"
     gene            complement(<334207..>335163)
                     /gene="TDEL0H01940"
                     /locus_tag="TDEL_0H01940"
                     /db_xref="GeneID:11501217"
     mRNA            complement(<334207..>335163)
                     /gene="TDEL0H01940"
                     /locus_tag="TDEL_0H01940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683216.1"
                     /db_xref="GeneID:11501217"
     CDS             complement(334207..335163)
                     /gene="TDEL0H01940"
                     /locus_tag="TDEL_0H01940"
                     /inference="similar to DNA sequence:INSDC:YIL061C"
                     /note="similar to Saccharomyces cerevisiae SNP1 (YIL061C);
                     ancestral locus Anc_7.250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683264.1"
                     /db_xref="GeneID:11501217"
                     /db_xref="GOA:G8ZZK9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR022023"
                     /db_xref="UniProtKB/TrEMBL:G8ZZK9"
                     /translation="MSYNITKFPADVSRLFKPRPPLAYKKPVDYPLEKRQTCPHITGV
                     SQILDKPLAGYLSDFPQGSQNKYLQDYEKAADSKNREQRELENKLSEWDPQNDPNMKD
                     TDPYRTIFVGRLPYDISEVELQRKFNEFGEIEKVRVVRDKINNQSKGYAFIVFTDPQS
                     SKSACKEYGLHRGIEIKGRTCIVDIERGRTVKYFKPRRLGGGLGGRGYTRADKMARLS
                     NNPALRYGDRTSRRPGYEPNRFPPNWAAKPRYAGPSRFSNTATPVPSSVPAQGRYNSQ
                     DMPAHRPVGPAVSASPVQTSYRSRTARAQETRQTPKAEEPDY"
     gene            complement(<335297..>337090)
                     /gene="TDEL0H01950"
                     /locus_tag="TDEL_0H01950"
                     /db_xref="GeneID:11501218"
     mRNA            complement(<335297..>337090)
                     /gene="TDEL0H01950"
                     /locus_tag="TDEL_0H01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683217.1"
                     /db_xref="GeneID:11501218"
     CDS             complement(335297..337090)
                     /gene="TDEL0H01950"
                     /locus_tag="TDEL_0H01950"
                     /inference="similar to DNA sequence:INSDC:YER068W"
                     /note="similar to Saccharomyces cerevisiae MOT2 (YER068W);
                     ancestral locus Anc_7.249"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683265.1"
                     /db_xref="GeneID:11501218"
                     /db_xref="GOA:G8ZZL0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003954"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G8ZZL0"
                     /translation="MTLNPHVHDNLKAIQQALSNYDMSFLSDDEEDFCPLCLEPMDIT
                     DKNFKPCPCGYQICQFCYNNIRQNEELNGRCPACRRKYDDECVEYVVLSPEELKLERE
                     KQSRKEWERKQRDKERKENEYANRKHLAGMRVIQKNLVYVVGINPPVPYEEVASLLKS
                     DKYFGQYGKINKIVVNRKNPHSSANDHYHANMNNIVPGYGVYITFSKKEDAAKCIAQV
                     DGTYMDGRLVKAAYGTTKYCSSYLRGLPCPNPNCMFLHEPGEEADSFNRRELNNKQQA
                     VPAHQALPQQTRSHVTSNVYKSTSTGSAVNGSGHFSGTPSPAPAKVQLHHDHHQNGTG
                     SLTPVLIPAPVPTGSNPWGVTQPATPIASINLSKNSSAHNLPTLSHSLNQSSSQTQQE
                     QTTGGGHKKKHQNSNDKEFIDPYDSLGSAVRFLDARITSLSEYKNQDIHLKSDLIDEE
                     TYQRYPSLFSWDKIEVSEESDGDLTRKLVDILAINPVDYSASVISFLQNASASASANP
                     NAYTPIPQHIMPQQVAQASQRPLKVNTPPPPGMFTPHQAAMQQQQQPQQQQQQQQQQQ
                     QQPPKGDNGGATYSTDFLNQLINGRRVAASN"
     gene            complement(<337451..>337927)
                     /gene="TDEL0H01960"
                     /locus_tag="TDEL_0H01960"
                     /db_xref="GeneID:11501219"
     mRNA            complement(<337451..>337927)
                     /gene="TDEL0H01960"
                     /locus_tag="TDEL_0H01960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683218.1"
                     /db_xref="GeneID:11501219"
     CDS             complement(337451..337927)
                     /gene="TDEL0H01960"
                     /locus_tag="TDEL_0H01960"
                     /inference="similar to DNA sequence:INSDC:YER067W,YIL057C"
                     /note="similar to Saccharomyces cerevisiae YER067W and
                     YIL057C; ancestral locus Anc_7.248"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683266.1"
                     /db_xref="GeneID:11501219"
                     /db_xref="InterPro:IPR022554"
                     /db_xref="UniProtKB/TrEMBL:G8ZZL1"
                     /translation="MGKKDKGPKMTTVTTKEGETLKVFEDLKDFETFIKQETEDEEFD
                     NLHCQLKYYPPFVLHEAHDDPEKISTTANSHSRKFVRHLHQHVEKHLLKDIKEAINLR
                     DLKFRNKSKDESFDRIVWHYGDDTQYHERKFHIEVGVTCTHDDAMVDVDYKTIPIT"
     gene            338196..338277
                     /gene="TDEL0Htrna5S"
                     /locus_tag="TDEL_0Htrna5S"
                     /db_xref="GeneID:11501220"
     tRNA            338196..338277
                     /gene="TDEL0Htrna5S"
                     /locus_tag="TDEL_0Htrna5S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCA"
                     /db_xref="GeneID:11501220"
     gene            <338582..>340249
                     /gene="TDEL0H01970"
                     /locus_tag="TDEL_0H01970"
                     /db_xref="GeneID:11501723"
     mRNA            <338582..>340249
                     /gene="TDEL0H01970"
                     /locus_tag="TDEL_0H01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683219.1"
                     /db_xref="GeneID:11501723"
     CDS             338582..340249
                     /gene="TDEL0H01970"
                     /locus_tag="TDEL_0H01970"
                     /inference="similar to DNA sequence:INSDC:YER065C"
                     /note="similar to Saccharomyces cerevisiae ICL1 (YER065C);
                     ancestral locus Anc_7.247"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683267.1"
                     /db_xref="GeneID:11501723"
                     /db_xref="GOA:G8ZZL2"
                     /db_xref="InterPro:IPR006254"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018523"
                     /db_xref="UniProtKB/TrEMBL:G8ZZL2"
                     /translation="MDATTLDYQTLKKQLGASAREIEQWWSDPRWKNTKRIYSAQDVA
                     ARRGTFPPIQYPSSVQAKKLYKVLQEHRKRGTVARTFGALDPIHISQMAKYLDTIYVS
                     GWQCSSTASTSNEPGPDLADYPMDTVPNKVDHLFKAQLFHDRKQLENRAKATSQKELD
                     AQGPPIDYMTPIIADGDAGHGGLTAVFKLTKMFIERGAAGIHMEDQTSTNKKCGHMAG
                     RCVIPVQEHVNRLSTVRMCADIMHSDLVIVARTDSEAATLISSTIDVRDHYYVVGATN
                     PEVEDQPFAEVMDKAILAGASSSELAQIEAQWCKKAGLKLFHEAFAEELQKSNVSNKE
                     RVLAEFQRKVGPYTGTPHREAQKLAKKLLGHEVYFNWDVPRVREGLYRYQGGTQCAVM
                     RARAFAPFADLVWMESNYPDYPQAKQFAEGVREEFPNHMLAYNLSPSFNWTKAMSTEE
                     QGTFIERLGKLGYNWQFITLAGLHTTALAVNNFSREFAKHGMKAYAQNVQQKEMDEGV
                     DVLKHQKWSGAEYIDSLLKLAQGGVSATAAMGQGVTEDQFKEDKSKL"
     gene            <340563..>342239
                     /gene="TDEL0H01980"
                     /locus_tag="TDEL_0H01980"
                     /db_xref="GeneID:11501221"
     mRNA            <340563..>342239
                     /gene="TDEL0H01980"
                     /locus_tag="TDEL_0H01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683220.1"
                     /db_xref="GeneID:11501221"
     CDS             340563..342239
                     /gene="TDEL0H01980"
                     /locus_tag="TDEL_0H01980"
                     /inference="similar to DNA sequence:INSDC:YER064C,YIL056W"
                     /note="similar to Saccharomyces cerevisiae YER064C and
                     VHR1 (YIL056W); ancestral locus Anc_7.246"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683268.1"
                     /db_xref="GeneID:11501221"
                     /db_xref="InterPro:IPR007147"
                     /db_xref="UniProtKB/TrEMBL:G8ZZL3"
                     /translation="MYRVAKSVNNGGTTQKIREQLNFSDEKKWKRFSGRRLELIDKFG
                     LSERKASEQDDNIRQIATILRTEFGYPLNSASEFEKLVTAAVQSVRRNRKRSKKRGPT
                     SPSGLPSPNHTTVSASEDDDSRTNSPNNLPQQAAPAHVILPAIQPKVSIPSSVASIPV
                     VQSQQRYDDNVKGIIADMVNCVVPLSEQSQRDQSNGPNLTDFALSSNDQNLLSLGLHS
                     QVGNGGSASSNNTDIPFFLREKILLQIQRSGTCSKVACVPGSVDLFSNLEILGEMCIK
                     SAIAFVIERFFSNLMPSSMEYITSKTYSEESLSLLCTKLFGPATKRNLNQLPHTQVQL
                     KLLHLVMGAIVKDFGFDPCLYPLSEVIHHLVMNQYPLLYNSSNSTSEPKNQRAAILSS
                     LSMKPQVANQDVNKKVLLRFKDREQLFTFHLLSNGPPTVSEILENSQSLFHIFSKTKS
                     LALCHQGEIIHDDFQLAKLFNSLSEDYIVLELKEVDSHLDGLNILSTASLQVKKENHT
                     PSTSRVDMLDKIINRINKNPQNEPVDVPSVVSTGKFQDKNLPQPVFQPLL"
     gene            complement(<342304..>343365)
                     /gene="TDEL0H01990"
                     /locus_tag="TDEL_0H01990"
                     /db_xref="GeneID:11501222"
     mRNA            complement(<342304..>343365)
                     /gene="TDEL0H01990"
                     /locus_tag="TDEL_0H01990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683221.1"
                     /db_xref="GeneID:11501222"
     CDS             complement(342304..343365)
                     /gene="TDEL0H01990"
                     /locus_tag="TDEL_0H01990"
                     /inference="similar to DNA sequence:INSDC:YIL055C"
                     /note="similar to Saccharomyces cerevisiae YIL055C;
                     ancestral locus Anc_7.245"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683269.1"
                     /db_xref="GeneID:11501222"
                     /db_xref="UniProtKB/TrEMBL:G8ZZL4"
                     /translation="MHSCIILSLGSSYKYIENYTLAKDSDITRCARMSDRVIFLRIDN
                     LPPGKTWKQVKYLIGGIIHHSNVVKVKMLPLMSSIVPPFIPFQSCVVSLRGGLDGSSL
                     NELLVSLNTFQWDYYNLYAYTLPQPMDMGTSGEDRRRYLGHFSQGFQPSVPELKSALA
                     DGLGAGNSRRLRQIFNERSFRKQMTGRGMWQLQLDNFPPFLKLDTMETLTPEDDEALR
                     EKGVPELEIEQPDKFGRLRWTVLKDFIKLKCPKLLNLEDKSMDGTENNTREFYVGVYE
                     DAEEQVRLKISGESRIVKSTVYKAIVGFNDKELCDLCLESLQDQEYSLGYRLKVRHLP
                     PYDERNNGITENNNNNNNE"
     gene            <344139..>344891
                     /gene="TDEL0H02000"
                     /locus_tag="TDEL_0H02000"
                     /db_xref="GeneID:11501223"
     mRNA            <344139..>344891
                     /gene="TDEL0H02000"
                     /locus_tag="TDEL_0H02000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683222.1"
                     /db_xref="GeneID:11501223"
     CDS             344139..344891
                     /gene="TDEL0H02000"
                     /locus_tag="TDEL_0H02000"
                     /inference="similar to DNA sequence:INSDC:YER062C,YIL053W"
                     /note="similar to Saccharomyces cerevisiae HOR2 (YER062C)
                     and RHR2 (YIL053W); ancestral locus Anc_7.243"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683270.1"
                     /db_xref="GeneID:11501223"
                     /db_xref="GOA:G8ZZL5"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023198"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G8ZZL5"
                     /translation="MPLTTKPLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYF
                     DAEHVINISHGWRTYDAIAKFAPDYADEDYVTKLEGEIPEKYGQHSIEVPGAVKLCGE
                     LNALPKEKWAVATSGTRDMARKWFDILHIKRPEYFITANDVKQGKPYPEPYLKGRDGL
                     GFPINKEDPSKSKVVVFEDAPAGIAAGKAAGCKIIGIATTFDKEFLIEKGCDIIVKNH
                     ESIEVGGYNAETDEVEFVFKDYLYAKDDLLKW"
     gene            <344995..>346293
                     /gene="TDEL0H02010"
                     /locus_tag="TDEL_0H02010"
                     /db_xref="GeneID:11501224"
     mRNA            <344995..>346293
                     /gene="TDEL0H02010"
                     /locus_tag="TDEL_0H02010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683223.1"
                     /db_xref="GeneID:11501224"
     CDS             344995..346293
                     /gene="TDEL0H02010"
                     /locus_tag="TDEL_0H02010"
                     /inference="similar to DNA sequence:INSDC:YER061C"
                     /note="similar to Saccharomyces cerevisiae CEM1 (YER061C);
                     ancestral locus Anc_7.242"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683271.1"
                     /db_xref="GeneID:11501224"
                     /db_xref="GOA:G8ZZL6"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR017568"
                     /db_xref="UniProtKB/TrEMBL:G8ZZL6"
                     /translation="MIMSRVVITGLGCRTPLGHSVRESWTNLLKGKSGIVPVTGLADY
                     ETEFKDVIPKTVTVGKIPEGSVEPEGLITDQDRRRCANFTRLALLATHEALKGARLLE
                     DDLTVTSGVDLDRFGCIIGSGIGSIQDICSATQTLNNGKKVSPLFVPRILANMAAGNV
                     SIKFNLRGASHCVSTACATGNNAIGDAYNFIRLGMQDICVAGASESCINPLSLAGFIR
                     AKSINTENGVSRPFDAKRSGFVLGEGAGIVVLESLESAKKRQAPIIAEVKGYGLSSDA
                     YHITSPSPNGDGARRAMQMALSEVDHREVGYVNAHATSTLLGDRAESLAIKSTFLQYR
                     TKPLYVSSNKGSIGHLLGAAGAVESIFTIMALREQIIPHTLNLETVAGAKGDDFDTQF
                     SGIDFVKNQPRRDDELHFAMCNSFGFGGVNTALLFERWQE"
     gene            complement(<346307..>347398)
                     /gene="TDEL0H02020"
                     /locus_tag="TDEL_0H02020"
                     /db_xref="GeneID:11501225"
     mRNA            complement(<346307..>347398)
                     /gene="TDEL0H02020"
                     /locus_tag="TDEL_0H02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683224.1"
                     /db_xref="GeneID:11501225"
     CDS             complement(346307..347398)
                     /gene="TDEL0H02020"
                     /locus_tag="TDEL_0H02020"
                     /inference="similar to DNA sequence:INSDC:YER059W,YIL050W"
                     /note="similar to Saccharomyces cerevisiae PCL6 (YER059W)
                     and PCL7 (YIL050W); ancestral locus Anc_7.240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683272.1"
                     /db_xref="GeneID:11501225"
                     /db_xref="GOA:G8ZZL7"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:G8ZZL7"
                     /translation="MYNGSSTSTGAINIPKCDRRTSVCDESPENGDSIVTKVDSGGAN
                     RVPQQRTGGRVVTTEEDVCSSQSSSSPRRNLVGFSVPQPPTMLSSIRHYRSEDEDEDD
                     SEHIIDSDDSSWVRPYDHGTTRTEPIMPVSRDKPSEEVLDIATFPTEKLLEMLTALLD
                     KIIKSNDRLASSNPTLNQERELMNNNNVYLNSVLSFRGKHIPQISLEHYFQRIQKYCP
                     TTNDVFLSLLVYFDRISKRCNSNNNDTTNDNDLQYDMPAKQQQQTQQTQQQQAFVMDS
                     HNIHRLLIAGVTVSTKFFSDFFYSNSRYARVGGISLQELNHLELQFLVLCDFELLISV
                     NELQRYADLLYKFWHNSAMVETASPSGET"
     gene            <347688..>348218
                     /gene="TDEL0H02030"
                     /locus_tag="TDEL_0H02030"
                     /db_xref="GeneID:11501226"
     mRNA            <347688..>348218
                     /gene="TDEL0H02030"
                     /locus_tag="TDEL_0H02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683225.1"
                     /db_xref="GeneID:11501226"
     CDS             347688..348218
                     /gene="TDEL0H02030"
                     /locus_tag="TDEL_0H02030"
                     /inference="similar to DNA sequence:INSDC:YAL059W"
                     /note="similar to Saccharomyces cerevisiae ECM1 (YAL059W);
                     ancestral locus Anc_7.4"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683273.1"
                     /db_xref="GeneID:11501226"
                     /db_xref="InterPro:IPR022784"
                     /db_xref="UniProtKB/TrEMBL:G8ZZL8"
                     /translation="MARKVSKHSRAARRGADELPESKQLEEVPRAQRTDLANILTRTA
                     AKNEALLEARLQRKKKHRVGKKGLRSKLSETSVGSEKERFQRALDVASRLDGKIARSI
                     SRAKYVQTARKSGWDSINEQIRKETVLTSGESKDMKDVKDQEDAMIDDEEEVTAPENG
                     NQASNLFGVLTDDVEV"
     gene            <348332..>349876
                     /gene="TDEL0H02040"
                     /locus_tag="TDEL_0H02040"
                     /db_xref="GeneID:11501227"
     mRNA            <348332..>349876
                     /gene="TDEL0H02040"
                     /locus_tag="TDEL_0H02040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683226.1"
                     /db_xref="GeneID:11501227"
     CDS             348332..349876
                     /gene="TDEL0H02040"
                     /locus_tag="TDEL_0H02040"
                     /inference="similar to DNA sequence:INSDC:YAL058W"
                     /note="similar to Saccharomyces cerevisiae CNE1 (YAL058W);
                     ancestral locus Anc_7.5"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683274.1"
                     /db_xref="GeneID:11501227"
                     /db_xref="GOA:G8ZZL9"
                     /db_xref="InterPro:IPR001580"
                     /db_xref="InterPro:IPR009033"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:G8ZZL9"
                     /translation="MWLISCALASLALAVDVEGPTLDFNSRDLTLSKDSFWEDFQTYN
                     DKRPLEESWIVSESLGQDPSTGESTRRYKGEWDVQEPYNLKALKGDRALTLKNSGVAA
                     MIGRVLPQPIECTADSDLVVQYEVQLQNDLKCGGAFVKLLPEVSPSELREYAGTSPIL
                     ELLFGPDMCPPYTDEIHLGIKKTNPYSMAPELKLLKEAPLSSLSDTAIAHLYTLILKG
                     STGEYEIRVDGSVTKAGRLLDEGAFSPGFNPPKYIPDPNEEKPTEWDDLKLVPDPNVK
                     KPDDWNESEPLLIPDDIEEKPADWDESMPVIVPDSSRERPEWWDDEHDGEWIAPMIEN
                     PACGEISGCGEWEPSLIDNPNYKGPWEPPLIENPNYQGVWQAKNIRNPNYFEDSAPAK
                     LENKIGAIVFEFWSGTSNLLIDNIYIGKHIDEAEFLGNSTFAAKRALQDKQNEHRLGA
                     KKPQSPPPTLDGSPNFYDQVIDFILTHVSPSTAILTIITTIIGLLTLGKRKPQPPKKT
                     ETRKSE"
     gene            complement(<349919..>350230)
                     /gene="TDEL0H02050"
                     /locus_tag="TDEL_0H02050"
                     /db_xref="GeneID:11501228"
     mRNA            complement(<349919..>350230)
                     /gene="TDEL0H02050"
                     /locus_tag="TDEL_0H02050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683227.1"
                     /db_xref="GeneID:11501228"
     CDS             complement(349919..350230)
                     /gene="TDEL0H02050"
                     /locus_tag="TDEL_0H02050"
                     /inference="similar to DNA sequence:INSDC:YER058W"
                     /note="similar to Saccharomyces cerevisiae PET117
                     (YER058W); ancestral locus Anc_7.239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683275.1"
                     /db_xref="GeneID:11501228"
                     /db_xref="UniProtKB/TrEMBL:G8ZZM0"
                     /translation="MSRASKITFALSCVFTASTVVGVHIVQGLERDTLHQGPIKDAQR
                     VAARKQQRLAAEADPEKERQKLVNRSEHELQQELRKKYEAVQPLSGKVVTKDGEAIDD
                     V"
     gene            <350315..>350848
                     /gene="TDEL0H02060"
                     /locus_tag="TDEL_0H02060"
                     /db_xref="GeneID:11501229"
     mRNA            <350315..>350848
                     /gene="TDEL0H02060"
                     /locus_tag="TDEL_0H02060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683228.1"
                     /db_xref="GeneID:11501229"
     CDS             350315..350848
                     /gene="TDEL0H02060"
                     /locus_tag="TDEL_0H02060"
                     /inference="similar to DNA sequence:INSDC:YER057C,YIL051C"
                     /note="similar to Saccharomyces cerevisiae HMF1 (YER057C)
                     and MMF1 (YIL051C); ancestral locus Anc_7.238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683276.1"
                     /db_xref="GeneID:11501229"
                     /db_xref="GOA:G8ZZM1"
                     /db_xref="InterPro:IPR006056"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR013813"
                     /db_xref="InterPro:IPR019897"
                     /db_xref="UniProtKB/TrEMBL:G8ZZM1"
                     /translation="MTTSYILHTLEKLDEIFNKTPNRRHNQEMFLRNNLLRSPIARKM
                     ATLTPVATKNAPPAAASYSQAMKANNLIFVSGQIPYTPENKPVEGSIADKAEQVFKNV
                     RNILEASDSSFERVIKVNVFLADINNFAEFNKVYAKYFSTHKPARSCVAVAALPLNVD
                     LEMEVIATENEKSASHL"
     gene            <351266..>351745
                     /gene="TDEL0H02070"
                     /locus_tag="TDEL_0H02070"
                     /db_xref="GeneID:11501230"
     mRNA            join(<351266..351302,351402..>351745)
                     /gene="TDEL0H02070"
                     /locus_tag="TDEL_0H02070"
                     /product="60S ribosomal protein L34"
                     /transcript_id="XM_003683229.1"
                     /db_xref="GeneID:11501230"
     CDS             join(351266..351302,351402..351745)
                     /gene="TDEL0H02070"
                     /locus_tag="TDEL_0H02070"
                     /inference="similar to DNA
                     sequence:INSDC:YER056C-A,YIL052C"
                     /note="similar to Saccharomyces cerevisiae RPL34A
                     (YER056C-A) and RPL34B (YIL052C); ancestral locus
                     Anc_7.237"
                     /codon_start=1
                     /product="60S ribosomal protein L34"
                     /protein_id="XP_003683277.1"
                     /db_xref="GeneID:11501230"
                     /db_xref="GOA:G8ZZM2"
                     /db_xref="InterPro:IPR008195"
                     /db_xref="InterPro:IPR018065"
                     /db_xref="UniProtKB/TrEMBL:G8ZZM2"
                     /translation="MAQRVTYRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLASRPKC
                     GDCGAALQGIATARPRQYATLSKTHKTVSRAYGGSRCANCVKERIVRAFLIEEQKIVK
                     KVVKEQTEAAKKDASKSKKSSKKN"
     gene            <352154..>353767
                     /gene="TDEL0H02080"
                     /locus_tag="TDEL_0H02080"
                     /db_xref="GeneID:11501231"
     mRNA            <352154..>353767
                     /gene="TDEL0H02080"
                     /locus_tag="TDEL_0H02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683230.1"
                     /db_xref="GeneID:11501231"
     CDS             352154..353767
                     /gene="TDEL0H02080"
                     /locus_tag="TDEL_0H02080"
                     /inference="similar to DNA sequence:INSDC:YER056C"
                     /note="similar to Saccharomyces cerevisiae FCY2 (YER056C);
                     ancestral locus Anc_7.236"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683278.1"
                     /db_xref="GeneID:11501231"
                     /db_xref="GOA:G8ZZM3"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="InterPro:IPR026030"
                     /db_xref="UniProtKB/TrEMBL:G8ZZM3"
                     /translation="MSMPGKEDIEIQDFEKGLTHSQSSSSRWEIQQAEKKAVTTEAYS
                     ENDEDDQFVGGTAEVTQLSFLSRIAVKLNAETKGIEPVTDEEKTDDSVINAASMWFSA
                     NMVIAAYALGTLGPLIFELNFGTCVLVIVFFSILGLLSIAFFSVFGAEFGLRQMILSR
                     FLLGNLTARVFALINVVACVGWAVVNTIASAQLLNMINPGSHQCPPWAGVLIIVGGTV
                     MITFFGYRIIHAYEKWSWVPNFAVFLVIIACLAKNGSFSNGEWTSGPTTAGGVLSFGS
                     AVYGFATGWTTYAADYTVYMPRNMNKYKIFFSLVFGLAFPLFFTMILGAASARATMNN
                     PLWNQYYESDSVGGLTFAILVPESLHGFGQFCCVLLALSTIANNIPNMYTIALSAQAT
                     WEPFSKVPRIVWTLLGNGATIAIAIPAYYKFESFMSNFMNSIGYYLAIYTAISLSEHF
                     IYRRGFKGYNIEEWDKWDKLPIGIAGCCALFVGAVGVAVGMCQTYWVGELGRKIGEFG
                     GDIGFELGAGFAFVVYNIIRPLELKYIGR"
     gene            <353919..>354680
                     /gene="TDEL0H02090"
                     /locus_tag="TDEL_0H02090"
                     /db_xref="GeneID:11501232"
     mRNA            <353919..>354680
                     /gene="TDEL0H02090"
                     /locus_tag="TDEL_0H02090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683231.1"
                     /db_xref="GeneID:11501232"
     CDS             353919..354680
                     /gene="TDEL0H02090"
                     /locus_tag="TDEL_0H02090"
                     /inference="similar to DNA sequence:INSDC:YIL049W"
                     /note="similar to Saccharomyces cerevisiae DFG10
                     (YIL049W); ancestral locus Anc_7.235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683279.1"
                     /db_xref="GeneID:11501232"
                     /db_xref="GOA:G8ZZM4"
                     /db_xref="InterPro:IPR001104"
                     /db_xref="UniProtKB/TrEMBL:G8ZZM4"
                     /translation="MDAEDSISRYVIIGYRLTFLVGLSSVAVANYLLPELLQYGKTFV
                     PDNPHRKDAPLWQRLFYATVPKGRFAHFYYLSTFLSMINLYSYHGSPIAWLILFHSVR
                     RAYETTYVSKYTPTSRMHWSHYVVGIWFYSVLNLMINIKLHQGAVSSALKPVPFLIFC
                     FASWDQYKNHRILSRLVKYSLPTEGLFQIVCCPHYLDEVLIYASLIPYNWEFSWLLIW
                     VFTNLSVSARENKNYYDHRFPKARVPQYAIIPLVL"
     gene            <354989..>358414
                     /gene="TDEL0H02100"
                     /locus_tag="TDEL_0H02100"
                     /db_xref="GeneID:11501233"
     mRNA            <354989..>358414
                     /gene="TDEL0H02100"
                     /locus_tag="TDEL_0H02100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683232.1"
                     /db_xref="GeneID:11501233"
     CDS             354989..358414
                     /gene="TDEL0H02100"
                     /locus_tag="TDEL_0H02100"
                     /inference="similar to DNA sequence:INSDC:YIL048W"
                     /note="similar to Saccharomyces cerevisiae NEO1 (YIL048W);
                     ancestral locus Anc_7.234"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683280.1"
                     /db_xref="GeneID:11501233"
                     /db_xref="GOA:G8ZZM5"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:G8ZZM5"
                     /translation="MSYPAVPGSSIANKFDSASRQKNKSKDSFDLQFDDSLDAALDNL
                     QINDLNHSGGPDHSWDSRSSIESFEMRTMNENEGTAAAIRKHSTTDSRPLLDGSRNSG
                     SGNRNQIHNYSTDYRNANGLWAKLRSLFNGQSRLSKYRSTSGIELNDSHIDREIHPDT
                     TPTYDRNKYPSNEISNAKYNAITFVPTLLYEQFKFFFNLYFLAVALSQAIPALRIGYL
                     SSYVLPLAFVLTVTMLKEAMDDIQRRRRDSESNNELYAIINKSQLVPSKDLKVGDLIK
                     MHKGARIPADCILLQSSEPSGEAFIKTDQLDGETDWKLRIACPLTQNLSQDDLLNKIS
                     ITASAPEKSIHRFLGKVTYKSSSSNPLSVDNTLWANTVLASSGYCIACVVYTGADTRQ
                     AMNTTTPKVKTGLLELEINSISKILCACVFLLSISLVAFGGIQNADWYVDILRYLILF
                     STIIPVSLRVNLDLAKSVYAYQIEHDDAIPETVVRTSTIPEDLGRIEYLLSDKTGTLT
                     QNDMQLRKIHLGTVSYTAETIDIVSDYIQTLDSSAPPSTSRRDISTRVRDMVVTLALC
                     HNVTPTFEDEGLMYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHEHSGTTLNYDI
                     LQVFPFNSDTKRMGIIVHDKQKNEYWFLEKGADTVMAKIVERNDWLEEETGNMAREGL
                     RTLVIGRKQLTHKSYEEFKKKYEEASVSMLNRDEQISNVVSEYLERNLELLGLTGVED
                     KLQKDVKASIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKQHDPHG
                     ALDKLEYLRINKNSCLIIDGESLGMYLQYYRKEFFEVAASVPAVIACRCTPQQKADVA
                     LVIRELTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLTEL
                     LLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSSFEPIALYQGWLMVGYATCYT
                     MAPVFSLTLDHDIDKPLTKTYPELYKDLTEGKSLSYKTFLVWVALSLFQGLVIQGSSQ
                     EFTSLDPQDFNKMVAISFSALVMNELVMVALEINTWNKVMVITEMSTLLLYIISVPFL
                     GDYFDLKYMTKLMFLGATIFILAISVFPVWAAKAIHRKLNPPSYAKVQEFATV"
     gene            complement(<358534..>361116)
                     /gene="TDEL0H02110"
                     /locus_tag="TDEL_0H02110"
                     /db_xref="GeneID:11501234"
     mRNA            complement(<358534..>361116)
                     /gene="TDEL0H02110"
                     /locus_tag="TDEL_0H02110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683233.1"
                     /db_xref="GeneID:11501234"
     CDS             complement(358534..361116)
                     /gene="TDEL0H02110"
                     /locus_tag="TDEL_0H02110"
                     /inference="similar to DNA sequence:INSDC:YIL047C"
                     /note="similar to Saccharomyces cerevisiae SYG1 (YIL047C);
                     ancestral locus Anc_7.233"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683281.1"
                     /db_xref="GeneID:11501234"
                     /db_xref="GOA:G8ZZM6"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR004342"
                     /db_xref="UniProtKB/TrEMBL:G8ZZM6"
                     /translation="MKFGDHLRESAVPEWKDKYIDYRLGKKKLKVFQKNLEQQVSDGL
                     SNYGSSSGTVNAPFSLSDQSARLRRNESSSTSLSKGYNVLQKKSIQDFIQHWLIGEEL
                     MKCNDFYSWLLEESRRKFVILEDQLKCYHNHVNSETVSPADEFQDSASQYKKPAYGSI
                     SHFSDNAKEVVGLAKNLEKFLRRHDLVPSWPKGLSDVKAKMLSAQTGKETFGRTSLAV
                     NVHQAERLLSDALIGYYQYLQLVKTYRDMNVTGFRKMVKKFDKTCKTKELPAFMVYAR
                     ENSPLFRHVNASVQLMAQKMKQTASAQAVGKLKVANDTDDPLIWWENNVTQWYTKDLT
                     RSDSAQKRHNQRLKKLAIQYTLNEQMIHRNNRAISQMFFSGIGLGISIAFIVYTLYLS
                     FVAPADSNMRTILFPLWSGWYMVWLSGLLFLSDCFVWHRMGINYRFIMLGEMQAKNGT
                     QLFNNDFATSAISLKLYFLTFFVASCAICALMSFHWDVLTPYGFIYLGVVILLFLCPN
                     NIIPYFDKLVDARKWILATVVRLVFSGFYPVEFGDFFIGDIICSLTYSMSDIAMFFCY
                     YSSEPGYLCGSSHSKAIGVLSCLPNYWRMLQCLRRFGDSGDWFPHLLNAFKYGFGVAY
                     YAALCAYRISTHKDEVRKPFIILATFNSVATAVWDIVMDWSLLQTCGHNWLLRNDLYL
                     AGKRDWRTGKYSFKGKIIYYLAMVWDIIIRFQWIVYAVAPQTIQQSAITSFVLAVTEV
                     LRRFVWIIFRVENEHVANVHLFKVTGESPLPYPVLRTDSELDSLKDRSSSSISLSQMY
                     TNMEEPIAAYHSLLRRQTGLFDSLSRSIPWAHASDFQRPRTYSSNQVSNHDSDSESEM
                     ESIV"
     gene            <361565..>362458
                     /gene="TDEL0H02120"
                     /locus_tag="TDEL_0H02120"
                     /db_xref="GeneID:11501235"
     mRNA            <361565..>362458
                     /gene="TDEL0H02120"
                     /locus_tag="TDEL_0H02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683234.1"
                     /db_xref="GeneID:11501235"
     CDS             361565..362458
                     /gene="TDEL0H02120"
                     /locus_tag="TDEL_0H02120"
                     /inference="similar to DNA sequence:INSDC:YER055C"
                     /note="similar to Saccharomyces cerevisiae HIS1 (YER055C);
                     ancestral locus Anc_7.232"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683282.1"
                     /db_xref="GeneID:11501235"
                     /db_xref="GOA:G8ZZM7"
                     /db_xref="InterPro:IPR001348"
                     /db_xref="InterPro:IPR011322"
                     /db_xref="InterPro:IPR013115"
                     /db_xref="InterPro:IPR013820"
                     /db_xref="InterPro:IPR015867"
                     /db_xref="InterPro:IPR018198"
                     /db_xref="InterPro:IPR020621"
                     /db_xref="UniProtKB/TrEMBL:G8ZZM7"
                     /translation="MDLVNHLTDRLLFAIPKKGRLYEKCVSILKGSDIKFHRSQRLDI
                     ALSTNLPVALIFLPAADIPMFVGEGKCDLGITGVDQVREADMDVELPIDLQFGNCKLQ
                     VQVPEKGDIRDPKQLIGKTIVSSFTNLTSKYFAELEGTTVDKMTTNIRYVGGSVEASC
                     ALGIADAIVDLVESGETMRAAGLTDIATVLETSAYLIESKNPKSDPELIATLKSRIEG
                     VMTAQKYVCCNYNAPEGQLAQLLPITPGRRAPTISRIDDEGWVCVSSMVERSKKGAVM
                     DELKKNGAEDIMVFEISNCRV"
     gene            <362711..>364465
                     /gene="TDEL0H02130"
                     /locus_tag="TDEL_0H02130"
                     /db_xref="GeneID:11501236"
     mRNA            <362711..>364465
                     /gene="TDEL0H02130"
                     /locus_tag="TDEL_0H02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683235.1"
                     /db_xref="GeneID:11501236"
     CDS             362711..364465
                     /gene="TDEL0H02130"
                     /locus_tag="TDEL_0H02130"
                     /inference="similar to DNA sequence:INSDC:YIL046W"
                     /note="similar to Saccharomyces cerevisiae MET30
                     (YIL046W); ancestral locus Anc_7.231"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683283.1"
                     /db_xref="GeneID:11501236"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8ZZM8"
                     /translation="MGVEEMSESKKRKTEESVDGVHKVVKSGSAELPMFNLQRFCYRH
                     NPDIQSSPTNTACYKQDLKRFKNINDRITQLPKEEREEMHHILSTFAKSNDRLRKLML
                     DGLLTASCFPQLSYVASQVQNMIKIDFIGILPQEISLKILCYLDCQSLCSAAKVCRRW
                     KTMADDDRVWYRMCEQHIDRKCPNCGWGLPLLHMKRARFPQKQSGCSEVITGAKIPQC
                     AAKDNTNISGATPWKVIYRDRFKVECNWRKGHCEIQEFKGHMDGVLTLQFSSRLLFTG
                     SYDSTVAIWDLCSGRLIRRLSRHGDGVKALHFDEQKLVTGSLDKTIRVWNYITGECIS
                     TYRGHTDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYSLRGHTEWVNCVKLHPKSF
                     LCFSCSDDTTIRMWDIRTNACLRVFRGHVGQVQKVIPLTIVDIDNLVVDDRQINRSTQ
                     EEDTEEDQDVLKEDLPYPTHLLSCSLDNTIKMWDIRTGKCVRTQFGHVEGVWDIAADN
                     FRIVSGSHDGKVKLWDLQSGKCIHTFQGKSLQEPRESVNDQSPHKVSPIACVGIGDSE
                     FFTGDEMGYVKRYNFDIT"
     gene            <364932..>366278
                     /gene="TDEL0H02140"
                     /locus_tag="TDEL_0H02140"
                     /db_xref="GeneID:11501237"
     mRNA            <364932..>366278
                     /gene="TDEL0H02140"
                     /locus_tag="TDEL_0H02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683236.1"
                     /db_xref="GeneID:11501237"
     CDS             364932..366278
                     /gene="TDEL0H02140"
                     /locus_tag="TDEL_0H02140"
                     /inference="similar to DNA sequence:INSDC:YER054C,YIL045W"
                     /note="similar to Saccharomyces cerevisiae GIP2 (YER054C)
                     and PIG2 (YIL045W); ancestral locus Anc_7.230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683284.1"
                     /db_xref="GeneID:11501237"
                     /db_xref="InterPro:IPR005036"
                     /db_xref="UniProtKB/TrEMBL:G8ZZM9"
                     /translation="MYIKVGSHNEDGNEELRRSMKDGEMASAPNLMERRVKANNISSI
                     NSLNFMHKPQRVSQMKTNLFPDEEILKNTNLNKKLSTETYGGGYSPTRRQGSNGNLYS
                     DEQLPFPPVYKKSGEILKSSLKMRSKSLPTSPYISSENKDFSNVQPGRLQRSKSVHFD
                     QKTPVKYFCEDESPIDVGTKPNDETEDISYQHKPVRSLYDDPEEGFLSMGIDRLTMDS
                     EPKTKSPRNLRKSKRFNDLWKDQTTNKINTNNVLLRPHIAHKSNSSSNVTNGQVNGKQ
                     RVVGLYNVNFPILSNNNPKALKLNIFINLSRGKKCFLQDLTLCTRKGSDEQTQLRSDS
                     HGTRLIIGRVLVKNIFFDKRVVIKYTWNAWQTTREVECVYVSDGDGILPGTNMDVFKF
                     IIDDLSRTDSRAKLEFCIHYVARNDFQRQEYWDNNEGANYKLDCILDGFHNPFATT"
     gene            <366763..>366876
                     /gene="TDEL0H02150"
                     /locus_tag="TDEL_0H02150"
                     /db_xref="GeneID:11501238"
     mRNA            <366763..>366876
                     /gene="TDEL0H02150"
                     /locus_tag="TDEL_0H02150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683237.1"
                     /db_xref="GeneID:11501238"
     CDS             366763..366876
                     /gene="TDEL0H02150"
                     /locus_tag="TDEL_0H02150"
                     /inference="similar to DNA sequence:INSDC:YER053C-A"
                     /note="similar to Saccharomyces cerevisiae YER053C-A;
                     ancestral locus Anc_7.229"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683285.1"
                     /db_xref="GeneID:11501238"
                     /db_xref="UniProtKB/TrEMBL:G8ZZN0"
                     /translation="MQDIQVFLSVFTCLFVFYISAHKSVMNRYKSDVPCLQ"
     gene            <367235..>368149
                     /gene="TDEL0H02160"
                     /locus_tag="TDEL_0H02160"
                     /db_xref="GeneID:11501239"
     mRNA            <367235..>368149
                     /gene="TDEL0H02160"
                     /locus_tag="TDEL_0H02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683238.1"
                     /db_xref="GeneID:11501239"
     CDS             367235..368149
                     /gene="TDEL0H02160"
                     /locus_tag="TDEL_0H02160"
                     /inference="similar to DNA sequence:INSDC:YER053C"
                     /note="similar to Saccharomyces cerevisiae PIC2 (YER053C);
                     ancestral locus Anc_7.228"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683286.1"
                     /db_xref="GeneID:11501239"
                     /db_xref="GOA:G8ZZN1"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8ZZN1"
                     /translation="MSKSDHKIQLYTNEFYSACILGGVIACGPTHSAVTPLDLVKCRL
                     QVNPKLYKSNVDGWKTIIRNEGFGKVFTGFGATAIGYSLQGAGKYGGYEFFKHFYSNN
                     VLSPELASRYTTGVYLAASATAEFIADIMLCPFEAIKVRQQTTVPPFCNNVFQGLSKV
                     YSTEGLKGFYKGIVPLWFRQIPYTMVKFTSFEKIVQAIYAKLPTPKSEMSPLQQISVS
                     FTGGYLAGILCAIVSHPADVMVSKINSERKSGESMMDASKRIYKVIGFNGLWNGLMVR
                     IVMIGTLTSFQWLIYDSFKVKIGLPTTG"
     gene            complement(<368209..>368979)
                     /gene="TDEL0H02170"
                     /locus_tag="TDEL_0H02170"
                     /db_xref="GeneID:11501240"
     mRNA            complement(<368209..>368979)
                     /gene="TDEL0H02170"
                     /locus_tag="TDEL_0H02170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683239.1"
                     /db_xref="GeneID:11501240"
     CDS             complement(368209..368979)
                     /gene="TDEL0H02170"
                     /locus_tag="TDEL_0H02170"
                     /inference="similar to DNA sequence:INSDC:YIL044C"
                     /note="similar to Saccharomyces cerevisiae AGE2 (YIL044C);
                     ancestral locus Anc_7.227"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683287.1"
                     /db_xref="GeneID:11501240"
                     /db_xref="GOA:G8ZZN2"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:G8ZZN2"
                     /translation="MSSSPSVRKALAGLLRDPKNNTCADCKAQSHPRWASWSLGVFIC
                     IKCAGIHRSLGTHISKVKSVDLDIWKEEHLVTLVRFKNNESANGYYEARLPELSRKSI
                     TDGNKLQLFIKNKYEDKKWIGDEEPSMDSNNNISPVSSRSSTITNSKESLVSTEPPSE
                     KNSSSNVMSSTHSSLLNLQLSSVPRRNEETRRNGLSGRPDLKKSILSLYSKPSNTPTQ
                     NSLSAVSLPTSTKDESPSKNVSVNSLDDNELFKNVWST"
     gene            <369539..>370150
                     /gene="TDEL0H02180"
                     /locus_tag="TDEL_0H02180"
                     /db_xref="GeneID:11501241"
     mRNA            <369539..>370150
                     /gene="TDEL0H02180"
                     /locus_tag="TDEL_0H02180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683240.1"
                     /db_xref="GeneID:11501241"
     CDS             369539..370150
                     /gene="TDEL0H02180"
                     /locus_tag="TDEL_0H02180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683288.1"
                     /db_xref="GeneID:11501241"
                     /db_xref="GOA:G8ZZN3"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:G8ZZN3"
                     /translation="MSSVSRTSTREGALENFEDRNLPKIRLAEVREHNTAHDCWMAIH
                     GRVYDVTPILSKHPGGCQILLKYAGMDATFPFDDVGHSMESLIYDMPSGTLKGLLDPR
                     DRPMYKQHESGYEDPEGKDTECITMGHGQAENSYLIVNRLYTSILYFTIIFCALLLLF
                     VRIRWRPDLGNSHATDMHHQDGASASLDLHQEFEENSIPAWAY"
     gene            <370572..>372128
                     /gene="TDEL0H02190"
                     /locus_tag="TDEL_0H02190"
                     /db_xref="GeneID:11501242"
     mRNA            <370572..>372128
                     /gene="TDEL0H02190"
                     /locus_tag="TDEL_0H02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683241.1"
                     /db_xref="GeneID:11501242"
     CDS             370572..372128
                     /gene="TDEL0H02190"
                     /locus_tag="TDEL_0H02190"
                     /inference="similar to DNA sequence:INSDC:YER052C"
                     /note="similar to Saccharomyces cerevisiae HOM3 (YER052C);
                     ancestral locus Anc_7.226"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683289.1"
                     /db_xref="GeneID:11501242"
                     /db_xref="GOA:G8ZZN4"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001341"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR018042"
                     /db_xref="UniProtKB/TrEMBL:G8ZZN4"
                     /translation="MGYQPSNWVVQKFGGTSVGKFPAEIVEDIVKVYTTEYDNNVAVV
                     CSARSSYTKAEGTTSRLLRCCDLASQELDFADVIEAIRQDHVQNAESYIQNPVLQTKL
                     IADTNKELDLVTRYLEASQILGEVSTRTMDLVMACGEKLSCLFMASLCNDRGCKAQFV
                     DLTHLIPSDYNVSVLDSTFYTFLVQALKEKLLPFVNAKERTVPLITGFFGLVPNGLLN
                     GVGRGYTDLCAALIAVALNADELHVWKEVDGIFTADPRKVPQARLLSSVTPEEAAELT
                     YYGSEVIHPFTMEQVMREKIPIRIKNVQNPKGDGTVIYPDDMAKKGEATPPHPPEALS
                     QSFFERRRRGATAITTKHDIVVVNIHSNKKTLSHGFLAQIFTILDKYKLVVDLISTSE
                     VHVSMALPIPDTDSMKNLRQAVEKLKLLGTVDIIKKMAIVSLVGKQMKQYIGIAGTMF
                     ATLAENNINIEMISQGANEINISCVIEEVDSIKALKSIHGKLLDDKSSEKSFEHAINE
                     RLEQIKKMDL"
     gene            complement(<372192..>373043)
                     /gene="TDEL0H02200"
                     /locus_tag="TDEL_0H02200"
                     /db_xref="GeneID:11501243"
     mRNA            complement(<372192..>373043)
                     /gene="TDEL0H02200"
                     /locus_tag="TDEL_0H02200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683242.1"
                     /db_xref="GeneID:11501243"
     CDS             complement(372192..373043)
                     /gene="TDEL0H02200"
                     /locus_tag="TDEL_0H02200"
                     /inference="similar to DNA sequence:INSDC:YIL043C"
                     /note="similar to Saccharomyces cerevisiae CBR1 (YIL043C);
                     ancestral locus Anc_7.225"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683290.1"
                     /db_xref="GeneID:11501243"
                     /db_xref="GOA:G8ZZN5"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:G8ZZN5"
                     /translation="MADNSSRIVIALIVLVAIILVGRVLSKRQRPAVLIPDQFQEFPL
                     IMKTNLTHNTALYRFGLPGADDVLGLPIGQHISIRAEIEGKEILRSYTPTSLDTDAKG
                     CFELLVKTYEKGNISKVIGELNIGDKIQVRGPKGFYQYMPNMYTHIGMVAGGTGISPM
                     YQIIKAIATNPADRTKVFLVYGNVTEDDILLKAELDAIVRSNPAQFKVRYLLDKPPAD
                     EWEGGVGYVTEEVMREYLPSAKEPAVQLLICGPRPMVSSVKKTAVTLGFDKAKPISKM
                     GDQVFVF"
     gene            complement(<373219..>374676)
                     /gene="TDEL0H02210"
                     /locus_tag="TDEL_0H02210"
                     /db_xref="GeneID:11501244"
     mRNA            complement(<373219..>374676)
                     /gene="TDEL0H02210"
                     /locus_tag="TDEL_0H02210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683243.1"
                     /db_xref="GeneID:11501244"
     CDS             complement(373219..374676)
                     /gene="TDEL0H02210"
                     /locus_tag="TDEL_0H02210"
                     /inference="similar to DNA sequence:INSDC:YER051W"
                     /note="similar to Saccharomyces cerevisiae JHD1 (YER051W);
                     ancestral locus Anc_7.224"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683291.1"
                     /db_xref="GeneID:11501244"
                     /db_xref="GOA:G8ZZN6"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G8ZZN6"
                     /translation="MSTDTCVYCQLDDPTKELWVQCDLCPQWVHVICVPLECVHYDRS
                     ETPLPKVLEYPKTSKDIRRFQCGDHGTQGELFIKPVQAKRKRNDSVTQSTDPAKRRHG
                     LRSKQQIDYIALNEGDNIRLKHKHLHTDAFLRSFEKCKNNSNVISSQDFYDNFQSLHK
                     PLKVLDPSNSGMRIPSPEKGHVLTIDEITGIIGDDYPVDVMDIQTQQNERWTMSRWNQ
                     YISQTKPEDRDRVRNVISLEVSHVKGLKIERPVAVEENDLVNIIWESFGDGDDKPKVT
                     RYVLMSAGNSYTDFHLDFAGTSVYYNLISGNKKFLLFPPTESNLKIYSDWCCDMEQNV
                     VFLGDLLSDGVAMELEAGDLFMIPSGFIHAVYTPIDSLIIGGNFLTVRDIETQLQVVK
                     LERMTKVPKRFTFPNFDLVMGKCCEWALSQKQPSAISSTAIEALIRYMEDPTTKYKPI
                     NYPSKRALIKQLKQLHLLTPNHTLSEATKLEYPKD"
     gene            <375172..>375678
                     /gene="TDEL0H02220"
                     /locus_tag="TDEL_0H02220"
                     /db_xref="GeneID:11501245"
     mRNA            <375172..>375678
                     /gene="TDEL0H02220"
                     /locus_tag="TDEL_0H02220"
                     /product="mitochondrial 37S ribosomal protein RSM18"
                     /transcript_id="XM_003683244.1"
                     /db_xref="GeneID:11501245"
     CDS             375172..375678
                     /gene="TDEL0H02220"
                     /locus_tag="TDEL_0H02220"
                     /inference="similar to DNA sequence:INSDC:YER050C"
                     /note="similar to Saccharomyces cerevisiae RSM18
                     (YER050C); ancestral locus Anc_7.223"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM18"
                     /protein_id="XP_003683292.1"
                     /db_xref="GeneID:11501245"
                     /db_xref="GOA:G8ZZN7"
                     /db_xref="InterPro:IPR001648"
                     /db_xref="UniProtKB/TrEMBL:G8ZZN7"
                     /translation="MSSILLRVKPSISATRSFSASVLRMDAGLKFKPNTKTQVEVGSM
                     KQPGNNKRVDPRLMKRFARDSIYDPFDFSLARIHLDRKESSSNRSANDMFDKFGVNPL
                     DLYTSPEILSQFLSSTGKILHRDVTGLSAKNQRRLSKAIRRAQAIGLLSKTHKDVSFL
                     PTRTSGRL"
     gene            complement(<375714..>377006)
                     /gene="TDEL0H02230"
                     /locus_tag="TDEL_0H02230"
                     /db_xref="GeneID:11501246"
     mRNA            complement(<375714..>377006)
                     /gene="TDEL0H02230"
                     /locus_tag="TDEL_0H02230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683245.1"
                     /db_xref="GeneID:11501246"
     CDS             complement(375714..377006)
                     /gene="TDEL0H02230"
                     /locus_tag="TDEL_0H02230"
                     /inference="similar to DNA sequence:INSDC:YIL042C"
                     /note="similar to Saccharomyces cerevisiae PKP1 (YIL042C);
                     ancestral locus Anc_7.222"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683293.1"
                     /db_xref="GeneID:11501246"
                     /db_xref="GOA:G8ZZN8"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR018955"
                     /db_xref="UniProtKB/TrEMBL:G8ZZN8"
                     /translation="MRLAYSNMGKKDACRRLAGDLRLGILASTVKMSPVYQRRMCLHT
                     QTPLRTSRDNEKSLQLLELGFDKHYKIRSNIELLIQDYAKKPIQPITYEYLTRYKPPL
                     RDNTEYMLSIKTANLLLSYTCRQLDAIQKLPYIVVLNPNIEISNSLYLKTLETLLSIE
                     YPYGLHNRETMIELLTGFLDEHQDTLVTLARGFQEVMDFFPKESVFEFLNQHLRDRIS
                     MKLLATHYLSLLEQSKQDKPSEMIGVLHQNLQISSLVRQVSEYVNDMCFVKYDRTVPI
                     SILTGQNVTFPCIPTSLEYVITEVLKNSFRAHIEGSTSENDLTEKPIEITIVRKDDEM
                     QIRIRDYGGGISPAVEERMYDYSYSTVSEKAKDTGAEAYMIPGEDVNNVSGMGFGLPM
                     CKAYIDMFDGGLDVQSLLGWGTDVYIKLKGPSKEMLES"
     gene            <377524..>378540
                     /gene="TDEL0H02240"
                     /locus_tag="TDEL_0H02240"
                     /db_xref="GeneID:11501247"
     mRNA            <377524..>378540
                     /gene="TDEL0H02240"
                     /locus_tag="TDEL_0H02240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683246.1"
                     /db_xref="GeneID:11501247"
     CDS             377524..378540
                     /gene="TDEL0H02240"
                     /locus_tag="TDEL_0H02240"
                     /inference="similar to DNA sequence:INSDC:YIL041W"
                     /note="similar to Saccharomyces cerevisiae GVP36
                     (YIL041W); ancestral locus Anc_7.221"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683294.1"
                     /db_xref="GeneID:11501247"
                     /db_xref="InterPro:IPR018859"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:G8ZZN9"
                     /translation="MSTFNNFTNSLNQKFQELSTAVSQRTQEISTNLPSLTQSTQRLV
                     QERLGQVTDISQLPREYLELERKVDTIKLIYENFLHVTSIYENESYDYPKYVTESVND
                     FSKIVAHKVQELSHASSASEAQNILITPTPAKEPRTLNYALSKVSLISSEYLNHIGDH
                     DEAQVASVLLKYSDLQAKVAQARLQQDTMIQTRFNKQLKDNLEHNFKKAQKARKDVEY
                     KRLQYDVARSNLAQAKPEKEASLRVQMETLEDQFAQATEDATIIMQEVLSNAKFTEEI
                     KEMANAQLTYHQTSASLIEEFVAGFDTSLPASGSGATSKKVEPSEADDEDDAVKVDAD
                     DVEA"
     gene            complement(<378630..>380528)
                     /gene="TDEL0H02250"
                     /locus_tag="TDEL_0H02250"
                     /db_xref="GeneID:11501248"
     mRNA            complement(<378630..>380528)
                     /gene="TDEL0H02250"
                     /locus_tag="TDEL_0H02250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683247.1"
                     /db_xref="GeneID:11501248"
     CDS             complement(378630..380528)
                     /gene="TDEL0H02250"
                     /locus_tag="TDEL_0H02250"
                     /inference="similar to DNA sequence:INSDC:YER049W"
                     /note="similar to Saccharomyces cerevisiae TPA1 (YER049W);
                     ancestral locus Anc_7.220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683295.1"
                     /db_xref="GeneID:11501248"
                     /db_xref="GOA:G8ZZP0"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR006620"
                     /db_xref="InterPro:IPR019601"
                     /db_xref="UniProtKB/TrEMBL:G8ZZP0"
                     /translation="MKRKAPSNPVNLPQKQASLEEDKVKGLFNKKIWDPKFQNELKNE
                     IAEAKPYNWGTIRDLVDDELLRAVRKEIETEIHFTKKETDIYKVNQSGDLANLAGLDW
                     NDLSRLPNLYKLRQILYSEVYRDVIAHVTGSGKLSGQKADMSINTYTKGCHLLTHDDV
                     IGSRRISFILYLPDPDRTWKSHYGGGLRLFDSIIPNVPYSDPCAKLVPQFNQIAFFKV
                     QPGFSFHDVEEVKVDKHRLSIQGWYHIPQKGEDGFIPGEEEAWVQTNTSTLAQLESNV
                     LQDYEFPKFERDILPYHQVKHFEKVLDANEAERHDDKDKEVTPVSAFSDEHQLSKHEM
                     EYLTQYISHEYLSNEGIVKLQNKFLEDSALQIESFLNDSKSELMKKLIKGNELEKDCP
                     YAAKDVKSPWKTAVPPHKWRYLYIDGKSHENFQNEADILANLNREELQNFELLKQTLN
                     KKENEAETELIDLVEFFKSTIFKKYLALLTSLCPLSEQVLIRRFRPGEDFTLATKCQL
                     NELLKNVDGFVDSVLEGTLCLTPFDGWESGEVGGYELYMADNDDEGDEESKTQLDRDV
                     EDAAVYRADDSGDSVLINSSASWNTFNLVLRDETVLEFVKYVSWSAKSSRWDIKMQWD
                     VKSTEADE"
     gene            complement(<380933..>381226)
                     /gene="TDEL0H02260"
                     /locus_tag="TDEL_0H02260"
                     /db_xref="GeneID:11501249"
     mRNA            complement(<380933..>381226)
                     /gene="TDEL0H02260"
                     /locus_tag="TDEL_0H02260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683248.1"
                     /db_xref="GeneID:11501249"
     CDS             complement(380933..381226)
                     /gene="TDEL0H02260"
                     /locus_tag="TDEL_0H02260"
                     /inference="similar to DNA sequence:INSDC:YER048W-A"
                     /note="similar to Saccharomyces cerevisiae ISD11
                     (YER048W-A); ancestral locus Anc_7.219"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683296.1"
                     /db_xref="GeneID:11501249"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:G8ZZP1"
                     /translation="MSATPTRGQVLKLYKQFMKNARQFNDYNFREYFIRRARIGFKEN
                     KDVHDSQKLNTLFKEAQRDLGVLKRQSVLSQMYTFDKLVVEPLIKSHGHSRGL"
     gene            complement(<381601..>382137)
                     /gene="TDEL0H02270"
                     /locus_tag="TDEL_0H02270"
                     /db_xref="GeneID:11501250"
     mRNA            complement(<381601..>382137)
                     /gene="TDEL0H02270"
                     /locus_tag="TDEL_0H02270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683249.1"
                     /db_xref="GeneID:11501250"
     CDS             complement(381601..382137)
                     /gene="TDEL0H02270"
                     /locus_tag="TDEL_0H02270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683297.1"
                     /db_xref="GeneID:11501250"
                     /db_xref="UniProtKB/TrEMBL:G8ZZP2"
                     /translation="MFATKVVYLIFSLIAIARSVIVVTNQSEYDAWSDALPDETYHQL
                     VEPNSASQNATVQAITNDGEVYATFTLTLNGTASQWYEEVTARWIAMEEAVAAGENAC
                     PLQVGYNEQDCSTLDSNGTSTLSNLYSTSTLSKRYSIINNCGWWCGNSPQCSGLTTKC
                     HKCKSLRQGWRKHCLLSW"
     gene            complement(382842..382913)
                     /gene="TDEL0Htrna6Q"
                     /locus_tag="TDEL_0Htrna6Q"
                     /db_xref="GeneID:11501251"
     tRNA            complement(382842..382913)
                     /gene="TDEL0Htrna6Q"
                     /locus_tag="TDEL_0Htrna6Q"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAA"
                     /db_xref="GeneID:11501251"
     gene            <383217..>383687
                     /gene="TDEL0H02280"
                     /locus_tag="TDEL_0H02280"
                     /db_xref="GeneID:11501725"
     mRNA            <383217..>383687
                     /gene="TDEL0H02280"
                     /locus_tag="TDEL_0H02280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683250.1"
                     /db_xref="GeneID:11501725"
     CDS             383217..383687
                     /gene="TDEL0H02280"
                     /locus_tag="TDEL_0H02280"
                     /inference="similar to DNA sequence:INSDC:YIL040W"
                     /note="similar to Saccharomyces cerevisiae APQ12
                     (YIL040W); ancestral locus Anc_7.218"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683298.1"
                     /db_xref="GeneID:11501725"
                     /db_xref="UniProtKB/TrEMBL:G8ZZP3"
                     /translation="MSSVREHPEQQLEEYIALFLTKLVRIIQIVIPLMAKFSKDHPHV
                     FLFFASALVIYVTWRVLCNMLVILKRLGFLLVLLFASFVFLRGFNQVFFQDIPLLYKI
                     VTGSQNFEVVLTKWTAYLGNTSFDHFVKVLHELNSKAQELAHSFRSKAASANLL"
     gene            <383876..>385039
                     /gene="TDEL0H02290"
                     /locus_tag="TDEL_0H02290"
                     /db_xref="GeneID:11501252"
     mRNA            <383876..>385039
                     /gene="TDEL0H02290"
                     /locus_tag="TDEL_0H02290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683251.1"
                     /db_xref="GeneID:11501252"
     CDS             383876..385039
                     /gene="TDEL0H02290"
                     /locus_tag="TDEL_0H02290"
                     /inference="similar to DNA sequence:INSDC:YER048C"
                     /note="similar to Saccharomyces cerevisiae CAJ1 (YER048C);
                     ancestral locus Anc_7.217"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683299.1"
                     /db_xref="GeneID:11501252"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR026894"
                     /db_xref="UniProtKB/TrEMBL:G8ZZP4"
                     /translation="MVKDTEYYDVLGVSPTATAMEIKKAYRKKAMQTHPDKNPDDPEA
                     ETKFQAVGEAYQVLSDTELRSRYDQFGKDDAVPQQGFEDAEEYFSAIFGGDGFKDWIG
                     EFSLFKDLNDASEMMDKGQNAEAPNSAGAIDSTSHTTSGEITKPDEKSKKLSKEQKEK
                     LIELEKKRREELARQVEELSKKLNERLDSFALAASQNRMDEFVTKLDHEIEELKLESF
                     GLELLYILAKVYKTKANNFIMSKKTRGISKIFTGVRDNARSVKSAYNLLSTGLDAQRA
                     LEQMNEVNVDELEDYERAKFESTMAGKALGVMWAMSKYELEKKLKDVCNKILNDPAVP
                     TKVRLVKAKGLLFMADRFAMAKRSPEEDEEARVFEELILGEKQREKQNKRKKI"
     gene            <385229..>386662
                     /gene="TDEL0H02300"
                     /locus_tag="TDEL_0H02300"
                     /db_xref="GeneID:11501253"
     mRNA            <385229..>386662
                     /gene="TDEL0H02300"
                     /locus_tag="TDEL_0H02300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683252.1"
                     /db_xref="GeneID:11501253"
     CDS             385229..386662
                     /gene="TDEL0H02300"
                     /locus_tag="TDEL_0H02300"
                     /inference="similar to DNA sequence:INSDC:YIL039W"
                     /note="similar to Saccharomyces cerevisiae YIL039W;
                     ancestral locus Anc_7.216"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683300.1"
                     /db_xref="GeneID:11501253"
                     /db_xref="GOA:G8ZZP5"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8ZZP5"
                     /translation="MISKPFVKRFATLATVLAVVANVYIYTYPSIHPTECSWHCYDDN
                     TGIGVIDQLSLWEKAVFYAKRYFDDVRDQTFGKVGPEFEDNEPEDIHLMAFGDPQIKG
                     VWKKTPYITRLDIFGNDFFLGHIASMMRKRLHPSHVVVMGDLFSSQWIGDSEFYNRTT
                     RYTSRIFGRDTTWLEKIKEKSHNSEGYKADWHAWGDSFNEIRSKEKPWDYGFHHSDVY
                     SWDPEKEDTLFINITGNHDIGYSGDITYQHMARFSELFGKANYWIEYDTDTDHPWRIV
                     VLNSLTLEGPALQPEFIETTWEFLYQLFERRFKGSTVLLTHVPFYKREGLCSDGPEFN
                     YYPADFEREAYKKNMLRSQNHLSEDVTNRVLNLIFDNNKQGIILTGHDHVGCETYYNK
                     NAREGTWSASKEKDSQDLTVQEITVKSMMGEFHGNTGLVSGHFNKLMGTWEWTFTLCP
                     FAVQHVWWFAKVTALLTGFLWSLYILI"
     gene            <386966..>389599
                     /gene="TDEL0H02310"
                     /locus_tag="TDEL_0H02310"
                     /db_xref="GeneID:11501254"
     mRNA            <386966..>389599
                     /gene="TDEL0H02310"
                     /locus_tag="TDEL_0H02310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683253.1"
                     /db_xref="GeneID:11501254"
     CDS             386966..389599
                     /gene="TDEL0H02310"
                     /locus_tag="TDEL_0H02310"
                     /inference="similar to DNA sequence:INSDC:YER047C"
                     /note="similar to Saccharomyces cerevisiae SAP1 (YER047C);
                     ancestral locus Anc_7.215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683301.1"
                     /db_xref="GeneID:11501254"
                     /db_xref="GOA:G8ZZP6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR015415"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZZP6"
                     /translation="MENSSNYHLLSKLSRLRKKPQQPLTDLTELYGRIANESIYFLKL
                     EEIGDYRAALQGWKALNTDAMYRLTLIDHEHPDVSSYTREETSIKSGVRELYHKSLKH
                     LERVKKLCDEDQSKQSSNGPRETIQHKVHENSSFVKRPHLQHTLNGSSRKMVTTLRDG
                     GPRGLSSSLRSRNSSESKRVPAASSSQNRVNFTASKPLVKSNASSINDGESTNERFEG
                     FDNETDLIDLTQTSDEEVLSTGKESAQASLEDDPFDFDFEDYYGDDDKTNGANDQDNE
                     ETRRLEIFGHIERQISNMSMNSPPMVPAPSLPSQDKPTTPRERPPVPTNQPPIPTNQP
                     PTSTNQPPVHTIRASIDPAPKTASRPGQPFQKSHNSTGALVPTNSSKTGSKPRPAGKL
                     NLPANTKATKSTPTLVNRQKIIQAPTQPSAGPTRPQTASTAAKRVLGLSTEPTHRAKP
                     NQHARQPMSKRAPVSTAKRPPTAAKPPLTIAADKKEAQESYIHANSRSSKDRSISPSS
                     ASSESLPSSRQRPNSETKETANPAPSVVAPPLPSSESGTENEQDGLKEMLEEEIINSL
                     RGVDKTAAKQIFAEIVVHGDEVHWDDIAGLESAKSSLKEAVVYPFLRPDLFRGLREPV
                     RGMLLFGPPGTGKTMLARAVATESHSYFFSISASSLTSKYLGESEKLVRALFAVAKKL
                     SPSIIFVDEIDSIMGSRNSEGENESSRRIKNEFLIQWSSLSSAAAGNNKDDAGDEDDE
                     RVLVLAATNLPWSIDEAARRRFVRRQYIPLPEPETRSVHLKRLLSHQKHTLTEEDFIT
                     LLTLTEGFSGSDITSLAKDAAMGPLRELGDKLLLTPTESIRSMALKDFQSSLNYIKPS
                     VSQEGLERYEDWAAKFGSSGI"
     gene            <389960..>391153
                     /gene="TDEL0H02320"
                     /locus_tag="TDEL_0H02320"
                     /db_xref="GeneID:11501255"
     mRNA            <389960..>391153
                     /gene="TDEL0H02320"
                     /locus_tag="TDEL_0H02320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683254.1"
                     /db_xref="GeneID:11501255"
     CDS             389960..391153
                     /gene="TDEL0H02320"
                     /locus_tag="TDEL_0H02320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683302.1"
                     /db_xref="GeneID:11501255"
                     /db_xref="GOA:G8ZZP7"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="UniProtKB/TrEMBL:G8ZZP7"
                     /translation="MPLTITPLEGQGFGGKVTLPKGCTDPSELSKEDFKALYEGLHKY
                     LVLVIPGMKDLKPESQWKLTTMFDPTCDQSGKSYGHGKEFRHDKSVLRRDGTSVPNFP
                     QVQVLGQGDWPAGHEGLGEFTLRHPVHFDFHKTPLTQEEAYDKHLTRFYRWHIDSALY
                     GLSPPVCTTLLGIHVPAHSNKLKVEYDDGDELEVTQGATAFVSGAKAFELLTPEEQKR
                     ALGTKVVYAPHPYIFISPARATSDGLTMVSEQKEMPLDELPPWEESKVKELPLVWTNP
                     VTKKHHLQVHGCCIHRLKYPDGTVLELEDARKEVHRMMRPAIASKYVYAHDWEAGDLA
                     IFYNRGVWHSVTGQFSPGERRLMHQCNIASGEDPVCVPEGFSAPSTGVSSTIVDMVGK
                     EEVVA"
     gene            complement(<391361..>393799)
                     /gene="TDEL0H02330"
                     /locus_tag="TDEL_0H02330"
                     /db_xref="GeneID:11501256"
     mRNA            complement(<391361..>393799)
                     /gene="TDEL0H02330"
                     /locus_tag="TDEL_0H02330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683255.1"
                     /db_xref="GeneID:11501256"
     CDS             complement(391361..393799)
                     /gene="TDEL0H02330"
                     /locus_tag="TDEL_0H02330"
                     /inference="similar to DNA sequence:INSDC:YIL038C"
                     /note="similar to Saccharomyces cerevisiae NOT3 (YIL038C);
                     ancestral locus Anc_7.214"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683303.1"
                     /db_xref="GeneID:11501256"
                     /db_xref="GOA:G8ZZP8"
                     /db_xref="InterPro:IPR007207"
                     /db_xref="InterPro:IPR007282"
                     /db_xref="InterPro:IPR012270"
                     /db_xref="UniProtKB/TrEMBL:G8ZZP8"
                     /translation="MAHRKLQQEIDRVFKKINEGLEIFDTYYERHENCTNNPSQKDKL
                     ESDLKREVKKLQRLREQIKSWQSSPEIKDKDSLLDYRRSVETAMEKYKAVEKASKEKA
                     YSNISLKKSDLLDPQERERRDVSEFLSGTIDELERQYDGLQVEVDRLILLNKKKKTAS
                     SANEQQKEQLKALQARYRWHQQQIELALRLLANEELDPDSVKEVQDDINYFVDSNQDP
                     DFVEDETIYDALNLQSNEAIAHEVAQYFASQLAEDNADEEDSRDASRLSKKEQRKLER
                     DAKKAAKAAAKSKPEEEVPASPVDESEAVELPKSKSASPEQKTTEPLKSVPSSAAVPA
                     TTKSPNGLGATIPKASLTSSTPSNNNHESHSGHTHIHQSLNGVTTTSTLKPATVPIRP
                     AGELKWAVAASQGVEKDKKISSSISATNVAGTVNNQTTASSTSASSAISSRATSATNT
                     PRLAAQSLEPSNLAQLDNSAYGSSNSLSANTAAAVLAAGAAAVHLNNKAIHRNNSSSH
                     QLAEALNYRNLSGDSSSKADLNQTENLEDVSAPDLVIDDYEPELTDDEIENEPVPEHL
                     SAEEYIKRTEAKEQMRKELIEDYELLLLPSGIQEFIMGTHLFTKGLEPLDGKVGGFRR
                     SCDTCNIPRFDEVPLGVNPPAPLDAFRSTQQWDITRCSLRSIIQNGDLNDDEKYEAII
                     EKFRSLEMFTLFYNYYFAVTPLEQTIASLVLSERNWKVSKSGTLWFLRQGEPKFANEV
                     CEVADYKIFKLDDWTVADKPNFKLDYAALKEAPATLPSAQKDQSIDTNGLNDLSHGQQ
                     LLQQLKQGKIAVSD"
     gene            complement(<394080..>395909)
                     /gene="TDEL0H02340"
                     /locus_tag="TDEL_0H02340"
                     /db_xref="GeneID:11501257"
     mRNA            complement(<394080..>395909)
                     /gene="TDEL0H02340"
                     /locus_tag="TDEL_0H02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683256.1"
                     /db_xref="GeneID:11501257"
     CDS             complement(394080..395909)
                     /gene="TDEL0H02340"
                     /locus_tag="TDEL_0H02340"
                     /inference="similar to DNA sequence:INSDC:YIL037C"
                     /note="similar to Saccharomyces cerevisiae PRM2 (YIL037C);
                     ancestral locus Anc_7.213"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683304.1"
                     /db_xref="GeneID:11501257"
                     /db_xref="UniProtKB/TrEMBL:G8ZZP9"
                     /translation="MYQLLTAPSLPQRLCQCAFQPILLTIVLSSLLTVWTSYAILISK
                     KDITSTSIVNGQSQTSTAIRNSTSTATFSSITTTTATDSSSAAIQTYYTVNTSVVEEA
                     ANEYIESKVSKWNDLINSRILPETYEGWQANLTLWNGTISQVLEAKKAGYNDLLTFSD
                     NIRTQLLNQSERVNETIDELSRTALTVGNVNGQEIIQNLSINYWFLDGMLGKVPEELQ
                     TVEDISHEVALPNVPNLTFSFTVENVTDTLKSVITNLTTELQELVSSQTSKTSIGASK
                     SLYRRSNDLNTQVRGDNQLYKKTCALSICICVFYAVTVALLCIYEWIRFSWEKDMFKL
                     HMADALEISDIEYELGTAKIKLQQRLRSFTRDLAFSLGDVVVYRLSNIMTLKQDSSDV
                     SWNRLSFFYWWIWSTGKTLWILLFCTLIHWQVLASLMKVRQYSEPEFSAPAQSKSITR
                     SPPTNSTYNSSFVYSAAIGACNNFKNDIDSIVITKITDDFEAFLSGPANEINSKMTNL
                     TATVAIAVQAPWENFTSSIDLPKITFDDSLTSTIITSAINYSVTVSANQIQKSNFQKS
                     SIQGPQETQNTPTLDPIFQWALIALTIAALIHHLFGFLILPRL"
     gene            complement(<396032..>396778)
                     /gene="TDEL0H02350"
                     /locus_tag="TDEL_0H02350"
                     /db_xref="GeneID:11501258"
     mRNA            complement(<396032..>396778)
                     /gene="TDEL0H02350"
                     /locus_tag="TDEL_0H02350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683257.1"
                     /db_xref="GeneID:11501258"
     CDS             complement(396032..396778)
                     /gene="TDEL0H02350"
                     /locus_tag="TDEL_0H02350"
                     /inference="similar to DNA sequence:INSDC:YER046W"
                     /note="similar to Saccharomyces cerevisiae SPO73
                     (YER046W); ancestral locus Anc_7.212"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683305.1"
                     /db_xref="GeneID:11501258"
                     /db_xref="UniProtKB/TrEMBL:G8ZZQ0"
                     /translation="MKRGRKPPGKQKLFLKDLDGLPEDIFVENERGVGLLGYPFFSAK
                     LLIPRIDPSNFQIVNTEDRLLRNISNASVHSIAGLYPLTKDEAREKANGPSKWFVLMD
                     FKDKLDMDDQGWLYSWHFSTERWKSKHGFVRRRVWVKLPERRGELALVPKESPPPLPT
                     TVSSVSSESMASSFVTANDDYEHLISDLKGMLLDRQRFERLDEAWQRGELDKISLRDK
                     EFCERVRKCFQYKSSQMRFEDDWLPNKLRP"
     gene            <397320..>398495
                     /gene="TDEL0H02360"
                     /locus_tag="TDEL_0H02360"
                     /db_xref="GeneID:11501259"
     mRNA            <397320..>398495
                     /gene="TDEL0H02360"
                     /locus_tag="TDEL_0H02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683258.1"
                     /db_xref="GeneID:11501259"
     CDS             397320..398495
                     /gene="TDEL0H02360"
                     /locus_tag="TDEL_0H02360"
                     /inference="similar to DNA sequence:INSDC:YER045C,YIL036W"
                     /note="similar to Saccharomyces cerevisiae ACA1 (YER045C)
                     and CST6 (YIL036W); ancestral locus Anc_7.211"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683306.1"
                     /db_xref="GeneID:11501259"
                     /db_xref="GOA:G8ZZQ1"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:G8ZZQ1"
                     /translation="MDEHDRHVQVAHGVPFRGSTAVPDGNLVHSQQQQLPHAAIDHQQ
                     VPFGDMMMHNEYLPTDSTHTNGNGLMANGTADSRNVLLAMTMNNPHLLTDPSIQETLS
                     PFFQPFGVDVSHLPMTNPPIFQSSLTRYDEPVRRRRISISNGQISQLGEDLETVENLY
                     NTQPPPLPPRFDQQHAAKPFFESSSVSGENSKNVLIHIQDNGEGTQGHSNVLPTIPPW
                     QSNNPVKEEEPKSLASLLQDNQGPLSTNGNPDPLPTAELSRNTSTSSSSSQFQGYQGQ
                     YGSNRMEPMPGTNAWKRARLLERNRIAASKCRQRKKVAQLQLQQEFDVMSKENRMMRK
                     KLDYYEKLVLKFKRFSEAHMKKCTDMQSFSIIEEMLMIDSGIREVDKDGLVVKIEEK"
     gene            <398629..>399799
                     /gene="TDEL0H02370"
                     /locus_tag="TDEL_0H02370"
                     /db_xref="GeneID:11501260"
     mRNA            join(<398629..398682,398738..>399799)
                     /gene="TDEL0H02370"
                     /locus_tag="TDEL_0H02370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683259.1"
                     /db_xref="GeneID:11501260"
     CDS             join(398629..398682,398738..399799)
                     /gene="TDEL0H02370"
                     /locus_tag="TDEL_0H02370"
                     /inference="similar to DNA sequence:INSDC:YER044C-A"
                     /note="similar to Saccharomyces cerevisiae MEI4
                     (YER044C-A); ancestral locus Anc_7.210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683307.1"
                     /db_xref="GeneID:11501260"
                     /db_xref="UniProtKB/TrEMBL:G8ZZQ2"
                     /translation="MPKNEFSLDSPTPVDWIICFALIKRRNSTLWRQVHRGSSGIHSK
                     VRSKSINALIPDSLSQLRVNKPLIMQLNIVYQCVRNFKKLANSKEVIRSLSDDITAND
                     ITRWVLPNYKNIVAILSMGESIDNRKSLKQLASCFQLLISSYCCFKVADPSKYVVDNL
                     LARIIRNDILTNKTKNSKIINQLYLKEGQSINKRELLKLHCKLIVLILNLQLGIAILP
                     NGEHSESNAVHFFHMMSSICFYLESLIHVYIAQISSKEDTAFQKHLACNQHYLKRTQS
                     LPQLHVNDLLLMLGKETERVQDRLDCLKMIIREFLKIFNDVQWSRLDSYVEQHEVHAC
                     AMKKRRLNIQSTLLVTGELELISAFRLINWPTWAISS"
     gene            complement(<399810..>400931)
                     /gene="TDEL0H02380"
                     /locus_tag="TDEL_0H02380"
                     /db_xref="GeneID:11501261"
     mRNA            complement(<399810..>400931)
                     /gene="TDEL0H02380"
                     /locus_tag="TDEL_0H02380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683260.1"
                     /db_xref="GeneID:11501261"
     CDS             complement(399810..400931)
                     /gene="TDEL0H02380"
                     /locus_tag="TDEL_0H02380"
                     /inference="similar to DNA sequence:INSDC:YIL035C"
                     /note="similar to Saccharomyces cerevisiae CKA1 (YIL035C);
                     ancestral locus Anc_7.209"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683308.1"
                     /db_xref="GeneID:11501261"
                     /db_xref="GOA:G8ZZQ3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8ZZQ3"
                     /translation="MKCKKWSESRVYTNANQIRGQEYWDYENTTIEWSQNNKHYEIEN
                     KVGRGKYSEVFQGVHLATKDSIVIKMLKPVKKKKIKREIKILTNLSIETNPPTSKPFD
                     KDAYYTNRKQEVLQFMRSYLYELPHNGHENIVQLLDVVRDPISRTPALVFENVNNVDF
                     RVLYPKFTDYDMRFYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKQKKLRLIDWGLA
                     EFYHANMEYNVRVASRFFKGPELLVDYRMYDYSLDLWSFGTMLASMVFQKEPFFHGTS
                     NTDQLVKIVRILGTADFEKYLLKYEITLPREFHDIDQYIRRPWRRFINDSNKHLCDND
                     EIIDLIDNLLRYDHQERLTAKEAMGHPWFEPIRKENSAT"
     gene            complement(<401417..>402253)
                     /gene="TDEL0H02390"
                     /locus_tag="TDEL_0H02390"
                     /db_xref="GeneID:11501262"
     mRNA            complement(<401417..>402253)
                     /gene="TDEL0H02390"
                     /locus_tag="TDEL_0H02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683261.1"
                     /db_xref="GeneID:11501262"
     CDS             complement(401417..402253)
                     /gene="TDEL0H02390"
                     /locus_tag="TDEL_0H02390"
                     /inference="similar to DNA sequence:INSDC:YIL034C"
                     /note="similar to Saccharomyces cerevisiae CAP2 (YIL034C);
                     ancestral locus Anc_7.208"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683309.1"
                     /db_xref="GeneID:11501262"
                     /db_xref="GOA:G8ZZQ4"
                     /db_xref="InterPro:IPR001698"
                     /db_xref="InterPro:IPR019771"
                     /db_xref="UniProtKB/TrEMBL:G8ZZQ4"
                     /translation="MSSTDSYDASLDLLRRLDPRRLKEHLQNLIKLEPSLAEDLLSSV
                     DTPLTIKRDPKASQREYLCCDYNRDIDSHRSPWSNEYYPELSPEDLKESPFPSTELRK
                     LEALANDSFDIYRDLYYEGGVSSVYLWELDEDNTDDFAGVVLFKNKDQSSSCWDSIHV
                     LEATRDGSDFTYRITTTIILHLDKGDQMSLSGNLTRQTERTVNVPAAESVTEEQLSVA
                     HITNLGTLIEDVESQMRTMLEAVYFEKTRDIFHQTKNSAPSAEEMNKEAHQELIKGLQ
                     GL"
     gene            <402741..>403187
                     /gene="TDEL0H02400"
                     /locus_tag="TDEL_0H02400"
                     /db_xref="GeneID:11501263"
     mRNA            <402741..>403187
                     /gene="TDEL0H02400"
                     /locus_tag="TDEL_0H02400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683262.1"
                     /db_xref="GeneID:11501263"
     CDS             402741..403187
                     /gene="TDEL0H02400"
                     /locus_tag="TDEL_0H02400"
                     /inference="similar to DNA sequence:INSDC:YER044C"
                     /note="similar to Saccharomyces cerevisiae ERG28
                     (YER044C); ancestral locus Anc_7.207"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683310.1"
                     /db_xref="GeneID:11501263"
                     /db_xref="GOA:G8ZZQ5"
                     /db_xref="InterPro:IPR005352"
                     /db_xref="UniProtKB/TrEMBL:G8ZZQ5"
                     /translation="MLSFQDVIRFTQNKLVSMPPGYLPKWLLFISVVSVFNSLQTYIS
                     GLELTRRVYENKPAETTSLSARTFGTWTFVSCVIRFYGAMYLQEEHIFQLTFISYLIA
                     IAHFGSELLIFRTCKLGKGFMGPLVVASTSLIWMYNQKEYYTGSGW"
     gene            complement(<403240..>404583)
                     /gene="TDEL0H02410"
                     /locus_tag="TDEL_0H02410"
                     /db_xref="GeneID:11501264"
     mRNA            complement(<403240..>404583)
                     /gene="TDEL0H02410"
                     /locus_tag="TDEL_0H02410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683263.1"
                     /db_xref="GeneID:11501264"
     CDS             complement(403240..404583)
                     /gene="TDEL0H02410"
                     /locus_tag="TDEL_0H02410"
                     /inference="similar to DNA sequence:INSDC:YIL033C"
                     /note="similar to Saccharomyces cerevisiae BCY1 (YIL033C);
                     ancestral locus Anc_7.206"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683311.1"
                     /db_xref="GeneID:11501264"
                     /db_xref="GOA:G8ZZQ6"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR002373"
                     /db_xref="InterPro:IPR003117"
                     /db_xref="InterPro:IPR012198"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018488"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:G8ZZQ6"
                     /translation="MPLSQEQKVEYDLYQSEVERQSPNDILQFSANYFNKRLEQQRVF
                     MKNQEAFALSKGITLFSRPSRSESVAAASTSIGGNGEERDVLFKSPFANQDPHATHED
                     EHLASNTPSQSSSATGLFKGNFNVGQESSKRMKSPLDPHSGDTKESKRKANVNHQPLP
                     LNFNAERRTSVSGETLQPDNFDDWTPAHYSEKNQDQLKRLAKSIGRNFLFNKLDDDSK
                     ILVINSLEEKMVKKGTEIIKQGDEGDYFYIVEEGSVEYLVDGTKVNSSGPGSSFGELA
                     LMYSSPRAATVIALTDCILWALDRITFRKILLGSSFKKRMMYDELLKSMPILKSLTTY
                     DRAKLADALDTEFYEPGQVIVKEGDVGENFYLIEYGECEVSKDGQGVVAQLKSRDYFG
                     EVALLNDLPRQATVTAKTKTKVATLGKSGFQRLLGPVVDVLKLNDPTRKAHSTSK"
     gene            complement(<404876..>407377)
                     /gene="TDEL0H02420"
                     /locus_tag="TDEL_0H02420"
                     /db_xref="GeneID:11501265"
     mRNA            complement(<404876..>407377)
                     /gene="TDEL0H02420"
                     /locus_tag="TDEL_0H02420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683264.1"
                     /db_xref="GeneID:11501265"
     CDS             complement(404876..407377)
                     /gene="TDEL0H02420"
                     /locus_tag="TDEL_0H02420"
                     /inference="similar to DNA sequence:INSDC:YFR038W"
                     /note="similar to Saccharomyces cerevisiae YFR038W;
                     ancestral locus Anc_7.205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683312.1"
                     /db_xref="GeneID:11501265"
                     /db_xref="GOA:G8ZZQ7"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZZQ7"
                     /translation="MGDSVGRTMTRSLRSNRNGLRRDYREKEESDLRADVNETDSDTE
                     DTGGKSDTEPIWLKDEVKDDSDVALDSDEESDERQLNELLRNSQSELQQKADDEDDED
                     DNLDEVDKQTVSLKLKKLNEFVKQSQVYSGVIADTLLERSMQKQEDQKAQEPPAKKQK
                     KGARSIVDFFKRKGEEKDEQNVSDVMDDKTIAEQQPALLKNCVLKGYQLEGLNWLITL
                     YENGLNGILADDMGLGKTIQSIALLAFIYEMDTKGPFLIAAPLSTVDNWMNEFEKFAP
                     DLPVLKYYHQGGYKERSKLLRKFFKNTKGTGVVVTSYEMIIRDSDQIMSKQWKFLIVD
                     EGHRLKNINCKLIQELKRINTTNRLLLTGTPLQNNLGELWSLLNFIMPEIFADFEIFN
                     KWFNFEDLDLQSDSSKLNRVINDELEKNLISNLHTILKPFLLRRLKKTVLAGILPPKR
                     EYIIDCPLTPMQNKLYRMGLSGKLKKTIFKELIKHFFTLNSRYIGNVSNKSIRDYINY
                     KLGDQAVDGPPSDILKKMDILYDEHLHKECTSIKLQNMMMQLRQIVDSTFLFYFPYMQ
                     PEDLTLEMLLSTSGKLQVLQKLLPPLIKKGHKVLIFSQFIKMLDLIEDWCELNSLNAL
                     RIDGSVDNETRKAQISQFNSPKDQTNVFLLSTRAAGLGINLAVADTVVLFDSDWNPQV
                     DLQAMDRCHRIGQVRPVIVYRLCCDNTVEHIILTRAASKRRLEKLVIQMGQFNTLRKL
                     ALNEKSFLQQSSTNTHGSRATNKELFQELSQLLLSGESSIGFNRNRKNKDQDNGQLTS
                     QELAELTDRSAKAYEANRTVELPHVRLFETSTGQL"
     gene            <407748..>409409
                     /gene="TDEL0H02430"
                     /locus_tag="TDEL_0H02430"
                     /db_xref="GeneID:11501266"
     mRNA            <407748..>409409
                     /gene="TDEL0H02430"
                     /locus_tag="TDEL_0H02430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683265.1"
                     /db_xref="GeneID:11501266"
     CDS             407748..409409
                     /gene="TDEL0H02430"
                     /locus_tag="TDEL_0H02430"
                     /inference="similar to DNA sequence:INSDC:YFR037C"
                     /note="similar to Saccharomyces cerevisiae RSC8 (YFR037C);
                     ancestral locus Anc_7.204"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683313.1"
                     /db_xref="GeneID:11501266"
                     /db_xref="GOA:G8ZZQ8"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:G8ZZQ8"
                     /translation="MSGAEDQIGNVEVGGAVGPALSGSAPPLLPHLQQQQMMQHEAAD
                     INYEQEAQKLEDKALRFLAKQAHPVIIPSFAAWFEFSEVHEIEKRSIPDFFDDSSRFK
                     TPKAYKDARNFMINTYRLSPYEYLTMTAVRRNIAMDVASIVKIHAFLEKWGLINYQID
                     PRSKPSLIGPSFTGHFQVILDTPQGLKPFVPAELVKDEEEAETKNEETTPSASHENTS
                     TEYKFIDREPFPVNLSLRESVYDTTQDFNALQSREKSSRQIHKTFVCHTCGNNAVVVH
                     YHNLRARDANLCSRCFQEGHFGANFQSSDFIRLENDTQTGKRQWSDQELLLLLEGIEM
                     YEDQWERIVDHVGNTKTMEECVEKFLSLPIEDQYINDIVRKTKIKSYKVQNGNGKQFT
                     TTEAVDATIKALLEGLNRQTLEETLPESAKKISVKYLQETQAVAQELVSLKVKKLDLK
                     FEKLDKLEAALQEEKTKYVEESEKILNDRISLSKQITDLNSELGKLNISKKLVLISDQ
                     VDSGIKLVEEEEGAGADKEPLQKQTDQEIQALSHAEPQMYQPWSL"
     gene            <409539..>410678
                     /gene="TDEL0H02440"
                     /locus_tag="TDEL_0H02440"
                     /db_xref="GeneID:11501267"
     mRNA            <409539..>410678
                     /gene="TDEL0H02440"
                     /locus_tag="TDEL_0H02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683266.1"
                     /db_xref="GeneID:11501267"
     CDS             409539..410678
                     /gene="TDEL0H02440"
                     /locus_tag="TDEL_0H02440"
                     /inference="similar to DNA sequence:INSDC:YIL023C"
                     /note="similar to Saccharomyces cerevisiae YKE4 (YIL023C);
                     ancestral locus Anc_7.203"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683314.1"
                     /db_xref="GeneID:11501267"
                     /db_xref="GOA:G8ZZQ9"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="UniProtKB/TrEMBL:G8ZZQ9"
                     /translation="MIALLHKLFVLLQVVKPVVAHKHDSDIADSYEHDPSAQLIHQIQ
                     DYLFPFSARYNSILATLLIQLAPCFIIFSIPGLKKSKTSGQSSSLLPVLVSFAFGTLL
                     GDILLHLIPEIFESIENTQPSFILIGSAIFTGFLAFLFLDKTLRVMSIGTGKEISLSS
                     HSHSHVQESDEIATSSSINAPQSTNGLKQRKTRNIATKPTRKAAKAHESHQKPNIAAY
                     LNIVTGCVHNITDGIALASSFYSSRHVGATTTIAVMFHEIPHEIGDFVILLSSGFTFP
                     QALKSQLVTSIGAMVGTAIGCALNEMPQSTSKTSTTSTHWLLQPDLLLPISTGGFIYI
                     ATVGVAPQVLQLTCSNKSQEARIWILQLVSIIAGFALMMALALLE"
     gene            <410878..>411507
                     /gene="TDEL0H02450"
                     /locus_tag="TDEL_0H02450"
                     /db_xref="GeneID:11501268"
     mRNA            <410878..>411507
                     /gene="TDEL0H02450"
                     /locus_tag="TDEL_0H02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683267.1"
                     /db_xref="GeneID:11501268"
     CDS             410878..411507
                     /gene="TDEL0H02450"
                     /locus_tag="TDEL_0H02450"
                     /inference="similar to DNA sequence:INSDC:YIL024C"
                     /note="similar to Saccharomyces cerevisiae YIL024C;
                     ancestral locus Anc_7.202"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683315.1"
                     /db_xref="GeneID:11501268"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:G8ZZR0"
                     /translation="MSSIQFVIPSEVIGSYWSPQDKVVITGEFDDWKHSDYVLQYLEN
                     EGFKVAIPRINGQEKAMFKLVINDREWITLAYFETTVDGSGHTNNVLNYQDYEIDESL
                     DDVTIGSARQESEQRQLLSYTAEVTTTPYVSPELLSPALAPQVALNDYVNISSHGELS
                     STEDLEFEPCDLDLEETLQYDSNTPFSSNQRPLNGLVSMVKKARTYWNS"
     gene            <411812..>415015
                     /gene="TDEL0H02460"
                     /locus_tag="TDEL_0H02460"
                     /db_xref="GeneID:11501269"
     mRNA            <411812..>415015
                     /gene="TDEL0H02460"
                     /locus_tag="TDEL_0H02460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683268.1"
                     /db_xref="GeneID:11501269"
     CDS             411812..415015
                     /gene="TDEL0H02460"
                     /locus_tag="TDEL_0H02460"
                     /inference="similar to DNA sequence:INSDC:YIL026C"
                     /note="similar to Saccharomyces cerevisiae IRR1 (YIL026C);
                     ancestral locus Anc_7.201"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683316.1"
                     /db_xref="GeneID:11501269"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR020839"
                     /db_xref="UniProtKB/TrEMBL:G8ZZR1"
                     /translation="MSAVRRSTRQRTKSSVGSSGEQDAGEVVVDTNTVVDEALSDEDQ
                     SSDEEEDVQDEDYEEPSNIKKRKATGQRSRPASKRGKTAGSNTSKGGTSSANSRKDQV
                     EFLEIVKGFEPTEMFEILATSEGISIDEVARDWLDTYRENRDVFVQEFINLLLCCCGA
                     VVHVEEHDVHSNESSNKTIEEVQLMFQNQKIHEFHLMISKNNRKKSKYPHLYENFVEL
                     MSRLMEVAINAQLICEESTEEGGQIVTGPFIVDLLTWLSSISVCKLRCLRYIATLTLY
                     LFQDYLTEHVVDLESRYLSKLTKQLKMEQRKKRPNTKTVQKLESNIEEYQGEKMVSRD
                     IIDNIIKLCFVHRFKDVDSTTRSLSMIHLSLWIQNYPEYFMKVTFLKYYGWLLSDSSA
                     EVRSRVLRILPQLITRQNNDLVDNSALRQFFERFKERILEIALKDEILDVRLHAVGVL
                     TEVAALGYLEDSEVLTISSLIFDDNEVKVSSRGKNSRFLMAAAKFFAQVTSERIAEFT
                     NSHDTPNELFEMTTTSLIKIGTFTKLLNESLVFYMKENTDVDSGKRVSTVFQAAEFLY
                     PFFGSLIEDMCRMLTYDGEFDHPSLRTESNMNEDDEEVYENQLLLPSEGNGNILYVTI
                     LFGLCYGGCNLKSQPRFDVAEAVLPHLDKLMTQLPVQSSNILSSLTGIFNLFSFEDWI
                     HTGYEKSIRKTLDKIVRAFSEASLSCSPTDLEYKSLSETVKHTKQLNLDELNEPWQNQ
                     IVHLKILLEKFLDERLLDHSEGFEEHITVLSTMFTNKLTLLGKFYPIEFDPSLLDKLL
                     ENYVLRIPSEKQNIQPAVAREMNLNVLTLLATWKVQKWTEIPEKRLPTNSNLSVPRSD
                     LQAVSKVIKSLDKVLRQLNDGDDFAKDSSNVALKLAVSDPLLDVLVAIKVVELGLSQS
                     ERSLELQLLEFFPTQLSESTCSALLSIFLYLESAYAQKSEIHLDRSPEEHANLNDLDD
                     ELITSDCEQQLLIFTIKLKGLVKLGLLRGHIAERIALNKDKLSPLFTQVVDDSIFDQA
                     KKGKYVGKQSHKRAPSIAEEPDDIDMLQDDPIDDSEI"
     gene            <415141..>415542
                     /gene="TDEL0H02470"
                     /locus_tag="TDEL_0H02470"
                     /db_xref="GeneID:11501270"
     mRNA            <415141..>415542
                     /gene="TDEL0H02470"
                     /locus_tag="TDEL_0H02470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683269.1"
                     /db_xref="GeneID:11501270"
     CDS             415141..415542
                     /gene="TDEL0H02470"
                     /locus_tag="TDEL_0H02470"
                     /inference="similar to DNA sequence:INSDC:YIL027C"
                     /note="similar to Saccharomyces cerevisiae KRE27
                     (YIL027C); ancestral locus Anc_7.200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683317.1"
                     /db_xref="GeneID:11501270"
                     /db_xref="InterPro:IPR018937"
                     /db_xref="UniProtKB/TrEMBL:G8ZZR2"
                     /translation="MGLISKLLLVLSIVLIGHSGFSSHEFHQLLKRGARESSSQIPKD
                     IKYETITGLVLFVLSAFLSFEKLSYYPLVGPKKSLTQGQYLEDIAMSKATNVDNLIGS
                     DPAGAVNYTPSFVDIINKREQVRQHIAKKDL"
     gene            complement(<415567..>415929)
                     /gene="TDEL0H02480"
                     /locus_tag="TDEL_0H02480"
                     /db_xref="GeneID:11501271"
     mRNA            complement(<415567..>415929)
                     /gene="TDEL0H02480"
                     /locus_tag="TDEL_0H02480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683270.1"
                     /db_xref="GeneID:11501271"
     CDS             complement(415567..415929)
                     /gene="TDEL0H02480"
                     /locus_tag="TDEL_0H02480"
                     /inference="similar to DNA sequence:INSDC:YFR036W"
                     /note="similar to Saccharomyces cerevisiae CDC26
                     (YFR036W); ancestral locus Anc_7.199"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683318.1"
                     /db_xref="GeneID:11501271"
                     /db_xref="GOA:G8ZZR3"
                     /db_xref="InterPro:IPR018860"
                     /db_xref="UniProtKB/TrEMBL:G8ZZR3"
                     /translation="MLRRPPTTLQLSQDDVAELIAEVEEEKLQLRIQSQRKNLIRSST
                     RLESGTVDDGNLAEPAGIDSSFQISPLDGKRLHAEASDGLPTATLNWSNRQNVDPNVS
                     GNTNNAEGNPFYSSQSRQ"
     gene            416099..416172
                     /gene="TDEL0Htrna2K"
                     /locus_tag="TDEL_0Htrna2K"
                     /db_xref="GeneID:11501272"
     tRNA            416099..416172
                     /gene="TDEL0Htrna2K"
                     /locus_tag="TDEL_0Htrna2K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:11501272"
     gene            <416399..>420133
                     /gene="TDEL0H02490"
                     /locus_tag="TDEL_0H02490"
                     /db_xref="GeneID:11501717"
     mRNA            <416399..>420133
                     /gene="TDEL0H02490"
                     /locus_tag="TDEL_0H02490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683271.1"
                     /db_xref="GeneID:11501717"
     CDS             416399..420133
                     /gene="TDEL0H02490"
                     /locus_tag="TDEL_0H02490"
                     /inference="similar to DNA sequence:INSDC:YIL030C"
                     /note="similar to Saccharomyces cerevisiae SSM4 (YIL030C);
                     ancestral locus Anc_7.198"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683319.1"
                     /db_xref="GeneID:11501717"
                     /db_xref="GOA:G8ZZR4"
                     /db_xref="InterPro:IPR011016"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G8ZZR4"
                     /translation="MDVDVDRETMSGVKNSDIPAGATCRICRGDATEDNPLFHPCKCK
                     GSIKYIHESCLMEWISSKNVDISKPGTTANCDICHYPINFSTTYAENMPDRIPVSLLV
                     KRSLISCFHFVKDGLTLNLAAVLFLIGIPLTWNFFGKLYTMILDGELPYKGDFHKSMA
                     YGYRDDISEGTSLLLQYTLNFRFSILQIVMVVILHISLYFQYDMIVRESVMSKMIFHK
                     IGPQYTKEELIKIQLKERFPMMDNQTIEHVARLMKARDEAGDAADTHDDSTADLGAEQ
                     NEESDEDDEPPNTGDSTGQENSTHETTDMDSSGDELEEERQDELVDDTLSEDEIDVPI
                     QRPFDAFMHRRAQNEFDELLDRQNEQANDQAVPILDGGRNEEEDAEGPMVEGAGEDDM
                     IQQAPPPIVINLKLKLINVLAYYIVAEVLVAVYLAVAYLLPTVVGYGLIKVAILFGTI
                     VQRGMVRLYYILQLFKIYHLALENVPYFEPLCGWMSKNVVSIWIYYYDGYVNNTLKSS
                     IVTRSLPALVTYIATISIISVSSELLCKGYGRENGVRNRTKRFIFQILFAIKCTFKVF
                     TLFFIELAGFPVLAGLMLDYSIFSPLLSPGKMLWAPQICTVWPPLIFFTYWTIGTLYM
                     YWFAKYIGMIRQHIIRPGVLFFIRSPDDPNIKILHDSLIHPMSIQVSRLCLSMFIYAV
                     FIIVGFGFHTRFLFPVLLKSKLLTTNNCIEHPQLIYVALFYITKQIVESKPSVKLYIR
                     KYWERAFDVSARKLRLSSFILGHDIPTERGHILYRNFFYRFFAKKSAEWSNPQLFTMP
                     KTLDQAKTLFREDPNIHAYFIPDGILMRVPSSDIVSRNYVQTLFVPVTKDDKLLRPLD
                     LEVIKARNQRNAGDFGYLDEQNTEFDAYSIVYTPPNFRMRYMSLLVFVWLFASLMVLL
                     TALLCQYSVATLLAFILLPATSLLSKSDSTYRTSKLFIKTKFQQLDLFFVCAGAIVLS
                     IALERYHAYKISRIVLSDHIVPVVNEDTNEPELNANNNVRLEARPAQDIRNVLRNILN
                     HGEAKFFIFLIGMLSVVFVRHVALLVNLRSLRYFGLGYISRKYFKDFEISISPTHLFE
                     ADFEELTFLLLQNLSTFYIGRKFANNRHRPLSAWFKLISGDLLGQLSFILYTTIPLVI
                     SWFTFTSLEYFLHSDRYTSFSAVVKFLWHYRLSPQSNDIPWTIPQHLCFSSLYVIMSS
                     YIVWKCAFAAKKWFGVAIQNVKDEVYAKGRSLQNFSGGDD"
     gene            complement(<420304..>423144)
                     /gene="TDEL0H02500"
                     /locus_tag="TDEL_0H02500"
                     /db_xref="GeneID:11501273"
     mRNA            complement(<420304..>423144)
                     /gene="TDEL0H02500"
                     /locus_tag="TDEL_0H02500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683272.1"
                     /db_xref="GeneID:11501273"
     CDS             complement(420304..423144)
                     /gene="TDEL0H02500"
                     /locus_tag="TDEL_0H02500"
                     /inference="similar to DNA sequence:INSDC:YIL031W"
                     /note="similar to Saccharomyces cerevisiae ULP2 (YIL031W);
                     ancestral locus Anc_7.197"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683320.1"
                     /db_xref="GeneID:11501273"
                     /db_xref="GOA:G8ZZR5"
                     /db_xref="InterPro:IPR003653"
                     /db_xref="UniProtKB/TrEMBL:G8ZZR5"
                     /translation="MSSKRRKTAGFVPVNNLFERNRMGSGQLRGGYGPVKRHTIQRDP
                     DVVAKIDSGSIGQEILAQDVRDGTRELHVIDEVPRVDSGGLLVDTDQNTNNVSYTISG
                     RISNIDSHNNVLERSKCLLIFRNDYDGPRICFKFQEQDIKNAYIDPQKDCQVILFDQE
                     DLTIAFVLHKSRLIRIDTRTQATRNGDSTLDPTYVILWESTDSTKISRIRENLKQFQT
                     CKIKVEASAESLMRNLSEYSVNETKSTPFLKKNLSSLERIRHSTQPSQAAHRIQVPSS
                     PERPDTTKKMREIKPAGFYSKLTDHAFSRTRSQTPNLVQSKLFSIDDDKDFETPEKFT
                     PRLCYKFDDGAGYTITNQDFKCLYNHDWINDTILDFFTKYYVERAIKESIIKREKVHI
                     MSSFFYTKLISDPTDYYVNVQNWVTNCDLFNKQYVVVPINMNFHWFGCIITNLDAILR
                     FFEKLSDNEKAKLARKPKDEPKVSPSPAGQDIISRLSSRSTTPLVAEEEDDDDSVSVS
                     APIIRILTFDSLRQTHSREIDPIKDFLIAYAKDKYGIDLDKSLIKMRTCAVPQQPNMS
                     DCGVHVILNTMKFFENPMSTIEVWRSAKSKSKVSSRIINEYFERNKRSSARRDLRDVL
                     WALQKEQIKTMEENNENPLQGDSSRVEEDEEDGDIEILEDLSKFQASLPQQKDTTSNL
                     EAQQQRIEGPAKKKAQQENEQIMIESFNGGSTFKESSELPKEFRRYESPDDKSRVASS
                     SMDGPSNRKYLESSPIRSSGGKGEATASGITSPYFGTSSLKGRSDAFESSGMKPLSSP
                     IFIKPRDGNDDKHMTQPPSSILSEFPIAEADEREQSESSSFSDADESRVTISDKANDS
                     DVNLLGYSDRGSSTQLRKDVEAELNEPIIGETIDLNYAGNLGSYHSELARKNVRDSHH
                     KFQDRSAPDFRVSEKLSPDANDDVQSIASESD"
     gene            <423430..>424686
                     /gene="TDEL0H02510"
                     /locus_tag="TDEL_0H02510"
                     /db_xref="GeneID:11501274"
     mRNA            <423430..>424686
                     /gene="TDEL0H02510"
                     /locus_tag="TDEL_0H02510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683273.1"
                     /db_xref="GeneID:11501274"
     CDS             423430..424686
                     /gene="TDEL0H02510"
                     /locus_tag="TDEL_0H02510"
                     /inference="similar to DNA sequence:INSDC:YIL022W"
                     /note="similar to Saccharomyces cerevisiae TIM44
                     (YIL022W); ancestral locus Anc_7.196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683321.1"
                     /db_xref="GeneID:11501274"
                     /db_xref="GOA:G8ZZR6"
                     /db_xref="InterPro:IPR007379"
                     /db_xref="InterPro:IPR017303"
                     /db_xref="UniProtKB/TrEMBL:G8ZZR6"
                     /translation="MIRGTVVSRSSVIAEGRLAGRALFSTSSGSLQNPRSPVQIFRDT
                     FKKEWKKSQELQDNIKTLQDASGRLGESEAYKRAREAYVRAQKGSTIVGKTLKKTGET
                     VENIASKAWDSEIARNTREAASKTAKKIDEGFEPVRQTKIYKDVSEVMDDGNSSRYGG
                     FITKEQRRLKREQDMLSGKRAKAVKGNEDAGTALVATDIEAKQSFGKKVEDFKEKTVL
                     GRTLHRLKNSLWDESVNPLIVFLRKITRKIGGFFAETEAARVLGQFKMMDPTFTNESF
                     TRHLREYVIPEILEAYVKGDEKVLKKWFSEAPYNVYAAQQKAFREQQLFADGKILDIR
                     GVEIVSAKMLPPQDIPVLVVGCRAQEIHLYRKAKTGEVAAGHESNIMMSSYAMVFTRD
                     PEQIDDEETEGWRILEFVRGGSRQFT"
     gene            complement(<424797..>425156)
                     /gene="TDEL0H02520"
                     /locus_tag="TDEL_0H02520"
                     /db_xref="GeneID:11501275"
     mRNA            complement(<424797..>425156)
                     /gene="TDEL0H02520"
                     /locus_tag="TDEL_0H02520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683274.1"
                     /db_xref="GeneID:11501275"
     CDS             complement(424797..425156)
                     /gene="TDEL0H02520"
                     /locus_tag="TDEL_0H02520"
                     /inference="similar to DNA
                     sequence:INSDC:Scer_YGOB_ADL119W"
                     /note="similar to Saccharomyces cerevisiae ADL119W
                     (Scer_YGOB_ADL119W); ancestral locus Anc_7.195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683322.1"
                     /db_xref="GeneID:11501275"
                     /db_xref="UniProtKB/TrEMBL:G8ZZR7"
                     /translation="MSANYPVPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVIN
                     ELQKAQPPSISKLVVCKVVLRDVIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSS
                     IYRLVLGTDLVKPKRRI"
     gene            <425329..>426264
                     /gene="TDEL0H02530"
                     /locus_tag="TDEL_0H02530"
                     /db_xref="GeneID:11501276"
     mRNA            <425329..>426264
                     /gene="TDEL0H02530"
                     /locus_tag="TDEL_0H02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683275.1"
                     /db_xref="GeneID:11501276"
     CDS             425329..426264
                     /gene="TDEL0H02530"
                     /locus_tag="TDEL_0H02530"
                     /inference="similar to DNA sequence:INSDC:YIL021W"
                     /note="similar to Saccharomyces cerevisiae RPB3 (YIL021W);
                     ancestral locus Anc_7.194"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683323.1"
                     /db_xref="GeneID:11501276"
                     /db_xref="GOA:G8ZZR8"
                     /db_xref="InterPro:IPR001514"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="InterPro:IPR011262"
                     /db_xref="InterPro:IPR011263"
                     /db_xref="UniProtKB/TrEMBL:G8ZZR8"
                     /translation="MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTL
                     AIDSVEIETNTTVLADEFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQ
                     AIGESESTTNVYAKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAK
                     KGISKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDA
                     FDYKAKANTFYMNVETVGSIATDQVVLRGIDTLQKKVASILLALNQMDQERVNFGTAN
                     NTGAIQDAGNVDVAMDGVQDQNPYSNGGGAYDEAW"
     gene            complement(<426295..>427089)
                     /gene="TDEL0H02540"
                     /locus_tag="TDEL_0H02540"
                     /db_xref="GeneID:11501277"
     mRNA            complement(<426295..>427089)
                     /gene="TDEL0H02540"
                     /locus_tag="TDEL_0H02540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683276.1"
                     /db_xref="GeneID:11501277"
     CDS             complement(426295..427089)
                     /gene="TDEL0H02540"
                     /locus_tag="TDEL_0H02540"
                     /inference="similar to DNA sequence:INSDC:YIL020C"
                     /note="similar to Saccharomyces cerevisiae HIS6 (YIL020C);
                     ancestral locus Anc_7.193"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683324.1"
                     /db_xref="GeneID:11501277"
                     /db_xref="GOA:G8ZZR9"
                     /db_xref="InterPro:IPR006062"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR011858"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G8ZZR9"
                     /translation="MTRFVGCIDLHNGQVKQIVGGTLTDKADDTPRTNFVSQHSSSHY
                     AQLYHDNKVTGCHVIKLGPNNDDAALQALKQAPNFLQVGGGINDTNCLQWLEYASKII
                     VTSWLFDKRGVFQLDNLVKLAQMCGKDRIVIDLSCRKKIDEQGTRWIVAMNRWQTLTD
                     LELNEETFKSLCEYSNEFLIHAADVEGLCRGIDEELVTKLYEWTKNLPSQIKIVYAGG
                     AKSASDLDLVDKLSHGKVDLTYGSALDIFGGSLVKFNDCCNWNESH"
     gene            <427236..>428102
                     /gene="TDEL0H02550"
                     /locus_tag="TDEL_0H02550"
                     /db_xref="GeneID:11501278"
     mRNA            <427236..>428102
                     /gene="TDEL0H02550"
                     /locus_tag="TDEL_0H02550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683277.1"
                     /db_xref="GeneID:11501278"
     CDS             427236..428102
                     /gene="TDEL0H02550"
                     /locus_tag="TDEL_0H02550"
                     /inference="similar to DNA sequence:INSDC:YIL019W"
                     /note="similar to Saccharomyces cerevisiae FAF1 (YIL019W);
                     ancestral locus Anc_7.192"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683325.1"
                     /db_xref="GeneID:11501278"
                     /db_xref="UniProtKB/TrEMBL:G8ZZS0"
                     /translation="MSDDLEVQRRAFEAQFGSLESMGFEDKTKRAEESETSDESSNDD
                     GREESDEREDNSEDESQDEEEKEEDDEDEVSEEESQPRVIKFQGPSDDYTPISKKEQR
                     LLRSGKPLRQEKSSEPVEESSEDDENLKNDIELQRFLKESHLLSALGNGTANVNDDSV
                     IGKARARTLEMRLRGLSETNGRSTTLEKMPVNVRKGMIKKHRKRIEKHETEAKEGGIV
                     LHNVKKGQFRQIDHTHRNDIERRIGSSIKKQQEQRNKRRQRGLRIQSVGKSTRNGLRI
                     SQQDIDRINNRK"
     gene            <428642..>430099
                     /gene="TDEL0H02560"
                     /locus_tag="TDEL_0H02560"
                     /db_xref="GeneID:11501279"
     mRNA            <428642..>430099
                     /gene="TDEL0H02560"
                     /locus_tag="TDEL_0H02560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683278.1"
                     /db_xref="GeneID:11501279"
     CDS             428642..430099
                     /gene="TDEL0H02560"
                     /locus_tag="TDEL_0H02560"
                     /inference="similar to DNA sequence:INSDC:YFR034C"
                     /note="similar to Saccharomyces cerevisiae PHO4 (YFR034C);
                     ancestral locus Anc_7.191"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683326.1"
                     /db_xref="GeneID:11501279"
                     /db_xref="GOA:G8ZZS1"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:G8ZZS1"
                     /translation="MEDSHEQMMDIPNASTSILDQVDDYLHDDHSSHHGSHHGSHHED
                     TTTATSTRSPTVDVNSSKENSHWVPDSMQVDLDHLSHTLFIHNADHVNDEESQLKKPD
                     SNLVRPEMVFSPMASPLVMPTRCTSAGTYDTPFMLPQPTTTSGPNTTNTTPFLNPSMA
                     SNSSTSLSSLRGTTRKQKHGGVSQFSPLSSPALTAIDQAQIVNFALPESTITSLPKSR
                     SRKKSAFSSSSANSKVVKSSPRMNATNSSRRQYAADQFKGNSPVIANEHSWDDVIFKL
                     PESSVKDTKWHNNDEPTPKSSSSSSGTPVAMMNYPKVILPSTAKPRYDDPKSPKETTQ
                     LIKVASNASENDRVIRATESPVIKPKMNQYQDTPVWKPNFKPSFSPRSDDAHIETKRF
                     TEPRPQTRKATSASSLQLSQGNGSSDDGELSKKEVHKVAEQGRRNRLNTALGDLNSLL
                     PPELKESIPIPSKATTVELACEYIRRLVATRNASE"
     gene            <430302..>430774
                     /gene="TDEL0H02570"
                     /locus_tag="TDEL_0H02570"
                     /db_xref="GeneID:11501280"
     mRNA            join(<430302..430379,430454..>430774)
                     /gene="TDEL0H02570"
                     /locus_tag="TDEL_0H02570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683279.1"
                     /db_xref="GeneID:11501280"
     CDS             join(430302..430379,430454..430774)
                     /gene="TDEL0H02570"
                     /locus_tag="TDEL_0H02570"
                     /inference="similar to DNA sequence:INSDC:YFR033C"
                     /note="similar to Saccharomyces cerevisiae QCR6 (YFR033C);
                     ancestral locus Anc_7.190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683327.1"
                     /db_xref="GeneID:11501280"
                     /db_xref="GOA:G8ZZS2"
                     /db_xref="InterPro:IPR003422"
                     /db_xref="InterPro:IPR023184"
                     /db_xref="UniProtKB/TrEMBL:G8ZZS2"
                     /translation="MISSITEFLEELKDSFVPTVAKAEDEDNEEEKGEDEDEDEDDED
                     EDDEDDEDDEDEEEAADQLDELREECRQTPEGKEVVHHYMECAERVHKQQEQPGYEDL
                     EYKEDCVEEFFHLQHYLDSCAAPRLFNKLK"
     gene            <431333..>431521
                     /gene="TDEL0H02580"
                     /locus_tag="TDEL_0H02580"
                     /db_xref="GeneID:11501281"
     mRNA            <431333..>431521
                     /gene="TDEL0H02580"
                     /locus_tag="TDEL_0H02580"
                     /product="60S ribosomal protein L29"
                     /transcript_id="XM_003683280.1"
                     /db_xref="GeneID:11501281"
     CDS             431333..431521
                     /gene="TDEL0H02580"
                     /locus_tag="TDEL_0H02580"
                     /inference="similar to DNA sequence:INSDC:YFR032C-A"
                     /note="similar to Saccharomyces cerevisiae RPL29
                     (YFR032C-A); ancestral locus Anc_7.189"
                     /codon_start=1
                     /product="60S ribosomal protein L29"
                     /protein_id="XP_003683328.1"
                     /db_xref="GeneID:11501281"
                     /db_xref="GOA:G8ZZS3"
                     /db_xref="InterPro:IPR002673"
                     /db_xref="UniProtKB/TrEMBL:G8ZZS3"
                     /translation="MAKSKNHTAHNQTRKAHRNGIKKPKTFKYPSLKGVDPKFRRNHK
                     HALHGTARTLAAERAAKK"
     gene            <431721..>432521
                     /gene="TDEL0H02590"
                     /locus_tag="TDEL_0H02590"
                     /db_xref="GeneID:11501282"
     mRNA            <431721..>432521
                     /gene="TDEL0H02590"
                     /locus_tag="TDEL_0H02590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683281.1"
                     /db_xref="GeneID:11501282"
     CDS             431721..432521
                     /gene="TDEL0H02590"
                     /locus_tag="TDEL_0H02590"
                     /inference="similar to DNA sequence:INSDC:YFR032C"
                     /note="similar to Saccharomyces cerevisiae YFR032C;
                     ancestral locus Anc_7.188"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683329.1"
                     /db_xref="GeneID:11501282"
                     /db_xref="GOA:G8ZZS4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8ZZS4"
                     /translation="MSSNESTRLYISNLNFSSTEPELYDYFKDYDVKSVLIPSQTVRG
                     FRSNQVRPLGIAYAEFESFEMVKDVIDNLNGKEFKGRELRLKTYVPYSPTVATKKLNK
                     TNHLSRLRRRKNQEHSEESELISNVEVVQREQEEEEKIVEEPELSEDTVYCGYLPKGV
                     TDVDIRHYFQEYNPQEIWIFRTKLTKSRHFQLHRHFTAALVSFEKGTSSQEISEAVSD
                     KKLLNKKIVVKPAYLDKVEELKQISKEKISIEQGNTEQQSQQSQPTNE"
     gene            <432980..>433837
                     /gene="TDEL0H02600"
                     /locus_tag="TDEL_0H02600"
                     /db_xref="GeneID:11501283"
     mRNA            join(<432980..432983,433077..>433837)
                     /gene="TDEL0H02600"
                     /locus_tag="TDEL_0H02600"
                     /product="60S ribosomal protein L2"
                     /transcript_id="XM_003683282.1"
                     /db_xref="GeneID:11501283"
     CDS             join(432980..432983,433077..433837)
                     /gene="TDEL0H02600"
                     /locus_tag="TDEL_0H02600"
                     /inference="similar to DNA
                     sequence:INSDC:YFR031C-A,YIL018W"
                     /note="similar to Saccharomyces cerevisiae RPL2A
                     (YFR031C-A) and RPL2B (YIL018W); ancestral locus
                     Anc_7.187"
                     /codon_start=1
                     /product="60S ribosomal protein L2"
                     /protein_id="XP_003683330.1"
                     /db_xref="GeneID:11501283"
                     /db_xref="GOA:G8ZZS5"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR014726"
                     /db_xref="InterPro:IPR022666"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="InterPro:IPR022671"
                     /db_xref="UniProtKB/TrEMBL:G8ZZS5"
                     /translation="MGRVIRNQRKGAGSIFTSHTRLRQGAAKLRTLDFAERHGYIRGV
                     VKQIVHDAGRGAPLAKVVFRDPYKYKLREEIFIANEGVHTGQFIYAGKKASLNVGNVL
                     PLGSLPEGTIVSNVEEKPGDRGAIARASGNYVIIIGHNPDENKTRVRLPSGSKKIISS
                     NARGVVGVVAGGGRVDKPLLKAGRAFHKYRVKRNSWPKTRGVAMNPVDHPHGGGNHQH
                     IGKASTISRGAVSGQKAGLIAARRTGLLRGSQKTQD"
     gene            <434116..>437628
                     /gene="TDEL0H02610"
                     /locus_tag="TDEL_0H02610"
                     /db_xref="GeneID:11501284"
     mRNA            <434116..>437628
                     /gene="TDEL0H02610"
                     /locus_tag="TDEL_0H02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683283.1"
                     /db_xref="GeneID:11501284"
     CDS             434116..437628
                     /gene="TDEL0H02610"
                     /locus_tag="TDEL_0H02610"
                     /inference="similar to DNA sequence:INSDC:YFR031C"
                     /note="similar to Saccharomyces cerevisiae SMC2 (YFR031C);
                     ancestral locus Anc_7.186"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683331.1"
                     /db_xref="GeneID:11501284"
                     /db_xref="GOA:G8ZZS6"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR024704"
                     /db_xref="InterPro:IPR027120"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZZS6"
                     /translation="MKIEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDA
                     ICFVLGISAMTTVRASSLQDLIYKRGQAGVTKASVTVVFDNSDKSNSPIGFTNSAKIS
                     VTRQVMLGGSSKYLINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE
                     ILSLIEEAAGTKMFEDRKDKAERTMAKKEAKLEENRALLVEEIEPKLGKLRSEKEIFI
                     KFQETQSELEKTERVVYAFDYHNMINKSSSLKQHLNSSNKRSEQLKELISRTSDEISS
                     LNEDLEETKRNKQKEIDEQGTLANLEEREGQLLNEISRIQTQLGICKDNSDDTKQKLS
                     DAKEYIKKCSASLETKSVSYKKTEEEYQKLNDALEQLKGTHKQKEELLSTLQTGISST
                     GATDGGYNEQLILAKQSLNECELSVRKLNLKIDHLKKEHTLNVPKLQQAESEHAESLK
                     HVQKCQKSCDELQKIITKFGYDETLVESLKQEENNLRHEISRLNNESSYLRRKVANVD
                     FTYSKPTHDFNPRSVKGVAAQLFTLAEDNYDSATALQVCAGGRLYNVVVDNERTASQL
                     LEKGRLRKRVTIIPLNRIAARALNSQTLQLAQKTAPGKVELALNLVGYEEEVSRAMEF
                     IFGNSLICKDAETAKKITFHPQIRTRSITLQGDVYDPEGTLSGGSRNNTSSLLIDVQK
                     YNKTAKRIEELELKLKSITRDLEEQESKLQKTRSVRNDLNLATHKLTLAQRSLESNQA
                     AHIIRKNEELIKEIDESQKEIASKRSSISDCEKEIQRIQTDIQEFSTDKGSKLKQLKD
                     EVSKLFKEIGILETKVESKYDSYQTFQLDTEQLAGEIASGNDTVKQLSELQQTLEGER
                     RSLEENLGMNQTELDNVQVELKAEQSRLVDINEELKELDTVIKTKTEAKNNYELELQK
                     LSNDLNKFKNNSSSIYEKISSLEQEHDWLKDGALVAGIIQQSGEVNLEQMKKRVEHLQ
                     KQFQDMRRKVNPNIMSMIESVEKKEAALKAMIDTIEKDKVKIQETIHKLNEYKKDTLI
                     KTWKKVTVDFGQVFADLLPNSFAKLVPLEGKEVTEGLEFKVRLGSIWKESLVELSGGQ
                     RSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKE
                     GMFTNANRVFRTRFQDGTSVVSIM"
     gene            complement(<437838..>440957)
                     /gene="TDEL0H02620"
                     /locus_tag="TDEL_0H02620"
                     /db_xref="GeneID:11501285"
     mRNA            complement(<437838..>440957)
                     /gene="TDEL0H02620"
                     /locus_tag="TDEL_0H02620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683284.1"
                     /db_xref="GeneID:11501285"
     CDS             complement(437838..440957)
                     /gene="TDEL0H02620"
                     /locus_tag="TDEL_0H02620"
                     /inference="similar to DNA sequence:INSDC:YFR030W"
                     /note="similar to Saccharomyces cerevisiae MET10
                     (YFR030W); ancestral locus Anc_7.185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683332.1"
                     /db_xref="GeneID:11501285"
                     /db_xref="GOA:G8ZZS7"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR002869"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR019752"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G8ZZS7"
                     /translation="MPVSYLTNPFDEPTDPTKLPTYGSPTAAISSVLYNNLKTIFSYK
                     TFSEPDLLDVSLKKWIKRSTNDVYFQEVDLRVGAGLAPLGYSRNSSDVTGIVAPGYAL
                     PYFVDSFQQAKGSESSFLFNVGSLNYDEKTGAIGSDYVTPLEAAVKLGFPVVTPVSSD
                     EAQSVALLALALAKFGQKKGAINLFDGVSYAKSISEIREKLPQKESLTKIEKLLPVDA
                     SFEDVLDTFNETTGLKLHNFHYTGAVDAETVFVTYGSLESQLFNDALEANDSKTALVS
                     VRVPLPFDMERFAAQIPKTAKRVVVIGQSLDGTAPSLLKRQVSAALFYHGNYSVNVSE
                     YIFQPNFIWSPAAVEQVVAGFVPNSNFNEEKSEAKSFIYWSSDKSANIDLSSRLVHAL
                     SLIDGQTVSLRTKFDNITNAGTFQAQFTVAPASNRTTVSNIDQADVAIVENIALLDSL
                     QVAATVKEQGTILVISQKSLNDQDMKCGETYVKTLGINESFFKAVAERKIKVVIIDAE
                     TIGDREETRGRTLSFVTQAVFWKYAFGHDVAESVRRIWSSAGPDIELLAAVLSDTITT
                     ALENGVKEVPAEAFNDIIKDVKETEKKEEPILELPIFVTETSFGPNTSQIEEVPEAEV
                     GKITDITKKLVFSEAYGVDRKLRPDLPVKNYVVKVKENRRVTPSDYDRYIFHIEFDIS
                     GTGMTYDIGEALGVHARNNEAQVKKFLATYGLNENDIVLVPNKDDSGVLESRTVLQAF
                     VENLDIFGKPPKKFYESLIEFATNEDEKKKLEDLVSATGAVELKRFQDVEYYSYADVF
                     ELFPSVRPQLEDLVTIIAPLKRREYSIASSQKVHKNEVHLLIVVVDWVDNKGRKRFGQ
                     ASKYLSDLAVGSELVVSVKPSVMKLPPNPEQPVIMSGLGTGLAPFKAIVEEKLWQKQQ
                     GYDIGQVFLYLGSRHKREEYLYGELWEAYKDAGIITHIGAAFSRDQPQKIYIQDRIKE
                     NLKELKVAMIDQVGSFYLCGPTWPVPDITQALQDILAADAKERGVKIDLDAEIEELKE
                     TSRYILEVY"
     gene            complement(<441254..>443893)
                     /gene="TDEL0H02630"
                     /locus_tag="TDEL_0H02630"
                     /db_xref="GeneID:11501286"
     mRNA            complement(<441254..>443893)
                     /gene="TDEL0H02630"
                     /locus_tag="TDEL_0H02630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683285.1"
                     /db_xref="GeneID:11501286"
     CDS             complement(441254..443893)
                     /gene="TDEL0H02630"
                     /locus_tag="TDEL_0H02630"
                     /inference="similar to DNA sequence:INSDC:YIL017C"
                     /note="similar to Saccharomyces cerevisiae VID28
                     (YIL017C); ancestral locus Anc_7.184"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683333.1"
                     /db_xref="GeneID:11501286"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8ZZS8"
                     /translation="MGATREELRKLCDSLVGDQLAKVELLTSASPEFLDELVDFGVLS
                     SLQDVKLDILFTVLHLDEYIRDELGELYIDMVAKIYDERTLASDLVANDPLINYKYVR
                     LINLCVNFCPPCVYPYMASLQEGFVHLISRSLGGRQDDEEMYLKDLATITELSNFFLI
                     EKDSLDPELLCHLEGLLKQIVDKYSYELHFSYAIRIKIAKTSSAAARYDPLSNKGIEM
                     NNTVPNAVNIQNSMDRRLISLGLALYSTPTEAEHYSYNNMLSLWQDSHFCTFVTSMLK
                     SGDINLRCSALAFLTHPYFVDHNTWDQKQRVKQILPYLVDCLNYQPLPWWFDPFDTLD
                     SLIELYHMHEPLDNPVIIFLSKTNIMYGLLTLFADCLSLKQQSRSSLRSTTKFIKLCA
                     SFAAYDELYRSLLLEQKSLLHHLEFGMETHLKLLKDFLSHKQVIMDSCDKAEMLPPLY
                     DSQLVVAWLLLLKSFSRSVSALRTSLKRNKLAELLLELLQTTYQVTQECGFAGKEFLS
                     AEIDVMGITLGCICNFVVEFSNLQSFMLSNGIVDITGEILKPTIGTCLSAIHEFKANA
                     VKTNALWVLRHLMYNCQNAEKLDLLSKIPMSTILEYINDPSWPVQEQCFQLIRNLTCN
                     SRKVVNILLEKFKDIKFENDPKTSARIGRGTTYLFQFLARKIKLIDPTDIIQRKTLEG
                     VLYIIVNLAAVNENKKELVIEQDEILSLLGDILSETRQKVERYGNDSKLKLASLWVLN
                     NLLWNSTISNYTQYALEGYAPSQKDEAGSNQSPMSPFAGEGDINESMINDEEEDDEDE
                     ENNNDPDDDDDDEGNEFVHGSSSTTDLSRAANSAAIKRCKKLVDMGIYDLVKQNVFDE
                     SLSVREKARTLQYHMDMLLKENL"
     gene            <444260..>444766
                     /gene="TDEL0H02640"
                     /locus_tag="TDEL_0H02640"
                     /db_xref="GeneID:11501287"
     mRNA            <444260..>444766
                     /gene="TDEL0H02640"
                     /locus_tag="TDEL_0H02640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683286.1"
                     /db_xref="GeneID:11501287"
     CDS             444260..444766
                     /gene="TDEL0H02640"
                     /locus_tag="TDEL_0H02640"
                     /inference="similar to DNA sequence:INSDC:YIL016W"
                     /note="similar to Saccharomyces cerevisiae SNL1 (YIL016W);
                     ancestral locus Anc_7.183"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683334.1"
                     /db_xref="GeneID:11501287"
                     /db_xref="GOA:G8ZZS9"
                     /db_xref="InterPro:IPR003103"
                     /db_xref="UniProtKB/TrEMBL:G8ZZS9"
                     /translation="MNCIIDFYRANLKPLVAQYAPDDSEVSSTLYMTGAAAIIVTAII
                     WRSLGISSSNRIKRQQAKKKDSKHKKDVKLEPLTFEKKIDNVRLRFNKEYKPGIDQLL
                     ENYDPADKDKVYQRNFYNEMLLKLLIELDGVELVEVQGERKIALKEQRKGVIREIQTH
                     LKTLDKLI"
     gene            <445052..>446710
                     /gene="TDEL0H02650"
                     /locus_tag="TDEL_0H02650"
                     /db_xref="GeneID:11501288"
     mRNA            <445052..>446710
                     /gene="TDEL0H02650"
                     /locus_tag="TDEL_0H02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683287.1"
                     /db_xref="GeneID:11501288"
     CDS             445052..446710
                     /gene="TDEL0H02650"
                     /locus_tag="TDEL_0H02650"
                     /inference="similar to DNA sequence:INSDC:YIL015W"
                     /note="similar to Saccharomyces cerevisiae BAR1 (YIL015W);
                     ancestral locus Anc_7.182"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683335.1"
                     /db_xref="GeneID:11501288"
                     /db_xref="GOA:G8ZZT0"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:G8ZZT0"
                     /translation="MILFRFAYITLITNFFISLVYSTPTSVLKYSAGHLHIPIKKVDN
                     LSKRKLQRRKSTEIDLQHESGIYYSAILEIGTSHQELPVLFDSGSSDMWVSSSSNPYC
                     LESEGYVNQTYNGETVTPFIDCKALGTFDYNGSSSFERLDIGRFYIKYSDESFADGFW
                     AKEKLRLNGIDISTLQFGVADYATVPVGGVLGIGFPRRESVKGYDDAPNEFYPNFPQV
                     LKNEGVIGVAAYSMFLNEVSSDAGSILFGAVDPTKYTGSLYTFPMVNEYPNVVDKPAT
                     LAMTLQALGAKSDSSCKYKTFTTTKQAVLLDSGTTLMTAPPEIAEEMAFFCWGPTYNE
                     SEGIFYFDCPSDDDDTEFIFDFGDLKITLPLASLVISSSGDGHCGFGLTPASYSMTLG
                     AIFLSSAYVVYDLDNYQISIAQAKWDGNPSQKSRVRIPKDGTIYGATKATATPWTTDE
                     PVKVDYDMFEDHSSCIASQNETNQTSSESSSSMTSPVNSTSLSLQVSVTSTTADSQPT
                     ADQTSTTLDAEPSSIVFPDDNKAVTIVVTATTTVASSNMCQCTF"
     gene            <446985..>447698
                     /gene="TDEL0H02660"
                     /locus_tag="TDEL_0H02660"
                     /db_xref="GeneID:11501289"
     mRNA            <446985..>447698
                     /gene="TDEL0H02660"
                     /locus_tag="TDEL_0H02660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683288.1"
                     /db_xref="GeneID:11501289"
     CDS             446985..447698
                     /gene="TDEL0H02660"
                     /locus_tag="TDEL_0H02660"
                     /inference="similar to DNA sequence:INSDC:YBR256C"
                     /note="similar to Saccharomyces cerevisiae RIB5 (YBR256C);
                     ancestral locus Anc_7.181"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683336.1"
                     /db_xref="GeneID:11501289"
                     /db_xref="GOA:G8ZZT1"
                     /db_xref="InterPro:IPR001783"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023366"
                     /db_xref="InterPro:IPR026017"
                     /db_xref="UniProtKB/TrEMBL:G8ZZT1"
                     /translation="MFTGIVEQIGTVLEYHNYDDSESGGKGVSVTITDASQVLGDCHI
                     GDSIAINGICLTVTEFNENTFKVGISPETIKRTNVASWTKGSKVNLERAVSQDVRFGG
                     HYVQGHVDTVATIVSKEPEGNSIIFGFKLRDSEYNKFIVEKGFICIDGTSLTIIKVDH
                     NEAFFISMIKHTQENVVMPLKSIGDEVNIEVDLTGKIIEKQVTLALENQIELKSSPFT
                     QMIERIVEEKVENYMKNQK"
     gene            complement(<447727..>449049)
                     /gene="TDEL0H02670"
                     /locus_tag="TDEL_0H02670"
                     /db_xref="GeneID:11501290"
     mRNA            complement(<447727..>449049)
                     /gene="TDEL0H02670"
                     /locus_tag="TDEL_0H02670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683289.1"
                     /db_xref="GeneID:11501290"
     CDS             complement(447727..449049)
                     /gene="TDEL0H02670"
                     /locus_tag="TDEL_0H02670"
                     /inference="similar to DNA sequence:INSDC:YIR012W"
                     /note="similar to Saccharomyces cerevisiae SQT1 (YIR012W);
                     ancestral locus Anc_7.180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683337.1"
                     /db_xref="GeneID:11501290"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8ZZT2"
                     /translation="MSEGVEDQQQGYEGTPRDEFIDTTEVEQEIALGDDDDAPMDEDD
                     DEEGDEIPEGDEMENETLEIDMSNNSVTYFDKHTDSVFIVFHHPTLPLVCTGGGDDVA
                     HLWTSHSQPPKFAGTLTGHTESVIAGSFTCDGQFLVTADMTGKVLVHMSHKGGSQWKK
                     VSELQEVDEVVWLICHPTIPGIFAFGAIDGSVWCYQIDGSKGSLEQLMSGFVHQQDCS
                     AGAFINVDKGENTLELVTCSLDSTIVGWNCFTAQPLFKIAQENIKGLEAPWVSISVAP
                     ASLTNGNAAVVACGSNNGVLAVINCNNEGSVLHLSQVIELKEEDDELDASIESIAWSQ
                     NFPLMAVGLVSGDILLYETKTWKIRHKFLLPDSVTKLLFDGDDLFASGIDGKVYQFDA
                     RMGKEKFVCTGHNMGVLDFALVKKDDSSLRRVITAGDEGVSLVFEVPN"
     gene            <449467..>450411
                     /gene="TDEL0H02680"
                     /locus_tag="TDEL_0H02680"
                     /db_xref="GeneID:11501291"
     mRNA            <449467..>450411
                     /gene="TDEL0H02680"
                     /locus_tag="TDEL_0H02680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683290.1"
                     /db_xref="GeneID:11501291"
     CDS             449467..450411
                     /gene="TDEL0H02680"
                     /locus_tag="TDEL_0H02680"
                     /inference="similar to DNA sequence:INSDC:YIR011C"
                     /note="similar to Saccharomyces cerevisiae STS1 (YIR011C);
                     ancestral locus Anc_7.179"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683338.1"
                     /db_xref="GeneID:11501291"
                     /db_xref="GOA:G8ZZT3"
                     /db_xref="InterPro:IPR013868"
                     /db_xref="InterPro:IPR029449"
                     /db_xref="UniProtKB/TrEMBL:G8ZZT3"
                     /translation="MNNNSQMGAYSAGFSWGFKSATVVKSPQQEDEGAVAQLLREDAN
                     AKRRSKRAFTGSEEEEQQSSSQSSNVHRKYMISKRKSNLSSTIQGQPLPIQRGLELMS
                     KEQLQNVLMEVLKDHPQTQQMVSSRIMGFNFSIEKCSELLKTKLEALYGSVPYSRSYE
                     MNSLDDYAFVRMKPYILEFLNCLIDCILDQIPPRVENLHTSLKFLDECTDMVTHLPRF
                     QLASNNYYYDKCLEQVSYVWCTVIEHIARDVIMAFNDEALLGSWVQKLEVYNDLSNGM
                     LSRPLQLFKSLHCVEDGAPSSTRNPQTFSSNGAVAYKP"
     gene            <450548..>450982
                     /gene="TDEL0H02690"
                     /locus_tag="TDEL_0H02690"
                     /db_xref="GeneID:11501371"
     mRNA            join(<450548..450610,450665..>450982)
                     /gene="TDEL0H02690"
                     /locus_tag="TDEL_0H02690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683291.1"
                     /db_xref="GeneID:11501371"
     CDS             join(450548..450610,450665..450982)
                     /gene="TDEL0H02690"
                     /locus_tag="TDEL_0H02690"
                     /inference="similar to DNA sequence:INSDC:YBR255C-A"
                     /note="similar to Saccharomyces cerevisiae YBR255C-A;
                     ancestral locus Anc_7.178"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683339.1"
                     /db_xref="GeneID:11501371"
                     /db_xref="UniProtKB/TrEMBL:G8ZZT4"
                     /translation="MGGQVQPIHYDPATVKQLTKEIAIASVIGAAQGAAISVVSGLLL
                     RRFSTVYRNVRTQVRVFYHCSWISMGAVFQADKQLLKFQANYYEKELQRRSRILDEAA
                     ERGIFLEEEAALSSTVPQPPSASK"
     gene            complement(<451146..>452831)
                     /gene="TDEL0H02700"
                     /locus_tag="TDEL_0H02700"
                     /db_xref="GeneID:11501372"
     mRNA            complement(<451146..>452831)
                     /gene="TDEL0H02700"
                     /locus_tag="TDEL_0H02700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683292.1"
                     /db_xref="GeneID:11501372"
     CDS             complement(451146..452831)
                     /gene="TDEL0H02700"
                     /locus_tag="TDEL_0H02700"
                     /inference="similar to DNA sequence:INSDC:YBR255W"
                     /note="similar to Saccharomyces cerevisiae YBR255W;
                     ancestral locus Anc_7.177"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683340.1"
                     /db_xref="GeneID:11501372"
                     /db_xref="UniProtKB/TrEMBL:G8ZZT5"
                     /translation="MVETDKGLDYVETSNDEVHVHAKPERLKMVTKLLMDNKFGLMDD
                     LNYTRALPESYENMFSPEDKFGQPNGDSNKIPGAEQRPPILAIPRSTRIKAERVRIYM
                     DFYYNVMDRCINLESHDHHHDGVEGVYNPLQVIRNRKLRKKYREMPPRELFVQKAPVI
                     AIKQFSSKPNKKMPWFVEVSERSSDLTWRTSHWDELVDPHGNLWFRPNKSLTASPTKE
                     QHRHHRPHIRRRTSSHLELPSSSPYYMSGINPSSPELRGQHRDSVSDVSAFSHSELPM
                     SHLVAPEPGTSLDENEKSRLNRFEMIIGNRPKRWSKSPNLRRRSHDSVEKLSLPMSKG
                     ESYNTGTSDHSRASSTSMANITGNSYMTPMDPQGPRTTLLSALPIRPVRRSSQEKDAV
                     HVEHVESGRGQTYEDTESLDPLEPLNKSVQTDKQLEKFWWDARYMAGTLRIMHHRRIT
                     HSIVKDWGIRKRNKMQCDENMDSILSDTSKVLGTYDRELDKAFKRGNLLASSILNDYS
                     MRVETLISTTDRILSDINTSLTLRLKLFQEDVDKFGNLRMMRAQKLTKFFTES"
     gene            <453009..>453539
                     /gene="TDEL0H02710"
                     /locus_tag="TDEL_0H02710"
                     /db_xref="GeneID:11501373"
     mRNA            <453009..>453539
                     /gene="TDEL0H02710"
                     /locus_tag="TDEL_0H02710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683293.1"
                     /db_xref="GeneID:11501373"
     CDS             453009..453539
                     /gene="TDEL0H02710"
                     /locus_tag="TDEL_0H02710"
                     /inference="similar to DNA sequence:INSDC:YBR254C"
                     /note="similar to Saccharomyces cerevisiae TRS20
                     (YBR254C); ancestral locus Anc_7.176"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683341.1"
                     /db_xref="GeneID:11501373"
                     /db_xref="GOA:G8ZZT6"
                     /db_xref="InterPro:IPR006722"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:G8ZZT6"
                     /translation="MPQYFAIIGKRDNPVYEAEFTAQQGQQGQVQQGFPQNLKELNPF
                     ILHASLDIIEDLQWKTNPNTQSGSNSGGGGGFLRSRNVANVDNCYLCKVDHFYGLAVT
                     AYLTYGGMKFVMIHGNMNNGDVQIDDNSVRAFYQEVHELYIKTLMNPFYKINDPITSP
                     AFDSRVRALARKYLNK"
     gene            complement(<453565..>455109)
                     /gene="TDEL0H02720"
                     /locus_tag="TDEL_0H02720"
                     /db_xref="GeneID:11501374"
     mRNA            complement(<453565..>455109)
                     /gene="TDEL0H02720"
                     /locus_tag="TDEL_0H02720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683294.1"
                     /db_xref="GeneID:11501374"
     CDS             complement(453565..455109)
                     /gene="TDEL0H02720"
                     /locus_tag="TDEL_0H02720"
                     /inference="similar to DNA sequence:INSDC:YIR010W"
                     /note="similar to Saccharomyces cerevisiae DSN1 (YIR010W);
                     ancestral locus Anc_7.175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683342.1"
                     /db_xref="GeneID:11501374"
                     /db_xref="GOA:G8ZZT7"
                     /db_xref="InterPro:IPR013218"
                     /db_xref="UniProtKB/TrEMBL:G8ZZT7"
                     /translation="MSLDGSRSVSKTPPRKKSYPLKMETIPMSSSSYAEFKETRNDEE
                     QEDEYNVGKPNASSFEADQDFKFKRHRNKQSNGVPSLGERLDNLQDVKKAKWVDNFNS
                     SMPNVRETTTNGVHSPRVPAADQGYPSSQPVPPYIALHVLLSDANSRYDAICRFSCAS
                     DTDGESAVYELFDFTQFFSATFFPPAQQTKFDQETPQLLPPPNLYPYNYVQSQQQYAK
                     KASDRRKSIAQNRGRRLSILASQDDGHGIVSPHRDVSEKDFYRHIGDTSFGKGLQMRQ
                     LFNWCTIRALRRLEEKETNQTSRRENGEYVDPKKIALVIMKEFVNDLRRGSIDIDWEA
                     EEAAANSGDDNEVGEDTELRELFDDDDGEKKIRRKKMRFNIEGRKKVPNSKNVENEKN
                     LKILESRVKNLKDEIESWAQVLGKQKPEAEWEVIDKQFSLPNQDMAIDEVATTNVSQD
                     LTRRLDRLQVHSHLLDSSSKAFFVLLKARRDKLTQSFAATVRDNTQQIDSKSILKSLS
                     KSLTER"
     gene            complement(<455260..>455631)
                     /gene="TDEL0H02730"
                     /locus_tag="TDEL_0H02730"
                     /db_xref="GeneID:11501375"
     mRNA            complement(<455260..>455631)
                     /gene="TDEL0H02730"
                     /locus_tag="TDEL_0H02730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683295.1"
                     /db_xref="GeneID:11501375"
     CDS             complement(455260..455631)
                     /gene="TDEL0H02730"
                     /locus_tag="TDEL_0H02730"
                     /inference="similar to DNA sequence:INSDC:YBR253W"
                     /note="similar to Saccharomyces cerevisiae SRB6 (YBR253W);
                     ancestral locus Anc_7.174"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683343.1"
                     /db_xref="GeneID:11501375"
                     /db_xref="GOA:G8ZZT8"
                     /db_xref="InterPro:IPR009332"
                     /db_xref="InterPro:IPR016530"
                     /db_xref="UniProtKB/TrEMBL:G8ZZT8"
                     /translation="MSNQGLYGKLDQTCDVLSTKLIELVKLSSIDGPEGDGSDAALSE
                     ASIATTGVMLVNSQTMQLIKRVQDLFILTRSIREKWLLNQIPERSTQQGVGPAELEQL
                     LDQCMQQIAGDTDVELNRPLG"
     gene            complement(<455726..>456166)
                     /gene="TDEL0H02740"
                     /locus_tag="TDEL_0H02740"
                     /db_xref="GeneID:11501376"
     mRNA            complement(<455726..>456166)
                     /gene="TDEL0H02740"
                     /locus_tag="TDEL_0H02740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683296.1"
                     /db_xref="GeneID:11501376"
     CDS             complement(455726..456166)
                     /gene="TDEL0H02740"
                     /locus_tag="TDEL_0H02740"
                     /inference="similar to DNA sequence:INSDC:YBR252W"
                     /note="similar to Saccharomyces cerevisiae DUT1 (YBR252W);
                     ancestral locus Anc_7.173"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683344.1"
                     /db_xref="GeneID:11501376"
                     /db_xref="GOA:G8ZZT9"
                     /db_xref="InterPro:IPR008180"
                     /db_xref="InterPro:IPR008181"
                     /db_xref="InterPro:IPR029054"
                     /db_xref="UniProtKB/TrEMBL:G8ZZT9"
                     /translation="MSHLPNALKVQLRSPDAKAPTKGSITAAGYDIYASQHTVIPAHG
                     QGLASTDISFTVPFGTYGRIAPRSGLAVKHGIQTGAGVVDRDYTGEVKVVLFNHSNKD
                     FEINKGDRVAQLILEKIVDDAEVVVVNNLEETARGINGFGSTGK"
     gene            complement(<456272..>457198)
                     /gene="TDEL0H02750"
                     /locus_tag="TDEL_0H02750"
                     /db_xref="GeneID:11501377"
     mRNA            complement(<456272..>457198)
                     /gene="TDEL0H02750"
                     /locus_tag="TDEL_0H02750"
                     /product="mitochondrial 37S ribosomal protein MRPS5"
                     /transcript_id="XM_003683297.1"
                     /db_xref="GeneID:11501377"
     CDS             complement(456272..457198)
                     /gene="TDEL0H02750"
                     /locus_tag="TDEL_0H02750"
                     /inference="similar to DNA sequence:INSDC:YBR251W"
                     /note="similar to Saccharomyces cerevisiae MRPS5
                     (YBR251W); ancestral locus Anc_7.170"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS5"
                     /protein_id="XP_003683345.1"
                     /db_xref="GeneID:11501377"
                     /db_xref="GOA:G8ZZU0"
                     /db_xref="InterPro:IPR000851"
                     /db_xref="InterPro:IPR005324"
                     /db_xref="InterPro:IPR013810"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018192"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:G8ZZU0"
                     /translation="MFRRHFSTGLRCLQHYDDQLLSKYYPKELLRSIQMAQDVIPAST
                     NFKVSHNVEFAPSYLDDFSKIDSYWDYKPGMPHVHSQRDELVQNAIYDWNVTQQPLPG
                     TGHVLPPGVSLPTTGGRSSKTLDVARGLQRQTGVDIDYITRKLVMKPLVMKRVSNQTG
                     KGKIPSFYALVVVGDRHGMVGLGSGKSRDEMSKAISKAHWDAIRNLKEIHRYENRTIF
                     ADIDYRYHGVKLHLRSAKPGFGLRVNHIIFEICECAGIKDLSGKVYKSRNEMNIAKGT
                     IEALVGAQKTLDEIALGRGKKIADVRKVYYSA"
     gene            complement(<457314..>458183)
                     /gene="TDEL0H02760"
                     /locus_tag="TDEL_0H02760"
                     /db_xref="GeneID:11501378"
     mRNA            complement(<457314..>458183)
                     /gene="TDEL0H02760"
                     /locus_tag="TDEL_0H02760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683298.1"
                     /db_xref="GeneID:11501378"
     CDS             complement(457314..458183)
                     /gene="TDEL0H02760"
                     /locus_tag="TDEL_0H02760"
                     /note="ancestral locus Anc_7.169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683346.1"
                     /db_xref="GeneID:11501378"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:G8ZZU1"
                     /translation="MGGYTPLKSMAAIVVPHGGLRLTPKIGRSAELLRLAPVPKAYFH
                     PGVKAMRRAGTIMNNTLTIITFGSLLSSTMQERQSPIFSFPRLTTFHIALPFNTFIYM
                     RIYDYNYIYVNAWPIYDNLPQVLVVTLQQMSDPRTNITLPSIKFLLSSLEGQVEFQTP
                     VPKPSTRAPSGCSCNCKGHSNYIPRPKNAFILYRQHLHQFLFPKDKAMLGSQDSFKTN
                     SLVSREIGRRWRSLSPQEKKHWQDLADNEKELHKEKYPGYKYVPRKLKIGARPKGSQC
                     LGTCDYCTQKKAT"
     gene            <458980..>461214
                     /gene="TDEL0H02770"
                     /locus_tag="TDEL_0H02770"
                     /db_xref="GeneID:11501379"
     mRNA            <458980..>461214
                     /gene="TDEL0H02770"
                     /locus_tag="TDEL_0H02770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683299.1"
                     /db_xref="GeneID:11501379"
     CDS             458980..461214
                     /gene="TDEL0H02770"
                     /locus_tag="TDEL_0H02770"
                     /inference="similar to DNA sequence:INSDC:YER017C"
                     /note="similar to Saccharomyces cerevisiae AFG3 (YER017C);
                     ancestral locus Anc_7.168"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683347.1"
                     /db_xref="GeneID:11501379"
                     /db_xref="GOA:G8ZZU2"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZZU2"
                     /translation="MGLLVFPETCCHISTTSESHIKIHCEASAVQAGIPLYFSNIQRF
                     QRTSKGGKGAKGRQKKQDKKDEPEFKNLGEYFKSKEFAKTIYLTVGSIFLLNLISSSN
                     PNENPETDALTFQEFKTKYLEKGLVKKLYVVNKFLVEAELLPQAVPENKAQTGLFGSF
                     SSPTVVAFTIGSVDTFEEQMDQLQDKLKISPDDRIPITYVDRASVFQYLLPFLPTIIL
                     LGGLYFITRKVNGGASGGAGGGGPFGGMFGVGKSKAKLFNKETDIKVQFKDVAGCNEA
                     KQEIMEFVHFLKNPDKYTALGAKIPRGAILSGPPGTGKTLLAKATAGEAGVPFLSVSG
                     SEFVEMFVGVGASRVRDLFEQGRKMAPSIIFVDEIDAIGKERGKGGAMGGSNDEREAT
                     LNQLLVEMDGFSTTDQVVVLAGTNRPDVLDSALMRPGRFDRHIQIDAPDVEGRKAIYL
                     VHMRKLNLDKRFTTLQSEREELAGKLAALTPGFAGADIANACNEAALIAARHNDPCIE
                     LHHFEQAIERVIAGLEKKSKVLSPQEKKTVAYHEAGHAVCGWYLQYADPLLKVSIIPR
                     GQGALGYAQYLPPDQYLISEEQFHHRMIMALGGRVSEELHFPSVTSGAHDDFKKVTQM
                     ANSMVTALGMSRKVGYVSYDENDGGFQVNKPFSDKTARTIDLEVKKIVNEAHAKCKKL
                     LTENLEKVDKVAKELLTKEAITREDMIRLLGPRPFPERNEAFEKYLDPKYDKKIDDTA
                     PATN"
     gene            complement(<461326..>462255)
                     /gene="TDEL0H02780"
                     /locus_tag="TDEL_0H02780"
                     /db_xref="GeneID:11501380"
     mRNA            complement(<461326..>462255)
                     /gene="TDEL0H02780"
                     /locus_tag="TDEL_0H02780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683300.1"
                     /db_xref="GeneID:11501380"
     CDS             complement(461326..462255)
                     /gene="TDEL0H02780"
                     /locus_tag="TDEL_0H02780"
                     /inference="similar to DNA sequence:INSDC:YER016W"
                     /note="similar to Saccharomyces cerevisiae BIM1 (YER016W);
                     ancestral locus Anc_7.167"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683348.1"
                     /db_xref="GeneID:11501380"
                     /db_xref="GOA:G8ZZU3"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR004953"
                     /db_xref="InterPro:IPR027328"
                     /db_xref="UniProtKB/TrEMBL:G8ZZU3"
                     /translation="MSGIGESRTELLNWLNDLLKLNYRKIEECGMGAAYCQIMDSIYG
                     DLPMHRVKFNATAEYEFQTNYKVLQSCFTKHHIEKTVYVEKLIRCRFQDNLEFLQWLK
                     RFWMQNKDDTPYDAEARRKYRAVSSGPGSNNSTISVTKRKTSGFSNTSSSSTGANTAN
                     NITTRTSYGARRVSNEQVLGLQAELAQAQGSVASLNREVNTYKEAMNIMERERNFYFG
                     KLRDIEILVQSTQDLIKEGVYNTGNADLSKLLNKVQQILYATEEGFEVSRDEVERNLE
                     DNEILNEPGLSNFAEGIQQDRPEHNLITDEETF"
     gene            complement(<462486..>464711)
                     /gene="TDEL0H02790"
                     /locus_tag="TDEL_0H02790"
                     /db_xref="GeneID:11501381"
     mRNA            complement(<462486..>464711)
                     /gene="TDEL0H02790"
                     /locus_tag="TDEL_0H02790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683301.1"
                     /db_xref="GeneID:11501381"
     CDS             complement(462486..464711)
                     /gene="TDEL0H02790"
                     /locus_tag="TDEL_0H02790"
                     /inference="similar to DNA sequence:INSDC:YER015W"
                     /note="similar to Saccharomyces cerevisiae FAA2 (YER015W);
                     ancestral locus Anc_7.166"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683349.1"
                     /db_xref="GeneID:11501381"
                     /db_xref="GOA:G8ZZU4"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="UniProtKB/TrEMBL:G8ZZU4"
                     /translation="MESTCSLAELVETDPRYRPLKEKLAGYEPGSDQYLSCLMDLCPL
                     TECPDYQTYVRKQAAPVPGSQNDGYSPIYRNTLSPDRLLSCFDRKLATIYHHFLFSVR
                     RWPNHDCLGFRPYDEESGKFLDYYQFWSFEEVERRSRRIGAGILSLVNVKRRKSLGCN
                     DFIVAILSHNKPEWMLVDLGCQAYSLANTALYETLGVDTSHYIMNLTESPVLLFAKVN
                     MSKVIEMLPNLKYVNTLVCLEDIEDDELRLFNESLFPMAKNSRDETISLFSLKQVERI
                     GKMNEIPVIPPAPDTLYTISFTSGTTGQPKGVEMTHGHCAAGIAFTFSSIVLPEDAKT
                     RQLHNMCFLPLAHIFQRMIVSFGLSMGIGLGFMHSSDPAVLVEDLKILKPDIIGLVPR
                     ILTRIETGIKISLQQSASKKFIANSILSAKKARLAAQDGEDHSLMNRLVYHPILNDKI
                     RSSLGFDNGAMIITGSAPISPGTLKFLRTALDIGVRQGYGLTETFAGICLSEAHEKDP
                     GSCGAIGVSVECRLKSVPEMGYDSSDLKGELQLRGPQIFNRYYKRPEETAEALDENLW
                     FSTGDIASIDRRGRLSVIDRVKNFFKLSQGEYIAPEKIENVYLSSSPLITQAFVYGDS
                     YKSYLVGILGIEIASVQKILGLKHPEVNGLPPSKLIEVINISKPLKKSFLLTINKYAR
                     NLQGFEKLHNVYVAIEPLKMEDEVITPTLKIKRAIASKHFKSILNNLYEEGSIIKEPK
                     L"
     gene            complement(<464931..>465281)
                     /gene="TDEL0H02800"
                     /locus_tag="TDEL_0H02800"
                     /db_xref="GeneID:11501382"
     mRNA            complement(<464931..>465281)
                     /gene="TDEL0H02800"
                     /locus_tag="TDEL_0H02800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683302.1"
                     /db_xref="GeneID:11501382"
     CDS             complement(464931..465281)
                     /gene="TDEL0H02800"
                     /locus_tag="TDEL_0H02800"
                     /inference="similar to DNA sequence:INSDC:YIR009W"
                     /note="similar to Saccharomyces cerevisiae MSL1 (YIR009W);
                     ancestral locus Anc_7.165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683350.1"
                     /db_xref="GeneID:11501382"
                     /db_xref="GOA:G8ZZU5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR024888"
                     /db_xref="UniProtKB/TrEMBL:G8ZZU5"
                     /translation="MSERQTKKQKLSTSSDGSRSIETDDKLGNQPKHTLYVNNLSDHI
                     DIKRLTTNLYLLFSIYGEVIKITVNPRRQRGQAFITMKNIDESNLAIISLNNEPFFGK
                     PLHVSFSREETINI"
     gene            complement(<465456..>467048)
                     /gene="TDEL0H02810"
                     /locus_tag="TDEL_0H02810"
                     /db_xref="GeneID:11501383"
     mRNA            complement(<465456..>467048)
                     /gene="TDEL0H02810"
                     /locus_tag="TDEL_0H02810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683303.1"
                     /db_xref="GeneID:11501383"
     CDS             complement(465456..467048)
                     /gene="TDEL0H02810"
                     /locus_tag="TDEL_0H02810"
                     /inference="similar to DNA sequence:INSDC:YER014W"
                     /note="similar to Saccharomyces cerevisiae HEM14
                     (YER014W); ancestral locus Anc_7.164"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683351.1"
                     /db_xref="GeneID:11501383"
                     /db_xref="GOA:G8ZZU6"
                     /db_xref="InterPro:IPR004572"
                     /db_xref="InterPro:IPR027418"
                     /db_xref="UniProtKB/TrEMBL:G8ZZU6"
                     /translation="MLSPLTKLPTNAKVAVVGSGVAGLMFTYFLGKLRPDVTIHLIES
                     QKRTGGWIKSLDTKDKNNEPVMLEQGPRTLRGVSDGTVLIVDTLKDLNQQSIVQCISA
                     NAEANRKFLLDPNDKLAQVPNSPATAIEFLCNPLGKGLITGFLGEPFRRPPSHPGQDE
                     SVSSFIKRRFGSDYIGNNILSAVFHGIYGDDIDNMSAKRTVRKLFDLETKYGSIMKGF
                     YNSKSDPNEKHQLSQLLSDYQRAFNKDEAELKGLSTKLHKYPMLGLKGGLEMFPHLVR
                     QSLNKLSNVNLISGEKVIKINQGKEQEGLSVQLSQGKSLTGLNHVRLTPTPARISPMI
                     DNEQLAKEFAKIKANSILLVNFYLPKKDAIARKYHGFGYLCPKSSKNPQGLLGVIFDS
                     VIERSFQPLFQNMDANQKSSSPEQYTKLTAMLGGHYLNHHSSETVPSQELTIRAVKDS
                     LNTHLGISSQDLEDGMWAFTVAEKCLPRFSVGYDAWQASVEQELQKAYKGTVSVGGMG
                     FAKGPGVPDVIADGLQDAIKLA"
     gene            complement(<467209..>470577)
                     /gene="TDEL0H02820"
                     /locus_tag="TDEL_0H02820"
                     /db_xref="GeneID:11501384"
     mRNA            complement(<467209..>470577)
                     /gene="TDEL0H02820"
                     /locus_tag="TDEL_0H02820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683304.1"
                     /db_xref="GeneID:11501384"
     CDS             complement(467209..470577)
                     /gene="TDEL0H02820"
                     /locus_tag="TDEL_0H02820"
                     /inference="similar to DNA sequence:INSDC:YER013W"
                     /note="similar to Saccharomyces cerevisiae PRP22
                     (YER013W); ancestral locus Anc_7.163"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683352.1"
                     /db_xref="GeneID:11501384"
                     /db_xref="GOA:G8ZZU7"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZZU7"
                     /translation="MSNDIAGIAEVIGTDDEVVIEFVLNVKKLSRNSSDFKRKIDELD
                     VNLSQEAIEKLWELISDFRNDVSKIMKEAIGVEDPVVIDFVIDIARKCQSLQEYQQKL
                     DEMESGVSADVASQIYAKINPASAPVTDLPDEGLKLPNQQIKWDDIDDSKDMFPQRPV
                     SQHLDVSPITGKVYRGSVKNITAFGCFVQLSGVKKVNCDGLVHISELSPIRVRDPNDV
                     VQVGQHVFVKVLKVQSNGKVSLSMKNIDQKTGEGSGTGPNGMPLVPRGRRLGRSTDDV
                     ASEHRTQRRPLTSPERWEIRQLIGSGAASIEDYPELNQDQIKEVPKLSDSSNANVRNQ
                     EVDVELNSDDEPLFLQGQLEKGPKKYEAPKIAKVPKGVMNRVAVGGSALMKSHREEKV
                     KLKREIEQQIRKKRAVDDPTKNREEDKKKVDDLRQQLVVTAWERNRLRENISFGKRES
                     QPISGQRKSLPVYKMRSELVRAVQDNQFLVIVGETGSGKTTQITQYLNDAGFADRGII
                     GCTQPRRVAAVSVSKRVAEEVGCKLGTEVGYTIRFEDNTSPQTRIKYMTDGMLQREAL
                     LDPTMSRYSVIMLDEAHERTVATDVLFALLKQAAQKRPDLKVIITSATLDAAKFSEYF
                     CQCPVITIPGKTFPVEVFYAQTPQMDYIESALDAVMEIHVNEGAGDILVFLTGQDEID
                     SCCEILYQRVKTLGDSIGELLILPVYSALPSEVQSKIFEPTPEATRKVVFATNIAETS
                     ITIDGIYYVIDPGFAKINTFNPRVGMEQLVVSPISQAQANQRKGRAGRTGPGKCYRLY
                     TESAFYNEMLPNTIPEIQRQNLAHTILMLKAMGINDLINFEFMDPPPRNLLMRALEEL
                     FNLQALEDDGRLSKLGMRMSQFPMEPQLSKALLSSVTNGCGDDIITIISMLSVQNVFY
                     RPKEKQQEADNKKARFHHPYGDHLTLLNVYNKWQQANCTEQFCTINYLHYRHLKRARD
                     VRNQLTTLFTRFRLPIASSHGDPEVIRRTLVSGFFMNAAKRDSQVGYKTICGGTTVGI
                     HPSSSLFGKEYEYVIYHSLVLTSKEYMSQVTAIDPNWLVESAPHFYKVADEDSQSRKK
                     AKIAPLYNKFSKDQNSWKLSSIRQSREKALGIKR"
     gene            complement(<470716..>471306)
                     /gene="TDEL0H02830"
                     /locus_tag="TDEL_0H02830"
                     /db_xref="GeneID:11501385"
     mRNA            complement(<470716..>471306)
                     /gene="TDEL0H02830"
                     /locus_tag="TDEL_0H02830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683305.1"
                     /db_xref="GeneID:11501385"
     CDS             complement(470716..471306)
                     /gene="TDEL0H02830"
                     /locus_tag="TDEL_0H02830"
                     /inference="similar to DNA sequence:INSDC:YER012W"
                     /note="similar to Saccharomyces cerevisiae PRE1 (YER012W);
                     ancestral locus Anc_7.162"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683353.1"
                     /db_xref="GeneID:11501385"
                     /db_xref="GOA:G8ZZU8"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8ZZU8"
                     /translation="MDIILGIRVQDSVILATSKAVTRGISILKDSDDKTRLLSPHNLM
                     SFSGEAGDTVQFAEYIQANMQLYSVRENVELSPHATASFVRQELAKSLRSRKPYQVNV
                     LIGGYDSKAGKPELYQIDYLGTNVELPYAAHGYAGFYTFSLLDRHYRPDMTEQEGLEL
                     LKKCVEELNRRMPIDFKGVIVKVVDKDGVRRLDDME"
     gene            <471844..>473094
                     /gene="TDEL0H02840"
                     /locus_tag="TDEL_0H02840"
                     /db_xref="GeneID:11501386"
     mRNA            <471844..>473094
                     /gene="TDEL0H02840"
                     /locus_tag="TDEL_0H02840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683306.1"
                     /db_xref="GeneID:11501386"
     CDS             471844..473094
                     /gene="TDEL0H02840"
                     /locus_tag="TDEL_0H02840"
                     /inference="similar to DNA sequence:INSDC:YIR008C"
                     /note="similar to Saccharomyces cerevisiae PRI1 (YIR008C);
                     ancestral locus Anc_7.171"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683354.1"
                     /db_xref="GeneID:11501386"
                     /db_xref="GOA:G8ZZU9"
                     /db_xref="InterPro:IPR002755"
                     /db_xref="InterPro:IPR014052"
                     /db_xref="UniProtKB/TrEMBL:G8ZZU9"
                     /translation="MEQSDVVANGNGKFKTPSSSDMQYYYQCLFPFKVIFNWLNHSPK
                     PGRDIVNREFAMAFRSGAYKRYNSYNSVQEFKTQIEKANPDRFEIGAIYNKAPRERDT
                     ILKSEMKPLEKELVFDIDMDDYDTFRTCCSGAQVCERCWKFITLAMLVVNTTLTEDFA
                     YEDFIWVFSGRRGAHCWVSDKRARILHDLQRRNVLDYVNVVRDRNADKRLSLKRPYHP
                     HLVRSLEILKPHFASIILEEQNPWQNDEHAFTTLLPCLHDKNLIDALRRYWSENPNRS
                     SKEKWNDIDVIASKEIKTSRKQDYATRLRECKEDMVIATLYPKLDIEVTKQTIHLLKS
                     PFCIHPSTGNVCVPIDMKFNPDQAPKLITLQHEMEQNGNNVEKTSLQPFIELFQQHVN
                     KVMKNDMGTVKRERAEDGETSLEF"
     gene            complement(<473127..>475328)
                     /gene="TDEL0H02850"
                     /locus_tag="TDEL_0H02850"
                     /db_xref="GeneID:11501387"
     mRNA            complement(<473127..>475328)
                     /gene="TDEL0H02850"
                     /locus_tag="TDEL_0H02850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683307.1"
                     /db_xref="GeneID:11501387"
     CDS             complement(473127..475328)
                     /gene="TDEL0H02850"
                     /locus_tag="TDEL_0H02850"
                     /inference="similar to DNA sequence:INSDC:YIR007W"
                     /note="similar to Saccharomyces cerevisiae YIR007W;
                     ancestral locus Anc_7.172"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683355.1"
                     /db_xref="GeneID:11501387"
                     /db_xref="GOA:G8ZZV0"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR018087"
                     /db_xref="UniProtKB/TrEMBL:G8ZZV0"
                     /translation="MLGKICVSKDAEFCDSSGNAIQLRGVNFDPTVKFPADPYLPTRL
                     PIAGKSILEDAENVSFADHPVPLAEVELHVNKLKSLGYNCIRFPFTWESLEQKGPGEY
                     DFDYMDYVIDVLQKIRSIGGIQVYLDPHQDVWSRFSGGSGAPLWTLYCAGFQPTGFEA
                     TEAAVLHSHYTSEKKEYPKMLWPTNLYKLACQTMFTLFFAGKDFAPKCTINGENIQDY
                     LQGKFVDAVMRLYSRIQEKAPELFVENCIIGLETMNEPNCGYFGEKDLGIIPKNRNLK
                     RGSTPTAFQSFILGEGHPAIVDQYDISIFGPTKTGTQKIDPKGTKCWLTAEERSEVDA
                     RYKWERNEEWLPGQCIWKLHGVWGETALGPELIKKDYFASLRDRTAVDESYFINHNFV
                     NFYKNFQSKFRSIDRDALLFMQGMVFKEPPKLLGSDLIDNRTVYACHYYDGMSLMFKT
                     WSRKFNVDTFGIVREKYLNPAFSVVIGEANVRKSFKRQLRDMKQEVKDVLHVPCFFTE
                     IGMPIDMDNKKAYKDGNFSSQTAAIDALQLALEGENLSYSLWCYCSKNSHKWGDEWNN
                     EDFSIWSMEDSSKTKEPKREEDGRLDSEASDFIPFAKKLELDSPPCADRNSLDFDGIR
                     VLDAVLRPFPVKIHGQFINAEFDLPSKTYYLEITAKVDAELSPDAHSFIFLPRHHFPL
                     EQVRVRSSSGRFTYYREYQLLKWYHSSGKQWLKLSLAEENQRDPSPDCVIA"
     gene            complement(475438..475509)
                     /gene="TDEL0Htrna4E"
                     /locus_tag="TDEL_0Htrna4E"
                     /db_xref="GeneID:11501388"
     tRNA            complement(475438..475509)
                     /gene="TDEL0Htrna4E"
                     /locus_tag="TDEL_0Htrna4E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:11501388"
     gene            <475918..>476952
                     /gene="TDEL0H02860"
                     /locus_tag="TDEL_0H02860"
                     /db_xref="GeneID:11501719"
     mRNA            <475918..>476952
                     /gene="TDEL0H02860"
                     /locus_tag="TDEL_0H02860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683308.1"
                     /db_xref="GeneID:11501719"
     CDS             475918..476952
                     /gene="TDEL0H02860"
                     /locus_tag="TDEL_0H02860"
                     /inference="similar to DNA sequence:INSDC:YOR008C"
                     /note="similar to Saccharomyces cerevisiae SLG1 (YOR008C);
                     ancestral locus Anc_7.124"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683356.1"
                     /db_xref="GeneID:11501719"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="UniProtKB/TrEMBL:G8ZZV1"
                     /translation="MILTRSGYALLLTVMFVSRLALGYQCFSSLPSSFTLDDTYEYQA
                     SGYCNDKCTAKGYKYFALTQGNQCYCGNDNPAESQSTSTGCTSTCFGYPAEMCGGANA
                     FSVYAITANGGTAVEVTGSSSLASSSSSSTSSTSSTSSSSSTTSSSTTTSSSSTTTSS
                     SSSSTSSRGTTTTRSSESADSVVYLTATNTDGGSTVFVTSTITTSTQGMPTSTSSNDS
                     DTNHKKKVNIGAIVGGVVGGVGGALVIGAAVLLILRHVNKRREQERMEKEYQEAIKPV
                     EYGDKLHHGGSSVSLNNLQSSGSFDDTTHAMSSNNPFDDSRRISNGSILNAPSHTNPK
                     TLTVVNPDED"
     gene            <477363..>479126
                     /gene="TDEL0H02870"
                     /locus_tag="TDEL_0H02870"
                     /db_xref="GeneID:11501389"
     mRNA            <477363..>479126
                     /gene="TDEL0H02870"
                     /locus_tag="TDEL_0H02870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683309.1"
                     /db_xref="GeneID:11501389"
     CDS             477363..479126
                     /gene="TDEL0H02870"
                     /locus_tag="TDEL_0H02870"
                     /inference="similar to DNA sequence:INSDC:YPL260W"
                     /note="similar to Saccharomyces cerevisiae YPL260W;
                     ancestral locus Anc_7.125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683357.1"
                     /db_xref="GeneID:11501389"
                     /db_xref="InterPro:IPR018810"
                     /db_xref="UniProtKB/TrEMBL:G8ZZV2"
                     /translation="MVVSLPVAASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRR
                     QYLNSKEVQNIYQQVLTKVRELDQIRKSNHDTPSNSATTLIHSTELHNRVDSVLDDVF
                     QLLSLCFLTVGLKNSAPATYASLSTVQRLLEHLNESNVFTQHDLRPIRERLLEISKIV
                     ENSSYKNEVSGDNLEDIDEKLPEADRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTE
                     SKVEEIDPHLTTIMEKLFEIRRGLLSLAASSKRSNPSLEKSPLSQEHVHEQVEKLESQ
                     LTELESHRDENGKFKSLETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKL
                     QPIYEQLIDIKTSLENLLVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKG
                     QSILLYLLRRCFAIIYKLLESSEPVSESLQPIHNQLSTVRRCLLELKRMGGVNNDREL
                     YPYQMKLASLDDLRTDGKFYDSDGNIPEGQGTLNALLAECFDIVHELKIEAQERAETE
                     SAQQSEAEQDDGLVNDTDNDNDGDQPVARYLDVHNQYSNDDDEDEEEEDGEEASLTNA
                     SEHSYVDEEENDYHIPAKAHH"
     gene            <479958..>481022
                     /gene="TDEL0H02880"
                     /locus_tag="TDEL_0H02880"
                     /db_xref="GeneID:11501390"
     mRNA            <479958..>481022
                     /gene="TDEL0H02880"
                     /locus_tag="TDEL_0H02880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683310.1"
                     /db_xref="GeneID:11501390"
     CDS             479958..481022
                     /gene="TDEL0H02880"
                     /locus_tag="TDEL_0H02880"
                     /inference="similar to DNA sequence:INSDC:YIL010W"
                     /note="similar to Saccharomyces cerevisiae DOT5 (YIL010W);
                     ancestral locus Anc_7.126"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683358.1"
                     /db_xref="GeneID:11501390"
                     /db_xref="GOA:G8ZZV3"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:G8ZZV3"
                     /translation="MSKKSKTSESTKPPAGEDETGVKGEELWKLSKDESAPKGRRGSK
                     SKKDATKPPAGEDETGGKGEELWKLPRGESASSKARRGSRTSKHKNDSSKPPAGEDET
                     GVAGEELWKLPRKEGAESESTKPPAGEDETGKEGEELWKLHKDEGAKPRRGSKSSDKT
                     KPLAGEDETGGEGEELWKLPKKDEKETDVAEDSDQTAQSTELDIGDEIPDVTLQNQDG
                     KDVSLRDVAKEHKIIIIFAYPKASTPGCTRQACGYRDNYDELKEHAAVFGLSGDNASA
                     QKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTAQSGTLRSHWVFFDGKLKYKRVKVSPE
                     VSIQDGKKEVLELAASLQNE"
     gene            complement(<481125..>482453)
                     /gene="TDEL0H02890"
                     /locus_tag="TDEL_0H02890"
                     /db_xref="GeneID:11501391"
     mRNA            complement(<481125..>482453)
                     /gene="TDEL0H02890"
                     /locus_tag="TDEL_0H02890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683311.1"
                     /db_xref="GeneID:11501391"
     CDS             complement(481125..482453)
                     /gene="TDEL0H02890"
                     /locus_tag="TDEL_0H02890"
                     /inference="similar to DNA sequence:INSDC:YPL259C"
                     /note="similar to Saccharomyces cerevisiae APM1 (YPL259C);
                     ancestral locus Anc_7.127"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683359.1"
                     /db_xref="GeneID:11501391"
                     /db_xref="GOA:G8ZZV4"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR018240"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:G8ZZV4"
                     /translation="MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRFAPLLADLEEESS
                     VIPPCLNHRGIQYLFIEHEDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEE
                     SVRDNFVIIYELLDEMMDYGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGL
                     TNSVSWRADGITYKKNEAFLDIVESINMVMNQQGQVLRSEIIGQVIVRSRLSGMPDLK
                     LGINDKGIFTRDPETGESQVTAGKKKSSAELEDLKFHQCVRLSKFENEKIITFIPPDG
                     EFELMSYRLTTPVKPLIWCDVNVQVHSKSRIEIHCRAKAQIKKKSVANNVEILIPVPD
                     DADTPSFRYSHGSIKWVPEKNAILWKIRSFYGGKEYSMAAQMGLPSINGVEKPKFKRP
                     VQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQNGDDYTIRLN"
     gene            complement(<482608..>483175)
                     /gene="TDEL0H02900"
                     /locus_tag="TDEL_0H02900"
                     /db_xref="GeneID:11501392"
     mRNA            complement(join(<482608..482892,482894..>483175))
                     /gene="TDEL0H02900"
                     /locus_tag="TDEL_0H02900"
                     /product="hypothetical protein"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_003683312.1"
                     /db_xref="GeneID:11501392"
     CDS             complement(join(482608..482892,482894..483175))
                     /gene="TDEL0H02900"
                     /locus_tag="TDEL_0H02900"
                     /inference="similar to DNA sequence:INSDC:YIL009C-A"
                     /artificial_location="low-quality sequence region"
                     /note="similar to Saccharomyces cerevisiae EST3
                     (YIL009C-A); ancestral locus Anc_7.128"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683360.1"
                     /db_xref="GeneID:11501392"
                     /db_xref="UniProtKB/TrEMBL:G8ZZV5"
                     /translation="MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRLPVFNFI
                     PKLQLKDLRKPQLSPRILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCV
                     SEFERTHRSRITLETEHSLFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTI
                     PVLIVNQASQFEMDQIESFEHFPYLYTL"
     gene            complement(483274..483345)
                     /gene="TDEL0Htrna5D"
                     /locus_tag="TDEL_0Htrna5D"
                     /db_xref="GeneID:11501393"
     tRNA            complement(483274..483345)
                     /gene="TDEL0Htrna5D"
                     /locus_tag="TDEL_0Htrna5D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:11501393"
     gene            complement(483732..483832)
                     /gene="TDEL0Htrna1W"
                     /locus_tag="TDEL_0Htrna1W"
                     /db_xref="GeneID:11501742"
     tRNA            complement(join(483732..483768,483796..483832))
                     /gene="TDEL0Htrna1W"
                     /locus_tag="TDEL_0Htrna1W"
                     /product="tRNA-Trp"
                     /note="codon recognized: UGG"
                     /db_xref="GeneID:11501742"
     gene            <484766..>486520
                     /gene="TDEL0H02910"
                     /locus_tag="TDEL_0H02910"
                     /db_xref="GeneID:11501716"
     mRNA            <484766..>486520
                     /gene="TDEL0H02910"
                     /locus_tag="TDEL_0H02910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683313.1"
                     /db_xref="GeneID:11501716"
     CDS             484766..486520
                     /gene="TDEL0H02910"
                     /locus_tag="TDEL_0H02910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683361.1"
                     /db_xref="GeneID:11501716"
                     /db_xref="UniProtKB/TrEMBL:G8ZZV6"
                     /translation="MPAKSYVENPYFGEFEDANVNVYSSFESHKKLPKAEIPKMQETA
                     TKLSKRERLKLRTARALKGEIKPGDIIGRRHHVRFWKNSKLSSAAPLQTQSTTPSNSS
                     SPATSPATSLDSGSWNEESVIYSPLGPSLTPNEETTHVELVHSSEEITRISSFETTPQ
                     AFDLSKYTARAMSARFSCGSSEPVSPNRSEAFSPTDGFGAGFTPITPMPVDESKSAAA
                     KPADQIQELVSRPNASLVDSRAPGKVPAVRSCTMPITPVELEEDITHANFNRHHSLPS
                     TFIVEEESLRKAQPEVRLSRESIEVSTKQAKKIRFHELNNRTKGSEGRQYHEEQCRRL
                     QKEPQTNKSKVNLFSRTWENLNEESWYVRVLHEYCPVRFRKNKRLNFDSHQFRAMQSK
                     LTFEALVEQEVRRQDRKLIFRPNNYANKSFIRRWFNFEEDKDILDSMDHFILCNEGLT
                     PIFRGSRPAVRKHLFRRWLNFDRNRAIICEQLMERWLEDKQYVNKLKKGRDEREQMRA
                     EMETRLKDYDKIPPPSFFIKKLMSNLSGNRSRIGKPPKRGSQIVVLKKEPLFGSQYFE
                     NKKTKAKRWIKDLLLGMH"
     gene            complement(486700..486771)
                     /gene="TDEL0Htrna9R"
                     /locus_tag="TDEL_0Htrna9R"
                     /db_xref="GeneID:11501394"
     tRNA            complement(486700..486771)
                     /gene="TDEL0Htrna9R"
                     /locus_tag="TDEL_0Htrna9R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGA"
                     /db_xref="GeneID:11501394"
     gene            <488487..>488783
                     /gene="TDEL0H02920"
                     /locus_tag="TDEL_0H02920"
                     /db_xref="GeneID:11501729"
     mRNA            <488487..>488783
                     /gene="TDEL0H02920"
                     /locus_tag="TDEL_0H02920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683314.1"
                     /db_xref="GeneID:11501729"
     CDS             488487..488783
                     /gene="TDEL0H02920"
                     /locus_tag="TDEL_0H02920"
                     /inference="similar to DNA sequence:INSDC:YIL008W"
                     /note="similar to Saccharomyces cerevisiae URM1 (YIL008W);
                     ancestral locus Anc_7.129"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683362.1"
                     /db_xref="GeneID:11501729"
                     /db_xref="GOA:G8ZZV7"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR015221"
                     /db_xref="InterPro:IPR016155"
                     /db_xref="UniProtKB/TrEMBL:G8ZZV7"
                     /translation="MVTVKVEFLGGLDVVFGKQRVHKVRIDEPSVNAKRLISYIAEEM
                     ITNKKDINVFLEEGTVRPGILTLINDTDWELEGGEDYVLEDGDVVSFTSTLHGG"
     gene            complement(<488780..>489397)
                     /gene="TDEL0H02930"
                     /locus_tag="TDEL_0H02930"
                     /db_xref="GeneID:11501395"
     mRNA            complement(<488780..>489397)
                     /gene="TDEL0H02930"
                     /locus_tag="TDEL_0H02930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683315.1"
                     /db_xref="GeneID:11501395"
     CDS             complement(488780..489397)
                     /gene="TDEL0H02930"
                     /locus_tag="TDEL_0H02930"
                     /inference="similar to DNA sequence:INSDC:YIL007C"
                     /note="similar to Saccharomyces cerevisiae NAS2 (YIL007C);
                     ancestral locus Anc_7.130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683363.1"
                     /db_xref="GeneID:11501395"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="UniProtKB/TrEMBL:G8ZZV8"
                     /translation="MTNVQLNGSLADPWIVEQVANLEQLSLPQVLELKSHIESELDRN
                     FDRLKGHGADLSSPLITEDGFPRQDIDVLEVRLLRNYLNMLRNDLRAVIDRSQPLLAT
                     HSSLPVASQTTSTPTAFAEIYGLIPRSPMHSAGCQNGDKLVSVASVNATNHSNLSFLQ
                     QTIQGNANVALPLRILREGQVLDLTVTPTDTWGGSGLLGARFKLI"
     gene            complement(<489468..>490115)
                     /gene="TDEL0H02940"
                     /locus_tag="TDEL_0H02940"
                     /db_xref="GeneID:11501396"
     mRNA            complement(<489468..>490115)
                     /gene="TDEL0H02940"
                     /locus_tag="TDEL_0H02940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683316.1"
                     /db_xref="GeneID:11501396"
     CDS             complement(489468..490115)
                     /gene="TDEL0H02940"
                     /locus_tag="TDEL_0H02940"
                     /inference="similar to DNA sequence:INSDC:YEL009C"
                     /note="similar to Saccharomyces cerevisiae GCN4 (YEL009C);
                     ancestral locus Anc_7.131"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683364.1"
                     /db_xref="GeneID:11501396"
                     /db_xref="GOA:G8ZZV9"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:G8ZZV9"
                     /translation="MSVFMNQNITCTAETDTEPFFGSLDAFVKKEDDGQVPMDLLVHH
                     DDHDGLTPMFDSDPALSAVSGEESKWGSLFDDEIPINPADVFNFTPQAEEEVEVVVPS
                     PAKDRNVSFLPTPIFEEAPLTTPATKKRVGKVDHLGVVAYNRKNRSAPLSPVVVESDD
                     PAALKRARNTEAARRSRARKMQRMTQLESKVEQLIARNSELEQEITRLNSLLSKT"
     gene            <490993..>492090
                     /gene="TDEL0H02950"
                     /locus_tag="TDEL_0H02950"
                     /db_xref="GeneID:11501397"
     mRNA            <490993..>492090
                     /gene="TDEL0H02950"
                     /locus_tag="TDEL_0H02950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683317.1"
                     /db_xref="GeneID:11501397"
     CDS             490993..492090
                     /gene="TDEL0H02950"
                     /locus_tag="TDEL_0H02950"
                     /inference="similar to DNA sequence:INSDC:YEL007W"
                     /note="similar to Saccharomyces cerevisiae YEL007W;
                     ancestral locus Anc_7.132"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683365.1"
                     /db_xref="GeneID:11501397"
                     /db_xref="InterPro:IPR018608"
                     /db_xref="UniProtKB/TrEMBL:G8ZZW0"
                     /translation="MELKPTFKGYIHDEADALLLLQATLEGRLQQISRRPYEIERPYL
                     IVSGSAFVFVEEMSGIKRWTDGVPWSPSRISGRFLIYKGLDKSYANPVVRKRPRQQDS
                     FSSNSTPSPTESNGEAKNYTGFVKKTMSVKFKNRLKNSVETLHLVSYYNVDDVRDKKL
                     IRPRDSPLFRSVKPSADLLAAVENRTLGNSTKFNLLPSTTASPSTTTTSSASTTNSYS
                     SSSCPSSTGNSPLLNKITAGSSFLPYIKRHQTDPSSLVPPQIIPATNSFLTQQQLSQN
                     FLPFTPPPSANYTSQPLALPHLNPQQPQYYQQHTYYQLRPPSHLALPNVNTQVPPLLL
                     NPYLPHSYHPNDRMRGHPSGPYYNSSTNDQR"
     gene            <492274..>493338
                     /gene="TDEL0H02960"
                     /locus_tag="TDEL_0H02960"
                     /db_xref="GeneID:11501398"
     mRNA            <492274..>493338
                     /gene="TDEL0H02960"
                     /locus_tag="TDEL_0H02960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683318.1"
                     /db_xref="GeneID:11501398"
     CDS             492274..493338
                     /gene="TDEL0H02960"
                     /locus_tag="TDEL_0H02960"
                     /inference="similar to DNA sequence:INSDC:YEL006W,YIL006W"
                     /note="similar to Saccharomyces cerevisiae YEA6 (YEL006W)
                     and YIA6 (YIL006W); ancestral locus Anc_7.133"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683366.1"
                     /db_xref="GeneID:11501398"
                     /db_xref="GOA:G8ZZW1"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8ZZW1"
                     /translation="MSKEDPHEGFLVPDGISPLSSSDVIEPRRAARLIQDHQLTLDHD
                     SMQIPKEPSGRIRLNDTEITALSGALSGFISGIVVCPLDVAKTRLQAQGLQSVGENRY
                     YNGMLGTFSTIIRDEGVRGLYKGLVPIIMGYFPTWMIYFSFYEFCKDFYPRMLPHQDF
                     LSYSLSAITAGAVSTTVTNPIWVIKTRLMLQTHVSQYPTHYKGTFDAFNKIRTQEGFK
                     ALYAGLVPSYFGLLHVAIHFPVYEKLKVTFNCYRGKNNNHELDLSRLIMASCVSKMIA
                     SVITYPHEILRTRMQLKSNLPDSVQHKMIPLIRKTYFTEGIRGFYSGFTTNLVRTVPA
                     SAITLVSFEYVRNHLSSITD"
     gene            <493481..>495580
                     /gene="TDEL0H02970"
                     /locus_tag="TDEL_0H02970"
                     /db_xref="GeneID:11501399"
     mRNA            <493481..>495580
                     /gene="TDEL0H02970"
                     /locus_tag="TDEL_0H02970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683319.1"
                     /db_xref="GeneID:11501399"
     CDS             493481..495580
                     /gene="TDEL0H02970"
                     /locus_tag="TDEL_0H02970"
                     /inference="similar to DNA sequence:INSDC:YIL005W"
                     /note="similar to Saccharomyces cerevisiae EPS1 (YIL005W);
                     ancestral locus Anc_7.134"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683367.1"
                     /db_xref="GeneID:11501399"
                     /db_xref="GOA:G8ZZW2"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:G8ZZW2"
                     /translation="MWNPWFIALYLLWSGVFAILEQQEKPQFPEPLNEEGFNTQLKAG
                     LHVVEFYSPNCHHCKALAPTWEKTWETFYEEGKALHIAFSQVNCLLSGDLCAKEKIGY
                     FPTIRLYGPSGVIKNFPDDAKRSMENLIDFARREANDPSNSEIVDIKSTSIQLSGDKF
                     NQLLDGRGSQPILVSFWPSKAMRSTDDDMEFENCEDCRPFQRTWRVLSSRLLSSSIST
                     GHVNCESSAKLCEELGFDDLVKIRNHSYERLPRVALIIPGRKVNNLFIYESKFSTSVS
                     DYEDFATRVTRNSEAPFISSSDVKQIAERDFQLSASSAFASPPQNLHIVFAYNPKTVV
                     QEDFAVLDHLVEPLSNIPNAYLYKSTDDMKQTSRSNLDSLYKIMNSNLDGPEKTIKEE
                     FIDLNVMDQNPTFYVFRDGDRIPHVFPGYSTTEVRDVDRIVTWIESLSLPFMNEVSTS
                     NFKELLNFIPEEYSGLAIQLIDTSSPVLFEKSSRFLEKFMLAGYDYEDFRMGYVVNVT
                     SAERAKKSKKMSDLKGKGASAKKRIQAAIQDVPHVDDNKVVLGYIDISKSSNTLSNMG
                     LAHRGDTYKAGDVIIINKVTKFVYEHNAAGDVLTSESSSKIKNALISALLPKATPSPP
                     RISGHLLSTPFGDSFRFLDSLHQFGFFGYLGLLSVVLFSYKILRFYSRSKVNRKYKAK
                     RNTLGILGKSNQKKLRD"
     gene            complement(<495672..>496182)
                     /gene="TDEL0H02980"
                     /locus_tag="TDEL_0H02980"
                     /db_xref="GeneID:11501400"
     mRNA            complement(join(<495672..496083,496172..>496182))
                     /gene="TDEL0H02980"
                     /locus_tag="TDEL_0H02980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683320.1"
                     /db_xref="GeneID:11501400"
     CDS             complement(join(495672..496083,496172..496182))
                     /gene="TDEL0H02980"
                     /locus_tag="TDEL_0H02980"
                     /inference="similar to DNA sequence:INSDC:YIL004C"
                     /note="similar to Saccharomyces cerevisiae BET1 (YIL004C);
                     ancestral locus Anc_7.135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683368.1"
                     /db_xref="GeneID:11501400"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:G8ZZW3"
                     /translation="MNPSYHDNVLHQRDNNRTRLFDTGANEQEMGPSSPYGNNGKIDY
                     SQSSLARLESQNEEGMSLMGERIQALKSLSLKMGDEIRGSNQTLDNLGETFQQTATKV
                     KNNITNMLVMAKNSRISVKTWLLIFSLVGLLFFWVWIR"
     gene            <496440..>497288
                     /gene="TDEL0H02990"
                     /locus_tag="TDEL_0H02990"
                     /db_xref="GeneID:11501401"
     mRNA            <496440..>497288
                     /gene="TDEL0H02990"
                     /locus_tag="TDEL_0H02990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683321.1"
                     /db_xref="GeneID:11501401"
     CDS             496440..497288
                     /gene="TDEL0H02990"
                     /locus_tag="TDEL_0H02990"
                     /inference="similar to DNA sequence:INSDC:YIL003W"
                     /note="similar to Saccharomyces cerevisiae CFD1 (YIL003W);
                     ancestral locus Anc_7.136"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683369.1"
                     /db_xref="GeneID:11501401"
                     /db_xref="GOA:G8ZZW4"
                     /db_xref="InterPro:IPR000808"
                     /db_xref="InterPro:IPR019591"
                     /db_xref="InterPro:IPR025723"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028600"
                     /db_xref="UniProtKB/TrEMBL:G8ZZW4"
                     /translation="MEVSEGVPAQSLSQIKHIILVLSGKGGVGKSSVTTQTALTLCNM
                     GYKVGVLDIDLTGPSLPRMFGLEKKSILQSKDGWLPVSLPVPEGSNGSLSVISLGFLL
                     DDRGNSVVWRGPKKTAMVKQFITDVAWGELDYLIIDTPPGTSDEHISLAEQLRWSKPD
                     GAIIVTTPQNVAVADVKKEINFCKKVEINILGIVENMSGFVCPHCAACTNIFSRGGGE
                     RLANQYSVPYLGNIPIDPKFVEMIESQGSSNVPLSDMYQKSSLFKVFQPILRKILDQN
                     CPSRIA"
     gene            complement(<497316..>498149)
                     /gene="TDEL0H03000"
                     /locus_tag="TDEL_0H03000"
                     /db_xref="GeneID:11501402"
     mRNA            complement(<497316..>498149)
                     /gene="TDEL0H03000"
                     /locus_tag="TDEL_0H03000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683322.1"
                     /db_xref="GeneID:11501402"
     CDS             complement(497316..498149)
                     /gene="TDEL0H03000"
                     /locus_tag="TDEL_0H03000"
                     /inference="similar to DNA sequence:INSDC:YEL005C"
                     /note="similar to Saccharomyces cerevisiae VAB2 (YEL005C);
                     ancestral locus Anc_7.137"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683370.1"
                     /db_xref="GeneID:11501402"
                     /db_xref="UniProtKB/TrEMBL:G8ZZW5"
                     /translation="MVNNTLKNKRKRYTFNSIEGGEAYNELKHVAAVPSHKQLTLRSI
                     SEAMEQDVTNLKKGIASVFEAVRNDISLENVQMESVELQLKKSAKRLNHTYDKVCDNR
                     IRNQRFNPSSEHLKGLSDGVAKLSSNLDIIEDSTDEILENIVKIDARIPRKSRFLNGQ
                     VFNEQHYPLLFGLMRDKFGYLLEEQAEEADLEEIEETNVAHAGPSKSAEITSKSSDAT
                     ASVDDLIVRYRMSQTMRTSSLHASDVFLPPSLRKVSTPSTKTTFETISAKNIFKATPP
                     T"
     gene            <498305..>499321
                     /gene="TDEL0H03010"
                     /locus_tag="TDEL_0H03010"
                     /db_xref="GeneID:11501403"
     mRNA            <498305..>499321
                     /gene="TDEL0H03010"
                     /locus_tag="TDEL_0H03010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683323.1"
                     /db_xref="GeneID:11501403"
     CDS             498305..499321
                     /gene="TDEL0H03010"
                     /locus_tag="TDEL_0H03010"
                     /inference="similar to DNA sequence:INSDC:YEL004W"
                     /note="similar to Saccharomyces cerevisiae YEA4 (YEL004W);
                     ancestral locus Anc_7.138"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683371.1"
                     /db_xref="GeneID:11501403"
                     /db_xref="GOA:G8ZZW6"
                     /db_xref="InterPro:IPR004689"
                     /db_xref="InterPro:IPR013657"
                     /db_xref="UniProtKB/TrEMBL:G8ZZW6"
                     /translation="MWDILGAIAFIFGGCCSNVLTLEGIIGPATSSVGSILTFCQFAF
                     ATLEGIWNFLDFSSPIPRLMPRKIPLKVYLISVLLYYTGSVTNNSVFQYGINVPLHIV
                     FRCSGTVVTMLICWLFNGKQYTRLQVLSAALLTIGAIITSLFREQEFSLDIWRSSTGK
                     NLSTELNARFSTGLLLLVVSSLTSSTLSVYNEWTYQKYGKHWKESLFYTHALALPVFL
                     LNYKQLKEEFFALSNSRKNAELVLFDYSINMNKGQLLMANILTQQACIKGVNLLACHT
                     NALTLSVVLLARKFVSLLLSFYLFGGDLSTTCYVGITTVFAGALLYTLAPNKSTKLNK
                     SKDS"
     gene            <499495..>499899
                     /gene="TDEL0H03020"
                     /locus_tag="TDEL_0H03020"
                     /db_xref="GeneID:11501404"
     mRNA            join(<499495..499513,499583..>499899)
                     /gene="TDEL0H03020"
                     /locus_tag="TDEL_0H03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683324.1"
                     /db_xref="GeneID:11501404"
     CDS             join(499495..499513,499583..499899)
                     /gene="TDEL0H03020"
                     /locus_tag="TDEL_0H03020"
                     /inference="similar to DNA sequence:INSDC:YEL003W"
                     /note="similar to Saccharomyces cerevisiae GIM4 (YEL003W);
                     ancestral locus Anc_7.139"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683372.1"
                     /db_xref="GeneID:11501404"
                     /db_xref="GOA:G8ZZW7"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR027235"
                     /db_xref="UniProtKB/TrEMBL:G8ZZW7"
                     /translation="MDQRNNAFQAKYNDYKQTLEELQSKIIELGHDKDEHDVVLNTLN
                     GTNPERKCYRMIGGALVESDVKTTIPILSLKQSKLSQTVSELKSELTKVAVEFEKWKK
                     DNKIQVVKQ"
     gene            complement(<499993..>501282)
                     /gene="TDEL0H03030"
                     /locus_tag="TDEL_0H03030"
                     /db_xref="GeneID:11501405"
     mRNA            complement(<499993..>501282)
                     /gene="TDEL0H03030"
                     /locus_tag="TDEL_0H03030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683325.1"
                     /db_xref="GeneID:11501405"
     CDS             complement(499993..501282)
                     /gene="TDEL0H03030"
                     /locus_tag="TDEL_0H03030"
                     /inference="similar to DNA sequence:INSDC:YEL002C"
                     /note="similar to Saccharomyces cerevisiae WBP1 (YEL002C);
                     ancestral locus Anc_7.140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683373.1"
                     /db_xref="GeneID:11501405"
                     /db_xref="GOA:G8ZZW8"
                     /db_xref="InterPro:IPR005013"
                     /db_xref="UniProtKB/TrEMBL:G8ZZW8"
                     /translation="MLRSFIVALLTFAALANARCVQGSRTLVIYDERLSVLDNYSNLF
                     NSMRERDYTLDFISVANETSSLQLFKGENKIYDNLMVFPIKGKTLNKHVSGKSLLQFS
                     LAGGNVLAVSSPESLSDPVRLFLNQLGIYPSPKDYRLVDHFQKSSDGIRIGTDGLKNR
                     FVYKPYDEEEDFFITNSSVAILDNREQLVPILVAPRTSYASGKGKDLWVSGSQGYLVV
                     GFQALNNARTAWVGSPEFLSNSNHQSNGILAKELTKWTFKEKGVIKTNGFRHSHIDGT
                     SYEEAPYKIKDAVNYEVSFSEWNGEEWQPFEATDIQFELKMLDPYYRLNLIPSHRDET
                     YQWYTTGDFRLPDHHGVFTFQVDYKRAGLSLVSVSDVKAIRHLAHDEYPRSWEITNAR
                     VYISGIFAVIFAWVLFVIFFVSTSKTTKNFNTEKKNN"
     gene            <501490..>501705
                     /gene="TDEL0H03040"
                     /locus_tag="TDEL_0H03040"
                     /db_xref="GeneID:11501406"
     mRNA            <501490..>501705
                     /gene="TDEL0H03040"
                     /locus_tag="TDEL_0H03040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683326.1"
                     /db_xref="GeneID:11501406"
     CDS             501490..501705
                     /gene="TDEL0H03040"
                     /locus_tag="TDEL_0H03040"
                     /inference="similar to DNA sequence:INSDC:YIL002W-A"
                     /note="similar to Saccharomyces cerevisiae YIL002W-A;
                     ancestral locus Anc_7.141"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683374.1"
                     /db_xref="GeneID:11501406"
                     /db_xref="UniProtKB/TrEMBL:G8ZZW9"
                     /translation="MTKDSPELNELTAVELSNALKKLQEGEQTADEIEHKLDLMEQKM
                     AQLLEQVELMQNDSNTIKIQQQSVEEK"
     gene            complement(<501784..>504636)
                     /gene="TDEL0H03050"
                     /locus_tag="TDEL_0H03050"
                     /db_xref="GeneID:11501407"
     mRNA            complement(<501784..>504636)
                     /gene="TDEL0H03050"
                     /locus_tag="TDEL_0H03050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683327.1"
                     /db_xref="GeneID:11501407"
     CDS             complement(501784..504636)
                     /gene="TDEL0H03050"
                     /locus_tag="TDEL_0H03050"
                     /inference="similar to DNA sequence:INSDC:YIL002C"
                     /note="similar to Saccharomyces cerevisiae INP51
                     (YIL002C); ancestral locus Anc_7.142"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683375.1"
                     /db_xref="GeneID:11501407"
                     /db_xref="GOA:G8ZZX0"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:G8ZZX0"
                     /translation="MRLFIGRNPRSIVISSNGYNLSFQIPSVPGGGQQQSTQQSSKTP
                     VVAIRSITDDELGDLARYVEVKSRIHHGLLGLVSINGDVSVALITGVQKVGFPRWTLQ
                     NGQLNPSENVFKVLDVDFHSLDLPIYDHLHFEITEQNYEKLVHEHPCGFLKKLFSDGT
                     FYYSRDFDISNVLKNHGLSHSLDYTIDNQDMNYIWNSSFVSEIINWRSRIPAQEKELI
                     GDEFFTFLIRGFYKTAVVEEADVVSTVTLITRISAESKQQSLELVGIDEQGRVSDFME
                     TEIIVTTENYIFSYTQVSGNVPLFWEVVDGQLLHGRKLKLTKSAEQSQAAFDRHFDNL
                     ASKYGMASVVNLVKSRSEAQESMARAYKSCAAAKGVKLTNVELGSGFLSKTPHKLLYM
                     LKQDLYEFGAFAYDKKRGIYIGKQTGVLRVSCYDSVDRTTTVERLVSREVLELTTGEL
                     SGVEITSLLIKTHDRLWSENNYWLETTYSKNNKNSSKYRKVYGKLFNSRVKIHDPLHS
                     TISQYLRLRKESYTYERDITIFAGTFNIGGKLPSDDIREWICPEEINNDASFPDIFVI
                     GLEEMVELTPGHILSTDPYVKQYWEKKMLSVLNNAKVDKNYGCVWSSQLGGVLLMLFV
                     CESEYPKVKHVEGDMKKTGFGGMTSNKGAVAVSFKYSATKFCLLVSHLAAGLENVEQR
                     HNDYKTIVKNIRFSRGLRIKDHDVIIWMGDFNYRILMPNDDVRKMIAAGEYAKLLEKD
                     QLNQQMIAGEAFPYYHEMEINFPPTYKFDPGTKTYDTSEKMRIPAWTDRILSRGSSLK
                     QLTYGCAENILFSDHRPVYATFLARVTVLDEQEKAVIAADIYQRIARKLANSSEKDKL
                     ALLSDSNLLLDSLEEDGVRNLSTQSQVAALAQNRGGRLPAPSSDFKKWWIGNGKQVKV
                     VLDVDTQNYIINPERDVNPFSEDNGELSLFVPRETT"
     gene            <505331..>506884
                     /gene="TDEL0H03060"
                     /locus_tag="TDEL_0H03060"
                     /db_xref="GeneID:11501408"
     mRNA            <505331..>506884
                     /gene="TDEL0H03060"
                     /locus_tag="TDEL_0H03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683328.1"
                     /db_xref="GeneID:11501408"
     CDS             505331..506884
                     /gene="TDEL0H03060"
                     /locus_tag="TDEL_0H03060"
                     /inference="similar to DNA sequence:INSDC:YIL001W"
                     /note="similar to Saccharomyces cerevisiae YIL001W;
                     ancestral locus Anc_7.143"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683376.1"
                     /db_xref="GeneID:11501408"
                     /db_xref="InterPro:IPR000210"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR013069"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8ZZX1"
                     /translation="MEKRFNELCYACRIGDTDNVDRLASTGVNLNSVDEFDNSPLFLA
                     SLCGHEEVVKLLLKRGAVCDRDRYEGARCVYGALTDSIRDILLKYDISKAVDVNQPFV
                     MHISSLMKNQLPATHDICLGTTLGNQERLNLHRFILSARSPSLKENFHSVWKEKHEID
                     ITQNVSIRVTETLAKFIYLVPVLHEIDPKDFDCLTSMARDWQMSELEDFLHRVRHVVD
                     PSDKSTMMAEYQFKFTEDARLQFKSLVDDEILKNIQDVDAETSLEASSVVERFATCSA
                     FPDLIVVVEDSDNSKRLFPCHLAILSRCIYFKLMFTLPFSEQATYNLKREGRSAHSRV
                     IPSVFFPSCEFEVAEIILRYLYYDSSDIPWQFAIDVLMTADLLLEDRLKSMAAVVITQ
                     SKEILENYSIFDILYVAWKTRMERLEHYAAKVVALDMKYYAKHPELKQAITLSSRRIS
                     AREETDSIEFVDDIRYYLLEKYSFEPDDIDFLSKEDDTDLLEASGITEYKEDVAVIEN
                     VLDELALQA"
     gene            complement(<506978..>507637)
                     /gene="TDEL0H03070"
                     /locus_tag="TDEL_0H03070"
                     /db_xref="GeneID:11501409"
     mRNA            complement(<506978..>507637)
                     /gene="TDEL0H03070"
                     /locus_tag="TDEL_0H03070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683329.1"
                     /db_xref="GeneID:11501409"
     CDS             complement(506978..507637)
                     /gene="TDEL0H03070"
                     /locus_tag="TDEL_0H03070"
                     /inference="similar to DNA sequence:INSDC:YEL001C"
                     /note="similar to Saccharomyces cerevisiae YEL001C;
                     ancestral locus Anc_7.144"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683377.1"
                     /db_xref="GeneID:11501409"
                     /db_xref="UniProtKB/TrEMBL:G8ZZX2"
                     /translation="MKLGNLLFSFLLSSLAVADETKLSDDASAGSLGYVNFDVSYNIL
                     ERPDAKLTLPIEFTAKETATFNITFQNREDQNVTIVGLAGNVIDTMGGQEIANVTAQE
                     LGPFAVPVNDSVNFQTAIQLTLPEGSFYLAPLLFVVKEDELMKVGIKPVSIFVSPPPM
                     SFFNPGFLSVQLVIGLVVIGATYALGNFRSTGTKRSKAARRGISEKSVDEGWLPDIHK
                     K"
     gene            complement(<508090..>508917)
                     /gene="TDEL0H03080"
                     /locus_tag="TDEL_0H03080"
                     /db_xref="GeneID:11501410"
     mRNA            complement(<508090..>508917)
                     /gene="TDEL0H03080"
                     /locus_tag="TDEL_0H03080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683330.1"
                     /db_xref="GeneID:11501410"
     CDS             complement(508090..508917)
                     /gene="TDEL0H03080"
                     /locus_tag="TDEL_0H03080"
                     /inference="similar to DNA sequence:INSDC:YIR001C"
                     /note="similar to Saccharomyces cerevisiae SGN1 (YIR001C);
                     ancestral locus Anc_7.145"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683378.1"
                     /db_xref="GeneID:11501410"
                     /db_xref="GOA:G8ZZX3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8ZZX3"
                     /translation="MSNSEESQVENTNENVEEVQHAIANSSKSDGTDNALSDTGILQA
                     VADLSIDEKPNANGLPKLSREERYAAQVEADSRSIFVGNITPEITPEIIDEHFKDCGV
                     IERITLLYDKNTGAPKGYAYVEFENADAQEKALEHNGSELKGGKISVYKKRTNLPGYH
                     RHAQFQRPNFYFQQQYYYYPQGGYQDYKNMNIYAPPFELQSSGPRQFGQFNGNFKGKY
                     RGNYRNSKRGGRQQRNYSNYNQLDDYRKDDPENASSSEEVFNADPSKNNDEINGKGN"
     gene            <509444..>510130
                     /gene="TDEL0H03090"
                     /locus_tag="TDEL_0H03090"
                     /db_xref="GeneID:11501411"
     mRNA            <509444..>510130
                     /gene="TDEL0H03090"
                     /locus_tag="TDEL_0H03090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683331.1"
                     /db_xref="GeneID:11501411"
     CDS             509444..510130
                     /gene="TDEL0H03090"
                     /locus_tag="TDEL_0H03090"
                     /inference="similar to DNA sequence:INSDC:YER002W"
                     /note="similar to Saccharomyces cerevisiae NOP16
                     (YER002W); ancestral locus Anc_7.146"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683379.1"
                     /db_xref="GeneID:11501411"
                     /db_xref="InterPro:IPR019002"
                     /db_xref="UniProtKB/TrEMBL:G8ZZX4"
                     /translation="MVSVRKRKMARSSVGKATRRNKDKQRKINITSNPIIAAHWDYSL
                     TLAQNYKKLGLRAKLQAPAGGQEADLSKENKKKPLGRHANESDDDEDEVDDEQDGDEL
                     NREELNSDGEYLEEKIPEGEARIQRDENGDVIKVVYGKMNTTDGEEGKTQATTEVVKE
                     LESFASRPLVRVERNQSTREEEWLATLYKKHGDDYRKMFFDKKLNIYQQSEGDLKRRI
                     RKWKKRHGIA"
     gene            complement(<510197..>511562)
                     /gene="TDEL0H03100"
                     /locus_tag="TDEL_0H03100"
                     /db_xref="GeneID:11501412"
     mRNA            complement(join(<510197..511455,511532..>511562))
                     /gene="TDEL0H03100"
                     /locus_tag="TDEL_0H03100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683332.1"
                     /db_xref="GeneID:11501412"
     CDS             complement(join(510197..511455,511532..511562))
                     /gene="TDEL0H03100"
                     /locus_tag="TDEL_0H03100"
                     /inference="similar to DNA sequence:INSDC:YER003C"
                     /note="similar to Saccharomyces cerevisiae PMI40
                     (YER003C); ancestral locus Anc_7.147"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683380.1"
                     /db_xref="GeneID:11501412"
                     /db_xref="GOA:G8ZZX5"
                     /db_xref="InterPro:IPR001250"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR016305"
                     /db_xref="InterPro:IPR018050"
                     /db_xref="UniProtKB/TrEMBL:G8ZZX5"
                     /translation="MSDKLFRLDAGFQQYDWGKLGSTSAVAKYAAHSDPSVKIAEDKP
                     YAELWMGTHTNVPSYRHDDKASLRDLISSNPKEFLGEDVIKKFQSTTELPFLFKVLSI
                     RKVLSIQAHPDKALGKILRAQDPKNYPDDNHKPEMAIAVTDFEGLCGFKPLEEIADEL
                     KRIPELKAIVGDEIAESFIKNIKPHAVKGSSEDSENKKLLQSVFGKVMNASEPTIAEN
                     ARLLVKRAETKPEDFNKPDLPQLIIDLNKQFPDDVGLFCGCLLLNHCKLNAGEAIFLR
                     AKDPHAYINGDIIECMAASDNVVRAGFTPKFKDVKNLVDMLTYAYDPVEEQKMKTDAV
                     PKSSGAGRSVCFNPPIEEFAIIQTTFAESTGTRHFEGLDGPSILITTSGNGYISSEGT
                     KLKAEPGFVFFVAPNTAVDLEALDTDFVTYRAFVEAN"
     gene            <512079..>512753
                     /gene="TDEL0H03110"
                     /locus_tag="TDEL_0H03110"
                     /db_xref="GeneID:11501413"
     mRNA            <512079..>512753
                     /gene="TDEL0H03110"
                     /locus_tag="TDEL_0H03110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683333.1"
                     /db_xref="GeneID:11501413"
     CDS             512079..512753
                     /gene="TDEL0H03110"
                     /locus_tag="TDEL_0H03110"
                     /inference="similar to DNA sequence:INSDC:YER004W"
                     /note="similar to Saccharomyces cerevisiae YER004W;
                     ancestral locus Anc_7.148"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683381.1"
                     /db_xref="GeneID:11501413"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8ZZX6"
                     /translation="MTTLVLGATGLCGKAILKYCENSRELGEICTITRRALPFQSTAV
                     QKVDKDTTKWGQYIPNEHLEFVFTGLATTRGAAGGFDKQYKIDHDLNIELAKVAKEKG
                     CSTFVLVSSGGAKEDSMFAYMKMKGEIERDILALGFDHTIILRPGPLLGDRLTSKGLI
                     TDVFSKIGSWMYKSRFQVLGGYPVYGDEVGKVGVHLALKESAPNGKKVRIVESKEIIE
                     IAESLR"
     gene            <512915..>514846
                     /gene="TDEL0H03120"
                     /locus_tag="TDEL_0H03120"
                     /db_xref="GeneID:11501414"
     mRNA            <512915..>514846
                     /gene="TDEL0H03120"
                     /locus_tag="TDEL_0H03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683334.1"
                     /db_xref="GeneID:11501414"
     CDS             512915..514846
                     /gene="TDEL0H03120"
                     /locus_tag="TDEL_0H03120"
                     /inference="similar to DNA sequence:INSDC:YER005W"
                     /note="similar to Saccharomyces cerevisiae YND1 (YER005W);
                     ancestral locus Anc_7.149"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683382.1"
                     /db_xref="GeneID:11501414"
                     /db_xref="GOA:G8ZZX7"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="UniProtKB/TrEMBL:G8ZZX7"
                     /translation="MAAASDNHYGIVIDAGSSGSRIHIFEWQDPAALNNAKVTEELKQ
                     SVPQIFQDKDWTYKVTPGLSKYEEKPQKAFSKHIKPLLEYAKNIIPEDKVKETPVFVQ
                     ATAGMRLLPAKKRDKILEDVCHGIKHSTDFLLSNCESQVQVIDGETEGLYGWIGLNYL
                     LGNFNEYDTSKEEHSTFGFMDMGGASTQIAFSPSDSNEIAKHKDDMAKITLRSINGES
                     QEWDVFVSTWLGFGANEARRRYLVQLINALPENSNKYDDDDYKTREITDPCLPKNCKT
                     EFEYKDKDFKFVGSGDQEQCLKLIYPLLLKNLPCSDEPCLFNGVHAPQIDFFKDKFVG
                     TSEYWYTANDVFNLGGSYNFEEFGNHVKEFCDTDWQEIKANSKQGMYNSIPTSFLADS
                     CFKANWVLNVLHEGFGLPRAGVDKIEGEAGNGDHPLFQSAVTIQDRELSWTLGRILLY
                     ASAGVTATNPKSIVGIEPSPNEASMLDKKFIPGAILPAENPTLPTWSALKWIVPLCLI
                     MICFLLLRNLSVIKKWRSVLDNFKHKASRFKYLNIQNDPQSQLEEGFYNNAAENFGDS
                     DREGFKFRSKSAFSLNLNEGSAQESPGYPMRFVSASVASSPTVPKMPSTPPLHPTKAL
                     RPAFSLSDFSKFKDAKFND"
     gene            <515053..>516588
                     /gene="TDEL0H03130"
                     /locus_tag="TDEL_0H03130"
                     /db_xref="GeneID:11501415"
     mRNA            <515053..>516588
                     /gene="TDEL0H03130"
                     /locus_tag="TDEL_0H03130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683335.1"
                     /db_xref="GeneID:11501415"
     CDS             515053..516588
                     /gene="TDEL0H03130"
                     /locus_tag="TDEL_0H03130"
                     /inference="similar to DNA sequence:INSDC:YER006W"
                     /note="similar to Saccharomyces cerevisiae NUG1 (YER006W);
                     ancestral locus Anc_7.150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683383.1"
                     /db_xref="GeneID:11501415"
                     /db_xref="GOA:G8ZZX8"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR014813"
                     /db_xref="InterPro:IPR023179"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZZX8"
                     /translation="MGTRKRTSKRGSTRMREGIKKKAAAHRRKERKNAKKDPTWKSRV
                     KKDPGIPANFPYKARILEEIEMSKQQALEEKELLKQQKLEAKRLAMEQGEDVMDEEME
                     DDGNGLAALVESAQNAAAEYEGADVENGEDFQEVVEHDIDFYSGSGEDDSELEKSRKA
                     YDKIFKTVVDASDVILYVLDARDPEGTRSRQVEEAVLQSQGKRLTLILNKVDLVPPHV
                     LEQWLNVLKSSFPTIPLRSAPGATTSTSFNKKLTQTVTASALLEALKTYSNNSNLKRS
                     IVVGVIGYPNVGKSSVINSLLSHRGGHSKACPVGNQAGVTTSLREIKVDNKLKILDSP
                     GICFPSESKRRTKAEQEAELALLNALPPKYIIDPYPSILMLVKRLAKSDEMVESFKRL
                     YELPSIPADDPDTFTKHFLIHVARKRGRLGKGGVPNLASAGLSVLNDWRDGKIMGWVL
                     PKASKDAGTAPQTLSTGVTQEPAKSEGTSIVSQWSKEFDLDGLFATLDNAITAEKEQN
                     QTM"
     gene            <516771..>518294
                     /gene="TDEL0H03140"
                     /locus_tag="TDEL_0H03140"
                     /db_xref="GeneID:11501416"
     mRNA            <516771..>518294
                     /gene="TDEL0H03140"
                     /locus_tag="TDEL_0H03140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683336.1"
                     /db_xref="GeneID:11501416"
     CDS             516771..518294
                     /gene="TDEL0H03140"
                     /locus_tag="TDEL_0H03140"
                     /inference="similar to DNA sequence:INSDC:YER007W"
                     /note="similar to Saccharomyces cerevisiae PAC2 (YER007W);
                     ancestral locus Anc_7.151"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683384.1"
                     /db_xref="GeneID:11501416"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8ZZX9"
                     /translation="MGFQIGDRLKIGDHICTVKFVGKLPKWPDSHAYGVEWDDPSRGK
                     NSGTFQGQSYFETLKFNSGSFFKDSRLEEIASRGVSFYEAYSRKFRGSAEEFNEIRLG
                     SRVIEAPGFEKVENRYRNRNSLERAILDHHAVNDFPLSEAQWETMREGCVKVRHLDLS
                     YNLLSDFHQTCVLLTHFDNLESVDLSRNVFTNGWDVLDDFIFPGVRELIMTGNELGIE
                     PLQKIIGCFPNLESLDLSWNQLTKLNEKPVSFPSTLKTLGLNGNFMTHVPTSVSDLSL
                     QTLHLSHNLLSNVDPIITPSLRHLDLSFNKIDDWETLDLLNDRIPKLLSLRINNNPIS
                     ANDQLDSVFHIMVARFQEIEVLDDSILSKKVRDDAELYFVSKVIKGEVNYNTKLRRWK
                     TLQKKYSLQTKDERIEKISWLESLIITVRAIDENSKAAIECTLLTNFTVRHSKKIICR
                     KLGLSLFDHKLHLAITPEVLQVMSFEFRPISSYGVSDNSIIYVKRKSCTQDSVKICS"
     gene            complement(<518325..>518932)
                     /gene="TDEL0H03150"
                     /locus_tag="TDEL_0H03150"
                     /db_xref="GeneID:11501417"
     mRNA            complement(join(<518325..518859,518922..>518932))
                     /gene="TDEL0H03150"
                     /locus_tag="TDEL_0H03150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683337.1"
                     /db_xref="GeneID:11501417"
     CDS             complement(join(518325..518859,518922..518932))
                     /gene="TDEL0H03150"
                     /locus_tag="TDEL_0H03150"
                     /inference="similar to DNA sequence:INSDC:YER007C-A"
                     /note="similar to Saccharomyces cerevisiae TMA20
                     (YER007C-A); ancestral locus Anc_7.152"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683385.1"
                     /db_xref="GeneID:11501417"
                     /db_xref="GOA:G8ZZY0"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR004521"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR016437"
                     /db_xref="UniProtKB/TrEMBL:G8ZZY0"
                     /translation="MFRKFTKDDVHSRSKVKSSIQRTLKTKLVNQYPQLEEVIDELIP
                     KKSQIELIKCEDKIQLYAVDGEVLFFQKFDELIPTLKLVHKFPAAYPTVQVDRGAIKF
                     VLSGANIMCPGLTSPGAALPDAPGFEEESIVVINAENKDSALAIGKLMMSTEEIKSVN
                     KGHGVEMIHHLGDPLWTFNVE"
     gene            <520473..>521579
                     /gene="TDEL0H03160"
                     /locus_tag="TDEL_0H03160"
                     /db_xref="GeneID:11501418"
     mRNA            <520473..>521579
                     /gene="TDEL0H03160"
                     /locus_tag="TDEL_0H03160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683338.1"
                     /db_xref="GeneID:11501418"
     CDS             520473..521579
                     /gene="TDEL0H03160"
                     /locus_tag="TDEL_0H03160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683386.1"
                     /db_xref="GeneID:11501418"
                     /db_xref="UniProtKB/TrEMBL:G8ZZY1"
                     /translation="MPKAYLENPNFGQRQDSESEQQGTGVAPFKLQNGAFVNGKLENA
                     SGKREHRRRNLLKTKLSALWNSKFEQHEIETTKPEDANHKRHHIRFWKNRFKDQRSDR
                     SQGDHKNTLSNTESSSPISNHNIFDTSALLFSRTSTERSEQDLESLINETCTVIFRPI
                     DGNDEHDLCSCIVDDHCSFRYSPSPTAPLNIFGPHSRSASEAASGTCIQHEESCHESF
                     SFALTPTATMGMGMGVVGVPESPVTTDSASRLSLRNSADSALHGADSLTPVVRSPTTY
                     SPVDTRSLDDVGTARDVDVMEEDRWIVSSLKEYCSTRLFGKSQRTNRDVGDFHSIPKT
                     LAGQESNPFDAKLLTSSSRSGGSFFHGWRHFKDG"
     gene            complement(<522372..>525392)
                     /gene="TDEL0H03170"
                     /locus_tag="TDEL_0H03170"
                     /db_xref="GeneID:11501419"
     mRNA            complement(<522372..>525392)
                     /gene="TDEL0H03170"
                     /locus_tag="TDEL_0H03170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683339.1"
                     /db_xref="GeneID:11501419"
     CDS             complement(522372..525392)
                     /gene="TDEL0H03170"
                     /locus_tag="TDEL_0H03170"
                     /inference="similar to DNA sequence:INSDC:YIR002C"
                     /note="similar to Saccharomyces cerevisiae MPH1 (YIR002C);
                     ancestral locus Anc_7.153"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683387.1"
                     /db_xref="GeneID:11501419"
                     /db_xref="GOA:G8ZZY2"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8ZZY2"
                     /translation="MVGADDSFDDINEEELESLCGNNVNRIVHETVIRKSMPVQKDLT
                     GRTIEGQKSIYEEIRQEVTFGPTHHKLVQDALGHYVYPTNFEVREYQFDIVRKALFQN
                     TLCAIPTGMGKTFIASTVMLNFFRWSQSGKIIFTAPTRPLVAQQIKACLGITGIPQDQ
                     TAILLDKSRKNREEIWEEKRVFFTTPQVMENDLKRGVLHPKDIITIVIDEAHRATGSY
                     AYTNIIKFVSRFNTSYRVLALTATPGTDLIGVQEVVNNLEISKIEARTEESADIVRYM
                     RKKSRAKIEVSPTVEIEDIIEQIGIAILPVLSQAIELKIYEDCNPSQINAFKAMQQSQ
                     KIIANPGIPEGIKWRNFFILQLLNHVGQMLKRIKIYGIRTFYNYFIDKHKEFTTKYSL
                     GKSTNKTAAEFYYNPILTTMMKQCESLLSNPKFLGHGKLNHVREELADFFSDIGSNSR
                     VIIFTELRESALEIVKCVDTMNEPGHPYQVRPHIFIGQAKGKEGFDEVTFARKNQPKG
                     RKKADRLKRLEEEKQLEEDRKLKKTQAKLERGTRRTGSSEEAQLNGMTQKQQKEVIMK
                     FKNGEYNVLVCTSIGEEGLDIGEVDLIICYDTTSSPIKNIQRMGRTGRKRDGRIVLLF
                     SSNESLKFEQAMKDYEKLQYLICQNNLQYKKSDRIIPSDINPICREEHINIDEDAQVV
                     NEMEDTEEVIRYATQCMLGKKPKRRERKKKGPKKEKQFFMPDNVNTGIATANTLVKKV
                     TSRKKEVKSVVLDKELPSLDPAELSPLEGSSPVKLEFDDDYSAFGKKSNSERLPICGG
                     STYGTGVQSEPPSPEKTSSDTNISLGQKMDDDDRWHINPVANKRKLKVEVSTSATTKK
                     PKREPTQNSNSNSQTDDDGLLTIQEREYFLRKYSAAHTVSIDTIPNFKRYTKIVNIPH
                     SYHNQKIQRLFEDLRHNKKVRTIEMNRTKCIARGLQSGIVNGDAQLTSVIVENDEISY
                     IAKTRKKQSSQENSGISRTSSKELDELLNSDSDF"
     gene            complement(<525616..>529437)
                     /gene="TDEL0H03180"
                     /locus_tag="TDEL_0H03180"
                     /db_xref="GeneID:11501420"
     mRNA            complement(<525616..>529437)
                     /gene="TDEL0H03180"
                     /locus_tag="TDEL_0H03180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683340.1"
                     /db_xref="GeneID:11501420"
     CDS             complement(525616..529437)
                     /gene="TDEL0H03180"
                     /locus_tag="TDEL_0H03180"
                     /inference="similar to DNA sequence:INSDC:YER008C"
                     /note="similar to Saccharomyces cerevisiae SEC3 (YER008C);
                     ancestral locus Anc_7.154"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683388.1"
                     /db_xref="GeneID:11501420"
                     /db_xref="InterPro:IPR019160"
                     /db_xref="InterPro:IPR028258"
                     /db_xref="UniProtKB/TrEMBL:G8ZZY3"
                     /translation="MKSSRSPFKKLSHSREASTGERPSSASHKRTVSGSSATNSHHIR
                     NVSGSGNAPPVSGINTSHRRTTSNSSRSSQNSNFLAEQYERDRKAIIASCFSTHDPRH
                     SEAPNSYITHVRIIEDSRSPSARPPPTSALQNKKKRILIMSVKPNNSNAIQLQKGREN
                     QDGSFQIGRTWDLKELTRVERDTEINEGFILTLGKKYYWETNSAKERTVFIKSLINAF
                     MQAFDGHVPELVNWDLSTFYLDEKSYNRAVITRTPSTSRTTTITTTTSESTRENGNGD
                     YAAAHPQVKSPERADRSGQDSQVTRGNVVNALSKVPYVNSPTIIEANKRYETQLQDRT
                     SPVRNDQTPASIVSGDSGTTTQSQRSSRHIPQAAFTTPVWQREVSPPGDSALGKESHS
                     EKHMSMSESRSDHLLEELNEMLSPAGLASSGAIPMEKDDSGSKEFVDAEPVVKSAKVQ
                     TLPESHQYEPKAFDEKSLDLNETISVNEADEADDTNDLSFERGDEVRYSQALDPDSMH
                     MYHEVSTIQEEALVTNAEESALVNHEGTKALIEKQEIVNKKTWDIDDEEVLEILTEIN
                     WDIDDDAESLIKRLNAKMAETEYNFNNTLLSLEKLGSTLLPYEQNVDRECDRMNPILS
                     LFLMEMGNVAGDIEYVESQNNGLQVESANKKLLWNTLSELLNTVSLDEANLNELLNYP
                     ITEKYLGRMEQQLVALYKALKAINGEKEEGHYNLGEMRALKQRREAYEKVTKVFIERL
                     VTEMTGKFANSSKDDISEDQLSSFLSRLLKFSSLTLFCKEISPESYQLLIESWSNSIA
                     GVYNKMCHSILKELKFLKDSFPLSEQKTINEQPGLNALLSQWKHPKDTKAAQTSNTES
                     ENLLHSLREYMQTIGRWCIFYQNFIDNFFHISSKLDFEQFVKKYSDPNSRMIPLTEYK
                     SMQSDRDSASIETQIVSRTFQPIVNHIASCFTDLLKGDRSIAPALMISLEQEVKVLES
                     TNAEFLMTAVSRVLSQVKQVWVDHVDEQIMYLERLSISVSSKCILPSVIGLPLFIKNS
                     QDLIKVTEREIHIEDDSSFKAAQIYDAACSKMSSAVTKLLARKNDTNKLLDSAEAASS
                     DSANIDRTITLLMNCHWLLELLTLLNGKGVFDSSLQDAKKIFDAEKETYASFLLRVAM
                     PKLTLFVHGASNLIDSTVPGRVADPSKWAAYSKHNLENILIGYTSNEIDILVKRLHDH
                     MLAHFANEPDETIKEVLCDKLWSCIQGQTVSLYLKLYMLIEKHYKGTYVKFTKNDIIT
                     AFERYKKQNFL"
     gene            <529672..>530049
                     /gene="TDEL0H03190"
                     /locus_tag="TDEL_0H03190"
                     /db_xref="GeneID:11501421"
     mRNA            <529672..>530049
                     /gene="TDEL0H03190"
                     /locus_tag="TDEL_0H03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683341.1"
                     /db_xref="GeneID:11501421"
     CDS             529672..530049
                     /gene="TDEL0H03190"
                     /locus_tag="TDEL_0H03190"
                     /inference="similar to DNA sequence:INSDC:YER009W"
                     /note="similar to Saccharomyces cerevisiae NTF2 (YER009W);
                     ancestral locus Anc_7.155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683389.1"
                     /db_xref="GeneID:11501421"
                     /db_xref="GOA:G8ZZY4"
                     /db_xref="InterPro:IPR002075"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="UniProtKB/TrEMBL:G8ZZY4"
                     /translation="MSLDFNALAQQFTEFYYNQFDSDRSQLGNLYRNESMLTFETSQL
                     QGAKDIVEKLVSLPFARVQHRITTLDAQPASPSGDVLVMITGDLLIDEEQNPQRFSQV
                     FHLIPEGSSYYVFNDIFRLNYSA"
     gene            <530254..>532191
                     /gene="TDEL0H03200"
                     /locus_tag="TDEL_0H03200"
                     /db_xref="GeneID:11501422"
     mRNA            <530254..>532191
                     /gene="TDEL0H03200"
                     /locus_tag="TDEL_0H03200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683342.1"
                     /db_xref="GeneID:11501422"
     CDS             530254..532191
                     /gene="TDEL0H03200"
                     /locus_tag="TDEL_0H03200"
                     /inference="similar to DNA sequence:INSDC:YIR003W"
                     /note="similar to Saccharomyces cerevisiae YIR003W;
                     ancestral locus Anc_7.156"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683390.1"
                     /db_xref="GeneID:11501422"
                     /db_xref="InterPro:IPR021582"
                     /db_xref="UniProtKB/TrEMBL:G8ZZY5"
                     /translation="MSSEDIPRIPKRPQRVHRPNDVNEPIQTRSLSSSSVDKTSLSDS
                     GPESPQIPVNRPQRLKTKSPTPVGESDSSPDVEVPPVPSTRPNRAITDEESNKSDSID
                     DESPRPPVNRPQRVRTTSPMPSAAIAGHLSKANTADAIGGLGAPSMPLNRPVKRTTTE
                     SLDRLVQNTSVQLKEMEQLISKHNERAAELGDVDAQRDGSSKEGLLAEEDKDERESIK
                     EVSGEHRLNTQEDEQVEKQHKDQPAQAVSNGIESSEADSVHGRGPPEEVSEKQESLEG
                     PVLNPLSNEDDKILISANESEPVNEQMKEQSETPSDTVKSSPDSAPNMPRRPIRTGPS
                     MLPANDLPKSDTQTPEPQLKTDDSSGSETSITKKRAPPVPKKPSSRIAAFQEMLQKKQ
                     LEQLQGPKPQHTLKQEVAESQRSKHGDEKAQFRQNLNALFTIPGAPAPAGVATTPSEI
                     PTGESTNEDKKEKTLPDVRQKRARGPRGRKLPSKVATVEKVRNESTGNNIELFHSWTT
                     IPRTRKEDEEDTIVKEEAVQLPSAGQDSSANDGIEERRSSVVQSPSGQKTETPEHSIN
                     QTEASLSELAEELESEHSGSIPATNEKEGEMEEVGPEAIESPQDSISKQISKDEIPPE
                     FRTSKEISEDWITGDIDLTEK"
     gene            <532389..>533624
                     /gene="TDEL0H03210"
                     /locus_tag="TDEL_0H03210"
                     /db_xref="GeneID:11501423"
     mRNA            <532389..>533624
                     /gene="TDEL0H03210"
                     /locus_tag="TDEL_0H03210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683343.1"
                     /db_xref="GeneID:11501423"
     CDS             532389..533624
                     /gene="TDEL0H03210"
                     /locus_tag="TDEL_0H03210"
                     /inference="similar to DNA sequence:INSDC:YIR004W"
                     /note="similar to Saccharomyces cerevisiae DJP1 (YIR004W);
                     ancestral locus Anc_7.157"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683391.1"
                     /db_xref="GeneID:11501423"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR026894"
                     /db_xref="UniProtKB/TrEMBL:G8ZZY6"
                     /translation="MVVDTEYYELLGIETTATAVEIKKAYRKKSIEEHPDKNPNDPGA
                     TERFQAISEAYQVLSDSDLRANYDKFGKEKAIPKGGFEDAAEQFSVIFGGEAFEPYIG
                     ELTLLKNLQRQEELQAQDDAEKEKEKEKEEVEKKNRAVKTQTDDAIKEGMGSLKIHDG
                     REHTEGPSKKTKLEEFEEQLKLEKEKNAEVLAAKLIERLSILTESVYDEACKESFAKK
                     FEEEANLLKMESFGLDILHTIGDVYCERARIFLASNTVFGLGGMFHSMKAKGGVFMDT
                     LRTVSAAIDAQSTMKELEKMKGASESDSPILDKDGKEVTKPTPEELAVQEQLLMGKVL
                     SAAWYGSKYEIMSTLRTVCDNVIFDKSIDKTTRYKRGESLLLLGKVFQKAYRNKAEQE
                     EAQVFEQLVAEATKKKRHT"
     gene            complement(<533898..>534950)
                     /gene="TDEL0H03220"
                     /locus_tag="TDEL_0H03220"
                     /db_xref="GeneID:11501424"
     mRNA            complement(<533898..>534950)
                     /gene="TDEL0H03220"
                     /locus_tag="TDEL_0H03220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683344.1"
                     /db_xref="GeneID:11501424"
     CDS             complement(533898..534950)
                     /gene="TDEL0H03220"
                     /locus_tag="TDEL_0H03220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683392.1"
                     /db_xref="GeneID:11501424"
                     /db_xref="UniProtKB/TrEMBL:G8ZZY7"
                     /translation="MQQLSSFRGEKLSVIPGDSERSVGSKGLKPITDLPQDTKKGLGE
                     SIRSGFQSLRRKTSSWRRAKVENLEDKSFKGDSDNVTDSDSEACQISLFDTQRQRNSG
                     ISTASSTRSHKLRFWLNSFDDVNDDYISAQSTKSTKSDAIIYQCPPKHRVRFWLNERN
                     PYGYSDSILEVRYSEITTRIIRSRCLANIAAVEASRIGESRRRVRALKFASAAAAAAF
                     ARFKKAERDINASHGSIANAAMYAYRAIAAASVIQPQKNGDFIRLQHKFNEHFKYQNE
                     SDYFRRIKYIPMKELKKGSAEYKMNQRLREIPTPPMQYDILKYHNDRLDMIIAKGARK
                     RAQLYVAQGAARNYIA"
     gene            <536298..>540827
                     /gene="TDEL0H03230"
                     /locus_tag="TDEL_0H03230"
                     /db_xref="GeneID:11501425"
     mRNA            <536298..>540827
                     /gene="TDEL0H03230"
                     /locus_tag="TDEL_0H03230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683345.1"
                     /db_xref="GeneID:11501425"
     CDS             536298..540827
                     /gene="TDEL0H03230"
                     /locus_tag="TDEL_0H03230"
                     /inference="similar to DNA sequence:INSDC:YIR006C"
                     /note="similar to Saccharomyces cerevisiae PAN1 (YIR006C);
                     ancestral locus Anc_7.160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683393.1"
                     /db_xref="GeneID:11501425"
                     /db_xref="GOA:G8ZZY8"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR026812"
                     /db_xref="UniProtKB/TrEMBL:G8ZZY8"
                     /translation="MYNPYGVPGNQKPQATGYYQQMQQNQQPQQPQQPQQLQQPLSYN
                     QVGGQNTGFSNVQSGMNSYLNPQMSSQQFTGYNPNNSQFNQANIGQTTGNYYGQQNNG
                     LLNVPGIDSSGKPGSSQSPFATSNNFQSPPAQQSQGTGYHNVPFQQPQIQQPQPQQTQ
                     QNQQPQQVQQTGMRPQLLAQQRTGPQPQLLQQQQTGFGQSQPLLPQQTGFYMQSSQQQ
                     APLEPLRPTATGFVNSFANNGINNDVNIPARRLSFITANDQAKFEKLFRSRVAKGSNT
                     ISGNDCRAILMKSGLQPSQLAKIWALCDSSKAGELLFPEFALAMHLVNDVLQGDSIPY
                     ELDTKTKNEVSSFIDAINLSIASQSYTDLSQARTPFDQLVNQGTTGLQAQNTGFMPQT
                     SFGMPLQTQITGRPVNNAQDNFAVPLQSQITGGAVSNAQNNFGVPLQSQITGGAVSNA
                     QNSFGVPLQSQITGGGLPATPNSFGMPLQSQVTGGGLKSQNTGYMPQTSFGLPVQPQV
                     GPQLNQQLTGNRLQSQNTGFMPQTSFLQNQVTGNGMLQQQTTGGFAPSLPNQNTGAFN
                     SFAPQNTVGANIAPNSQTSMNGGIQQPQFTGGPIGTQPSGNTFQQQITGGPLGTLPPL
                     QQQQQQQPVGPSAANLTTQSTGSLIPQQATGPPIGAQQFGGSQNQPYRGFATAVPSQS
                     TGNLSALQSQQTGYLPPSGFNPTMPLTAQKTGFGNNEIYAQSNFGSNFNAESEDSITP
                     EEKSLFYKIFETYDTEKKGLLESTSAVEIFRKSGLNRSDLEHIWNLCDVNNSGSLNKQ
                     EFALGMHLVYRRLNGYQLPNRLPLSLIPSSTKIIDNVKNQLKNTRSNEGKQKTAKIDA
                     LSYKNNDDEAALPSFRNRRKVFSTANEKPVSSVGASSSTSDANKKKEKLASLRKAIKE
                     KRDRLNAERNREQSTSEQDELRRIETLKAEIRDLPQFSNVENDAVPAELRERFDGIIS
                     KLPHLFSQITDADNEITNARIQLFKMKTPSSIVGTGPNGEITEDDRKKAKSKALLKAR
                     MDALTGKQVEVADSLDQEERRYNTEISKIRDESTKNQHIIDDIRRSISEISASLKSNL
                     NGGVINGNPADFGTWEFGVGLEPDVRRFINALNSAKLSTARPNNASSAVKPQQNAGNV
                     SQPQSSSYNSREPVENVGPGSYSSDQTGSNSQKAKPAEEDEDEEERHLRDQLEKLKLK
                     KKADKERRLAELRRQIEEAENDSEDEQEINQNAGTKAPLSSSVQGSTPSLDRNSQPNA
                     QSTSTPAVVANSVPPVTSTPTGGRNPFFRQEISSTSSFDAKAAENQRRLQRGLGEDDE
                     SDGWSDDEPQQKPVSSPTADEADAKKAAQVNTPVAPPASLQPSVTSSSQAPAVPLAPP
                     LPAVSQTVPPAVESSEPVPVAPPLPQVTGSNTAPPVPTAPPLPQVTGSNIAPPVPTAP
                     PLPQVGSGSVFSMPPPPSLPGAKVQALTPAQTPQLAETQNDSDDVLSIPDSVASEEDV
                     NESAPTGIPPPPPLP"
     gene            complement(<540934..>541437)
                     /gene="TDEL0H03240"
                     /locus_tag="TDEL_0H03240"
                     /db_xref="GeneID:11501426"
     mRNA            complement(<540934..>541437)
                     /gene="TDEL0H03240"
                     /locus_tag="TDEL_0H03240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683346.1"
                     /db_xref="GeneID:11501426"
     CDS             complement(540934..541437)
                     /gene="TDEL0H03240"
                     /locus_tag="TDEL_0H03240"
                     /inference="similar to DNA sequence:INSDC:YIR005W"
                     /note="similar to Saccharomyces cerevisiae IST3 (YIR005W);
                     ancestral locus Anc_7.159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683394.1"
                     /db_xref="GeneID:11501426"
                     /db_xref="GOA:G8ZZY9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8ZZY9"
                     /translation="MNQIRAIQRINDTELSSGILSPNLSWHNEYKDRAYIFIGGLNVE
                     LTEADILTIFSQYGIPVDVFLVRDRETGDSKGFGYLKYEDQRSAVLAIDNLNGSKIAG
                     RIIKVDHAWYTPRDDMIEYQEAVQRELSKDRIDIPKELRIMDRRQEVEEVELEDPMAS
                     YETCPGN"
     gene            <541571..>542299
                     /gene="TDEL0H03250"
                     /locus_tag="TDEL_0H03250"
                     /db_xref="GeneID:11501427"
     mRNA            <541571..>542299
                     /gene="TDEL0H03250"
                     /locus_tag="TDEL_0H03250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683347.1"
                     /db_xref="GeneID:11501427"
     CDS             541571..542299
                     /gene="TDEL0H03250"
                     /locus_tag="TDEL_0H03250"
                     /inference="similar to DNA sequence:INSDC:YER010C"
                     /note="similar to Saccharomyces cerevisiae YER010C;
                     ancestral locus Anc_7.158"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683395.1"
                     /db_xref="GeneID:11501427"
                     /db_xref="InterPro:IPR005493"
                     /db_xref="UniProtKB/TrEMBL:G8ZZZ0"
                     /translation="MTSYIDKLSPFTTCDVADGLLNCYNIEDGGYFANLTQWSGKSKG
                     SVVGRAYTVLFAPASDPRPAINYIDGVPEGSFLVIAMTKSLQCEFAPYVKITQACYGG
                     LMSTRAQYQGVVGSVIFGRIRDVDEHRNLEHPVFSYGLGACAPKAAVKAVAIEVPLEI
                     LHPDGSTKTIDSGDYVIGDEHGIVGVPISKVNLGFLIEYIERSIEADELVSQDIKSGV
                     PAKQSQQTRREILKRVLESAPDIS"
     gene            complement(<542810..>544735)
                     /gene="TDEL0H03260"
                     /locus_tag="TDEL_0H03260"
                     /db_xref="GeneID:11501428"
     mRNA            complement(<542810..>544735)
                     /gene="TDEL0H03260"
                     /locus_tag="TDEL_0H03260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683348.1"
                     /db_xref="GeneID:11501428"
     CDS             complement(542810..544735)
                     /gene="TDEL0H03260"
                     /locus_tag="TDEL_0H03260"
                     /inference="similar to DNA sequence:INSDC:YIL014W"
                     /note="similar to Saccharomyces cerevisiae MNT3 (YIL014W);
                     ancestral locus Anc_7.123"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683396.1"
                     /db_xref="GeneID:11501428"
                     /db_xref="GOA:G8ZZZ1"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8ZZZ1"
                     /translation="MLPFRQFISRLKRKNGALFKRLLLLGTCLMAIYLIFSTSTFSTS
                     YSVLSDDDILEIGARKAMRVSAFHWIEKRQKKVIGQVSEKRGKFFRFPFLASNRSEDA
                     ETELLLNWKSSPIAEKCRYMIDATYALNRAWTNEHILKFYGEDEVDNVLISLMAERQR
                     MFDYCFLSGNLSLEDVFKVESLIGLKHEIKSSPNDFLRRMFPFLKKLDDQGDQFLWPQ
                     ITNLRSGSVQALPDLPKNFNQNFFSNWQRMASGSGIVITLNEGSKNLLYKQLKVFDHS
                     DNTLPIQIITTGNDFSDGFIEELKAKVAASKQNVYLVDCSPILDSEFAKEHIGDIINK
                     WIAVIFTTFEESILLDVDAVPFVPMDDFLTEKSYKASGILMYKDRSMPNEHTFQYCID
                     MLREVEPSYQERHLINSRIKYHSGTKDFEQSEEADVYKRFSHDLLLHHVESGLVVINK
                     PKKLGGLLLSFLLQLDAKMKRCVYGDKEIFWLGQLYAGQDYSIYPTDGGVAGPLIVEN
                     NDSISVYQICATQIAHIDESHNLLWTNGGLKTCKFDNGAEADFERNPAYFEQRYQELE
                     SLKSIYGSPLNIEGTIIPNVNEKPWLQINECESYMYCASAYKDNNNASPEVGELSVFD
                     ESTSNRIKSIVSIWNQS"
     gene            complement(544936..545008)
                     /gene="TDEL0Htrna6T"
                     /locus_tag="TDEL_0Htrna6T"
                     /db_xref="GeneID:11501429"
     tRNA            complement(544936..545008)
                     /gene="TDEL0Htrna6T"
                     /locus_tag="TDEL_0Htrna6T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:11501429"
     gene            complement(<546044..>548269)
                     /gene="TDEL0H03270"
                     /locus_tag="TDEL_0H03270"
                     /db_xref="GeneID:11501726"
     mRNA            complement(<546044..>548269)
                     /gene="TDEL0H03270"
                     /locus_tag="TDEL_0H03270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683349.1"
                     /db_xref="GeneID:11501726"
     CDS             complement(546044..548269)
                     /gene="TDEL0H03270"
                     /locus_tag="TDEL_0H03270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683397.1"
                     /db_xref="GeneID:11501726"
                     /db_xref="UniProtKB/TrEMBL:G8ZZZ2"
                     /translation="MSDQIDLSIYQPNLNNKYTGDPWSIFNAAAQRRKEREVNLKQET
                     LSQPESDEERRRVLEQVKVDVMLFTAEYQKKNQLDWVDLEAQINDEEYYCPEAEADYD
                     DGKSTESDTAVETDAERETAFQAECVVSAEVEYSDAEITQDEGSSADGVDQYDEEYRD
                     TSSIYDDINEDVASNNNNVVKEDDEECLDYITDTFEIKRINKRLEDAIEYYNRKDVER
                     KGFGDRSFIEKAFKEFEAGELSEDKLHSLEKTVAFYNRPSSADRLHFANIRLRRSARK
                     IGFGETRIKTYNVGEVVTKEEHPVKPKHGAPGKSILKNTNVKKFQTPKGDYNLVGTDL
                     LANAIARLFNLSDMPLKFFDKDDPISSLTWAAHGIANAFGLKELCMENVMNGKIEARK
                     KAIKQRDECIKKLQTEKSSLVGEVSELKEKLEKVTTEMNLKTRESREYLDLANNRTRE
                     LKRTVGNMEELKIDLIEATSKAETLAVENNDLRKNTKELRANLVEQKETSKSLNAHIR
                     ILEKKLVHEQKRLSDSWSKIQSLEQYTKESLKLQSGLQAIDKSNEKLVDENKKLRTLN
                     DRLSVKVKDVEVSLSKIGRSLETSQCNESKLQEANQSLAKEREENHEKIERLEETNHA
                     YRAEFALQFRQLEAKYAEAVKECKIRDKEIRKAERQLEKRAQALRDTGWKMAKKRDDN
                     TVHVYSENMADDGNCVDRRRRNADSDVQVSGGHGHKVLRSLSNKMHVHMSSTDYKLGR
                     Y"
     gene            <549775..>550302
                     /gene="TDEL0H03280"
                     /locus_tag="TDEL_0H03280"
                     /db_xref="GeneID:11501430"
     mRNA            <549775..>550302
                     /gene="TDEL0H03280"
                     /locus_tag="TDEL_0H03280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683350.1"
                     /db_xref="GeneID:11501430"
     CDS             549775..550302
                     /gene="TDEL0H03280"
                     /locus_tag="TDEL_0H03280"
                     /inference="similar to DNA sequence:INSDC:YIR017C"
                     /note="similar to Saccharomyces cerevisiae MET28
                     (YIR017C); ancestral locus Anc_7.122"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683398.1"
                     /db_xref="GeneID:11501430"
                     /db_xref="UniProtKB/TrEMBL:G8ZZZ3"
                     /translation="MAEDDKEGKIVGDTDNVVNVSQDLQSLISKNSELGSRLLSLLLV
                     SSSNGKEIIEAINKGQLSLIQSLDMNLDVKVAKEGKGILDEMIKKRKSTEASARFRVR
                     KKQREQEKLNELRELNSKIGDLNRRVDVLLEENRYWKAQLERLNDKRSRELLESIKKR
                     NSSSSASASSSSLRG"
     gene            complement(<550421..>552517)
                     /gene="TDEL0H03290"
                     /locus_tag="TDEL_0H03290"
                     /db_xref="GeneID:11501431"
     mRNA            complement(<550421..>552517)
                     /gene="TDEL0H03290"
                     /locus_tag="TDEL_0H03290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683351.1"
                     /db_xref="GeneID:11501431"
     CDS             complement(550421..552517)
                     /gene="TDEL0H03290"
                     /locus_tag="TDEL_0H03290"
                     /inference="similar to DNA sequence:INSDC:YOL036W,YIR016W"
                     /note="similar to Saccharomyces cerevisiae YOL036W and
                     YIR016W; ancestral locus Anc_7.121"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683399.1"
                     /db_xref="GeneID:11501431"
                     /db_xref="UniProtKB/TrEMBL:G8ZZZ4"
                     /translation="MESTLGIRSNENGELGIGNAATQLQDIKEEEDVELRRLHSGVND
                     SSSIGESQMSGTKPVDEKMEYGVSVATSAASSDDEEKQVVGSRSRDDLSLLPPLPNTF
                     EKVIEDEAGHQGPLQDPETHKSDEHFDLSKALEIPVSYANNAESTTIENGGSDSSLPL
                     TPKITSPKLSLKKKFSNATPVAFPTPREGSPGEIYEPRAHSIRSKSNSNATAFQHILP
                     ALNLAIEASASDHHHHHHYHHYQVRRSQDRRSIRKFSFGDSSSDNSSNSLTDAELLYR
                     MPPPSLNRTSNSRSRSNSGVTTSFDALTNPTTAMNTPTASLLEGEPGSKKVPLLRRAS
                     SAILRKASIRGKNDILRSSSASTTPVLQNKPFFETQRTPPNANRYASSMIYGDNNSDD
                     DLQYVTQIEDTSRPCSRNPSIRSRVRRGFSRIMSSSGSVCRVASSASLRDSSATDDVR
                     TPVSSEKPRYENEDLDDSSRRSSPLESRKLENISSGTPISASTFLSPVNSKAVHLADQ
                     RAGMAISNVDYHKESTGENGNLVGNSNGGKKETGSSQTTSEGAKVAKNSDDDIGDDVT
                     VDLDKLTQSIPVITVTDNVSSKHIMDIKVQSNISLDEVYRGKNYKNYRKYIGGTRDRD
                     DDSKKPEMMTLREYVEVLVKQQQIEDERLAVLEKNFKDSGWCSKEDLMNLKQKRIIIS
                     KKWAERISFYQNKLDL"
     gene            complement(<552725..>553495)
                     /gene="TDEL0H03300"
                     /locus_tag="TDEL_0H03300"
                     /db_xref="GeneID:11501432"
     mRNA            complement(<552725..>553495)
                     /gene="TDEL0H03300"
                     /locus_tag="TDEL_0H03300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683352.1"
                     /db_xref="GeneID:11501432"
     CDS             complement(552725..553495)
                     /gene="TDEL0H03300"
                     /locus_tag="TDEL_0H03300"
                     /inference="similar to DNA sequence:INSDC:YOL038W"
                     /note="similar to Saccharomyces cerevisiae PRE6 (YOL038W);
                     ancestral locus Anc_7.120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683400.1"
                     /db_xref="GeneID:11501432"
                     /db_xref="GOA:G8ZZZ5"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8ZZZ5"
                     /translation="MSGYDRALSIFSPDGHIFQVEYAAEAVKRGTCAVGIKGRDCVVL
                     GCERRSTLKLQDPRITPSKISTIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLED
                     PVTVEYLTRYVAGVQQRYTQSGGVRPFGVATLIAGFDPQDDTPRLYQTEPSGIYSAWT
                     AQTIGRNSKTVREFLEKNYNRDEPPATAEECVKLTVRSLLEVVQTGAKNIEITLVKPG
                     AQIVTLTAEEIGKYVEDIEREKQLQQEEHDKRKKPTND"
     gene            <554567..>554860
                     /gene="TDEL0H03310"
                     /locus_tag="TDEL_0H03310"
                     /db_xref="GeneID:11501433"
     mRNA            <554567..>554860
                     /gene="TDEL0H03310"
                     /locus_tag="TDEL_0H03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683353.1"
                     /db_xref="GeneID:11501433"
     CDS             554567..554860
                     /gene="TDEL0H03310"
                     /locus_tag="TDEL_0H03310"
                     /inference="similar to DNA sequence:INSDC:YOL026C"
                     /note="similar to Saccharomyces cerevisiae MIM1 (YOL026C);
                     ancestral locus Anc_7.119"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683401.1"
                     /db_xref="GeneID:11501433"
                     /db_xref="GOA:G8ZZZ6"
                     /db_xref="InterPro:IPR013262"
                     /db_xref="UniProtKB/TrEMBL:G8ZZZ6"
                     /translation="MEDVPKQALETVEAGAIGEPQNNEEVHQEGLFSGVLSFAQTCTI
                     NLVLPFVNGLMLGFGELLAHEIAWRKDFFHRTNAGYRIYPERRKLQAPKTEFL"
     gene            complement(<554875..>555228)
                     /gene="TDEL0H03320"
                     /locus_tag="TDEL_0H03320"
                     /db_xref="GeneID:11501434"
     mRNA            complement(<554875..>555228)
                     /gene="TDEL0H03320"
                     /locus_tag="TDEL_0H03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683354.1"
                     /db_xref="GeneID:11501434"
     CDS             complement(554875..555228)
                     /gene="TDEL0H03320"
                     /locus_tag="TDEL_0H03320"
                     /inference="similar to DNA sequence:INSDC:YIR015W"
                     /note="similar to Saccharomyces cerevisiae RPR2 (YIR015W);
                     ancestral locus Anc_7.118"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683402.1"
                     /db_xref="GeneID:11501434"
                     /db_xref="InterPro:IPR007175"
                     /db_xref="UniProtKB/TrEMBL:G8ZZZ7"
                     /translation="MGKSVAGGDHFQRMNYLYELATWQTLVLGKHDPGQAMARANVAC
                     MDRVGKKTRSRILPQLKRTCCKKCHRVLVPLRTVESSLKEGVLQWNCRCGESKKFPIG
                     SDRSFKTYGERGNLD"
     gene            complement(<555251..>555868)
                     /gene="TDEL0H03330"
                     /locus_tag="TDEL_0H03330"
                     /db_xref="GeneID:11501435"
     mRNA            complement(<555251..>555868)
                     /gene="TDEL0H03330"
                     /locus_tag="TDEL_0H03330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683355.1"
                     /db_xref="GeneID:11501435"
     CDS             complement(555251..555868)
                     /gene="TDEL0H03330"
                     /locus_tag="TDEL_0H03330"
                     /inference="similar to DNA sequence:INSDC:YIR014W"
                     /note="similar to Saccharomyces cerevisiae YIR014W;
                     ancestral locus Anc_7.117"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683403.1"
                     /db_xref="GeneID:11501435"
                     /db_xref="UniProtKB/TrEMBL:G8ZZZ8"
                     /translation="MSRAEQLTMACYACVYLRYMRDGSLLLALVAWACVSLAEFLGGL
                     LVVHLRRTVESGEEEGGLEPQVVKAVVRKGLLYFRWLLLGQTVYLVASHWRYKPSGHH
                     HSVVMPLIGDLDGPERSSWGLWLLDAAITVLQLALLHRQLQPQVRSHKLTVTQLQTQR
                     YGILAPLRFDSWDNSDELDLLITRRALPGNEYGSLSSSSLAHLND"
     gene            <556026..>557528
                     /gene="TDEL0H03340"
                     /locus_tag="TDEL_0H03340"
                     /db_xref="GeneID:11501436"
     mRNA            <556026..>557528
                     /gene="TDEL0H03340"
                     /locus_tag="TDEL_0H03340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683356.1"
                     /db_xref="GeneID:11501436"
     CDS             556026..557528
                     /gene="TDEL0H03340"
                     /locus_tag="TDEL_0H03340"
                     /inference="similar to DNA sequence:INSDC:YOL027C"
                     /note="similar to Saccharomyces cerevisiae MDM38
                     (YOL027C); ancestral locus Anc_7.116"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683404.1"
                     /db_xref="GeneID:11501436"
                     /db_xref="InterPro:IPR011685"
                     /db_xref="UniProtKB/TrEMBL:G8ZZZ9"
                     /translation="MLGIRGYSAVVRRGAVRVPLRVPAVGLRRYATENPEAGKPVKAV
                     KEPLMQRIRHEVKHYVNGTKLLGYELKISTKLLVRFVQGYELSRRETNQLKRTMGDIF
                     RLVPFSAFLIIPFAELLLPVALKIFPNLLPSTYESGTDKQKKRNKLIEIRKKTSDFLH
                     ETLEESSLLSYSSIDNSEKKKRFYQFFKKLYSPKDGKTNLFTHDEILSVAQMFKNDTV
                     LDNLSRPQLVAMAKFISVTPFGNDNMLRYQIRHKLKQIMEDDKVIDYEGVDVLSKEEL
                     YHACVSRGVKAYGVTKEELIEYLKVWLDLRLRHKVPSVLLVLSSTFTFGGLEKKQEMK
                     AISPQAEEKDVKSRYDELLDLYYDGILRVLSSIPDPVYNVAKLDVSESKSAPEEAETK
                     KETTQQPPKTTPVVATQAASPELTDSSAKIQETETKEQEEEAVPKTDENEFKLNVLKE
                     QEELIKKEKEEAKNRTSAPVQDDITLDEDETAKPPIPADQAQPTAVTKKD"
     gene            <557681..>558718
                     /gene="TDEL0H03350"
                     /locus_tag="TDEL_0H03350"
                     /db_xref="GeneID:11501437"
     mRNA            <557681..>558718
                     /gene="TDEL0H03350"
                     /locus_tag="TDEL_0H03350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683357.1"
                     /db_xref="GeneID:11501437"
     CDS             557681..558718
                     /gene="TDEL0H03350"
                     /locus_tag="TDEL_0H03350"
                     /inference="similar to DNA sequence:INSDC:YIR018W,YOL028C"
                     /note="similar to Saccharomyces cerevisiae YAP5 (YIR018W)
                     and YAP7 (YOL028C); ancestral locus Anc_7.115"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683405.1"
                     /db_xref="GeneID:11501437"
                     /db_xref="GOA:G9A000"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:G9A000"
                     /translation="MGIDTVVKYAKLEPKSSTEAQLAMSKVHISKSWKLPPRSRPVKR
                     QVTKQLESPTSDEEERKKRQNRDAQRAYRERRTNRIQELEDTVETLQGLVKNWQKKFR
                     ALESELKDVKKDNTELKRRLVTTPQEEHIPLVDPLLRDLIDNFKPMKAVTLKKRKLSP
                     RKSTADCGFCSETTTCVCKEIEDSGMETARCTENTETCTKCSDIDQSCIKPRESQRPV
                     ETDTDFLAIDGEDQPNTMDPNFVPGSCKRCQSDSQSRAFCQAVYGPPNDDKVAACCGG
                     NGECSNSADFIPISDAYQRIIKYMLDSDRDSPPIKHIASGLRARGGEVELKTIDDAIR
                     GMDKKDVGSTE"
     gene            complement(<558755..>560182)
                     /gene="TDEL0H03360"
                     /locus_tag="TDEL_0H03360"
                     /db_xref="GeneID:11501438"
     mRNA            complement(<558755..>560182)
                     /gene="TDEL0H03360"
                     /locus_tag="TDEL_0H03360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683358.1"
                     /db_xref="GeneID:11501438"
     CDS             complement(558755..560182)
                     /gene="TDEL0H03360"
                     /locus_tag="TDEL_0H03360"
                     /inference="similar to DNA sequence:INSDC:YOL030W"
                     /note="similar to Saccharomyces cerevisiae GAS5 (YOL030W);
                     ancestral locus Anc_7.114"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683406.1"
                     /db_xref="GeneID:11501438"
                     /db_xref="GOA:G9A001"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G9A001"
                     /translation="MFWLSSLVLSLCASLTLGQSSNSTSTPAINITGNAFFNSETGER
                     FYIRGVDYQPGGSSNLTDPLADVEICKRDIPVFQDLGINTIRVYTVDNSLDHSECMQM
                     LQDAGIYLILDVNTPEASISRYNPSCSYNAVYLQSIFSTVDDFAQYDNVLGFFAGNEV
                     INMANNTYTATYVKAVVRDLKNNIKARDYRAIPVGYSAADIESNRELAAQYFNCGDDE
                     DARIDMFGVNDYSWCGQSSFQTSGYNEKMKIYEGYSLPIFLSEFGCNQVASSRPFTEI
                     GSLYSTQMSSVFSGGLVYEYSNETNNYGLVQIVSDTEVTKLQDFDNLKEQYSKQENPS
                     GNGGASTSNEHSTCPDYEEGIWEANTTLPEMPSAASVYFSSGAGAPQGTGYDTQSQCD
                     SDDSDDDSSSSSSTTTSDSSSDSSTSTSASSTDASSTSSSSATSSSSSSSSSSSSSSK
                     TKNGAVVVEIPRVFQAITQLLTMII"
     gene            complement(<560397..>560858)
                     /gene="TDEL0H03370"
                     /locus_tag="TDEL_0H03370"
                     /db_xref="GeneID:11501439"
     mRNA            complement(<560397..>560858)
                     /gene="TDEL0H03370"
                     /locus_tag="TDEL_0H03370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683359.1"
                     /db_xref="GeneID:11501439"
     CDS             complement(560397..560858)
                     /gene="TDEL0H03370"
                     /locus_tag="TDEL_0H03370"
                     /inference="similar to DNA sequence:INSDC:YDL008W"
                     /note="similar to Saccharomyces cerevisiae APC11
                     (YDL008W); ancestral locus Anc_3.190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683407.1"
                     /db_xref="GeneID:11501439"
                     /db_xref="GOA:G9A002"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024991"
                     /db_xref="UniProtKB/TrEMBL:G9A002"
                     /translation="MKVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRA
                     SYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGL
                     AINDSQISKFQELRNKQWQTRQQEFGDQQDPETNPLEDQDDPMMDQGLIVR"
     gene            complement(560976..561048)
                     /gene="TDEL0Htrna7T"
                     /locus_tag="TDEL_0Htrna7T"
                     /db_xref="GeneID:11501440"
     tRNA            complement(560976..561048)
                     /gene="TDEL0Htrna7T"
                     /locus_tag="TDEL_0Htrna7T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:11501440"
     gene            <561672..>562205
                     /gene="TDEL0H03380"
                     /locus_tag="TDEL_0H03380"
                     /db_xref="GeneID:11501728"
     mRNA            <561672..>562205
                     /gene="TDEL0H03380"
                     /locus_tag="TDEL_0H03380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683360.1"
                     /db_xref="GeneID:11501728"
     CDS             561672..562205
                     /gene="TDEL0H03380"
                     /locus_tag="TDEL_0H03380"
                     /inference="similar to DNA sequence:INSDC:YMR009W"
                     /note="similar to Saccharomyces cerevisiae ADI1 (YMR009W);
                     ancestral locus Anc_7.113"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683408.1"
                     /db_xref="GeneID:11501728"
                     /db_xref="GOA:G9A003"
                     /db_xref="InterPro:IPR004313"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR027496"
                     /db_xref="UniProtKB/TrEMBL:G9A003"
                     /translation="MVEAYIHDGNDSVDLREPHNSGTPVSLEELSKLGVFYRYLDTQE
                     DVDNLAKERNYKNRDIVNISPASFPDEETLKAKLDIFYKEHLHEDEEIRYCLDGEGYF
                     DVRNILSSDWIRIRFERNDLLIVPAGIFHRFTLTSSNYVKALRLFQDEPKWLAINKPE
                     ADLNPTHLKYVESVNSD"
     gene            <562388..>563539
                     /gene="TDEL0H03390"
                     /locus_tag="TDEL_0H03390"
                     /db_xref="GeneID:11501441"
     mRNA            <562388..>563539
                     /gene="TDEL0H03390"
                     /locus_tag="TDEL_0H03390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683361.1"
                     /db_xref="GeneID:11501441"
     CDS             562388..563539
                     /gene="TDEL0H03390"
                     /locus_tag="TDEL_0H03390"
                     /inference="similar to DNA sequence:INSDC:YMR010W"
                     /note="similar to Saccharomyces cerevisiae YMR010W;
                     ancestral locus Anc_7.112"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683409.1"
                     /db_xref="GeneID:11501441"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:G9A004"
                     /translation="MGDVTEKGPLVEDSPGDSLASYLPRVDQFYIPEWLTMQFIANNL
                     ISFTPLFSYGSTIISIERSKTALGFSIDICATMLIASILRVSYYLITPYEITLLRQSL
                     VMIFIQLILLKTTLRYRPEEYKYHNLSDVESFSQLIHDVWFEYFACAKPPAFSEDWKV
                     MLKSLSFKNLTGFANKILLVLVYKFLKFFDPSYKRFGSFWQWDEDRKFWKFLAYFATF
                     QLLLTFFISKVFNWATLSDWVGSTIGSLGLLIESLLPLPQIAILYKLKSIQGFKLILL
                     VSWLCGDSLKITYLIYGAKNISMIFLMFALFQMSLDFYIGGQYIYYKYYYPSLRNEGL
                     ILDENESTIEPQRESFELQDFNLKSVEHLDQDTPPPNQHPRGRAHTLSV"
     gene            complement(<563608..>565869)
                     /gene="TDEL0H03400"
                     /locus_tag="TDEL_0H03400"
                     /db_xref="GeneID:11501442"
     mRNA            complement(<563608..>565869)
                     /gene="TDEL0H03400"
                     /locus_tag="TDEL_0H03400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683362.1"
                     /db_xref="GeneID:11501442"
     CDS             complement(563608..565869)
                     /gene="TDEL0H03400"
                     /locus_tag="TDEL_0H03400"
                     /inference="similar to DNA sequence:INSDC:YOR017W"
                     /note="similar to Saccharomyces cerevisiae PET127
                     (YOR017W); ancestral locus Anc_7.111"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683410.1"
                     /db_xref="GeneID:11501442"
                     /db_xref="InterPro:IPR013943"
                     /db_xref="UniProtKB/TrEMBL:G9A005"
                     /translation="MYRCCNSGYRRTLSGSRYAYRKCGISTSVPSKNSHNEPLNQSDE
                     REGHSPNVKQDLLDALSYSSKILEGMGHRDESRKRFKRQKQDSIKMKIPPAIDIAVGK
                     SRKKVTNTTFTISSKRTKHVTINSDGSIQNDNRAKLTPHVIPPPLVSGLDRVLYQPVT
                     LHPLRDSRTGVYNFNPELEKITPDYLEAKDGASHFITPYKDQKLSELAHKSQRKYVSS
                     TSSMTSVLSHMHYLLSNFRPVNIIDSPISRHFPQKNCNFTQGAQFPAAIILRKLDKKV
                     KSIDSDRSLDREIILSILGHSLEEFLTEASPGQGEAYHYSKIDEFILRSQLDAYDSKL
                     PGTGVFDLKTRAVAAIRHDLSYVEKNNNHTGYEIDKVYGEFESLEREFFELIRSTLLK
                     YSLQARIGKMDGIFVAYHNISRMFGFQYLPLEEIDYIIHSSYDAPFKRAMDERNNTLR
                     NIYGDENFILKHQRNEREIASKVADAEFKMSIILLKNALTYIEDKLNSMGIKDWKMCK
                     IMMKTEQITETIPNSEKRATYPSLKVVVLPLPLEYVDKPLVSRGKKQKEILSQISNIQ
                     DYNEKLLTLQTDSMFGFEIRADHFYKNNPSGVYIPPFARVENKVLDIQSCQQVSKRLF
                     KDYYQNLKKDKSPSFFHPMDVETWKTTCTFIDIEDKGSLQKIYRQLLNEKFQSLRDQS
                     ITKESLNSSDEDIAERIKSFLDIKEKRSSPKGTSNAPSHFQTKLRAYAKKGSLRRKLL
                     DEAEDLKGSNSPF"
     gene            <566590..>567984
                     /gene="TDEL0H03410"
                     /locus_tag="TDEL_0H03410"
                     /db_xref="GeneID:11501443"
     mRNA            <566590..>567984
                     /gene="TDEL0H03410"
                     /locus_tag="TDEL_0H03410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683363.1"
                     /db_xref="GeneID:11501443"
     CDS             566590..567984
                     /gene="TDEL0H03410"
                     /locus_tag="TDEL_0H03410"
                     /inference="similar to DNA sequence:INSDC:YHL021C"
                     /note="similar to Saccharomyces cerevisiae YHL021C;
                     ancestral locus Anc_7.110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683411.1"
                     /db_xref="GeneID:11501443"
                     /db_xref="GOA:G9A006"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="UniProtKB/TrEMBL:G9A006"
                     /translation="MLLRTAGRTTNRLTAFTRLTRGLTSINPPPGPIENLPSAHNGKI
                     LKTHFTDESTTITFITKDSPGHEPFTVTFNNLFLRDSSRSEKSVDPKSGQKLFTTGHL
                     VSDPDSTVPKQVEISPDSQSVAINWKDGDHYRYSLDFIYKFKGSTFVTDALRNTVSKH
                     KPVLWDKKTLKGHMEDLVSVNYDGFMKNEEQLYKALTTLQKYGLALINNVPKGNEDAV
                     KDICERVGPIRNTIYGETFDVKSNITTTSNIAYSNLALPLHMDLLYMENVPGFQLLHS
                     INNSPDEAGGVNIFVDAFHAARHVREQDAEGYEAMQHVPVNYQYSKDGHCYYQSRPMI
                     EQYDSNESNTLMGNYEYLIKRVYYSPPFQAPFTVGIYEKAPETNTSKGKVTERFLFRD
                     FAHGIGLFDQFINKAENQFKIKLPENTCVIFNNTRILHARTAFKSSDRWLKGCYLDRD
                     SFKSRLKYLEQKYK"
     gene            <568040..>569092
                     /gene="TDEL0H03420"
                     /locus_tag="TDEL_0H03420"
                     /db_xref="GeneID:11501444"
     mRNA            <568040..>569092
                     /gene="TDEL0H03420"
                     /locus_tag="TDEL_0H03420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683364.1"
                     /db_xref="GeneID:11501444"
     CDS             568040..569092
                     /gene="TDEL0H03420"
                     /locus_tag="TDEL_0H03420"
                     /inference="similar to DNA sequence:INSDC:YHL022C"
                     /note="similar to Saccharomyces cerevisiae SPO11
                     (YHL022C); ancestral locus Anc_7.109"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683412.1"
                     /db_xref="GeneID:11501444"
                     /db_xref="GOA:G9A007"
                     /db_xref="InterPro:IPR002815"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013049"
                     /db_xref="UniProtKB/TrEMBL:G9A007"
                     /translation="MSRNLATLMSQCNSRSELCAALEPNPRRIHFNSTGTDVTEVLEM
                     ILSLSRNSIEQHQQPIAIIQSNGGTLSFPDVGMSTSAAKKIAVLFSLMRTIQVTVSTG
                     QIRTIRDVYYTNVELYGDQRKVETGLCSIAKNLHLSSRDSLNILPAQKGLCYSPFDIV
                     VQTNGQENLIPAKTSSMIPYLAQNSTARIVMRGDANLKLIVLEKEAVYNKLVGANTAE
                     DTIFITGKGYPDFLTRLFLNRLQQNICILDWRIYTDADPHGIDIALKYMQNDDHEHYM
                     CQKLVYKGALLTQLLRRKEAQFLQMSQRDLSLAIGLTNRLASNSSTKLLRVQLQRQLF
                     FQKKAEMNSLLTSQYL"
     gene            <569263..>569907
                     /gene="TDEL0H03430"
                     /locus_tag="TDEL_0H03430"
                     /db_xref="GeneID:11501445"
     mRNA            <569263..>569907
                     /gene="TDEL0H03430"
                     /locus_tag="TDEL_0H03430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683365.1"
                     /db_xref="GeneID:11501445"
     CDS             569263..569907
                     /gene="TDEL0H03430"
                     /locus_tag="TDEL_0H03430"
                     /inference="similar to DNA sequence:INSDC:YOR016C,YAL007C"
                     /note="similar to Saccharomyces cerevisiae ERP4 (YOR016C)
                     and ERP2 (YAL007C); ancestral locus Anc_7.108"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683413.1"
                     /db_xref="GeneID:11501445"
                     /db_xref="GOA:G9A008"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:G9A008"
                     /translation="MFQVSSLYQLLVASFVLLLGSPVLGAASNYAPIAINLPAFSKEC
                     LYYDLVSHEESLVVSYQVLTGGNFEIDFEITAPDGSQIVNEKQKKYSDFLLKSFGLGQ
                     YSFCFSNTYGTALKKVEIVLELEKGALSDENSSPKDAIANNAIEEIDRSLIKISKTMN
                     YLRAREWRNMSTVESTYSRLTWLSLLIMGIMIGISVIQAGIIQFFFKSRSRNYV"
     gene            complement(<569968..>570564)
                     /gene="TDEL0H03440"
                     /locus_tag="TDEL_0H03440"
                     /db_xref="GeneID:11501446"
     mRNA            complement(<569968..>570564)
                     /gene="TDEL0H03440"
                     /locus_tag="TDEL_0H03440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683366.1"
                     /db_xref="GeneID:11501446"
     CDS             complement(569968..570564)
                     /gene="TDEL0H03440"
                     /locus_tag="TDEL_0H03440"
                     /inference="similar to DNA sequence:INSDC:YAL008W"
                     /note="similar to Saccharomyces cerevisiae FUN14
                     (YAL008W); ancestral locus Anc_7.107"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683414.1"
                     /db_xref="GeneID:11501446"
                     /db_xref="InterPro:IPR007014"
                     /db_xref="UniProtKB/TrEMBL:G9A009"
                     /translation="MRAFTTQGILFNTAKNTIRRGLASTSTASFNGRLFAPKLATRVA
                     GLTMATSVGIAAPWVFNLHNTIYNDAVVDAHRNPGAAAASLAQGNVREPIKRKSRFNG
                     KLDYRQLCIGSIMGLILGVVVGKVSTLLVYITAAGFLGLQWLQNRGIVDKNATQSLFA
                     RYIIKSGRETLDLNTLIWERPSFKLSFLLTFVLAAANI"
     gene            complement(<570701..>572845)
                     /gene="TDEL0H03450"
                     /locus_tag="TDEL_0H03450"
                     /db_xref="GeneID:11501447"
     mRNA            complement(<570701..>572845)
                     /gene="TDEL0H03450"
                     /locus_tag="TDEL_0H03450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683367.1"
                     /db_xref="GeneID:11501447"
     CDS             complement(570701..572845)
                     /gene="TDEL0H03450"
                     /locus_tag="TDEL_0H03450"
                     /inference="similar to DNA sequence:INSDC:YOR014W"
                     /note="similar to Saccharomyces cerevisiae RTS1 (YOR014W);
                     ancestral locus Anc_7.106"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683415.1"
                     /db_xref="GeneID:11501447"
                     /db_xref="GOA:G9A010"
                     /db_xref="InterPro:IPR002554"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G9A010"
                     /translation="MKKASSSSSGTGKKKEKDGNDQKKTSPATVGSAAGSAAGTTSGS
                     SSSRSSTERTKSNTASQGSSKHHSGSSGKSGKSSSSKSRNNGGESTKGVRNATPTVSS
                     GADLTDHLTPAPPTVTVTKDNSSSAAVLQPIDTQSQGRSQPTLVGAASAVPPASTNGA
                     PNTEPTQSHLGTSHVDSGSPHASPSSPSGIDIPRLSHSFEKLPTPTKLNTDTELDMIK
                     IPQRHSSSRFEASRYTQLTKLPSFDDVSPEETIPLFLAKVDQCNTMFDFNDPSFDIQG
                     KEIKRVTLQELIEFIVTNRFTYTHEMYSHVVAMFKFNLFRPIPPPVNPIGDIYDPDED
                     EPVNELAWPHMQLVYEFFLRFVESPDFNHQIAKQYIDQEFILKLLELFDSEDVRERDC
                     LKTTLHRIYGKFLSLRSFIRRSINNIFLQFVYETERFNGVAELLEILGSIINGFALPL
                     KEEHKVFLVRVLLPLHKVRCLSLYHPQLAYCIVQFLEKEPLLTEEVVMGLLRYWPKIN
                     STKEIMFLNEIEDIFEVIEPLEFIKVEVPLFVQLAKCISSPHFQVAEKVLSYWNNEYF
                     LNLCIENAEVILPIIFPALYELTSQLELDTINGDDGTSDPYMLVEQAINSGSWNRAIH
                     AMAFKALKIFLETNPVLYENCNSLYLSSVKETQKRKAQREENWLKLEEYVKGLKINET
                     SESSDVTDFPSEEQAQATDNGINEQVVPTSLQ"
     gene            complement(<573660..>574466)
                     /gene="TDEL0H03460"
                     /locus_tag="TDEL_0H03460"
                     /db_xref="GeneID:11501448"
     mRNA            complement(<573660..>574466)
                     /gene="TDEL0H03460"
                     /locus_tag="TDEL_0H03460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683368.1"
                     /db_xref="GeneID:11501448"
     CDS             complement(573660..574466)
                     /gene="TDEL0H03460"
                     /locus_tag="TDEL_0H03460"
                     /inference="similar to DNA sequence:INSDC:YAL009W"
                     /note="similar to Saccharomyces cerevisiae SPO7 (YAL009W);
                     ancestral locus Anc_7.104"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683416.1"
                     /db_xref="GeneID:11501448"
                     /db_xref="InterPro:IPR005605"
                     /db_xref="UniProtKB/TrEMBL:G9A011"
                     /translation="MDTEIPSIRLEESGVLEGSVIATGTLRSPSFSGGAMERRRSNSR
                     TSSGRNVKSSNDISSASKIFRNLLILEDDLRRQAHRQKLLKWQFTIFLSCLMGVAGFA
                     FYELYFTNGSVKGLQRYVFQFILLFIGITVALFHLGGEYRRTIVIPRKFFASTNKGIR
                     QFNIKLVKVHSTWNEKFTDFVRFTSRNVAHFNIYLLTKVCRLSKENAFVVFWTSVTVR
                     SQPRIGAVDVKLVLNPRSFSAEIREGWEIYRDEFWAREGARRRKQTHCET"
     gene            <575137..>576486
                     /gene="TDEL0H03470"
                     /locus_tag="TDEL_0H03470"
                     /db_xref="GeneID:11501449"
     mRNA            <575137..>576486
                     /gene="TDEL0H03470"
                     /locus_tag="TDEL_0H03470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683369.1"
                     /db_xref="GeneID:11501449"
     CDS             575137..576486
                     /gene="TDEL0H03470"
                     /locus_tag="TDEL_0H03470"
                     /inference="similar to DNA sequence:INSDC:YAL010C"
                     /note="similar to Saccharomyces cerevisiae MDM10
                     (YAL010C); ancestral locus Anc_7.103"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683417.1"
                     /db_xref="GeneID:11501449"
                     /db_xref="GOA:G9A012"
                     /db_xref="InterPro:IPR022197"
                     /db_xref="InterPro:IPR027539"
                     /db_xref="UniProtKB/TrEMBL:G9A012"
                     /translation="MMLDYMDYISRAFEQSTNWNRDNSYANITATTSALIDFSVPSAF
                     EFQVSNASTPFTFNTMRVSTRNVFNGSLTYLYTDADNLEKIVSDSGSIDLQNVTETYR
                     YFQPFYNNHKLAAPTDGKTVGKSLYYGRMFYPNSNLEAMLIKTLDPHKQLKIKWLSTF
                     DDFNILTCYWQRDTGRDSQEVIFSTNDLLCGYRFLHNFIGKPSKMKNSLYNNSSLSLG
                     AELWLGLITLSPGCSTTLRYCTHAPNTGRPLTLTLKWNPIFGNLSSSYSAKTSSNTTV
                     CAKYDFNLYSIDSNLSFGVELWRRGNSAKAMSQYQDVSQTFGKDENLMYHHLVPDLSQ
                     EQASPQTRKDLVEKQQLLNDLTTAFSSSLRKIDREKTMIEEFQNNLHHANFTSVWKLS
                     TSLRDANLKVLWEGKFKGFLISAGAEVSKASPLLQSSSSEKLPSYLSKFGVQLQYST"
     gene            complement(<576502..>578289)
                     /gene="TDEL0H03480"
                     /locus_tag="TDEL_0H03480"
                     /db_xref="GeneID:11501529"
     mRNA            complement(<576502..>578289)
                     /gene="TDEL0H03480"
                     /locus_tag="TDEL_0H03480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683370.1"
                     /db_xref="GeneID:11501529"
     CDS             complement(576502..578289)
                     /gene="TDEL0H03480"
                     /locus_tag="TDEL_0H03480"
                     /inference="similar to DNA sequence:INSDC:YAL011W"
                     /note="similar to Saccharomyces cerevisiae SWC3 (YAL011W);
                     ancestral locus Anc_7.102"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683418.1"
                     /db_xref="GeneID:11501529"
                     /db_xref="UniProtKB/TrEMBL:G9A013"
                     /translation="MPVALRSRVKTEVDGNGSSEPSNSPKPISRRTKRRKRNSEDDQD
                     DDFVGSDGNSAYYHSDVGNSRPFEMVGGLPSSSEIPQYNSALAHPLSVKDSAVLYDSL
                     VSSRKTWVRGEMFELYFTKPVKTTKDVPVKPETPAEAMSVQVRDKMQKMCDCTMFGGP
                     HAFPVRLFILKNEEMEKKWQEEQDMKKKEKEDKEKEEKEERQKRVEMKKQQQLQKKQE
                     KERLIQLQKENKVKGKMELEAVKQKRKDEIRKSKEKLKRTQMNTPAPSSQSGTDPKMI
                     TNLNLMAQRDPKLNALMGIVANGDATLDQVEEFKKFIEIAKKMPTPPGWTPPLPRLTE
                     QTRVQGQDSNVTNAGKATQSESSAVDPADKKPTAHSGVKQVVQEKVEIAGAAVKAERE
                     IKQEMDAKATREIKETMAKLDDKSMHLTTFQQKYSQGAQIVLEYLEFTTSRYLLPKNS
                     IVEFLEDEETFIVSWVMVHNAADIRRHKSKRIRELCKNLKTEDEKKKLAEDYDVLTER
                     GCPTPLYTPMTVKFTGIHRKFAGILRNSVDPVEQVQKEMTAILEIGTRLSGYNLWYQL
                     DAYDDRDLAERLRVELNEHEQESKGKKRN"
     gene            <578645..>581956
                     /gene="TDEL0H03490"
                     /locus_tag="TDEL_0H03490"
                     /db_xref="GeneID:11501530"
     mRNA            <578645..>581956
                     /gene="TDEL0H03490"
                     /locus_tag="TDEL_0H03490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683371.1"
                     /db_xref="GeneID:11501530"
     CDS             578645..581956
                     /gene="TDEL0H03490"
                     /locus_tag="TDEL_0H03490"
                     /inference="similar to DNA sequence:INSDC:YOL034W"
                     /note="similar to Saccharomyces cerevisiae SMC5 (YOL034W);
                     ancestral locus Anc_7.101"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683419.1"
                     /db_xref="GeneID:11501530"
                     /db_xref="GOA:G9A014"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR027131"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G9A014"
                     /translation="MSTALNASDHVRRRSSEDINGEIATNAFKKLKFKSINYDDFRPG
                     ALIKLRMENFVTYKVAEFDLSPSLNMIIGPNGSGKSTFVCAVCIGLAGKPRFIGRSSK
                     LEDFIKNGEEKGLVEVTLKKPAEVEHSPIVKSHDQVIKITRHLSRSKRDSDYQINDIE
                     VPESLVKSIISQLNIQLDNLCQFLSQERVASFAGQSPEKLLEETARSIDIKLCEVLSL
                     LKELQDEERDHQNKVNSTQKRIDSLKNDCERLRITVSTFRAYQKKLKEIDEYKKLLPY
                     VQLKGLEEKLRQYRAEYEQAKTNLKTLLQEKRKLFETQKKFESTLKEANNKVHSIKAK
                     FEKLSRDSTRLTKDLKTMRTDIASKKQDIQRYREKIGGLRNNVAEKKKELEDKRVQLT
                     SIEIPDNSLLDDLKTQHEELLARETRINRSLREVEGKMSNLKYERDNVQSRIRRQTEA
                     LHDNDRIHVLDELASKDRGGGKTFRTVKNAVLYVRSRQDMHGQVLEPPAITVSVKDPQ
                     HACYLTQCVDFNTRIAFTLTDSQAYMSFGKDILDRYGVNTRELNNGNPKPPLPREELK
                     KMGFDFFLSDVVSGDSRVIRMLCQNCNIHSIPVSRRELSPEMISRLTQARRNGRLLFP
                     KFIHGNRVVEMGIGTYSHKVWTRDYECIKRTDFFRADVMSDEQKVNIERDISRCQLKV
                     EELSTEYKQLIEEKQSLEKTSSGCSRETESVRKRRNELNIKRSDYSKVKSRIRTLESE
                     IRELNYNERETLEGQISQSEAQIATQTMSQTVATTELMEALAKLRDCQEELVFAEIGE
                     FEARNMEASIIEIIASFEQREDECKNEFTNKKQKCREAKGVEWDRLKTQIRSYNEEVQ
                     ERLEVFKQKLINEGNFNLSHVQDVISRLESEMATLDNDESSITILKQKEDELQKLASD
                     IPQFSAALSDSQNEIKKNRQFLEPKLDSVVKNISDKFSDLFEEIGSRGHVALVKPDSF
                     AEWKIEIRVAFRDNAQLSKLDARTQSGGERAVSTVLYMIALQQYTTAPFRIVDEINQG
                     MDSHNERIVHKSMVINACAENTSQYFLITPKLLTGLYYHEKMMIHCVMAGPWIPNPSE
                     YPDMVNFGKTSKYVL"
     gene            <582143..>583747
                     /gene="TDEL0H03500"
                     /locus_tag="TDEL_0H03500"
                     /db_xref="GeneID:11501531"
     mRNA            <582143..>583747
                     /gene="TDEL0H03500"
                     /locus_tag="TDEL_0H03500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683372.1"
                     /db_xref="GeneID:11501531"
     CDS             582143..583747
                     /gene="TDEL0H03500"
                     /locus_tag="TDEL_0H03500"
                     /inference="similar to DNA sequence:INSDC:YOL033W"
                     /note="similar to Saccharomyces cerevisiae MSE1 (YOL033W);
                     ancestral locus Anc_7.100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683420.1"
                     /db_xref="GeneID:11501531"
                     /db_xref="GOA:G9A015"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR004527"
                     /db_xref="InterPro:IPR008925"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020058"
                     /db_xref="InterPro:IPR020061"
                     /db_xref="InterPro:IPR020751"
                     /db_xref="UniProtKB/TrEMBL:G9A015"
                     /translation="MTLIVRRLYSKLVRKEPGGLFSGKSILSKKPVQDVHPEVPVRTR
                     FAPSPTGMLHIGSLRTALYNYLLAKNTRGQFLLRLEDTDQNRLIQGAEENIYDSLKWC
                     GIEYDEGPGVNDEKFGPYRQSERTEIYQQHVDGLLKSGHAYRCFCSKERLDGLRESAK
                     RLKPPTTVTYDRKCESLSQGEIEERLAQQIPHTIRLKAPERYPAFHDLLHGTVDIQPQ
                     VNVNDRRYDDPILIKSDNLPTYHFANVIDDHLMKITHVIRGEEWLPSTQKHIALYRAF
                     GWDPPSFIHIPLLTSTNDKKLSKRRGDASVWNMKSNGILPEALVNFCVLFGWSPPRDL
                     AAANHECFTLKEFERVFDLNYLTKGNAKVDDKKLWFFNKHYLQKKLENSQVFEEILQE
                     VQTAARHKFGEKASDEKVAAVLKACGKSLTTVNEFNDTFYYFFEKPKYQDTEVATKFH
                     ATHKHADVVNILTHFKGTINQSNMDEMIKALASQAVPKKSIFESLRFALAGANPGTKI
                     PILIQLLGPQEANQRIEEAINYLQKS"
     gene            <583913..>584629
                     /gene="TDEL0H03510"
                     /locus_tag="TDEL_0H03510"
                     /db_xref="GeneID:11501532"
     mRNA            <583913..>584629
                     /gene="TDEL0H03510"
                     /locus_tag="TDEL_0H03510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683373.1"
                     /db_xref="GeneID:11501532"
     CDS             583913..584629
                     /gene="TDEL0H03510"
                     /locus_tag="TDEL_0H03510"
                     /inference="similar to DNA sequence:INSDC:YOL032W"
                     /note="similar to Saccharomyces cerevisiae OPI10
                     (YOL032W); ancestral locus Anc_7.99"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683421.1"
                     /db_xref="GeneID:11501532"
                     /db_xref="InterPro:IPR008493"
                     /db_xref="UniProtKB/TrEMBL:G9A016"
                     /translation="MFAAIASGNPLQLSTEVPNSSGLQHTIVLSSTKPKSYSHITLFI
                     LPNVTFPDNFIATVYFKLSPTEDFKLFGYLGNEKPSAIFKVRLPNATTSRPQNSSYGD
                     GLGEIDMDEDEGDSVPIGSHNISELIIGISIEEREQGMMKIAEWKAAQAPAATIHPWC
                     CRDPVWGANILTVGQLATVYPKLTQELAAKIVQHAYNYLSGFLDASGNVSIKRFDTWW
                     DKFKTRLANDGTFLDEVTGD"
     gene            complement(<584655..>585848)
                     /gene="TDEL0H03520"
                     /locus_tag="TDEL_0H03520"
                     /db_xref="GeneID:11501533"
     mRNA            complement(<584655..>585848)
                     /gene="TDEL0H03520"
                     /locus_tag="TDEL_0H03520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683374.1"
                     /db_xref="GeneID:11501533"
     CDS             complement(584655..585848)
                     /gene="TDEL0H03520"
                     /locus_tag="TDEL_0H03520"
                     /inference="similar to DNA sequence:INSDC:YOL031C"
                     /note="similar to Saccharomyces cerevisiae SIL1 (YOL031C);
                     ancestral locus Anc_7.98"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683422.1"
                     /db_xref="GeneID:11501533"
                     /db_xref="UniProtKB/TrEMBL:G9A017"
                     /translation="MVKISSLLLTGLMAGLTLSTETLARDHNELPKGLYLSGSMICND
                     VTCYPKIFEPTDIWTEIKPGQQLPGGLDLRMNLETGLKEAKLANGDVDQIVPAIVETE
                     RDSKTMNHEFTKDFDFIRDLMQSDLTESQVKAIEAKLDDLMEFAHDYKHGFDIINHEF
                     GLLRNISFSKRLPNTLRELGTRTIISCTRNNPRVVESVNVQHPHFLSEVFHEIEDLVA
                     QGKLSAIDSVLTKRYLSLLDELITDVHTFTQYEVDILAKTCQIPDNQIKIEALEIISQ
                     LFANEGSTLKKRDLETVVPDVQLWVNNLQKMIQDENTDELHTRKFFNSLYNIKKEYSD
                     AKVDSSFLNWLSKQTEERKKQLENNLQERDLEQDSFDKRMIESRHLVFGNPMANRIKM
                     YNDEL"
     gene            complement(<586031..>587206)
                     /gene="TDEL0H03530"
                     /locus_tag="TDEL_0H03530"
                     /db_xref="GeneID:11501534"
     mRNA            complement(<586031..>587206)
                     /gene="TDEL0H03530"
                     /locus_tag="TDEL_0H03530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683375.1"
                     /db_xref="GeneID:11501534"
     CDS             complement(586031..587206)
                     /gene="TDEL0H03530"
                     /locus_tag="TDEL_0H03530"
                     /inference="similar to DNA sequence:INSDC:YAL012W"
                     /note="similar to Saccharomyces cerevisiae CYS3 (YAL012W);
                     ancestral locus Anc_7.97"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683423.1"
                     /db_xref="GeneID:11501534"
                     /db_xref="GOA:G9A018"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G9A018"
                     /translation="MGLRESDKFATKAIHAGAHVDIHGSVIEPISLSTTFKQSSPAAP
                     LGEYEYSRSQNPNRKNLEEALAALENAKYGLAFSSGSATTAVVLQSLPQGSHAVSIGD
                     VYGGTHRYFTKVANAHGVDTSFTNDLIKDLPSLIKENTKLVWIESPTNPTLKVTDIAL
                     VVKTAKQINKEILVVVDNTFLSPYLSNPLNFGVDIVVHSATKYINGHSDVVLGVLATN
                     DKAIYEKLQFLQNAIGAIPSPFDSWLAHRGLKTLHLRVRQAALTATKIAEFLEQDSNV
                     LAVNYPGLASNPDREIVQRQHRDGLGGGMISFRIKGGAQAAAKFSSSTRLFTLAESLG
                     GIESLLEVPAVMTHGGIPKEQREASGVYDDLIRLSVGIEDSDDLLTDIKEALAATTK"
     gene            complement(<587410..>587730)
                     /gene="TDEL0H03540"
                     /locus_tag="TDEL_0H03540"
                     /db_xref="GeneID:11501535"
     mRNA            complement(<587410..>587730)
                     /gene="TDEL0H03540"
                     /locus_tag="TDEL_0H03540"
                     /product="60S acidic ribosomal protein P2"
                     /transcript_id="XM_003683376.1"
                     /db_xref="GeneID:11501535"
     CDS             complement(587410..587730)
                     /gene="TDEL0H03540"
                     /locus_tag="TDEL_0H03540"
                     /inference="similar to DNA sequence:INSDC:YOL039W"
                     /note="similar to Saccharomyces cerevisiae RPP2A
                     (YOL039W); ancestral locus Anc_7.96"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P2"
                     /protein_id="XP_003683424.1"
                     /db_xref="GeneID:11501535"
                     /db_xref="GOA:G9A019"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:G9A019"
                     /translation="MKYLAAYLLLNAAGSTPNSDNVKAVLESVGIEVEDDQVSKLLSS
                     LEGKDVAELITEGNEKLAAVPAAGPATGGAAAAAGSSEAAAEEEAEEEKEESDDDMGF
                     GLFD"
     gene            <588330..>588758
                     /gene="TDEL0H03550"
                     /locus_tag="TDEL_0H03550"
                     /db_xref="GeneID:11501536"
     mRNA            <588330..>588758
                     /gene="TDEL0H03550"
                     /locus_tag="TDEL_0H03550"
                     /product="40S ribosomal protein S15"
                     /transcript_id="XM_003683377.1"
                     /db_xref="GeneID:11501536"
     CDS             588330..588758
                     /gene="TDEL0H03550"
                     /locus_tag="TDEL_0H03550"
                     /inference="similar to DNA sequence:INSDC:YOL040C"
                     /note="similar to Saccharomyces cerevisiae RPS15
                     (YOL040C); ancestral locus Anc_7.95"
                     /codon_start=1
                     /product="40S ribosomal protein S15"
                     /protein_id="XP_003683425.1"
                     /db_xref="GeneID:11501536"
                     /db_xref="GOA:G9A020"
                     /db_xref="InterPro:IPR002222"
                     /db_xref="InterPro:IPR005713"
                     /db_xref="InterPro:IPR020934"
                     /db_xref="InterPro:IPR023575"
                     /db_xref="UniProtKB/TrEMBL:G9A020"
                     /translation="MSTAPAKNRRVFRTYSYRGVDLEQLLGMSNEEFVKLAPARIRRR
                     FARGLGHKPAGFMKKLRAAKLAAPENEKPSPVRTHMRNMIIFPEMIGSVVGVYNGKSF
                     NQVEIRPEMVGHYLGEFSITYTPVRHGRAGATTSRFMPLK"
     gene            complement(<588808..>589935)
                     /gene="TDEL0H03560"
                     /locus_tag="TDEL_0H03560"
                     /db_xref="GeneID:11501537"
     mRNA            complement(<588808..>589935)
                     /gene="TDEL0H03560"
                     /locus_tag="TDEL_0H03560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683378.1"
                     /db_xref="GeneID:11501537"
     CDS             complement(588808..589935)
                     /gene="TDEL0H03560"
                     /locus_tag="TDEL_0H03560"
                     /inference="similar to DNA sequence:INSDC:YAL013W"
                     /note="similar to Saccharomyces cerevisiae DEP1 (YAL013W);
                     ancestral locus Anc_7.94"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683426.1"
                     /db_xref="GeneID:11501537"
                     /db_xref="InterPro:IPR013907"
                     /db_xref="UniProtKB/TrEMBL:G9A021"
                     /translation="MVADGELSEYSVSSDAETEKMGDEKTKELDGSRPHISELVKEGK
                     RSLEDTDVLEDNKRVKLETEPHEDDDNEAGDEGEDEEEEDAEIPTVEPMKQEVEEEED
                     EEEEVEEDEDEIAEDEEEVDKTLEHKDDEIIEPMSSMPSPFEVESRRMDALKEITQIE
                     YKFAQLRQQLYENKLLRLQAELQMCLEGSHPELQTYYQKIASVRDYKLRRAYQRQKYE
                     LNCIDTETRATRTFIHQDFYRKVSDTRNNLLKETTQRWYDINKERRDMDICVPEVSYH
                     VPIKIAGKTLSCITGYAGPAQQRYPGEPLSEDLECENITFHYRSNAVDKLEVIVDRMR
                     LNNELSDLEGLKKYFNAFPSAPNLNGLRDSEIYDDLQDLTL"
     gene            <590287..>591546
                     /gene="TDEL0H03570"
                     /locus_tag="TDEL_0H03570"
                     /db_xref="GeneID:11501538"
     mRNA            <590287..>591546
                     /gene="TDEL0H03570"
                     /locus_tag="TDEL_0H03570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683379.1"
                     /db_xref="GeneID:11501538"
     CDS             590287..591546
                     /gene="TDEL0H03570"
                     /locus_tag="TDEL_0H03570"
                     /inference="similar to DNA sequence:INSDC:YOL041C"
                     /note="similar to Saccharomyces cerevisiae NOP12
                     (YOL041C); ancestral locus Anc_7.93"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683427.1"
                     /db_xref="GeneID:11501538"
                     /db_xref="GOA:G9A022"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G9A022"
                     /translation="MSTSISNLFGDVDPEKVDEGVSKLFSSSLGPVNEAEIKSKKRTV
                     IEVSKETEQVVEETVKEEVAVPLKKKQKKKDDDTELEDRYYAKLAGEEPTEEPTEEPV
                     SEESDEKSDIEEKPKAGESAKAIDLKEDELKKAERTVFVGNLSSEVITSKKVAKEFKR
                     LFSGLEDEASVIESIRFRSISFDEALPRKVAFVQQKLHKSRESVNAYVVYKDKGAVKK
                     ACAKLNGHVFLQRHLRVDSVTHPAVHENKRSIFVGNLDFEEDDESLWLHFKDCGEIEY
                     VRLVRDAKTNMGKGFAYIQFKDFQSVNKALLLNDKPMQSVKPNGPKRKLRVSRCKNIK
                     KIVGNKTSGSKLNDHHKTKIGRAKKVLGKADRATVGKELTVEGLRATKGTGPVSSVLK
                     KKKQRSKTGRVTKRSVALQKISGIILM"
     gene            <591869..>592681
                     /gene="TDEL0H03580"
                     /locus_tag="TDEL_0H03580"
                     /db_xref="GeneID:11501539"
     mRNA            <591869..>592681
                     /gene="TDEL0H03580"
                     /locus_tag="TDEL_0H03580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683380.1"
                     /db_xref="GeneID:11501539"
     CDS             591869..592681
                     /gene="TDEL0H03580"
                     /locus_tag="TDEL_0H03580"
                     /inference="similar to DNA sequence:INSDC:YAL014C"
                     /note="similar to Saccharomyces cerevisiae SYN8 (YAL014C);
                     ancestral locus Anc_7.92"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683428.1"
                     /db_xref="GeneID:11501539"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:G9A023"
                     /translation="MDDLKLSYEIDKLDDIVEERTRLITVLGIQPSSRDNVSLKKQLS
                     RTLDQLNESSDDDKVADSFQRYATQYSEILQKITDSGIDTSLYEFQIPIKPQSSSSSS
                     NGSLSRDLPKKVRFKDENLVTYSDVEQFKPYHDDISLVRESTDTQEQDRKNLMPEVEP
                     PSHNVISPSLSNQEIFVQQQQQLLEQDTYLSSLSESVHRSHAISLDINDEVVEQNDHV
                     LQDLESLVDNSGRNLDRAKRRLETFERTARENGPCFIIVLLVIILLILLILL"
     gene            complement(<592766..>593311)
                     /gene="TDEL0H03590"
                     /locus_tag="TDEL_0H03590"
                     /db_xref="GeneID:11501540"
     mRNA            complement(<592766..>593311)
                     /gene="TDEL0H03590"
                     /locus_tag="TDEL_0H03590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683381.1"
                     /db_xref="GeneID:11501540"
     CDS             complement(592766..593311)
                     /gene="TDEL0H03590"
                     /locus_tag="TDEL_0H03590"
                     /note="ancestral locus Anc_7.91"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683429.1"
                     /db_xref="GeneID:11501540"
                     /db_xref="UniProtKB/TrEMBL:G9A024"
                     /translation="MIVPSTSLPEAQRTSMKLPSNVPPSIGEMSRLQDDPGIRNAKIK
                     LNYKKSFQDDHIFFPEAQELLVANPYRSSNLFVPNELAGYQPPMNNAMPLNDSYSTKR
                     YQPNQQHHKENLLSLLALKNLEKQQQQQQYKHKPQYQVGYQPLHRNGQVYYQDTQPRP
                     YGEQHAVSQNPYNYSNLQAQG"
     gene            complement(<593714..>594814)
                     /gene="TDEL0H03600"
                     /locus_tag="TDEL_0H03600"
                     /db_xref="GeneID:11501541"
     mRNA            complement(<593714..>594814)
                     /gene="TDEL0H03600"
                     /locus_tag="TDEL_0H03600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683382.1"
                     /db_xref="GeneID:11501541"
     CDS             complement(593714..594814)
                     /gene="TDEL0H03600"
                     /locus_tag="TDEL_0H03600"
                     /inference="similar to DNA sequence:INSDC:YOL042W"
                     /note="similar to Saccharomyces cerevisiae NGL1 (YOL042W);
                     ancestral locus Anc_7.90"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683430.1"
                     /db_xref="GeneID:11501541"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:G9A025"
                     /translation="MFGRRFLPIKSITNSLPKSGSKRLIDDKFTFMTYNMLSPHYMWP
                     QVYTYVPDEYKDWNYRHKLLEKEILNSYRADIMCLQELTASDYHQYWEEVIDRDFHYG
                     SRFIAKPPPQYWQKDAKDVDGVGIFYNLNKFDYISSTSIHLNDLIGSFDLDELSYLKS
                     KQVKLTDGAGNPKGEKTLLEILKSRNQVGLFVALKHKDTNTIFVVINTHLYWKYDEVK
                     LTQCLIIMRKLAKIIRDLLVGEHGTTYNKMKVVFAGDLNSTRDSLLVKFLRGEVVRYE
                     NLDIVNPLRPYLNRCIYDDVSDDVFEHTCYSGKLKGIFDYIWYHDKDFELTKILTGAG
                     VSKELEVSKQFGLPNANHPSDHIPVLVEFKIL"
     gene            <595477..>596697
                     /gene="TDEL0H03610"
                     /locus_tag="TDEL_0H03610"
                     /db_xref="GeneID:11501542"
     mRNA            <595477..>596697
                     /gene="TDEL0H03610"
                     /locus_tag="TDEL_0H03610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683383.1"
                     /db_xref="GeneID:11501542"
     CDS             595477..596697
                     /gene="TDEL0H03610"
                     /locus_tag="TDEL_0H03610"
                     /inference="similar to DNA sequence:INSDC:YAL015C,YOL043C"
                     /note="similar to Saccharomyces cerevisiae NTG1 (YAL015C)
                     and NTG2 (YOL043C); ancestral locus Anc_7.89"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683431.1"
                     /db_xref="GeneID:11501542"
                     /db_xref="GOA:G9A026"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR003651"
                     /db_xref="InterPro:IPR004036"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:G9A026"
                     /translation="MARLRPRKREHIEVGIDDERGEVKSKYFKTDPSVEKVKEEKSLL
                     PIEEPVDVEWIKTLNSAEYFKWITKVTDDRPEHWNEPLNPDIFLNRPEGAPPLPENFI
                     PIYTRVRLMRSKIKTPVDSVGCAAIPITVSAKCDISLDAISPKNYRLQLLVALMLSAQ
                     TKDELNAQAMLNLIRYCIDELHIPQGLTLEALLKIDEKVLVNLIRTVGFHNRKAHYVK
                     QTAKILVEQFQSDIPTDLVGILSLPGVGPKMGLLALQRAWGKMDGIGVDVHVHRLCNM
                     WGWVSKKCKTADHTRKDLESWLPKPLWYEINPLLVGFGQVICMSRGKRCDLCLANDIC
                     NDVDKKVMIKAAQEKRSDERMRKRPNRGDFSQWLDYLAKEDKSFKVIDSEEVAKPLDE
                     GFALIKKDPDGDLT"
     gene            complement(<596794..>598623)
                     /gene="TDEL0H03620"
                     /locus_tag="TDEL_0H03620"
                     /db_xref="GeneID:11501543"
     mRNA            complement(<596794..>598623)
                     /gene="TDEL0H03620"
                     /locus_tag="TDEL_0H03620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683384.1"
                     /db_xref="GeneID:11501543"
     CDS             complement(596794..598623)
                     /gene="TDEL0H03620"
                     /locus_tag="TDEL_0H03620"
                     /inference="similar to DNA sequence:INSDC:YAL016W"
                     /note="similar to Saccharomyces cerevisiae TPD3 (YAL016W);
                     ancestral locus Anc_7.88"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683432.1"
                     /db_xref="GeneID:11501543"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:G9A027"
                     /translation="MASESVEGKDLYPLALLMDELKHDDIANRVEAMKKLDTIATALG
                     PQRTRDELIPFLMEVAQDDEDEVFAVLADELGQFVPYVGGPEFATVLLPPLEILASTE
                     ETLVRDKAVGSLNKIAEQLSQEQLFHDFIPLIEHLATADWFSSKVSSCGLFKSVIPRV
                     KDDGLRKELLALYLQMVQDETPMVRRTAAKNLPALIDLLTENPELSTNEDWDYISNMF
                     QKIINDSQDSVKYLTVNCLISILKFFNTKGDHSHSKDLLDSATKLIGDEAWRVRYMAA
                     DKFEELAAQFSDNEAYMAELIQPFLNLCEDNESDVRKAIAKQVAGFAKLLQDPSDVLT
                     KVLPAVQSLSMDESEAVRASLALTVTNLVTLMSKEEAIDHLLPILLNMLKDEFPDVRL
                     NIIANLKAVNDVIGIDLLSESLLPAITELAKDVNWRVRMAIIDYIPILAEQLGVQFFD
                     QQLSDLCLSWLWDTVFSIREAAVNNLKKLTEIFGSDWCRDEIIAKLLKFDSQLLENFV
                     YRFTLLSALTELVPVISLTVVANQILPFISHLADDGVPNIRFNVAKSYAVIVESLIKG
                     GAHYIDTINGTILPSLKKLTQDEDFDVKYFAKQSLNQCNELLK"
     gene            complement(<598922..>599974)
                     /gene="TDEL0H03630"
                     /locus_tag="TDEL_0H03630"
                     /db_xref="GeneID:11501544"
     mRNA            complement(<598922..>599974)
                     /gene="TDEL0H03630"
                     /locus_tag="TDEL_0H03630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683385.1"
                     /db_xref="GeneID:11501544"
     CDS             complement(598922..599974)
                     /gene="TDEL0H03630"
                     /locus_tag="TDEL_0H03630"
                     /inference="similar to DNA sequence:INSDC:YOL044W"
                     /note="similar to Saccharomyces cerevisiae PEX15
                     (YOL044W); ancestral locus Anc_7.87"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683433.1"
                     /db_xref="GeneID:11501544"
                     /db_xref="UniProtKB/TrEMBL:G9A028"
                     /translation="MSETKLDGGNGLPDGGASTVTTLEELLNDESFNYSASSIAFDED
                     TKYHECLTMFIAGDPERCLQKMYEYGLLSKESIQNNDKVFNLFQEACYAIGNFNRFGF
                     RLQDVILENFTGDPQVLQCHLMNCTLASEISILNRYYRCSAKALLMEKPINEEKATGL
                     EIQTRRTIARIGSRVRVPDEALEFQQLIGTYIFTIQIKLLQKTPSFSLYKKLCDRIPN
                     LSDQLKKWPSTYKEKTIEGQILSQLEHMYSKAKKQHQRRRTNSAAISESVKPSTQVTA
                     KKDKLQRPVNWLSLWHKYFSRMNLSRQNLLFLLIFLLISLQITKKLVKFPIFFTQFSR
                     KILIQLKSILSLLSSV"
     gene            complement(<600211..>603924)
                     /gene="TDEL0H03640"
                     /locus_tag="TDEL_0H03640"
                     /db_xref="GeneID:11501545"
     mRNA            complement(<600211..>603924)
                     /gene="TDEL0H03640"
                     /locus_tag="TDEL_0H03640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683386.1"
                     /db_xref="GeneID:11501545"
     CDS             complement(600211..603924)
                     /gene="TDEL0H03640"
                     /locus_tag="TDEL_0H03640"
                     /inference="similar to DNA sequence:INSDC:YAL017W,YOL045W"
                     /note="similar to Saccharomyces cerevisiae PSK1 (YAL017W)
                     and PSK2 (YOL045W); ancestral locus Anc_7.86"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683434.1"
                     /db_xref="GeneID:11501545"
                     /db_xref="GOA:G9A029"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G9A029"
                     /translation="MPYIGASNVSHSSFQSFKEKHSLQRPGMPDDSSAGSTNSSLNES
                     LDTAAGSSTANTTSHSSSTNVLPPCNGAKVKSGESERDDMEASGLNPLRAQSVSSIAT
                     NATEFEIGELVTLPNESTHAYSYNPLSPNSLAVRLRILKRSLEILIRSPQMLGEPTHQ
                     RNWSEMPRSKQEKLSKWSAPSAALNAFVSSTNASATSSGVQSPVTARGSSYFGPQVKS
                     HLQRASSLAFLPNLSQHNEGTPKNDNICYNKISAANNSDEIIEAQRTDLENLLDFLNE
                     TLENNTSEKATDLHMISLLNVNKLILGDSEHQNLTSQEQLRTLQLKKTLLNSLAEPFF
                     EHYGASEEEIEDSQKELRQEMDLFMGDLKDESQLPMNGLRPQQDYGRILHTFTSGKNI
                     APQAIFTCSQQHPWQFRAANDLACLTFGISKTVLRALTLLDLIHTDSRNFVLNKILST
                     EGQELVFTGEIVAIVQPGSSSQNSNLIWASFWAKRKNDLLVCVFQKVPCDFVDVLLDL
                     QDYSVEKVTNGGGLFWNRNEESTAKASFEIGCSDGEIDDEDDDDEETKGLSENFEKEG
                     RPQLKKKKSVKFADQLETVDELSHSLSHLIKDVIEGKISAPDDDLLPMPIRVANHINS
                     TRYYTLNHLSHNIPCAVSSSMLEDKLKLKIHSLPYEAGLFVVESQTLHLISCNKSILK
                     NMFGHHFVEIVGKPVTDIIPSFKSLIQFINIKYPAFNITLAKNKGLVLTEHFFRKTQA
                     EMMDNPEGFYTSVGIDALHRDGRMIKIDFQLRVMNANVILLWITHSRDVVFREYTTTP
                     SQLHMLKDHEPTYCSDDYSSGASSKKSSSKVSVDRLKDLSTHKSESLGSLDSLGSKLR
                     SASIADADTPPSSLRKASINSPAQLAASELELQKKLDLTKIYTKDKSQFVKDGNFKLD
                     EDLIKSITSSPQSTESNLSLDRMMSEQGATATTVGQIDDSPIFLKTPEGSIGAQKHIK
                     KFSDFLILQKMGEGAYGKVNLCLHKKERYIVVIKMIFKERILVDTWVRDRKLGTIPSE
                     IQIMAVLNKHPDENILRLLDFFEDDDYYYIETPVHGETGSIDLFDLIELKTNMTEFEA
                     KLIFKQVISGIKHLHEQGIVHRDIKDENVIVDSKGFVKLIDFGSAAYVKSGPFDVFVG
                     TIDYAAPEVLGGEPYEGKPQDIWAVGILLYTIVFKENPFYNIDEIMEGTLKFSIGSEV
                     SEECVNLIKKILNKNAPKRPTIQDIYDDVWLRI"
     gene            <605205..>606098
                     /gene="TDEL0H03650"
                     /locus_tag="TDEL_0H03650"
                     /db_xref="GeneID:11501546"
     mRNA            <605205..>606098
                     /gene="TDEL0H03650"
                     /locus_tag="TDEL_0H03650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683387.1"
                     /db_xref="GeneID:11501546"
     CDS             605205..606098
                     /gene="TDEL0H03650"
                     /locus_tag="TDEL_0H03650"
                     /inference="similar to DNA sequence:INSDC:YAL018C"
                     /note="similar to Saccharomyces cerevisiae YAL018C;
                     ancestral locus Anc_7.85"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683435.1"
                     /db_xref="GeneID:11501546"
                     /db_xref="UniProtKB/TrEMBL:G9A030"
                     /translation="MSFAGSLLLTGVGAMVYKFDRNQIFKKCPDNRLGDKSYKKKYES
                     TTARAFNVVGNFFNEFFNGSSFLYPLAGVRFFFNNSKELSFPILGIFALYLLMYSIVS
                     IVYWSTITPVYTALFAIFGPPGLLVAWVHAILQANLLTMMFMRLCHFNNNLITITIKS
                     SGFKKGFNKRPIKYYVPINTVHFWTFHLPWKFFKYFMGFLTLVVLLVISSIPLIGPLL
                     FNFLVSPFIAKVYFSKILRMKGLSNTARSDEFFDHYGQYCAFGLTAGFLENLPIVSGF
                     TLCTNTIGGALWGIDRDLSRE"
     gene            <606192..>607010
                     /gene="TDEL0H03660"
                     /locus_tag="TDEL_0H03660"
                     /db_xref="GeneID:11501547"
     mRNA            <606192..>607010
                     /gene="TDEL0H03660"
                     /locus_tag="TDEL_0H03660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683388.1"
                     /db_xref="GeneID:11501547"
     CDS             606192..607010
                     /gene="TDEL0H03660"
                     /locus_tag="TDEL_0H03660"
                     /inference="similar to DNA sequence:INSDC:YOL047C"
                     /note="similar to Saccharomyces cerevisiae YOL047C;
                     ancestral locus Anc_7.84"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683436.1"
                     /db_xref="GeneID:11501547"
                     /db_xref="UniProtKB/TrEMBL:G9A031"
                     /translation="MCRELRDYCQLKWQEMIDATSLIAASIYNDNSANLKIIKYPFLG
                     IKECFSTTRYGYLMFTIFLNYLVAFVSAGLVYFYLLFPLSVVLYSMFLGPAGLIFAFL
                     HGLAISNIVACHETRVSSRYFMNTIYTLRFNEKEIVPKIRYIRDPFKRINYESIPWIT
                     FIIISILKWAFFLLKLGIWYAISLIPVFGIILFKIQSSSSRGFSYFLPYFKYTGKLDD
                     KRLKYIYYSAYGQWSLFGLTTGLLEAIPIVSGLTICTNTCGCALWEIDRTKRMP"
     gene            <607134..>608414
                     /gene="TDEL0H03670"
                     /locus_tag="TDEL_0H03670"
                     /db_xref="GeneID:11501548"
     mRNA            <607134..>608414
                     /gene="TDEL0H03670"
                     /locus_tag="TDEL_0H03670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683389.1"
                     /db_xref="GeneID:11501548"
     CDS             607134..608414
                     /gene="TDEL0H03670"
                     /locus_tag="TDEL_0H03670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683437.1"
                     /db_xref="GeneID:11501548"
                     /db_xref="GOA:G9A032"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR027450"
                     /db_xref="UniProtKB/TrEMBL:G9A032"
                     /translation="MTEEKIATLISLYEDVIPKSRDTESFLLEILTACDGSVKNASLM
                     LNESLGVARKVDCNIGKRKRDTGNSDNRCYKVQKSLNQFIEDDAKKFRPISSDRRAKT
                     SNRAIELFSKEDVESTIGYVTMHEKALPEEFANSLLRQLMDDLEGFAPYEFHLFGNKC
                     SSNHTSKKYSSDPAILDGRDKIYYNNRRGTVYEYNDLLKATQLLIEDIVNETIKKFKP
                     LPFQISSPNWKGDVVLVNKYGKSDHLMWHSDRLTSIGPQPIVASLSLGCVREFRIRRC
                     YPSDSQIYVVRPPHNSLIIMHAGFQEEYRHSVHQQTNNRATNLHPISKDVRFNLTYRD
                     YLKKYINNAPRCPKCDNPMDLRRAFKDPERRGQYIWQCSSHYSGVECGGVRLADFNCN
                     SLVVEKNAGEGSRWLADDDWEAKEAQKNGTELPR"
     gene            <609143..>609721
                     /gene="TDEL0H03680"
                     /locus_tag="TDEL_0H03680"
                     /db_xref="GeneID:11501549"
     mRNA            <609143..>609721
                     /gene="TDEL0H03680"
                     /locus_tag="TDEL_0H03680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683390.1"
                     /db_xref="GeneID:11501549"
     CDS             609143..609721
                     /gene="TDEL0H03680"
                     /locus_tag="TDEL_0H03680"
                     /inference="similar to DNA sequence:INSDC:YOL048C"
                     /note="similar to Saccharomyces cerevisiae YOL048C;
                     ancestral locus Anc_7.83"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683438.1"
                     /db_xref="GeneID:11501549"
                     /db_xref="UniProtKB/TrEMBL:G9A033"
                     /translation="MVTLGPLGVILGHIQWVLQTNAITSIICRNIVLTHLGNQIFDIT
                     LYLNGQTEFLNRAKFIKYNKNDNESFLKAFSENWQITIPLLMIHCIRKMTIITILTLL
                     SLIPLLGPIVTNQLLSGRRAFSYMGRYFTLKGGSAKENKDFQYEHLGLFFTFGMAAGL
                     LEFVPLFSVITIISNTIGAAKWSIDLIKKNQN"
     gene            complement(<609795..>611240)
                     /gene="TDEL0H03690"
                     /locus_tag="TDEL_0H03690"
                     /db_xref="GeneID:11501550"
     mRNA            complement(<609795..>611240)
                     /gene="TDEL0H03690"
                     /locus_tag="TDEL_0H03690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683391.1"
                     /db_xref="GeneID:11501550"
     CDS             complement(609795..611240)
                     /gene="TDEL0H03690"
                     /locus_tag="TDEL_0H03690"
                     /inference="similar to DNA sequence:INSDC:YOL049W"
                     /note="similar to Saccharomyces cerevisiae GSH2 (YOL049W);
                     ancestral locus Anc_7.82"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683439.1"
                     /db_xref="GeneID:11501550"
                     /db_xref="GOA:G9A034"
                     /db_xref="InterPro:IPR004887"
                     /db_xref="InterPro:IPR005615"
                     /db_xref="InterPro:IPR014042"
                     /db_xref="InterPro:IPR014049"
                     /db_xref="InterPro:IPR014709"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:G9A034"
                     /translation="MVSAYPQLSERARDAILPEVHQWALTNGLIMYPRNFTSEQATIA
                     PTTLYPTLLPRSSVESVVSLQKAYNELYARIIRGENDDWLAKETVKLASYDTEFTGKL
                     WSLYLKTKELGTTQNLRLGIFRSDYLIDKKNSQAKQVEFNTISVSFGGSSTKTGELHN
                     YLNNSGKYCPDSGMPFYQTQIPVSKSSSLLAKGIAEAVNYYQGLNDERIVAFIVQENE
                     RNAFDQRIIEYALLQNHGIKSVRVTLGDVPHLTVVEGKSKRLFYKKTGQEIAVVYYRA
                     GYSPTEYKDEKDWDSRLLLETSYAIKAPDLLTQLSGTKKIQQLLTNENILTRFVPDSD
                     TRSKLISTFVEIYPLDDSPLGQEGKKLAFESPSKFVLKPQREGGGNNIYKENIPSFLK
                     EIDEKDWSAYILMELIQPFETTENVVIRGNESFNEPITSELGIFGCILFDDSKIHFNE
                     YSGWLLRSKFSRSDEGGVAAGFGCVDSFVLY"
     gene            complement(<613765..>616776)
                     /gene="TDEL0H03700"
                     /locus_tag="TDEL_0H03700"
                     /db_xref="GeneID:11501551"
     mRNA            complement(<613765..>616776)
                     /gene="TDEL0H03700"
                     /locus_tag="TDEL_0H03700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683392.1"
                     /db_xref="GeneID:11501551"
     CDS             complement(613765..616776)
                     /gene="TDEL0H03700"
                     /locus_tag="TDEL_0H03700"
                     /inference="similar to DNA sequence:INSDC:YOL051W"
                     /note="similar to Saccharomyces cerevisiae GAL11
                     (YOL051W); ancestral locus Anc_7.81"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683440.1"
                     /db_xref="GeneID:11501551"
                     /db_xref="GOA:G9A035"
                     /db_xref="InterPro:IPR003101"
                     /db_xref="InterPro:IPR008626"
                     /db_xref="UniProtKB/TrEMBL:G9A035"
                     /translation="MNSGGKESLSLDERSRNVNDLLLVLMDINEINGGNSDTAEKMKV
                     HAKNFEAALYAKSSSKKEYMDSMREKVNAMRNTRDSRKKAAVSAATPLSAGSVNRSMQ
                     QNGQQQRQGNMMMNGNYVPNTLNMNSQTFMNQQAQARQQAAQQLRTQQQQQQQRPQLT
                     PQQQQLINQMKVAIIPRELLQRIPNIPPGVNTWQQITDLAQQKRLTPQDMQMAKEVYK
                     LHQQLLYKSKIQQQQQQNANGRMNMQQQMPQQPPSRGAPSAQHQRAPSNGPLSQHHHS
                     SSLNRPAQQQPQQQQRQLKPGEIPNVLGQINQIFTPEEQRSLLQEAMEACKNFQKTQF
                     GKNMTDSNRQNFIRKYINQKALKKIQNMRLAQMAANGTSQRPQQRQEPISQMQQAHSR
                     SASAGLMPNGNQFNGNTNPQPTGPQQPVPGQQMNMGSQPPQQQPQQGKMQQPRPNVLQ
                     AFAPTPQDVETVKRISVEAARTPLRLSDLTNTLPPQEKEEIKRKLQVNQQLFAQVSNY
                     APQVYVLTKSENFLKEVLQLRIFVKEIVEKCTKGIFVVKLDTVDKLVLKYQKYWESMK
                     IQLLRRQQLIQQQQQQQQQQQQQHFNQDQTGPSISEQQQRVQGSLQQIQQQMQQKQRQ
                     QQQRSAPNSSSAMATPNPAAMAAATAMSNGNNYAGSNYQPVMTEANGATDLKNGGANI
                     GYMAPDTTKPSPSQGISPQKAANHSRIKSSSTKVSPANIGQSGINTPSVAAPGMVNSR
                     SATPAAAGTAGSPLGNVKNSAIFQKSPSPMTVPSTRQTPLVENKPFRQEEDNLRNLNI
                     RKAEIISRFKHRQEVFHSSPIDMFLSTLADCIGIKDDQVDIVTHVPQAVIDQINGTGK
                     KKPTKATQRARDQDVVTLAFKDNKFIMESKTSPKTRSYRIRPNALSSVFKNVYGTTDI
                     GEMNFNDATPKRISGGSQVIGRKRKLDESGISPVDSVTSQSSSLMGDSKKVKIDSPED
                     LFAGKENIKLQKPLQESLNNIWDWNYWQKLD"
     gene            complement(<618159..>621284)
                     /gene="TDEL0H03710"
                     /locus_tag="TDEL_0H03710"
                     /db_xref="GeneID:11501552"
     mRNA            complement(<618159..>621284)
                     /gene="TDEL0H03710"
                     /locus_tag="TDEL_0H03710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683393.1"
                     /db_xref="GeneID:11501552"
     CDS             complement(618159..621284)
                     /gene="TDEL0H03710"
                     /locus_tag="TDEL_0H03710"
                     /inference="similar to DNA sequence:INSDC:YAL019W"
                     /note="similar to Saccharomyces cerevisiae FUN30
                     (YAL019W); ancestral locus Anc_7.80"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683441.1"
                     /db_xref="GeneID:11501552"
                     /db_xref="GOA:G9A036"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G9A036"
                     /translation="MSDSTNDEVQVPESSSPLKQTNDETTASLLRSQFSFTPDNGANN
                     KPNPVAGGPKGNPDAQLAQLATEFPDFSPTLVQAVFKSNSFNIKMARERLTRIRNQRQ
                     NWSVNSKGGKTTLIPQTSRLGSSMSPTNRLNSIKPSDPSSKIVVEKQRTSIFDRYSNV
                     MNQKLRPTMTESLVVDDDALSKLSGSNIKRRRLVRADNLDKDRKATHLDKAKENLLNM
                     KMKKVTSGDDGTAEEEMSGEEDVSGEEYEERTPEINIDDQLLQFLNTADASDIADLGE
                     TTMAKAKIIISKRPFSSLYAFAQLEFSEENGDHTKKTPKRTVKRASNQKRESEKLLEK
                     VNQSIRGYNAIDSLIKRCSSYGNLIAGQMKRWGIDLEHTQNGGELDFTNIDSDDDDTA
                     VVEEFDESEVSATPTPAPETNVAKLKIKSESGSEAEEDEEEEEDEEDAPFEESEDEEY
                     GQTRKAAFPGRRGRPQKRLVKFFKGRPKLLGPDVQLKDYQQTGINWLNLLYHNHMSCI
                     LADDMGLGKTCQVISFLAYLKQINEPGPHLVVVPSSTLENWLREFQKFCPSLKIEPYY
                     GSQQERAGLREILERTAGQYDVIVTTYNLAAGNKYDISFLRGCHFNVVVYDEGHMLKN
                     SLSERFSKLMRIQGNFRLLLTGTPLQNNLKELMSLLEFIMPSLFEAKKDYLASIFKQR
                     ARTTDDNKGFNPLLAQEAINRAKMMMRPFILRRRKDQVLKHLPAKHRVIEHCEMNETQ
                     RKIYNEEIKLVMEHKRMIQNGELPEDPKEKAKIQSSSSKNLIMALRKASLHPLLFRNL
                     YNDKVLAKMSDAILDEPEYAENGNRQYIQEDMSYMTDFELHKLCCNFPNTLEKFQLHN
                     QEWLKSGKIDKLTELLKHIIIEKKEKVLIFSLFTQILDILELVLSTLNYKFLRLDGST
                     QVNDRQSLIDKFYEDETIPIFILSTKAGGFGINLVCANNVIIFDQSFNPHDDRQAADR
                     SHRVGQTKEVTITTLITKDSIEEKIFQLAKNKLDLDSHISEDDKKSQELLESKVSDIL
                     EDIIYDENSKP"
     gene            <621489..>622508
                     /gene="TDEL0H03720"
                     /locus_tag="TDEL_0H03720"
                     /db_xref="GeneID:11501553"
     mRNA            <621489..>622508
                     /gene="TDEL0H03720"
                     /locus_tag="TDEL_0H03720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683394.1"
                     /db_xref="GeneID:11501553"
     CDS             621489..622508
                     /gene="TDEL0H03720"
                     /locus_tag="TDEL_0H03720"
                     /inference="similar to DNA sequence:INSDC:YAL020C"
                     /note="similar to Saccharomyces cerevisiae ATS1 (YAL020C);
                     ancestral locus Anc_7.79"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683442.1"
                     /db_xref="GeneID:11501553"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:G9A037"
                     /translation="MVGTNLGLPHCEDVIVPQETLVLEKGQCVSRIACGGNHTVLLLD
                     DGTALACGDSKQGQLGGLEQWEGWKVLLGGVKDVTCGWEFTVVINEQNELLSRGTGPK
                     GELGLGSMRRAEEFTKIMDVNMGSRVFASLQNCTVVVPTREGGSKVYGWGSNTKCQLL
                     EPKSRIVDRPVLIYESTETIIEYPALGRDFIVLVDTHGRIAYASGSLPLGFSTQDWSS
                     HSGLQVHCMWTSIHIWSSKPGIYSYGNGNHGQLFRQEEWCPASEISQVAAGSEHGVLL
                     KHNNQVACWGWGEHGNCGRLYKDKDSIFNDYSNVISPLCDVFQAREPCDLFAGCATTW
                     IVTKC"
     gene            <623125..>625518
                     /gene="TDEL0H03730"
                     /locus_tag="TDEL_0H03730"
                     /db_xref="GeneID:11501554"
     mRNA            <623125..>625518
                     /gene="TDEL0H03730"
                     /locus_tag="TDEL_0H03730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683395.1"
                     /db_xref="GeneID:11501554"
     CDS             623125..625518
                     /gene="TDEL0H03730"
                     /locus_tag="TDEL_0H03730"
                     /inference="similar to DNA sequence:INSDC:YAL021C"
                     /note="similar to Saccharomyces cerevisiae CCR4 (YAL021C);
                     ancestral locus Anc_7.78"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683443.1"
                     /db_xref="GeneID:11501554"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:G9A038"
                     /translation="MSNPSMLSYPSLGPQQQPNLMPGMRADTPNGMHQQLHGNPMGAV
                     PPPGIMNPSMGVSGDSVPHQLLSHLGQSGVDHSGAANGAAMTGNNGNEKNALYHPHLE
                     EPALLNNPIWKLQLQLAAVSMQSVGQPNVYARQNAMKKYLVNQQQQKQQQQQQQQPVL
                     DHQRQPGLLQQISGGQPLQQQDQLQNPQMADASISLVDKTKQLLMEMATETKDNSATN
                     NNPPGSANTYATGNTSGSISSPSTPKTELHHLRDQNTGTPTLLLQHKKLSQFNIDEDD
                     ETEHRMTAPKNTKFDDQLWHAIDFSNLQIFNISSNLFKYTFLTRLYLNGNSLTSLPPQ
                     IKSLVNLRVLDLSHNRLTALPKELGLCYQLKYLYVFDNQITTLPWEFGSLFNLQFLGC
                     EGNPLDRQLLKILAEKSVTGLIFYLRDNRPEVPLNKDRDFIEINAEGEPVEKYRSLHE
                     ADEHLSSELSKRSFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLTEQILSYMT
                     DVICLQEVEAKTFEEYWAPLMQKHGYSGLFHAKTRAKTMHSKDSKKVDGCCVFYRENE
                     FKLAYKDAVDFSGVWQKHKKFQRTEDYLNRAMNKDNVAIYLKLQHIKSGESVWIVTTH
                     LHWDPQFNDVKTFQVGVLMDHIENLLKEQSNAQSKQEAKKCPVILCGDLNSEIHSAVY
                     ELLSTGRVQAHDDIKGRDFGYMTQKNFAHNLAMKSSYSYIGELPLTNFTPSFTSVIDY
                     IWFSTQSLRVRGLLGPIDPDYISQFIGFPNAKFPSDHIPVLARFEFLKGGAGSSRKI"
     gene            <625722..>626996
                     /gene="TDEL0H03740"
                     /locus_tag="TDEL_0H03740"
                     /db_xref="GeneID:11501555"
     mRNA            <625722..>626996
                     /gene="TDEL0H03740"
                     /locus_tag="TDEL_0H03740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683396.1"
                     /db_xref="GeneID:11501555"
     CDS             625722..626996
                     /gene="TDEL0H03740"
                     /locus_tag="TDEL_0H03740"
                     /inference="similar to DNA sequence:INSDC:YAL022C"
                     /note="similar to Saccharomyces cerevisiae FUN26
                     (YAL022C); ancestral locus Anc_7.77"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683444.1"
                     /db_xref="GeneID:11501555"
                     /db_xref="GOA:G9A039"
                     /db_xref="InterPro:IPR002259"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G9A039"
                     /translation="MHADEAILASEYDGTPEIEQRSLAQKPFMEKIRNHVYLTLLFIG
                     IGLLWPWNCILSASVYFKHDVFHDKTIWANIFTSSMMTVSTLSSMLSNVWLARRQHSY
                     SERVIRGLIWEILVFVALSAVTMMHSLCSLWFTFTLVMVLVAISSVATAMTQNGIMAI
                     ANVYGSEFSQAVMVGQAVAGVLPSVVLLIISFFSNPSEQSTSGIVFYFLTTTVVAMVS
                     VVLYRVNKIGSRLKNPTTSSLASPTIPFKTLFYKLKYLVLSIFTTFVVTLIFPVFAAT
                     VLVKGFPLSNSQYSPFIFTVWNVGDLHGRVIADWPIFRSPRFTPFKTFVYSLWRLLFI
                     PLFLSFCINNKSEISFPVLQDLGYTILQYAFGLTNGHVISISFMKVPEQLATDEEREA
                     AGGFTNIFVSTGLTLGSVVSYAFVYIIAFLNK"
     gene            <627212..>629464
                     /gene="TDEL0H03750"
                     /locus_tag="TDEL_0H03750"
                     /db_xref="GeneID:11501556"
     mRNA            <627212..>629464
                     /gene="TDEL0H03750"
                     /locus_tag="TDEL_0H03750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683397.1"
                     /db_xref="GeneID:11501556"
     CDS             627212..629464
                     /gene="TDEL0H03750"
                     /locus_tag="TDEL_0H03750"
                     /inference="similar to DNA sequence:INSDC:YAL023C,YOR321W"
                     /note="similar to Saccharomyces cerevisiae PMT2 (YAL023C)
                     and PMT3 (YOR321W); ancestral locus Anc_7.76"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683445.1"
                     /db_xref="GeneID:11501556"
                     /db_xref="GOA:G9A040"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:G9A040"
                     /translation="MSSATGFDDGLKDDSELLRRRREDEVLDESSNTIEKEDVSKLKV
                     ANVSPLLRLESIVMPIVFTALAFFIRMYRIGINDHVVWDEAHFGKFGSYYLRHEFYHD
                     VHPPLGKMLVGFSGFLAGYNGSFDFNSGEVYPDYVDYVKMRLFNAAFSALCVPLAYYT
                     AKNIGFSIPTVWLFTVLVLFENSYTTLGKFILLDSMLLFFTVASFFCFVTYHQQRKRP
                     FSRKWWKWMLLTGISLGCAISVKMVGLFVITVVGIYTVGELWIFLADKSMSWKTYTMH
                     WIARILCLIVVPMLVFMGCFKVHFDLLSHSGTGDANMPSLFQANLIGSDVGAGPRDIA
                     IGSSYVSIKNQALGGSLLHSHVQTYPEGSSQQQVTGYGFKDSNNLWFFDRQRAMPYYN
                     DSETDVEYIVAGMAYRLVHNSTQRNLHTHPIAAPVSKSAWEVSGYGDHLLGDEKDHWV
                     IEVVAQYGDEDKSRIHPLTTSFRLKNIVMDCYLAQTGHHLPEWGFRQSEMACVKSPFK
                     RDKRTWWNIESHENDVLPPRPENFRYPKTNFIKDFIHLNLAMMATNNALIPESDKLDN
                     LASAAWQWPTLDLGLRLCGWGDDNIRYFLLGNPLSTWPSTAAVVAFGALVVVLLLRWQ
                     RQYVDLANPQDASVFLIGGIFPMLAWGLHFMPFVIMSRVTYVHHYLPALYFALLVMCY
                     LFEAGLKGWTKSKCGNVMRVCIYGSYYAIVIGCFFYFSPISFGMEGPVSKYEYLDWLP
                     GWFISDKNKA"
     gene            complement(<629616..>631808)
                     /gene="TDEL0H03760"
                     /locus_tag="TDEL_0H03760"
                     /db_xref="GeneID:11501557"
     mRNA            complement(<629616..>631808)
                     /gene="TDEL0H03760"
                     /locus_tag="TDEL_0H03760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683398.1"
                     /db_xref="GeneID:11501557"
     CDS             complement(629616..631808)
                     /gene="TDEL0H03760"
                     /locus_tag="TDEL_0H03760"
                     /inference="similar to DNA sequence:INSDC:YOR322C"
                     /note="similar to Saccharomyces cerevisiae LDB19
                     (YOR322C); ancestral locus Anc_7.75"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683446.1"
                     /db_xref="GeneID:11501557"
                     /db_xref="InterPro:IPR024391"
                     /db_xref="UniProtKB/TrEMBL:G9A041"
                     /translation="MLRDLAHHHRDHPLELLIDIESPPCVLYGSATESSGALLSGLLT
                     LSVKDPYESETNSGSITPVNSKDGKRKNGLSSLSSTLSHLSLSSAQVSPVQSSTNLKI
                     MSGYTKVTITSVTLTFVQKVQYHKPFLPDGHSFHSCMNCKTKTTDMKTWIIQDAAQDM
                     AVGRHSFPFSYLIPGSVPAKSFLGLNSATQIKYELIAVVTYKDPKRGSSSKQQLVQLS
                     MPVSVTRSIPRGPDKNSLRVFPPTELTATAVLPNVVYPKSTFPLEMKINGVSSADRRW
                     RMRKLAWRIEEVSRIRCNTCEIHKHELKQLEETVKEKEANKKAGAIKKYNGESGPQVR
                     LTVGAENPPSQAMGRGSSLEATPSNTQASPGDQDEEDAPNDYVHPSDDALRQEIQRQQ
                     QRLREQQVEETKKNDIQIYTEEIRTVTRGEMKSGWKTDFDNNGQIELITDIDCTPVNS
                     GVANPITHVSTASPNVEPIKQDTNISCDIQDPTLGVFVNHILAVEIVVAEETLQHANG
                     QPVRKSSASGPSSKPNVNDPDQRLAELSPMFANRNNARSRPVDADTLTPTHSTSSTKS
                     NGSSKGTAANSRSRIVSVPTGAARVLRMQFRILITERSGLGISWDEEVPPIYQDIKLL
                     SPPSYEKSITKSATAPSLGAIDQSGFPRENRSDILLQSISPPPVAHHHNSSTSLRALT
                     TVQSPNLDSVVSIQGNVPFQDHALTPHATRDISIRNISELIDTDRITQ"
     gene            <632675..>636613
                     /gene="TDEL0H03770"
                     /locus_tag="TDEL_0H03770"
                     /db_xref="GeneID:11501558"
     mRNA            <632675..>636613
                     /gene="TDEL0H03770"
                     /locus_tag="TDEL_0H03770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683399.1"
                     /db_xref="GeneID:11501558"
     CDS             632675..636613
                     /gene="TDEL0H03770"
                     /locus_tag="TDEL_0H03770"
                     /inference="similar to DNA sequence:INSDC:YAL024C"
                     /note="similar to Saccharomyces cerevisiae LTE1 (YAL024C);
                     ancestral locus Anc_7.74"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683447.1"
                     /db_xref="GeneID:11501558"
                     /db_xref="GOA:G9A042"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR019804"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:G9A042"
                     /translation="MEAFSQKDYYPIPSDNVITYDGENNDHSRKRRVLKADLLALIVH
                     LSSPIDTVDYMVISDFFLIYRNFVSPMELSDLLVMRYRWCVSEIDSESLERRKIGEIA
                     LVRTFVLLRHWILNYFVQTFLPDGNLRLRVIKFLNEPCESRPKIVKSTMINLKKAWII
                     CSKRVWTNLSLNEPAFKSQDNQWVTYEIVDYTRLDEVCKRDSRLSAYAKNGSSSPNFR
                     NQSVLSLFKDSVVFKIPETNNRASRTASMVLFPCDNSNIKTGNGKNTAEKSEAQPNNK
                     RIMSNFSKMTNIPDVIKDVQGSVSPNIDKLIPPTPAKKVELIFQVPDNVERPINKDQI
                     EHTEPTSQKHSGPIALLHKWKKIHTTSRDNCKHAQLSETSGLTKPEVENFVKYVISIT
                     SLENKTPEPDNLHNLIASKFDILSARTIEEVEFLVSLENELVNQVKDAAMQGTKIPIN
                     ETVQELERVKTNDQGFSAMDNLNLYHTVSSIAKSVTSLTNSLNQRPKVQSNTLSPSHA
                     ALERRKVQSSVAAMLSSDSRYSLISRTNSGKGNTLNQLVDGPQRLVFHDITSSNQEKE
                     NNGDNLSFRKSGTQSPTRSSPLRNNLPCLAEDPLSSTRPIDRERGSIVSISTCSELST
                     SSLKRSDEESLLSVEVDNHGLKRKMAQINLREFTFENQQEIDTKGRDSVSSFVTTRET
                     IEETPPMTKKFPVKGVRPASGRISLMRKQSPVPLSPQNALLSKAEAAIKDLDFQEKEA
                     ELLQSEIEMAQLQKQTALRLSMAASVNTDVLFASQHNSPQKMIMEDDSSHIKLSTTPS
                     VRSVNRGTSVSTKMTTDSMEELAEAPAHSSLKDELRRLEPEVSVESSFGFPDLNVTDP
                     FSEGENSTGMKNKYLFSPDGESVDLASPAKNVEEIKDKFLNKEEDDEETEPQEVPEVA
                     NDLTRDAEKAIIDLKKKALDQENVVNIASLPDDSIHDDPVNVALMKLEGTYKRNGNGE
                     EEEIDGSKSSSVLAREVDVLGIKNLSVPQVSPADRRRSLLIEKRRQTITNFPFTPSDE
                     KEYVEPQPANVKELLKNYELRDPNLLITNSELHVPFILMYDSLSIAQQMTLIEREILG
                     EVDWNELLNLNLSHSPPQATSWLQLLVQNESLSGINLAISRFNLTVDWVISEIVLTSD
                     VKLRRNTIQRFIHVAEHCRVFQNYNTMMEIVLALGSTAVQRSSEAWRLIEPGDLITWE
                     ELRKIPSLDRNYSAIRSLLNNVDPLKGCVPFIVIYLSDISLNSEKKNWIVMNQVVNYN
                     KFNTNVQIVKNFIQRVQWSKFYDFTVDHELLSKCVYLTALSPDEITQLTG"
     gene            <636824..>637741
                     /gene="TDEL0H03780"
                     /locus_tag="TDEL_0H03780"
                     /db_xref="GeneID:11501559"
     mRNA            <636824..>637741
                     /gene="TDEL0H03780"
                     /locus_tag="TDEL_0H03780"
                     /product="66S preribosome component MAK16"
                     /transcript_id="XM_003683400.1"
                     /db_xref="GeneID:11501559"
     CDS             636824..637741
                     /gene="TDEL0H03780"
                     /locus_tag="TDEL_0H03780"
                     /inference="similar to DNA sequence:INSDC:YAL025C"
                     /note="similar to Saccharomyces cerevisiae MAK16
                     (YAL025C); ancestral locus Anc_7.73"
                     /codon_start=1
                     /product="66S preribosome component MAK16"
                     /protein_id="XP_003683448.1"
                     /db_xref="GeneID:11501559"
                     /db_xref="InterPro:IPR006958"
                     /db_xref="InterPro:IPR029004"
                     /db_xref="UniProtKB/TrEMBL:G9A043"
                     /translation="MSDDIVWQLINNQFCSYKLTTDKGQTFCRNEYNVTGLCSRQACP
                     LANSKYATVKSVNGRLYIYMKTAERAHTPAKMWERIKLSKNYSKALQQIDDHLLYWNK
                     FLIHKCKQRLTKLTQVAITERRMALREEERHYVGVAPKVKRREENRERKALIAAKIEK
                     SIEKELLDRLKSGAYGDKPLNVDEKIWKKVMGHMEDENEAQEDEENWEEEEEEESDEG
                     EVEYVEDEGDDDLVDLEDLENWLDGSNSDRDASEEESDDESDEDSDSGEEDEGKKKKR
                     KITSAKRRPKIEIEYEEEQAQPAAQEIAR"
     gene            <638120..>642124
                     /gene="TDEL0H03790"
                     /locus_tag="TDEL_0H03790"
                     /db_xref="GeneID:11501560"
     mRNA            <638120..>642124
                     /gene="TDEL0H03790"
                     /locus_tag="TDEL_0H03790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683401.1"
                     /db_xref="GeneID:11501560"
     CDS             638120..642124
                     /gene="TDEL0H03790"
                     /locus_tag="TDEL_0H03790"
                     /inference="similar to DNA sequence:INSDC:YAL026C"
                     /note="similar to Saccharomyces cerevisiae DRS2 (YAL026C);
                     ancestral locus Anc_7.72"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683449.1"
                     /db_xref="GeneID:11501560"
                     /db_xref="GOA:G9A044"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:G9A044"
                     /translation="MGPPARETEPADDTLFDVDFLDITPASGSRRQHDSQQSVLSDQN
                     SLNGAHHGSIDVARNESIENDLEGEYDPFEDEGNWDHNRLNTNKNRSDLRDSKVKGAG
                     VFSRMADTVKNTFRSNTGSSNGYRDIEMTDFNASSGGDNYESSRNRFNIKILFNRYIL
                     RRPTQAEIDGTHRIIHMNDRGANASTGYGDNHISTTKYNAATFLPKFLFQEFSKYANL
                     FFLFTSCIQQVPHVSPTNRYTTAGTLLIVLIVSAIKECVEDIKRITSDNELNNAKTEI
                     YSVDEGDFVQKRWIDIRVGDVIRVQSEEAIPADIILLSSSEPEGLCYIETANLDGETN
                     LKIKQAKPETSRFIDSRNLRNVQGTINSEQPNSSLYTYEGTMKLNGKDISLSPGQMIL
                     RGATLRNTSWIFGIVIFTGHETKLMRNATATPIKRTAVERIINLQIAALFGVLIILSL
                     ISSIGNVIMSTAGAGRLPYLYLGGTNKVGLFFKDLLTFWILFSNLVPISLFVTVELIK
                     YYQAFMIGSDLDLYYEETDTPTVVRTSSLVEELGQIEYVFSDKTGTLTRNIMEFKSCS
                     IAGRCYLEKIPEDKGATMEDGVEVGYRKFDELRTKLNDPTDDESTIIEDFLTLLATCH
                     TVIPEFQKDGQIKYQAASPDEGALVQGGAELGYKFIIRKPSSVTILVEETGEEQVYQL
                     LNICEFNSTRKRMSAILRCPDGSIKLFCKGADTVIMERLEKGYNPFVEATTKHLEEYA
                     SDGLRTLCLAMRVVSEEEYQEWKKIYNAAATTLTDRAERLDEAAELIEKDLFLLGATA
                     IEDKLQEGVPETIRTLQEAGIRIWVLTGDRQETAINIGMSCKLLSEEMNLLIINEEDK
                     EGTKANMLEKLRAFDEHQISQQDMNTLALVIDGKSLGYALDPDMEDYLLKIGKLCKAV
                     ICCRVSPLQKALVVKMVKRKTSSLLLAVGDGANDVSMIQAAHVGVGISGMEGMQAARS
                     ADVAIGQFKFLKKLLLVHGSWSYQRISVAILYSFYKNIALYMTQFWYVFANAFSGQSI
                     MESWTLTFYNVFFTVLPPFVMGVFDQFVSSRLLERYPQLYKLGQKGQFFSVMIFWGWI
                     INGFYHSAVTFIGSILIYRFGFALNKHGEVADHWSWGVAIYTTSILIVLGKAALVTNQ
                     WTKFTLFAIPGSFVFWIVFFPIYASIFPHANISREYLGVVTHTYGSGTFWLMLLVLPI
                     FALMRDFVWKYYKRMYVPEPYHVVQEMQKFNITDSRPHVQQFQKAIRKVRQVQRMKKQ
                     RGFAFSQSEEGGQEKIIRMYDTTQKRGIYGELQDASADPFSDENYVNIPSDPFSDENQ
                     THSGFPEENSSFIL"
     gene            complement(<642180..>643550)
                     /gene="TDEL0H03800"
                     /locus_tag="TDEL_0H03800"
                     /db_xref="GeneID:11501561"
     mRNA            complement(<642180..>643550)
                     /gene="TDEL0H03800"
                     /locus_tag="TDEL_0H03800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683402.1"
                     /db_xref="GeneID:11501561"
     CDS             complement(642180..643550)
                     /gene="TDEL0H03800"
                     /locus_tag="TDEL_0H03800"
                     /inference="similar to DNA sequence:INSDC:YOR323C"
                     /note="similar to Saccharomyces cerevisiae PRO2 (YOR323C);
                     ancestral locus Anc_7.71"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683450.1"
                     /db_xref="GeneID:11501561"
                     /db_xref="GOA:G9A045"
                     /db_xref="InterPro:IPR000965"
                     /db_xref="InterPro:IPR012134"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR020593"
                     /db_xref="UniProtKB/TrEMBL:G9A045"
                     /translation="MSSSEQIAKNARRAGNVLKTISDKNRSNVLYKIHDELKKNASTI
                     EKANQLDLEAAITSGLSPSLIKRLDLFKGDKFDTMLQGIKDVADLEDPVGKVKIARQL
                     DEDLILYQVTAPVGVLLVIFESRPEVIANITALAIKSGNAGILKGGKESVNTFREMAR
                     IINGTISRYEAETGVPVGSVQLIETREDVSGLLLQDEYIDLVVPRGSNALVRQIKANT
                     KIPVLGHADGICSVYLDDEADLEKAKRITLDAKTNYPAGCNAMETLLINPKLPNWWRV
                     LDHLSRKGDVVLHLTKDAKEAYIQKLKEEGTFDDFSSTKIVDVDESKDFDGEFLSLDC
                     AVKFVSSTKEAIEHINLHSSKHTDAIVTENEQHAELFLKGIDSSGVYWNASTRFADGF
                     RYGFGTEVGISTSKIHARGPVGLDGLVTYQYQLRGTGQVASDYLGAGGKKAFVHKDLD
                     ITKVTL"
     gene            complement(<643878..>644686)
                     /gene="TDEL0H03810"
                     /locus_tag="TDEL_0H03810"
                     /db_xref="GeneID:11501562"
     mRNA            complement(join(<643878..644619,644676..>644686))
                     /gene="TDEL0H03810"
                     /locus_tag="TDEL_0H03810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683403.1"
                     /db_xref="GeneID:11501562"
     CDS             complement(join(643878..644619,644676..644686))
                     /gene="TDEL0H03810"
                     /locus_tag="TDEL_0H03810"
                     /inference="similar to DNA sequence:INSDC:YAL027W"
                     /note="similar to Saccharomyces cerevisiae YAL027W;
                     ancestral locus Anc_7.70"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683451.1"
                     /db_xref="GeneID:11501562"
                     /db_xref="InterPro:IPR021624"
                     /db_xref="UniProtKB/TrEMBL:G9A046"
                     /translation="MAPSVATVKVAEDTVLPLRIFVNRKQLLQKSSNESIFHTPLLSN
                     NSIVYIKSPTVKIHLSNNDMRDLCSEIITELILIIYELAPELAVGKTFGSLRIGQSSD
                     FQDNYLSKLLEGDDADLVKSHIDTITRVAKFKYKLHYKGNWELEIYINSVKRLADIRS
                     FLLFKEQGLQHLIRTMPSKRKILLTETVSIEKPKILQEVDDNDISLEEIASSADQKPD
                     LTFKYKPVINLGDCIDIHILHRPKRQRNTTKD"
     gene            complement(<644900..>646396)
                     /gene="TDEL0H03820"
                     /locus_tag="TDEL_0H03820"
                     /db_xref="GeneID:11501563"
     mRNA            complement(<644900..>646396)
                     /gene="TDEL0H03820"
                     /locus_tag="TDEL_0H03820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683404.1"
                     /db_xref="GeneID:11501563"
     CDS             complement(644900..646396)
                     /gene="TDEL0H03820"
                     /locus_tag="TDEL_0H03820"
                     /inference="similar to DNA sequence:INSDC:YAL028W,YOR324C"
                     /note="similar to Saccharomyces cerevisiae FRT2 (YAL028W)
                     and FRT1 (YOR324C); ancestral locus Anc_7.69"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683452.1"
                     /db_xref="GeneID:11501563"
                     /db_xref="GOA:G9A047"
                     /db_xref="InterPro:IPR025752"
                     /db_xref="UniProtKB/TrEMBL:G9A047"
                     /translation="MNLLIDRIENPGHRNTAPLIPSVSRPTVQGQRRATNNSNGENVS
                     QERRSIDVPVISVNGNPVPMGMKTNQKRNSVSRKNSLNKPGEKELPHERRGSSYYHGR
                     HSVAAADVTSATAGMFSDCMFRSETQKPVRHSPSSTASSSSTSIYAHKHTDQQPLPLQ
                     HRRHHGRTDHHHNNSSTLHRKHAASFSSVFVNDNKRLVNQFLRSMEPSTPASRTPRVM
                     TATEPSTPRNFGPNYETGTSGSLQSLLYRDLASMHSKKKKQASTLPFAPSSVSSSSNS
                     SSFSLLRTEQSSPSLSSGYDSEDSLSITNDDKVAANNGGLTTKNGLGLNYNEVDYYRH
                     HIAAELHKFEDILKHNIKEVIMRSEFDMVKNWKLFDMSVLQLARLKEEVSNLHDLIKE
                     KNLQALRKDFDKKDKDSFICTLEFSIKTNASLLEGLEKRIDVCKKKLLRQRETLRKLE
                     GLLNLEDSLLNSQKTTKIAYKYRYMVYDVGALMGIICIIFIVRWFIWR"
     gene            <646726..>651474
                     /gene="TDEL0H03830"
                     /locus_tag="TDEL_0H03830"
                     /db_xref="GeneID:11501564"
     mRNA            <646726..>651474
                     /gene="TDEL0H03830"
                     /locus_tag="TDEL_0H03830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683405.1"
                     /db_xref="GeneID:11501564"
     CDS             646726..651474
                     /gene="TDEL0H03830"
                     /locus_tag="TDEL_0H03830"
                     /inference="similar to DNA sequence:INSDC:YAL029C,YOR326W"
                     /note="similar to Saccharomyces cerevisiae MYO4 (YAL029C)
                     and MYO2 (YOR326W); ancestral locus Anc_7.68"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683453.1"
                     /db_xref="GeneID:11501564"
                     /db_xref="GOA:G9A048"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR002710"
                     /db_xref="InterPro:IPR004009"
                     /db_xref="InterPro:IPR008989"
                     /db_xref="InterPro:IPR018444"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G9A048"
                     /translation="MSFEVGTRCWYPNDEQGWIGGEITKFESEGGKYRLELTLEDGTV
                     VPIETDSLVSNADDSNNRLPQLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYAQLNI
                     YTYSGIVLIATNPFDRVDQLYSQDMIQAYAGKRRGELEPHLFAIAGEAYRMMKHDKKN
                     QTIVVSGESGAGKTVSAKYIMRYFASVEEENSYAMDNVQHQVEMSETEQRILATNPIM
                     EAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGAKIRTYLLERSRLVYQPSVERNYHI
                     FYQLLAGLPQAQKEELHLTEPQDYFYMNQGGVTEIAGVNDADEYKVTVDALTLVGVST
                     ETQHQIFKILAALLHIGNIEIKKTRTDASLSSDEPNLQIACDLLGIDTYNFAKWITKK
                     QITTRSEKIVSNLNYNQAIVAKDSVAKFIYSALFDWLVEIINTVLCNPEVADQVSSFI
                     GVLDIYGFEHFERNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFND
                     NQPCINLIENKLGILSLLDEESRLPAGSDESWTQKLYQTLDKPPTNKVFSKPRFGQTK
                     FVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKATKNETLQNILQTLENAALKVEEA
                     KKVEQEQSKKPGPAARTVQRKPTLGSMFKQSLIELMDTINSTNVHYIRCIKPNSDKEP
                     WKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFSEFVLRYYILIPSEGWSKIFNEES
                     TTEENVIEVCRKILEATVTDKDKYQIGNTKIFFKAGMLAYFEKLRSEKIHQSGVLIQK
                     KIRAKYYRQKYLEILDALKSTQKYARGYVTRQKVDRQLKTHLAVLLQRLYRGSKVRAQ
                     TFNILDSIVKIQSKVRQQLAQRELEEKNTRKAAVAIQSRVRSFKPRKSFQRSRKDTIT
                     VQSLIRRRFAQAKLKSMKEEAKSVNHLQEVSYQLENKVIELTQNLATKVKENKEMTAR
                     LLDLQEKLQSTGALRKELESQREVHAEALKGQAIEHDARYKEIELQLKMSKQEVDDAK
                     EEIRVLAAKHKQISEDARAQLEELNGTKEVLNEARTQNSDLHDEVKSLKEEITRLQNA
                     MKSGAAFAQTPKSVKTYSMNGGPTNPLSSPDQLNLISVNGHADNIPVTGLGIEFDNRS
                     TMSTLSQINDELYKLLENTKVLNGEITEGLLRGFKVPETGVAIQLSEREVLYPARILI
                     IILSDMWRLGLTKQSEEFLAEVLNTIQKVVQSLKGADVIPGGAFWLTNVRELYSFVIF
                     AQESILNDESYNKGLTEDEYKEYVVLVTELREDFESLSYNIYNIWLKKLQKDLQKKAV
                     PAVIVSESLPGFKNDPGKFLSNLFGSSPEYNMDDILTFFNMIYWCMKSFHVENEIFRE
                     TVLILLNFVDSICFNDLIMRRNFLSWKRGLQLNYNVTRLEEWCKTHFIPEGADCLQHL
                     IQTSKLLQLRKTELDDVKILCDICTSLKPAQLQKLMSQYAVADYEPPISEEILNFVAE
                     KVKKGSSLSSNGKSEVHSEDIFLKVPTGPFEDPFVGIETRQFRKIEAYIPAWLNLPTT
                     RRVVELVTEQVSLQESQALLDTAEQEVLKT"
     gene            complement(<651664..>652053)
                     /gene="TDEL0H03840"
                     /locus_tag="TDEL_0H03840"
                     /db_xref="GeneID:11501565"
     mRNA            complement(join(<651664..651912,651973..>652053))
                     /gene="TDEL0H03840"
                     /locus_tag="TDEL_0H03840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683406.1"
                     /db_xref="GeneID:11501565"
     CDS             complement(join(651664..651912,651973..652053))
                     /gene="TDEL0H03840"
                     /locus_tag="TDEL_0H03840"
                     /inference="similar to DNA sequence:INSDC:YAL030W,YOR327C"
                     /note="similar to Saccharomyces cerevisiae SNC1 (YAL030W)
                     and SNC2 (YOR327C); ancestral locus Anc_7.67"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683454.1"
                     /db_xref="GeneID:11501565"
                     /db_xref="GOA:G9A049"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR016444"
                     /db_xref="UniProtKB/TrEMBL:G9A049"
                     /translation="MSSAVPYDPYIPPEEPAEQSKAAALKAEIDDTVGIMRDNINKVA
                     ERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRLCLVLVVIILLVVIIV
                     PIAVHFS"
     gene            complement(<652415..>654421)
                     /gene="TDEL0H03850"
                     /locus_tag="TDEL_0H03850"
                     /db_xref="GeneID:11501566"
     mRNA            complement(<652415..>654421)
                     /gene="TDEL0H03850"
                     /locus_tag="TDEL_0H03850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683407.1"
                     /db_xref="GeneID:11501566"
     CDS             complement(652415..654421)
                     /gene="TDEL0H03850"
                     /locus_tag="TDEL_0H03850"
                     /inference="similar to DNA sequence:INSDC:YOR329C"
                     /note="similar to Saccharomyces cerevisiae SCD5 (YOR329C);
                     ancestral locus Anc_7.66"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683455.1"
                     /db_xref="GeneID:11501566"
                     /db_xref="UniProtKB/TrEMBL:G9A050"
                     /translation="MSFEWLNVPGINTADNDVTVEQGNNLPPPSVSFDIGTSGSNAEQ
                     KTDVQPIGNVNGSHVPKGSGGHLGDYRPISQHHHSYPGSDQQKQNDNIQVHHHHNQGQ
                     NPRSHTDMIYKETPEELRVPLSLSRSQLTKEEVRTYLRWYNFITSRTHSKLVKLIEVF
                     KFLANFRLSHELKSRIEAIFRTCKNALNIGQFFAVLRLISKALIENVIPNRRMILDKA
                     PIPTPRSILTSGDRHEVYEEVDEEPDSNGQKVDFDSFASLLLTGKSVQKRIRRRIPDS
                     ADKNKRVRFSEHVTFQEPPSEDGEENGSHEVSDDEETDGKLDLSLPMDQLLKRMAKRK
                     EKNTALVSSMPNEQQETEEEREVLEDMKDSLSHFKQIQSVDLASMPSIRVSDNEPEMQ
                     PLKPTSTGSANSLFRQHYNNQSSAGAYQEPLQPLKPTATGSANYLMRNHIPPHQEAPS
                     EAPNGPSPVTGLQPLRPTATGSGNYLMKQQLSQHYAPSGLTAPMNSAERFPSPQHTGQ
                     LPTDPYLHAPQPRISMQQQLSPQVTPQSQNFQQQHNMLPVPPNPAGSYFQSLLSNSPS
                     PAPSNVNISGINNSSSPYQNPPNSHPPTSQSRAMYNNGYQYSNTAPNRQMFNEPAQQQ
                     NYPQQNFSSPYPMPSSTSPQSGDILSDLHSLQQQVNALQNSYRR"
     gene            <654623..>655378
                     /gene="TDEL0H03860"
                     /locus_tag="TDEL_0H03860"
                     /db_xref="GeneID:11501567"
     mRNA            <654623..>655378
                     /gene="TDEL0H03860"
                     /locus_tag="TDEL_0H03860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683408.1"
                     /db_xref="GeneID:11501567"
     CDS             654623..655378
                     /gene="TDEL0H03860"
                     /locus_tag="TDEL_0H03860"
                     /note="ancestral locus Anc_7.65"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683456.1"
                     /db_xref="GeneID:11501567"
                     /db_xref="UniProtKB/TrEMBL:G9A051"
                     /translation="MVRKNKRPAFDESDSDGGPGSGFQEYLNNKSAQSSKRAKSTEAI
                     EAASSSLQVASPCEDVYETKESSPTVIDGLLKSKRQRKQDKLHIQSIKSRLENELDKP
                     KDTEELVFITDEYKAKREEYDRADLLAEQEMEQEDTVDPNEELMGSSRSVALRSLMKT
                     ISSDKHLIPNIPQASDRTQQSTQKTKFENDVYRSPSYQAIKYEVKLAEDTMGLDPEQK
                     KLCIEEFLKSTKTAQDIRRYISHYEKKHNVHVD"
     gene            complement(<655391..>659326)
                     /gene="TDEL0H03870"
                     /locus_tag="TDEL_0H03870"
                     /db_xref="GeneID:11501568"
     mRNA            complement(<655391..>659326)
                     /gene="TDEL0H03870"
                     /locus_tag="TDEL_0H03870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683409.1"
                     /db_xref="GeneID:11501568"
     CDS             complement(655391..659326)
                     /gene="TDEL0H03870"
                     /locus_tag="TDEL_0H03870"
                     /inference="similar to DNA sequence:INSDC:YOR330C"
                     /note="similar to Saccharomyces cerevisiae MIP1 (YOR330C);
                     ancestral locus Anc_7.64"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683457.1"
                     /db_xref="GeneID:11501568"
                     /db_xref="GOA:G9A052"
                     /db_xref="InterPro:IPR001098"
                     /db_xref="InterPro:IPR002297"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR016265"
                     /db_xref="InterPro:IPR019760"
                     /db_xref="UniProtKB/TrEMBL:G9A052"
                     /translation="MVGYVVPPPPLARRASRGPLLSGVVRIRRIYRYRCYSKALGNFK
                     EEPRINPVGIQYLSKSLHNQLFGHKKHSKKEDAMSHAEQKALVNLSKQFLKNFDLLGK
                     KTSISEPISFELPKLQGKSLDEHFQKLGHYASEPYKTMCTKKFRDIVPRPKKWLKKPG
                     WTRYEPGKDPQEVPSPLEDTLVFDVETMYMISSYPTLAVALSDKAWYLWCSPFICGSE
                     NFEHLIPMDSLDRTRVIIGHNVGYDRARVLDEYNFKPSKAFYLDTQSLHVASSGLCSR
                     QRPQFVKNKKLRQSIESDEQAATDLSIETLEEDPWLNLSAMNSLHDVAFLHCGIRMNK
                     EPREFFSTTDKNDIINNFQQLTNYCATDVEVTSKVFDKVFPLFLEKCPHPVSFGALRS
                     LSSCILPTRHNKWDTYLKSSEKVYQESKQDIEKKIIKIVDNTLKSIKSERFMETINND
                     PWLRQLDWTIKPLKLTKKGVPVKNQKLPDHPEWYRSLFPNKNAATPHITIKSRSIPIF
                     FRLSWEGSPVIWTNDNGWCFAVQKSLKDEYKAKNYILADEPAMEQYLQEISQKNPAAA
                     ENHVLFKIPHPNGPENNCTTLLSKPYIHFFEKGILTSESEFAHDALKINSCGSYWMSA
                     RERILSQFVVPQSSFPNAFKPLKDGKEKFEDHEDLGIILPTVIPMGTVTRRAVENTWL
                     TASNAKSNRIGSELKAQIEAPKGYCFVGADVDSEELWIASLVSDSVFNIHGGTAIGWM
                     CLEGSKNEGTDLHTKTAQILGCSRSEAKIFNYGRIYGAGVKFAAQLLKKFNPSLPDEE
                     AKSIANKLYESTKGKTKTSKIFKKFWYGGSESILFNKLESIAEQDEPKTPVLGCGITF
                     SLMKKNLGTSSFLPSRINWAIQSSGVDYLHLLSCSMHYLISKYNINARLSISIHDEIR
                     FLVAEEDKYRAAMALQVSNIWTRAIFCEQMGIDDLPQNCAFFSLVDIDHVMRKEVDMD
                     CVTPSNPVPIPHGETIDMRKLLEVSGSSLQSPNETVSVSHFPYEYREPVFAEYNKAYS
                     KEFWKYLLKMQVQNTKWKVNALESAYVQEVTNKEFEQKVRPKPYGVLDYLKELKKGKK
                     RKITVMDNRPFENAEDWIAYSKEVESGTAGTPKERRYAATSSKRNSVPSAITNESNLV
                     TPSRIAVSHDPINACLSADATAGRAGSTEGQDQLLVDQSAAPRKTRLAQPEMVDQPPK
                     TSSSWTNSKGKSKPRLLGGRKAYDFFHEQIDLSQLDTIEMERRLSKINIGAVVEDVIS
                     DAPPTLSKTTRAKRSRTKKLVKNKCNENETRQMFNDANGSSRHDVHGQY"
     gene            <659887..>660579
                     /gene="TDEL0H03880"
                     /locus_tag="TDEL_0H03880"
                     /db_xref="GeneID:11501569"
     mRNA            <659887..>660579
                     /gene="TDEL0H03880"
                     /locus_tag="TDEL_0H03880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683410.1"
                     /db_xref="GeneID:11501569"
     CDS             659887..660579
                     /gene="TDEL0H03880"
                     /locus_tag="TDEL_0H03880"
                     /inference="similar to DNA sequence:INSDC:YOR332W"
                     /note="similar to Saccharomyces cerevisiae VMA4 (YOR332W);
                     ancestral locus Anc_7.63"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683458.1"
                     /db_xref="GeneID:11501569"
                     /db_xref="GOA:G9A053"
                     /db_xref="InterPro:IPR002842"
                     /db_xref="UniProtKB/TrEMBL:G9A053"
                     /translation="MSSVITALTPNQVNDELNKMQAFIKKEAEEKAKEIQLKADQEYE
                     IEKTGIVRNETSNIDSNFEDKLKKASLKQQITKSTIANKMRLKVLSAREENLDKIFDN
                     AKEELQKLAKKEKQYKPVLQSLIVEAALRLLEDKVIVQVVERDQKLAKSLIDDVTKDY
                     KEIANKDVTIVISDKFLNKDTAGGVVITNENGKIRVDNTLEERLKLLSEEALPAIRLE
                     LFGPSKTRKFLD"
     gene            <660839..>662158
                     /gene="TDEL0H03890"
                     /locus_tag="TDEL_0H03890"
                     /db_xref="GeneID:11501570"
     mRNA            <660839..>662158
                     /gene="TDEL0H03890"
                     /locus_tag="TDEL_0H03890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683411.1"
                     /db_xref="GeneID:11501570"
     CDS             660839..662158
                     /gene="TDEL0H03890"
                     /locus_tag="TDEL_0H03890"
                     /inference="similar to DNA sequence:INSDC:YOR334W"
                     /note="similar to Saccharomyces cerevisiae MRS2 (YOR334W);
                     ancestral locus Anc_7.62"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683459.1"
                     /db_xref="GeneID:11501570"
                     /db_xref="GOA:G9A054"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="InterPro:IPR026573"
                     /db_xref="UniProtKB/TrEMBL:G9A054"
                     /translation="MNSSLLRCGPRFTSLRIAPFRRFMATKKTDLALPPIHHQLLSLK
                     PITPSDAYVSCTVFNDKGDVTAVSQKFPKWAFLRDHSLYPRDLRKIDTTAIDIIPSII
                     VKSSCIVFNMLHIKALIEKDRVYVFDTANPSAAAKLGVLMYDLEAKLSLNRGSMNTLT
                     QYYEHRALESMLINVMSSLETDFKMHNRLCGQILTDLENEVNRDKLRDLLIKSKDLTL
                     FYQKSLLIREVLDELLESDDDLAGMYLTVKKKEQDDDFADLEMLLETYYTQCDEYVQQ
                     AESLIQDIRSTEEIVNIILDANRNSLMLLELKVTIYTLGFTVATLLPAFYGMNLENFI
                     EESNFGFAGVVLVSVIAGIMVTGANFKALRSVTRLTMLNNHTGAQSAHHKRLASKYAD
                     EHIPSLWQRWGQWTNLVWNGRTGVAQRAQDKRDRDVVWKWLLDDEKK"
     gene            <662604..>664892
                     /gene="TDEL0H03900"
                     /locus_tag="TDEL_0H03900"
                     /db_xref="GeneID:11501571"
     mRNA            <662604..>664892
                     /gene="TDEL0H03900"
                     /locus_tag="TDEL_0H03900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683412.1"
                     /db_xref="GeneID:11501571"
     CDS             662604..664892
                     /gene="TDEL0H03900"
                     /locus_tag="TDEL_0H03900"
                     /inference="similar to DNA sequence:INSDC:YAL031C"
                     /note="similar to Saccharomyces cerevisiae GIP4 (YAL031C);
                     ancestral locus Anc_7.61"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683460.1"
                     /db_xref="GeneID:11501571"
                     /db_xref="GOA:G9A055"
                     /db_xref="InterPro:IPR026241"
                     /db_xref="UniProtKB/TrEMBL:G9A055"
                     /translation="MLAKAAASASVPAMKGSVYLDSHDVKIIQYKAAIYKLGETSRLL
                     NLLQKNLEKTADTEIIPLMNYILSLGEGPMFNVHPVLRKRYQLLCEYKVCKVTAVNPA
                     LSTSGIDLEVELPEVPEDLDDLKCKIYDENLQWKLLECFQKIVANSSSIYERKLRQVQ
                     MERNAKRPVDASGRPITFVINSVENLLRPWEMSLSLDLAVLINSREQDTTTRSLRKLQ
                     TQVLSKFTDCLQKKVLPLIRGYYSQIQKFAATRGISETALKELQSWECSIHRVYALLF
                     RTLCLFDVMVSLVRQIYLPNKSYLNESRTMLLSSNVYSYQEEIQKMEALCNLEEHETF
                     GELLAILRNFSKEGSIYHVQPSKVLDVYNNSLSKVIPFLTASVQSLKIFAGMWKYIES
                     NSEANKKLVNWEESQLIHMVEERLAVDKLAHVEQIKQKRSKNEAGLSLKGNSPTSRNA
                     VKRNLIERVNGSSESSISSSGPGSPGKMSPLRMSRTSSIEKGSATSSNLSSPQVSRRG
                     SIAESRVPALAKTSNDKKMALKPATLSKRVIGRPRSSSLQSSQETDQKPKPFIASSLK
                     SNSLQANASLNQRIIQNAVAHSLNGNGTGPSPSARVRNAEKPSPVRCQGPAKTQSQSP
                     IPVPELETLSLNSLDDQICQEHSIDGPTSVNSSTATPEVIVSIKKVRFTGVPPMDEDE
                     DKSPTRRGWYKKPSVLHYPPPPPQFALQKYKMRQEGMAFKTSLREGDSCKKTGFLTNK
                     EIPSPKESSTSKLASKIRDKLR"
     gene            <665045..>666391
                     /gene="TDEL0H03910"
                     /locus_tag="TDEL_0H03910"
                     /db_xref="GeneID:11501572"
     mRNA            <665045..>666391
                     /gene="TDEL0H03910"
                     /locus_tag="TDEL_0H03910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683413.1"
                     /db_xref="GeneID:11501572"
     CDS             665045..666391
                     /gene="TDEL0H03910"
                     /locus_tag="TDEL_0H03910"
                     /inference="similar to DNA sequence:INSDC:YAL032C"
                     /note="similar to Saccharomyces cerevisiae PRP45
                     (YAL032C); ancestral locus Anc_7.60"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683461.1"
                     /db_xref="GeneID:11501572"
                     /db_xref="GOA:G9A056"
                     /db_xref="InterPro:IPR004015"
                     /db_xref="InterPro:IPR017862"
                     /db_xref="UniProtKB/TrEMBL:G9A056"
                     /translation="MSFSSLLPPPRRTSSEKESQVSLVKRNRELVLKALTDDDNQDDN
                     VKKDNIFDSVVGSKLNFQDFVPIRQRNFNMELPKPSQQEIEETYNRTKKVFDKILATT
                     LQPETLAVKNSEQANAESYELKYETKQPSGAVKSRVLKIVEKAQDPLQPSTIKAGKVV
                     APPVEEEITPLFHKTEAADSAKTFSKEERAEWDIPAAISSWKNPKGHTLSLDKRLAMD
                     ARYNKQNVGPHEVSEGFANLSSALEVADSEARQQMKVRAEAKRRLADEESREKEEKMR
                     LLAQKAREERENERSANARFGRRIADHEDEHDPAKGRRIARKAREVELEKDMRKSKMS
                     TADRLRELAYSQGRDISERVILSAAKATDSSEGLYDSRLFSKGANANARRHEDQLYDQ
                     PLFDQQARDSSNRANLDQIDSMIGEEKGEKRGHIQFTEASKDSTRDEEKEYGLQDK"
     gene            complement(<666420..>666929)
                     /gene="TDEL0H03920"
                     /locus_tag="TDEL_0H03920"
                     /db_xref="GeneID:11501573"
     mRNA            complement(<666420..>666929)
                     /gene="TDEL0H03920"
                     /locus_tag="TDEL_0H03920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683414.1"
                     /db_xref="GeneID:11501573"
     CDS             complement(666420..666929)
                     /gene="TDEL0H03920"
                     /locus_tag="TDEL_0H03920"
                     /inference="similar to DNA sequence:INSDC:YAL033W"
                     /note="similar to Saccharomyces cerevisiae POP5 (YAL033W);
                     ancestral locus Anc_7.59"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683462.1"
                     /db_xref="GeneID:11501573"
                     /db_xref="GOA:G9A057"
                     /db_xref="InterPro:IPR002759"
                     /db_xref="UniProtKB/TrEMBL:G9A057"
                     /translation="MVRLKSRYILFEVLYPVNANYSEEDVPFCSRREILLRHHQVSPV
                     DVSIKVLIQEIRRSLQHNFGDYGCGKATSLLQIKYFSNMTSTGILRCHREDSDLVITA
                     LTLISKIGTIDNVIVNPVKVSGTIKKIEDYAGRRSEKLLSVIKRDDKRLIDDFTTVTE
                     DNDEDTATA"
     gene            complement(<667096..>669966)
                     /gene="TDEL0H03930"
                     /locus_tag="TDEL_0H03930"
                     /db_xref="GeneID:11501574"
     mRNA            complement(<667096..>669966)
                     /gene="TDEL0H03930"
                     /locus_tag="TDEL_0H03930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683415.1"
                     /db_xref="GeneID:11501574"
     CDS             complement(667096..669966)
                     /gene="TDEL0H03930"
                     /locus_tag="TDEL_0H03930"
                     /inference="similar to DNA sequence:INSDC:YOR335C"
                     /note="similar to Saccharomyces cerevisiae ALA1 (YOR335C);
                     ancestral locus Anc_7.58"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683463.1"
                     /db_xref="GeneID:11501574"
                     /db_xref="GOA:G9A058"
                     /db_xref="InterPro:IPR002318"
                     /db_xref="InterPro:IPR003156"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018162"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="InterPro:IPR018164"
                     /db_xref="InterPro:IPR018165"
                     /db_xref="InterPro:IPR023033"
                     /db_xref="UniProtKB/TrEMBL:G9A058"
                     /translation="MTIGDKQRWTAKNVRNTFLDYFKSKEHRFVPSSPVIPYDDPTLL
                     FANAGMNQYKPIFLGTVDPASDFYTMKRAYNSQKCIRAGGKHNDLEDVGRDSYHHTFF
                     EMLGNWSFGDYFKKEAINYSWELLTKVYGIPADRLYVTYFEGDSKQGLEPDVEALELW
                     KSVGVPEDHILPGNAKDNFWEMGDQGPCGPCSEIHYDRIGGRNAASLVNQDDPDVLEV
                     WNLVFIQFNREQDGSLKSLPAKHIDTGMGFERLVSVLQDCRSNYDTDVFMPLFASIQE
                     LTGARPYAGKFGTEDADGVDTAYRVLADHVRTLTFALADGGVPNNEGRGYVLRRILRR
                     GARYARKYMNYPIGNFFSRLAPTLIDQVQEMFPEVAKDPSFLFEILDEEEASFAKTLD
                     RGERLFEKYADAAAQSGNKTLDGLQVWRLYDTYGFPVDLTELMAEEKGLTIDGPGFEK
                     AKQESYEASKRGGKKDNSSLLKLNVHELSQLNEEHVPKTDDSAKYGTQDVDATILRLF
                     DGSQFVNEITEPGKKYGIILDKTCFYAEQGGQEYDMGKIVIDGSAEFDVDNVQLYNGF
                     VFHTGTLLEGKLSINDKIIASYDELRRFPIRNNHTGTHILNYGLLETLGTEVDQKGSL
                     VAPEKLRFDFSHKKALTVDELRKVENISNEQIKQNLSVYYKDVPLDLARSIYNVRAVF
                     GETYPDPVRVVSVGRPVDELLENPASEEWGKYSIEFCGGTHVAKTSDIREFVILEESG
                     IAKGIRRIVAVTGSEAHEAQRIAKQYESELLAAEKLPFSPLKEKKLKELGVQLGQLSI
                     SVIRKQELREHFNKIDKAVKDEVKSRSKKEAKQTLDEVKEYFAANESSPYFVKFINIP
                     TNAKAITEAINYMKSSAKDKSIYLFTGNDPEGKVAHGCYISDDALSKGIDGPALGKIV
                     SGAVGGKAGGKGNVFQGMGDKPAGVENATTELESLFKEKLVI"
     gene            <670317..>674288
                     /gene="TDEL0H03940"
                     /locus_tag="TDEL_0H03940"
                     /db_xref="GeneID:11501575"
     mRNA            <670317..>674288
                     /gene="TDEL0H03940"
                     /locus_tag="TDEL_0H03940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683416.1"
                     /db_xref="GeneID:11501575"
     CDS             670317..674288
                     /gene="TDEL0H03940"
                     /locus_tag="TDEL_0H03940"
                     /inference="similar to DNA sequence:INSDC:YOR336W"
                     /note="similar to Saccharomyces cerevisiae KRE5 (YOR336W);
                     ancestral locus Anc_7.57"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683464.1"
                     /db_xref="GeneID:11501575"
                     /db_xref="GOA:G9A059"
                     /db_xref="InterPro:IPR009448"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G9A059"
                     /translation="MFLCSFIANVIFWLRLTSALDLNGAGIGVKEQAKVWSILGFLIQ
                     GEQRSILVDLYPFVTGLEDYESDIECEDCDLPTIVSGILSTEYGMKDIAALLPIYSNL
                     YPMGMLKDDHDTSNESRFVLNGKQYVKSDDVFYLKSKELQKQAEFSDLEVTQPNEVII
                     GNNKEAPIVILYGCPDEAGEFEEFNRNLYNEATTSGKLRYIWRSSCPLERSHITGVPV
                     SFTLRNQSSPAALPIESLDVPEEFTNRLPSFETPTAEELSGIDLKVAKLVADHYFKYR
                     DFHSTLSYAKGIINNLPLLLQQLAKLDTNTSEISKSNERLSDLGISYDMLGIYVNGQN
                     MRLSEVDRYNLLSAVVSEYLRLSHLGAALQTADKNCTLATAKQLLQEFSRLSLPNLEE
                     LQPIKVDLHRIPGFSESVIYFNDIEQDGQYDELGTEIQKFFGKSKFGEIPEYRQNWNE
                     VIFVIDFGRLDDQEAKYALDGLNRALKAVAQGYPQRVGLLPLNTGSAEGIINDIYRLK
                     DKDLNELMEFLETIPTPDFSSKSYDKAPNYSRILNELQIHETSIIVNGEIYPFKKNSW
                     HYLIAKVMKKDKAFLKKELLKFGSKKELTDIDVRGLLHLRSSNTRHGKYAPDYFVDSS
                     YTSLDNSVLQLFGGRVLEYTKGKDYLALHTVTLFDDFSCSQALERYKHILETSFVGVR
                     VRIIHRGSLKDHTWNKLKIILSNELDMAQIDSLIKTSKTSYSVPEVSKDDISRWLVDF
                     SDESLSDGAFLVVNGRFIILDNEEVPSKNQFEAIIKREAKRTLDTLKALEIVCPSTLE
                     GEISPDFTEMVSATLTKLFYHGAQLYNNGIDYTPEGFLPRINVNLEFNNFTVFESHSD
                     EKPVDVSLFLDPTEERSQTLLSLVTFLEPIPFVNLRIVLLPTEDLKITPVNRIYLDDS
                     SDVVIEEESKKEYQVELDVPSDFYVTNTSQLDGVIVEVHAFKKGELISESKIDGVGGV
                     CLELVDPQNNVVANCITMTTFGYGQLRAKSLGTGFSIRSCDPRFRVTSFASNGRSDYV
                     RSTTFPLLSLNKAKVHVEVEEISGAKMVVDSDSDEMHIFTILKDNGEDEEKTQKMIIS
                     VLLNAKNRKVKFWILDQAFLTKSFKEFCQRITQSTDFEGSVEFIKYKWPLWLRPQRFS
                     DRRMDLYKVLFVDVIFPQNVSQILYMEPDSSPIDPTELYDEEVSLPFSLLEASGPGYW
                     DSGYWAKTLQERRAKFHTTDPAFLINLQNLRKLEMGDKLRIHYQRLSADRNSLINAAQ
                     DLLNDLQVEVPINTLSPLTKSRLKVDDEEVALWLDGGSFEEELNEELAAEELRGDLIH
                     DEL"
     gene            <674423..>676411
                     /gene="TDEL0H03950"
                     /locus_tag="TDEL_0H03950"
                     /db_xref="GeneID:11501576"
     mRNA            <674423..>676411
                     /gene="TDEL0H03950"
                     /locus_tag="TDEL_0H03950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683417.1"
                     /db_xref="GeneID:11501576"
     CDS             674423..676411
                     /gene="TDEL0H03950"
                     /locus_tag="TDEL_0H03950"
                     /inference="similar to DNA sequence:INSDC:YOR337W"
                     /note="similar to Saccharomyces cerevisiae TEA1 (YOR337W);
                     ancestral locus Anc_7.56"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683465.1"
                     /db_xref="GeneID:11501576"
                     /db_xref="GOA:G9A060"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G9A060"
                     /translation="MEIGADNAADTAIKRPFENEDLPEAGKAKIENQGRKRLACSNCR
                     RRRKKCDLTYPCGNCQRLSLECNVNEEDLRKKRYAATYVKSLETHIAYLETSLKNLVD
                     KVYPNDVQVLNNMMIGDVDSGFPNNLPPTIENPRLSVDKKRTFIKGSYYPEGPVSEKT
                     QVLRRSTSALSVNSLVSSSSSTPSAYPETMKKERIKDLHTAVIVRPNRNPDPNLINND
                     PKVLKSLSKFYTWLYPGHYFFLHRESFLYGFFNHAENHYEDSNYCSTELIYAMCAVGS
                     RLSPELHDMSQIYYEKSKTKLLQLVFDEDSVASITTVQALFCLAFYELGKGDNKIAWY
                     LSGLAIRVGYEMGFQLDPQVWITTDSDDAKQKLTKSELEIRSRIYWGCYVADHLICVL
                     LGRTSTLSVSNSTIPQSDELPELEGTEGFKYRSDHELQVSVPLKNLIVLSRVVQIYTA
                     KIFIEAHLTSQKLVFLARFNLKVQSWRQSLPPFLAWSTQSLKDMMLATDPTISYFWYY
                     YYIVRLIFNRPFLADSSDSRAVVMDALDDLTTLFTNFRARFQNFYKATLQMLYACLLA
                     TNCLEHLLHATAPDTPQHREVTSRLRFFSTILHKDMAVTFDLPSTLARSRDHQPLQLD
                     QLDQACNSAYTHDFTLSNEIDELIRELFGSNDPQLPTT"
     gene            <676712..>677575
                     /gene="TDEL0H03960"
                     /locus_tag="TDEL_0H03960"
                     /db_xref="GeneID:11501577"
     mRNA            <676712..>677575
                     /gene="TDEL0H03960"
                     /locus_tag="TDEL_0H03960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683418.1"
                     /db_xref="GeneID:11501577"
     CDS             676712..677575
                     /gene="TDEL0H03960"
                     /locus_tag="TDEL_0H03960"
                     /inference="similar to DNA sequence:INSDC:YAL034C,YOR338W"
                     /note="similar to Saccharomyces cerevisiae FUN19 (YAL034C)
                     and YOR338W; ancestral locus Anc_7.55"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683466.1"
                     /db_xref="GeneID:11501577"
                     /db_xref="GOA:G9A061"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:G9A061"
                     /translation="MEFYSPQPEHAQLHGPVELKEGLLVRDNGIDALLEELLIPSPPL
                     SPVCSDREEEEEQKDENSIQVRPSWSPGLAVRREKRSLQGFLAEYRAFKRMDCKSVRR
                     PRVLADAERIYRTRRRLQEPRSESDDESAPMRPSTPSRRRRVGTSCVVSPLASAKAVH
                     QTPHYVPSMSWEKLPDYSPPLATLSSEKCLKVEWKGSPMDLSNDPLRDLLHPAELNLA
                     QTLRLPCDLYLDSKRRLFLEKMHRLKQGLAFRRTDAQKACRIDVNKASRLYAAFEKVG
                     WLKDSNFTIFL"
     gene            complement(<677619..>678089)
                     /gene="TDEL0H03970"
                     /locus_tag="TDEL_0H03970"
                     /db_xref="GeneID:11501578"
     mRNA            complement(<677619..>678089)
                     /gene="TDEL0H03970"
                     /locus_tag="TDEL_0H03970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683419.1"
                     /db_xref="GeneID:11501578"
     CDS             complement(677619..678089)
                     /gene="TDEL0H03970"
                     /locus_tag="TDEL_0H03970"
                     /inference="similar to DNA sequence:INSDC:YOR339C"
                     /note="similar to Saccharomyces cerevisiae UBC11
                     (YOR339C); ancestral locus Anc_7.54"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683467.1"
                     /db_xref="GeneID:11501578"
                     /db_xref="GOA:G9A062"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:G9A062"
                     /translation="MTTAAEGHSVVKRLQNELVQLMMSPTPGLSAFPASEDDLTQWFG
                     VIVGPEGTPYENLKFRLSLKFTDQYPYQPPKVTFVSPMWHPNVDMSGNICLDILKDQW
                     SAVYNVQTILLSLQALLEEPNNGSPLNAIAAELWDTDMDEYKKRLFARYEEFEE"
     gene            complement(<678168..>678977)
                     /gene="TDEL0H03980"
                     /locus_tag="TDEL_0H03980"
                     /db_xref="GeneID:11501579"
     mRNA            complement(<678168..>678977)
                     /gene="TDEL0H03980"
                     /locus_tag="TDEL_0H03980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683420.1"
                     /db_xref="GeneID:11501579"
     CDS             complement(678168..678977)
                     /gene="TDEL0H03980"
                     /locus_tag="TDEL_0H03980"
                     /inference="similar to DNA sequence:INSDC:YAL034W-A"
                     /note="similar to Saccharomyces cerevisiae MTW1
                     (YAL034W-A); ancestral locus Anc_7.53"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683468.1"
                     /db_xref="GeneID:11501579"
                     /db_xref="GOA:G9A063"
                     /db_xref="InterPro:IPR008685"
                     /db_xref="UniProtKB/TrEMBL:G9A063"
                     /translation="MSAPTMNSTSVLTEHLQYPAISLVDDIINAVNEIMYRCTAAMEK
                     YLLERSVVDGEDYTEEVRVGIAKLETLLESSVDKNFDKLELYVLRNVLRIPQELLDAN
                     VFRLAHQRDFEVIDDSQWEASGRDLQEKIRQIESAFNLHQQLMKQIRATRALHSDVLK
                     FKKSLVKVLECRDSSLRPVFDSLKPVDDSLRLITTQLRQLYVESEEYGSQERIDSITS
                     RAQSNRTTLKSRSHYIDTRARAILNNSTTTYESRPSRIEIQDPDLSQLDIT"
     gene            complement(<679069..>679989)
                     /gene="TDEL0H03990"
                     /locus_tag="TDEL_0H03990"
                     /db_xref="GeneID:11501580"
     mRNA            complement(<679069..>679989)
                     /gene="TDEL0H03990"
                     /locus_tag="TDEL_0H03990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683421.1"
                     /db_xref="GeneID:11501580"
     CDS             complement(679069..679989)
                     /gene="TDEL0H03990"
                     /locus_tag="TDEL_0H03990"
                     /inference="similar to DNA sequence:INSDC:YOR340C"
                     /note="similar to Saccharomyces cerevisiae RPA43
                     (YOR340C); ancestral locus Anc_7.52"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683469.1"
                     /db_xref="GeneID:11501580"
                     /db_xref="GOA:G9A064"
                     /db_xref="InterPro:IPR005576"
                     /db_xref="UniProtKB/TrEMBL:G9A064"
                     /translation="MAEVRKRSVEELQAAKFIKKHKNVVKNPVVDGISNCIIRVPVSL
                     YVSLAPKYTENPLQGVMRQHLNPMVMKYNSKVSGVVLGYQDLEIVDANPLSDDEDNEG
                     PPGKLVKLSADTPFGFTWCRVVLYVWQPQIGDVIEGWIFIQSASHIGLLVHDAFNASI
                     KKNHIPADWTFVHNEEEDAESQSRDENDQDDEKSEFTRRSMDYWVDANGERIDGKLKF
                     TIRNVYTTGRVISVEGTLLAEGNQDKERSQAENLPVVSNKKIVFDDEVSSENTASHKD
                     LELPEVNEGNGEEIIYEENSDSDEESSDSE"
     gene            <680730..>685727
                     /gene="TDEL0H04000"
                     /locus_tag="TDEL_0H04000"
                     /db_xref="GeneID:11501581"
     mRNA            <680730..>685727
                     /gene="TDEL0H04000"
                     /locus_tag="TDEL_0H04000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683422.1"
                     /db_xref="GeneID:11501581"
     CDS             680730..685727
                     /gene="TDEL0H04000"
                     /locus_tag="TDEL_0H04000"
                     /inference="similar to DNA sequence:INSDC:YOR341W"
                     /note="similar to Saccharomyces cerevisiae RPA190
                     (YOR341W); ancestral locus Anc_7.51"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683470.1"
                     /db_xref="GeneID:11501581"
                     /db_xref="GOA:G9A065"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="InterPro:IPR015699"
                     /db_xref="UniProtKB/TrEMBL:G9A065"
                     /translation="MDISKPVGSEITSLDFNILTPQDIRNLSAKQITNPTVLDNLGHP
                     ISGGLYDLSLGAFLRNLCSTCGLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSCC
                     LFCHHFRLKKVEVHRYACKLKLLQYGLIDESYRLDQISVAGFEYLEDDEDDEAAEDNA
                     MESSNTKKPSKNISAALLKELIQKRTEFVNLEIAKALSEGRTSERGTFTATTNDERKK
                     LIHDFHRRALSRAKCDNCGMFSPKFRKDGFTKIFETALTDKQLTNNRVKGLIRQDMIK
                     KQQQSKKLGGSDEGDAVDEDFNADRNSSARPKSGSTYILSTEVRNILRALFKKEQHVL
                     QYVFHSRPNVSRKVVKADNFFMEVVLVPPTRFRLPSKMGEEVHENTQNQLLSKILTTS
                     LLIRDLNDEMSTIQKDKVSVDDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQGSASSKI
                     PVPGVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPE
                     PVTAYNIAELRQAVINGPDKWPGASQIQNEDGTLVSLVGMTLEQRKALANQLMTPSSN
                     VSTHPLNKKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYN
                     ADFDGDEMNMHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSK
                     DSFFTREEYQQYIYGCIRPEHGHASRGKIVTMPPAVLKPVPLWTGKQIISTVLLNVTP
                     ADMPGINLESNNKIKNEYWGKGSTENDVIFKNGELVCGILDKSQYGASKYGIVHSLHE
                     VYGPEVAAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKSRSEILKTSIDIGRQA
                     AAEVTNLDKDTPSDDVELLKRLEEILRDENKSGILDAVTSSKVNTVTSKVVSTCVPDG
                     TMKKFPYNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFE
                     TDSMAGGYIKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVH
                     ISYDNSVRDGDGSLIQFLYGGDAVDVTKESHMTQFDFCRENYDALLKKYNPVALAEHL
                     DVETALQYSKKVSKNRKKNSKTAHYEQKVKYDPVLAKYNPAKYLGSVSEKFHDKLESY
                     LEDKAKEFKSRESVSAKRFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTF
                     HFAGHGAANVTLGIPRMREIIMTASSAIKTPQMTLPIWDDVSDEQADLFCKSISKVVL
                     SEVVDKVTVIETTGSSDGNAPSRSYAINMKFFSKEEYNEQYDVSAEELQNVISNKFLT
                     QLETAILKEVKKQKKTSLPEVGVAVPTSHVALNEAAEGSVDKATQDNDEEEARKKGKQ
                     AVSYEDPDDEELETMRQAEKSSDEEELDSDKETKDSDAESDSDVEMDDAIERTAVEIT
                     KNLNKSQRDRQHAVTSKQRFVTKYNFDDENGKWCEFRLELAADTEKLLMVNIVEEICK
                     KSVIREVPHIDRCVHSEPVNNKRMLVTEGVNFQAMWDQEAFIDVDAITSNDVASVLRT
                     YGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSL
                     MKMSYETTCQFLTKAVLDNEREELESPSARIVLGKLSNVGTGSFDLLTKIPNSGV"
     gene            complement(<685947..>688913)
                     /gene="TDEL0H04010"
                     /locus_tag="TDEL_0H04010"
                     /db_xref="GeneID:11501582"
     mRNA            complement(<685947..>688913)
                     /gene="TDEL0H04010"
                     /locus_tag="TDEL_0H04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683423.1"
                     /db_xref="GeneID:11501582"
     CDS             complement(685947..688913)
                     /gene="TDEL0H04010"
                     /locus_tag="TDEL_0H04010"
                     /inference="similar to DNA sequence:INSDC:YAL035W"
                     /note="similar to Saccharomyces cerevisiae FUN12
                     (YAL035W); ancestral locus Anc_7.50"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683471.1"
                     /db_xref="GeneID:11501582"
                     /db_xref="GOA:G9A066"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR023115"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G9A066"
                     /translation="MAKKGKKNQQNYWDEDFEDDAPQGETLGEESATPTSTEGTPVPE
                     EAGAEAVEADFMSTLKKSKKRSDKKADEDKAEGSNGKPVLKSKKEKEKEKKEAEKKKK
                     KEEAAKKKAQQQAQKEKNKELNKQNAEKLMAEKEAKKGGSQEPAEVKKPATKKPAKKV
                     PAGLAALKRQLELKKQAEEEERLAREEEERLEREEEEKAKRAEEELEESRKARKEKEK
                     AKRERLKAEGKLLSKKQKEEKKLLERRRAALLAAGNVKVAALSKKADDEEVEAPKPKK
                     IVYGKKKRKNVKEDESKETTPSTAQIEQDEEANVADEELLIDDWEKLDLGDDEEAEEA
                     AASEAEEQQEEDEEEEGEHDEQVEEEISTPAVSRPVVTEAQAASTSSAGANQKDLRSP
                     ICCILGHVDTGKTKLLDKIRQTNVQGGEAGGITQQIGATYFPIKSIKEKTKTMSKYEK
                     QTFEVPGLLIIDTPGHESFSNLRSRGSSLCNIAILVIDIMHGLEQQTLESIRLLRDRK
                     APFVVALNKIDRLYDWKTIPNNSFRDSFEQQSRAVKDEFETRLQNIKLALAEQGLNSE
                     LYFQNKNISKYVSIIPTSAVTGEGVPDLLWLLLELTQKRMSKQLMYLSHVEATILEVK
                     VVEGFGTTIDVILSNGYLREGDRIVLCGMNGPIVTNIRALLTPQPLRELRLKSEYVHH
                     KEVKAALGVKVAANDLEKAVSGSRLLVVGPDDDEEEMMDDVMDDLTGLLDSVDTSGRG
                     VVVQASTLGSLEALLDFLKDMKIPVMSIGLGPVYKRDVMKAGAMLEKAPEYAVMLCFD
                     VKVDKEAEQYAEQEHIKIFNADIIYHLFDAFTAYQEKLLEERRKNFLDFAIFPTVLQT
                     LQIINKRGPMIIGVDVIDGVLRVGTPICAVRTDPTTKEKNILLLGKVTSLEINHQPVT
                     EVKKGQTAAGVAMRLDDPSGQQPIWGRHVDETDTLYSMISRRSIDTLKDKAFRDQVSR
                     ADWLLLKKMKPVFGIE"
     gene            <689286..>690392
                     /gene="TDEL0H04020"
                     /locus_tag="TDEL_0H04020"
                     /db_xref="GeneID:11501583"
     mRNA            <689286..>690392
                     /gene="TDEL0H04020"
                     /locus_tag="TDEL_0H04020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683424.1"
                     /db_xref="GeneID:11501583"
     CDS             689286..690392
                     /gene="TDEL0H04020"
                     /locus_tag="TDEL_0H04020"
                     /inference="similar to DNA sequence:INSDC:YAL036C"
                     /note="similar to Saccharomyces cerevisiae RBG1 (YAL036C);
                     ancestral locus Anc_7.49"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683472.1"
                     /db_xref="GeneID:11501583"
                     /db_xref="GOA:G9A067"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR006074"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G9A067"
                     /translation="MSTTVEKIKAIEDEMARTQKNKATSFHLGQLKAKLAKLRREILT
                     SSQSSGGGAGVGFDVARTGVASVGFVGFPSVGKSTLLSKLTGTESEVAEYEFTTLVTV
                     PGVIRYKGAKIQMLDLPGIIDGAKDGRGRGKQVIAVARTCNLLFIVLDVNKPLHHKQI
                     IEKELEGVGIRLNKTPPDILIKKKEKGGISITNTVPLTHLDNDGIRAVMSEYRINSAE
                     IAFRCDATVDDLIDVLEAPSRRYMPAIYVLNKIDSLSIEELELLYRIPNAVPISSGKE
                     WNLDDLLQVMWDRLNLVRVYTKPKGQMPDFTDPVVLRSDRCSVKDFCNQIHKSLVDDF
                     RNALVYGSSVKHQPQYVGLSHVLEDEDVVTILKK"
     gene            complement(<690438..>691334)
                     /gene="TDEL0H04030"
                     /locus_tag="TDEL_0H04030"
                     /db_xref="GeneID:11501584"
     mRNA            complement(<690438..>691334)
                     /gene="TDEL0H04030"
                     /locus_tag="TDEL_0H04030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683425.1"
                     /db_xref="GeneID:11501584"
     CDS             complement(690438..691334)
                     /gene="TDEL0H04030"
                     /locus_tag="TDEL_0H04030"
                     /inference="similar to DNA sequence:INSDC:YAL037W,YOR342C"
                     /note="similar to Saccharomyces cerevisiae YAL037W and
                     YOR342C; ancestral locus Anc_7.48"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683473.1"
                     /db_xref="GeneID:11501584"
                     /db_xref="UniProtKB/TrEMBL:G9A068"
                     /translation="MLFDNAYYLSDPLEQLKPQKLDSNVFFGPLNTLTQFDFIKDNNV
                     KLFICIGLSTQRLANILNDIPALSRAAEEFLMVNFDPTFDQATLISANHVTQQYHYHN
                     SSLLRLLIDHFIKDSFSAAQSDSYRCLTPTPETPDVNQLLYGEPERYYNGGNVCVDST
                     SSKYEVLNDLITIFRYVNPSANVLVFSQNGNDQDLLSFLISVIIKKNSMVNIVEAYQY
                     IKSIRPTVNDFSEEALVGHSALLDFHELVRVKDQAKQKSFMAPNSPTPYSRRRRNDSI
                     SQRETPEPAEEQNFGSKRSRFD"
     gene            691632..691704
                     /gene="TDEL0Htrna1M"
                     /locus_tag="TDEL_0Htrna1M"
                     /db_xref="GeneID:11501585"
     tRNA            691632..691704
                     /gene="TDEL0Htrna1M"
                     /locus_tag="TDEL_0Htrna1M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:11501585"
     gene            complement(<691879..>692700)
                     /gene="TDEL0H04040"
                     /locus_tag="TDEL_0H04040"
                     /db_xref="GeneID:11501715"
     mRNA            complement(<691879..>692700)
                     /gene="TDEL0H04040"
                     /locus_tag="TDEL_0H04040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683426.1"
                     /db_xref="GeneID:11501715"
     CDS             complement(691879..692700)
                     /gene="TDEL0H04040"
                     /locus_tag="TDEL_0H04040"
                     /inference="similar to DNA sequence:INSDC:YOR344C"
                     /note="similar to Saccharomyces cerevisiae TYE7 (YOR344C);
                     ancestral locus Anc_7.47"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683474.1"
                     /db_xref="GeneID:11501715"
                     /db_xref="GOA:G9A069"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:G9A069"
                     /translation="MNSMMASYTAAPHTLMASNGTSNKGNDQFDDWVLSKQGVRQGSR
                     SESVTTMDSSSWSWFEPLENIISSSSTSSVGSPMDDQRFAPEKVTVADEIFDNSGQFF
                     NDPSSYANSPELLPVVKREESDESNDTTGAGLLEDLATLKDPAAANGKEKRAPRKRLT
                     SHQKQAHNKIEKRYRININTKIAKLQQIIPWVASEQTAFEVGDSMKKEEDGTQQKDGT
                     IAETPISAVAATKLNKSMILEKAVDYILYLQNSERLYEMEVQRLKNEVDTLKKNR"
     gene            <693662..>696229
                     /gene="TDEL0H04050"
                     /locus_tag="TDEL_0H04050"
                     /db_xref="GeneID:11501586"
     mRNA            <693662..>696229
                     /gene="TDEL0H04050"
                     /locus_tag="TDEL_0H04050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683427.1"
                     /db_xref="GeneID:11501586"
     CDS             693662..696229
                     /gene="TDEL0H04050"
                     /locus_tag="TDEL_0H04050"
                     /inference="similar to DNA sequence:INSDC:YOR346W"
                     /note="similar to Saccharomyces cerevisiae REV1 (YOR346W);
                     ancestral locus Anc_7.46"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683475.1"
                     /db_xref="GeneID:11501586"
                     /db_xref="GOA:G9A070"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR012112"
                     /db_xref="InterPro:IPR017961"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="UniProtKB/TrEMBL:G9A070"
                     /translation="MDNEELLKILESTQEEENDRLKVGPEEYDPGETLAQLSDGVLIE
                     YIANLSQDPRKDFTREEYFRDKEIKQREHDEATRQERGEIHPPIFAGCTIYINGYTKP
                     GRLQLHEMFVSYGGNFLHYLSGKRKITHIVATNLPLKKRLEFRNYKVVRPEWITESID
                     QEKLLPWQNYALSWDQEQKNLQFKAASPPPSDTIDCKDPNFIQNFFENSRLHHLSNWK
                     ADLRSKFLNDTFTKPSPGDSLSIFHIDFDCFFATVAALSCNTCDIDRDPIVVCHGTKS
                     SDIASCNYVARKYGIRNGMWVSRAKTLLPPDVELVCLPYNFEQIENKSKIFYEVLKDY
                     EIKFDLILPISIDEAVCVIINNHSIEPIDCDQICRDVRSQIWEKTKGCTVSIGCSDFL
                     VLSRLNLKLAKPNGYRVLTQDQLTKDEQFWDDFLAKFSIDDLPGVGYSIVSKLRADNP
                     ELDNLLQLKQYYHNSLPLLQKCVGKKTGNKIFSFLQGKDDQESSRMIYQPEEFFARKS
                     LSIEINWGIRFDTVQEIDDFIDSCAVYLVRKLIDLNKKTSQITMKLMRRSAHAPIEPA
                     KYLGMGECDALSHTSRLGIPTSEVGVIATELKCTFRLLACPPKELRGVGVQFNKLVEV
                     SSSVGGQQDKLRLPFQKTLNFELFNNLPNDVKADFSKELKRRDIIITGGPSVRSSRPT
                     TYQERFMEELPTQIRNEVKHDMRITEKIKKTKLSELREQTRKKKESIKNVRAHLLGRE
                     SLFEPIKFQKETRFKDICKIVLDWVDATLIDGPHEKDLELFETYLDRLSDANRVPLIL
                     RISKLISTRLNLKSNYHGEDSGFQEWERFLLTVIIPKLNKNKHTFQTVRKLDIDFDL"
     gene            complement(<696367..>697872)
                     /gene="TDEL0H04060"
                     /locus_tag="TDEL_0H04060"
                     /db_xref="GeneID:11501587"
     mRNA            complement(<696367..>697872)
                     /gene="TDEL0H04060"
                     /locus_tag="TDEL_0H04060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683428.1"
                     /db_xref="GeneID:11501587"
     CDS             complement(696367..697872)
                     /gene="TDEL0H04060"
                     /locus_tag="TDEL_0H04060"
                     /inference="similar to DNA sequence:INSDC:YAL038W,YOR347C"
                     /note="similar to Saccharomyces cerevisiae CDC19 (YAL038W)
                     and PYK2 (YOR347C); ancestral locus Anc_7.45"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683476.1"
                     /db_xref="GeneID:11501587"
                     /db_xref="GOA:G9A071"
                     /db_xref="InterPro:IPR001697"
                     /db_xref="InterPro:IPR011037"
                     /db_xref="InterPro:IPR015793"
                     /db_xref="InterPro:IPR015794"
                     /db_xref="InterPro:IPR015795"
                     /db_xref="InterPro:IPR015806"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018209"
                     /db_xref="UniProtKB/TrEMBL:G9A071"
                     /translation="MSSRLAWLTDLQTVPGTSARRTSIIGTIGPKTNNPETLVALRKA
                     GLNIVRMNFSHGSYEYHQSVIDNARKSEELYPGRPLAIALDTKGPEIRTGTTTNEVDY
                     PIPPNHEMIFTTDDKYAKACDDKTMYVDYKNITKVIEAGKIIYVDDGVLSFEVLEVID
                     NQTLKVKSMNAGKICSHKGVNLPGTDVDLPALSEKDKSDLRFGVKNGVHMVFASFIRT
                     AQDVLTIREVLGEDGADIKIVVKIENQQGVNNFDEILKVTDAVMVARGDLGIEIPAPE
                     VLAVQKKLIAKSNLAGKPVICATQMLESMTFNPRPTRAEVSDVGNAILDGADCVMLSG
                     ETAKGNYPINAVTTMADTALIAEQAIAYLPNYDDMRNLTPKPTSTSETIAAASVAAVF
                     EQNAKAIIVLSTSGNTPRLVSKYRPNCPIILVSRNPRTARSSHLNRGVFPFVYSKEQA
                     ADWSDDVEARLNFGIAQAKSFGFLKEGDTIVTIQGLKPGVGHSNTLRVTVV"
     gene            complement(<698717..>700450)
                     /gene="TDEL0H04070"
                     /locus_tag="TDEL_0H04070"
                     /db_xref="GeneID:11501588"
     mRNA            complement(<698717..>700450)
                     /gene="TDEL0H04070"
                     /locus_tag="TDEL_0H04070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683429.1"
                     /db_xref="GeneID:11501588"
     CDS             complement(698717..700450)
                     /gene="TDEL0H04070"
                     /locus_tag="TDEL_0H04070"
                     /inference="similar to DNA sequence:INSDC:YOR348C"
                     /note="similar to Saccharomyces cerevisiae PUT4 (YOR348C);
                     ancestral locus Anc_7.44"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683477.1"
                     /db_xref="GeneID:11501588"
                     /db_xref="GOA:G9A072"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:G9A072"
                     /translation="MFSRREKEKETTTNGNLFDQKTGQVLEIDLESLTPEGSSTNRGI
                     NGNKDAKLEGKLQQGLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIIS
                     TVLYPIMNAFGEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAA
                     ECTAASGVVKYWTDAVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGL
                     IILSFILFWGGGPNHDRLGFRYWKNPGGFAHHITGGNLGNFLDVYSGIIKGAFAFILG
                     PELIALASSECKDQRRNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSALASG
                     KPGAGSSPFVIGIQNAGIKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQAP
                     KIFGKINRFGVPWVAVTFSALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLV
                     AYLRFRKAIKYNGLENRLPYAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDF
                     IAAYITLPLFVVLWIGHKIYTRDFKKWWYPVEEIDVVTGLTEIEERTRILDEERVEPK
                     GAFPKFMDALL"
     gene            <701048..>704167
                     /gene="TDEL0H04080"
                     /locus_tag="TDEL_0H04080"
                     /db_xref="GeneID:11501589"
     mRNA            <701048..>704167
                     /gene="TDEL0H04080"
                     /locus_tag="TDEL_0H04080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683430.1"
                     /db_xref="GeneID:11501589"
     CDS             701048..704167
                     /gene="TDEL0H04080"
                     /locus_tag="TDEL_0H04080"
                     /inference="similar to DNA sequence:INSDC:YOR349W"
                     /note="similar to Saccharomyces cerevisiae CIN1 (YOR349W);
                     ancestral locus Anc_7.43"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683478.1"
                     /db_xref="GeneID:11501589"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G9A073"
                     /translation="MYLGSTDSLLESIDSNIDNLSNEGLDSLLKNIDAFQQDPSILLR
                     RNKLPGYIKSLTHDYFTLEYELQLLRCKVFYNLSKVVTWKKIVVYLPTNVFLITRLLE
                     ILQTEAKSWYTPYFLLSWVYILTLSPFKFDEVHDRIYKVAGKYTKLQTVQPIVAQIHA
                     QLLLKNTEAFKPHDLDLLTLNYYLKGIKPDSTVIDESMLHHFNSMCFQRDDIIALKIL
                     PKLFKINAFHDEWEAVEDIISYFLSHLDDSFTNYRFALAHSFSKVVNTLINDFDDLDT
                     ATGLVESCIDRIKHCLYETPTSLIDHDFLHTNLLIIAELCHAIAQNMPQLLNTVAMEL
                     IPPALKFQQLKMNEIKGSQIKDASNFICWSLARSTRSPEVKLSEDVEVSVLLNLLVCS
                     SFDRDLLVRRSANAAMQELLGRCFAATNVFENDAIMKIIELPILNLAENYVDNADEIY
                     TLFTKNESHKPYALFVLNWLIDINLAANCDLYIVRLTIEALLRLAQKFPNTISHIKIK
                     LDRLINQKDTLIAARSLDLILTMESEELFSSQNISTSNEIHTVMDIMLESVKIHHRAH
                     GNDINEFFKFFVILKGWVFSLRKLQNFSFTGRQIEICFHIVRMTSDSPYYKSEFKNLF
                     NEFVHSLSREPHLFATSEDEVSFWTIFEKFTRLNNSLTSSALPELPPAKFYDIFLKSL
                     PIMDSQRKSRLLDSLIDHLPNIVNTTGNSILNIIVQLLNDYTITQQGDVGRLVRISAS
                     KIVARHKDIFWETKDQQLIDDVVSNLLRLSGEQVKEARIICFKTLCKVYGYSVEGGCE
                     VSNSRLLDFQHQFFQGKSSAFWKGYMVTGGAINFSISEVTNAIDDFMIYYYSLPSDQD
                     RLNICNCLMRIIPSAKEVTEHQNTIEKNVLGLTKPDLLKTTITFLNFWTRLMESGLMI
                     DPHFNFNGVYAKIYNLNLIKGSSLLKLCTIQMLPHLLSSQVYSLNEIDRAFANKVIRR
                     LLVLAQREAQQKVQMSGSESSLVQKALIEALAQIYAEHGYLKQLEILKNATANDNAII
                     ALSESQLIL"
     gene            complement(<704180..>706003)
                     /gene="TDEL0H04090"
                     /locus_tag="TDEL_0H04090"
                     /db_xref="GeneID:11501590"
     mRNA            complement(<704180..>706003)
                     /gene="TDEL0H04090"
                     /locus_tag="TDEL_0H04090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683431.1"
                     /db_xref="GeneID:11501590"
     CDS             complement(704180..706003)
                     /gene="TDEL0H04090"
                     /locus_tag="TDEL_0H04090"
                     /inference="similar to DNA sequence:INSDC:YOR350C"
                     /note="similar to Saccharomyces cerevisiae MNE1 (YOR350C);
                     ancestral locus Anc_7.42"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683479.1"
                     /db_xref="GeneID:11501590"
                     /db_xref="InterPro:IPR025694"
                     /db_xref="UniProtKB/TrEMBL:G9A074"
                     /translation="MKKIKARQHSMDELVRSISKSQTVIDNWISNAIGNRKSNHQKHA
                     TVLHLPIVLKTLQRLRSTDKRALYFALMSKIQSSQIRWISQSAKEIDTGDKLPAEFYN
                     EISNMLYRISLRCGAEELNALSKFLLQLLANYESAVQQRGISKQNTKFYRNCLLPLAK
                     TESVSLLYEGLSLVPPSSRNIKLLIEMAFFFHTSQFTKLLAQLECNLLRSNSFSLDQE
                     EIDVFFPLFFDIMHKCILLGDEHICIKLLSKITQDWNFEMDDHYESLLIEICERNAAN
                     EVIQALNEDKSFDSCPERRWKVIQSQSSWDEFMSYVCHVDVNLFNEYQDLDFLQQKLS
                     SVGPSLNDWKTFLDNHKIPATANPSVKALIVNTILVTLVANKPLDFVMSIMEHMLYEL
                     NYCQYFVDTAMLAGQRSYSGFHCLFKAFSNSRSSVLTSSTLFKFLEQMKDYHFTTSDY
                     YFMMKSCLTGAGHHSLYYFLFQYISRKGSSLYQSSNGSLTWALPPRIEQLLKLSIAEQ
                     KGDKRILEIVGSVGNWFLAHHSVIGGNEIDQNTLRQIFGDEYVSEVTMRSLVDLEKKY
                     TSKEVGHSYRSDKRHYSPSADLRMSSRLHRLLEFAEKQTSK"
     gene            complement(<706443..>707974)
                     /gene="TDEL0H04100"
                     /locus_tag="TDEL_0H04100"
                     /db_xref="GeneID:11501591"
     mRNA            complement(join(<706443..707306,707369..>707974))
                     /gene="TDEL0H04100"
                     /locus_tag="TDEL_0H04100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683432.1"
                     /db_xref="GeneID:11501591"
     CDS             complement(join(706443..707306,707369..707974))
                     /gene="TDEL0H04100"
                     /locus_tag="TDEL_0H04100"
                     /inference="similar to DNA sequence:INSDC:YOR351C"
                     /note="similar to Saccharomyces cerevisiae MEK1 (YOR351C);
                     ancestral locus Anc_7.41"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683480.1"
                     /db_xref="GeneID:11501591"
                     /db_xref="GOA:G9A075"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:G9A075"
                     /translation="MVDRVEDDSDDSMTSMGFGGYPRRIGICKHKMLKFGRNEKECDL
                     VFSDPVVSSIHCVFWAILFDEESSPMCYIKDCSLNGTYLNGALLKRNSAYLLQDGDSV
                     ELHDQDSRAFRFRALGLAANSPLFDQLGFERVVGRWEVTSRLIGNGTFGHVLVAYKNL
                     SNVEKQEGSFSKCTPENYAVKIIKLKPSKLDKEAKILLKLNHPNIIKVHHTYCDMRDN
                     LYIFQDLIPGGDLFSYLAKGDCLTSISETESLIIVYQILHALKYLHDQGIVHRDLKLD
                     NILLCAPEPCTRIVLADFGIAKDLSTAKARMHTVVGTPEYCAPEVGFKANRKAYQCFS
                     RAATLEQNGYDSKCDLWSLGVITHIMLTGISPFYGDGTERCIIQNAKVGKLNFTAKQW
                     DTVAESAKSFVRKLLEIDVTKRLDSNQSLHHPWISKHKEQLQKIYAKKILNITEEASK
                     HDSTLLNSPECSSEWKRKLPKSVVMDHSVPKKKKQRTGI"
     gene            <708552..>709481
                     /gene="TDEL0H04110"
                     /locus_tag="TDEL_0H04110"
                     /db_xref="GeneID:11501592"
     mRNA            <708552..>709481
                     /gene="TDEL0H04110"
                     /locus_tag="TDEL_0H04110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683433.1"
                     /db_xref="GeneID:11501592"
     CDS             708552..709481
                     /gene="TDEL0H04110"
                     /locus_tag="TDEL_0H04110"
                     /inference="similar to DNA sequence:INSDC:YOR352W"
                     /note="similar to Saccharomyces cerevisiae YOR352W;
                     ancestral locus Anc_7.40"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683481.1"
                     /db_xref="GeneID:11501592"
                     /db_xref="UniProtKB/TrEMBL:G9A076"
                     /translation="MSEPDTPLHPQADEQIDLSNVRELGDDDIDDLDLNPELEVSEDL
                     DRYGEERDDEDGEGGFKRSYVEDEDERGMYDEMDDFRPRINVGSPFSSATVLAKSRPP
                     LDKPTNTQRRLSLSQQSKFISYCDERLLEIQRKYVQSRGLNTQNGYSGLEPLLKDLKS
                     LVDFIWYSIDGMPNTDYLLNNPSTTERDQITIKCNSTYFGQSAYLIRIADDLLDYVDK
                     FELKSLPVEKQNSTLSKLFKLLFILDKIFATLLEGVIPGNARMSGTDAVRFTAIAERT
                     RAMMPRYLEQQEIHGYHYEVSKVYEEALESCGN"
     gene            complement(<709600..>712023)
                     /gene="TDEL0H04120"
                     /locus_tag="TDEL_0H04120"
                     /db_xref="GeneID:11501593"
     mRNA            complement(<709600..>712023)
                     /gene="TDEL0H04120"
                     /locus_tag="TDEL_0H04120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683434.1"
                     /db_xref="GeneID:11501593"
     CDS             complement(709600..712023)
                     /gene="TDEL0H04120"
                     /locus_tag="TDEL_0H04120"
                     /inference="similar to DNA sequence:INSDC:YOR353C"
                     /note="similar to Saccharomyces cerevisiae SOG2 (YOR353C);
                     ancestral locus Anc_7.39"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683482.1"
                     /db_xref="GeneID:11501593"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR019487"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:G9A077"
                     /translation="MPDIAGYGSGVGKPVVNGVASHPGNGNGVKDKRTLRDVISKKLS
                     QQSAGGSTIKLIGLNITSIPDADVELLRNVERLSLRKNLLIHLPSNFCTLTGLRYLDL
                     DNNILQEIPPVLMQCPKLEILDLSYNNIEILPQDVSPLWSQQLKVLSLKSNNVNSIWG
                     LRFIVKFENLRVLEILGNPIPNEELEAVRAHTPMTPDIVKEEYWAIALRRFLQDHPSP
                     SENSHDPRMSKAAKRMGFINTTPQASAEITSSVSPSPVDAAQTSSEADVSYTTTETTN
                     NELYNHSKFNDYFKRLSILPEESSSNEQLKVSHDEFLVACRKLLFSFTECQQNVRKIA
                     SFCKEKAVAVNVVSLLYSVRSHIDNLVGLLEQAESEERSHDAALIKLCITIITIFKQI
                     ISQLRKNFKTFFEADDLCFIRMFYMTLVCSYTEIYNAWCFIGAEDARLSRKRQLNRAH
                     SAVNLSATASAATNGPSTVYLPRTRSNTVQARAVPMAMNLSTMGPSSIDTSLGTANGH
                     GFKSPPPTSSPSHSIATQGPVAVTPPSNGPIAHNLSQQTVDSKLTDSSPRQVHSHSPR
                     PHKANESHGINNRDGTEAETGSPSSSGTNNVDTQLYQTLGTVIVMVNVVYDQLTSEIS
                     KAAMASTIGQQELTDALLSKIRDLTDTCCQAMELSKTLNERLHLLTADGDNSEKYLST
                     AGKAKTWENINAFLKSIISILANTKLVMADMPALNEIRPNLASLAKITKDVTVILDLS
                     SYKGVSVLAAQNQAQAASQTQTQTQNQYQPQHSAGGTEERDEKFYSFVTTPQLTPAHS
                     HSTNPFDAA"
     gene            <712296..>713114
                     /gene="TDEL0H04130"
                     /locus_tag="TDEL_0H04130"
                     /db_xref="GeneID:11501594"
     mRNA            <712296..>713114
                     /gene="TDEL0H04130"
                     /locus_tag="TDEL_0H04130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683435.1"
                     /db_xref="GeneID:11501594"
     CDS             712296..713114
                     /gene="TDEL0H04130"
                     /locus_tag="TDEL_0H04130"
                     /inference="similar to DNA sequence:INSDC:YAL039C"
                     /note="similar to Saccharomyces cerevisiae CYC3 (YAL039C);
                     ancestral locus Anc_7.38"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683483.1"
                     /db_xref="GeneID:11501594"
                     /db_xref="GOA:G9A078"
                     /db_xref="InterPro:IPR000511"
                     /db_xref="UniProtKB/TrEMBL:G9A078"
                     /translation="MGWFWADKSGAGPTLNGLKQSDQGTSSCPVQHGKSSSQSECPVM
                     HDGVGNGGLNPLNNMPNFLSTKRQPGQKLNLPTDRTVSSIPKGEDDQSNWEYPSPQQM
                     YNAMVRKGKIDPNTGEEIPEDAVESMVFVHNFLNEGCWEEVLEWEKPYTEQTKIQPKL
                     LKFMGKPHEMSPRARYYQMMSKVFPKQYSGEPPFDRHDWTVLRADSMSADPDCPGYRK
                     VRYVIDFYGGPDDEEGMPTFNLDVRPALDNLSNAKDRFVHYTKPIIEKYFDGDK"
     gene            complement(<713215..>715197)
                     /gene="TDEL0H04140"
                     /locus_tag="TDEL_0H04140"
                     /db_xref="GeneID:11501595"
     mRNA            complement(<713215..>715197)
                     /gene="TDEL0H04140"
                     /locus_tag="TDEL_0H04140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683436.1"
                     /db_xref="GeneID:11501595"
     CDS             complement(713215..715197)
                     /gene="TDEL0H04140"
                     /locus_tag="TDEL_0H04140"
                     /inference="similar to DNA sequence:INSDC:YOR354C"
                     /note="similar to Saccharomyces cerevisiae MSC6 (YOR354C);
                     ancestral locus Anc_7.37"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683484.1"
                     /db_xref="GeneID:11501595"
                     /db_xref="UniProtKB/TrEMBL:G9A079"
                     /translation="MLSRRLLSRAKIPQLLVRCQSTVVHPVSKLGNELYDQLKSGDAN
                     EVYSTLKDHLDKISQELVDPTTLQRSFGLNAPLTQFLRKAATDKESTVEPYQILNTLC
                     QYQVARSPHFEVVMRHLLTRGSPQDVIALWVKYLETIAENPNAMSRSFNNRNGNNNSH
                     ENNMALASLAYLLLPENNPDLQVLGQILQLNKEQGQHVPFNKLRFMISSLIKDERREA
                     AQQGLKLLFHQYVDSDKESFIRQLDQTLQFHHLQDLYNQYHEQSVDPEIIAKFMEKYI
                     DCNNAAGAVKIYNENKDLDSSMLKDHLLLAVANLPANSRNLRLDRILAIWNSVIKPTN
                     PGAASFAALIQALGVSGNVQQLQNIWTKEIPQEIKLQSPVIEGYLTAMLKYNKQVKYD
                     DIAGKLPEKIESLNLINTVLLKMVIDNVSKEKFDSFYAAQFAKTEDVASQKRPNVETL
                     AIRMYANYHYASDKDSFDFLKSVFQSKKNFLKVNAIIEHFIQIVPSIEPIRVLYAQVK
                     EPVDSRKYGAFINAEFVKHNGDYKVAEEIFKEFLEALKAQSKKIDRFSLEPLITGFCE
                     QAIRDRDPSFLLKVSTYYSFASKVNLELTYQTTAKILHTLALLAKDKSGKFDASEQEF
                     IGLFLQDLESMEKFNPNSRDIDMLRKAGVKLPGKLA"
     gene            <716173..>717711
                     /gene="TDEL0H04150"
                     /locus_tag="TDEL_0H04150"
                     /db_xref="GeneID:11501596"
     mRNA            <716173..>717711
                     /gene="TDEL0H04150"
                     /locus_tag="TDEL_0H04150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683437.1"
                     /db_xref="GeneID:11501596"
     CDS             716173..717711
                     /gene="TDEL0H04150"
                     /locus_tag="TDEL_0H04150"
                     /inference="similar to DNA sequence:INSDC:YAL040C"
                     /note="similar to Saccharomyces cerevisiae CLN3 (YAL040C);
                     ancestral locus Anc_7.36"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683485.1"
                     /db_xref="GeneID:11501596"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:G9A080"
                     /translation="MKHVMDIVGVDLGYMARVRRTVAHLKSQEVNLITREAASHEFSV
                     LEYSNHLLNHLINLERNDGQHVISRPNIVTFESQPQINAKMRLLIFDFLMCCHTRLGL
                     SSSTLFLCFNILDRYTSKYIVKSCNYQLLALTALWISSKFWDSKNRITSLKHLTKLCC
                     KQYSAQQFKEMELHLLKSLNWSLCQFATHDSFIDLLLFMKDNKTVSPQILHENNLNVD
                     LIKFGSMMLCELACFDIKLSFNCSASQIVLAAITLTTLAIKFDDLNQWEDLDLVGNDA
                     NLIRVCHSLLALVLKTDSLPSSFKFKYINEGKTTSEKILKALQNYFIQLQMEQFYRSQ
                     EFETLQQNTLTSYEKRNDFNDNEKNKDDVSTTGVQTMGQSFDHSFASNTSNIASSHSA
                     TTPPAMASSSASPFASPFMAHDLFTNTPDSSTTPAGDRSLLSFSRSTTTSSGLLPLTP
                     TTPTLLQNKMAAIKRRSMAGRNLMAPSRTNTEGTEKFVKGHRKRASSSMDIDFFENDV
                     ALKR"
     gene            <718020..>719549
                     /gene="TDEL0H04160"
                     /locus_tag="TDEL_0H04160"
                     /db_xref="GeneID:11501597"
     mRNA            <718020..>719549
                     /gene="TDEL0H04160"
                     /locus_tag="TDEL_0H04160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683438.1"
                     /db_xref="GeneID:11501597"
     CDS             718020..719549
                     /gene="TDEL0H04160"
                     /locus_tag="TDEL_0H04160"
                     /note="ancestral locus Anc_7.35"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683486.1"
                     /db_xref="GeneID:11501597"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="UniProtKB/TrEMBL:G9A081"
                     /translation="MKRQVDELQSGKSKIALDLDKKLQSGYNGYVPPEFETEIDTVAV
                     PKTDQQIEDFFQKYVVSRKPCKIDGVPDDISFLQKLKPSKIRDYLPSEEILTIEKKNE
                     GGFGSGARRLKMSFGQFLDKIMEEKDTGLYLTTQYLEDDPNNGDYSTDEEEKDQVLEE
                     DFETGSITFENLHDDFDDLEEEDDEVDKDDEESDDQEEYEIRVKELYQSPMTNLVNVV
                     PETPKFLNYLIPQQINLWIGAAKPLADHSGDDSWLAKFDPNDPKGRLGLGRNVPGGGS
                     SSGLHHDHADNLYVPVAGRKRFTLFAPCDAAKMYTVGDIRQFFPSGVIDYFNNKNAPL
                     WRQLRDDGAIVAEVYKTLLTTSLDDELKNKYEELIDDDLKKQLRSRDVDARELDPPSF
                     STVPPSVVHLGDINNEKLRESITKAAGKLWPSFSGSHRISVDLKPGEMLYLPTGWFHE
                     VTSYGNNDKSDKNVHVAANYWFIPPTGQSRQRVYLDDYWPNDYKITQRALSALRSQDL
                     E"
     gene            <720209..>721465
                     /gene="TDEL0H04170"
                     /locus_tag="TDEL_0H04170"
                     /db_xref="GeneID:11501598"
     mRNA            <720209..>721465
                     /gene="TDEL0H04170"
                     /locus_tag="TDEL_0H04170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683439.1"
                     /db_xref="GeneID:11501598"
     CDS             720209..721465
                     /gene="TDEL0H04170"
                     /locus_tag="TDEL_0H04170"
                     /inference="similar to DNA sequence:INSDC:YOR355W"
                     /note="similar to Saccharomyces cerevisiae GDS1 (YOR355W);
                     ancestral locus Anc_7.34"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683487.1"
                     /db_xref="GeneID:11501598"
                     /db_xref="UniProtKB/TrEMBL:G9A082"
                     /translation="MALTNPRPLQIPALQNEILHNTASPVFQASPLVFNPKNDDGMFP
                     NTPSSEGSPSDNGKIRKDGSVNSPKKDPLTLEISKIIPVTGERPMPKDRTAPLDDDVL
                     FAVFVILWEEDPGLQGMTVKQLSDHLLEKHPDMSNLSTKLSNLISAKLNAYVKKLKKV
                     EKTLTYALSREWSNSSPRRMVYVYRGILSPDYKKHAQAAAVHLKQQQGVAINDNFGDS
                     QLNSKKGDSGFSDAAKMGTSTNLGFSLSPEFNIPYSTSPVSAILTPASVTPEKGTAVN
                     PGVKRAHSDGDEEANEQFKKTKSNNSDYKADSNRSESAPVTYITAAAAAPRLSKSSSK
                     NNFNAIPQNSAAIVAAIHKVFSTQTPIDSRSKTMPSSNSISTPDRPSGAGFVDSWVKT
                     VREGFLTHDIESPEAMSFEELECIFD"
     gene            <721905..>723851
                     /gene="TDEL0H04180"
                     /locus_tag="TDEL_0H04180"
                     /db_xref="GeneID:11501599"
     mRNA            <721905..>723851
                     /gene="TDEL0H04180"
                     /locus_tag="TDEL_0H04180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683440.1"
                     /db_xref="GeneID:11501599"
     CDS             721905..723851
                     /gene="TDEL0H04180"
                     /locus_tag="TDEL_0H04180"
                     /inference="similar to DNA sequence:INSDC:YOR356W"
                     /note="similar to Saccharomyces cerevisiae YOR356W;
                     ancestral locus Anc_7.33"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683488.1"
                     /db_xref="GeneID:11501599"
                     /db_xref="GOA:G9A083"
                     /db_xref="InterPro:IPR007859"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="UniProtKB/TrEMBL:G9A083"
                     /translation="MIRTIGKRAVKPRLNPLLKTISKNAGISNVVLRQSYRHLNYVRQ
                     FSVSTRQLQSAEIPFDKLTSEEQQTLTEERAVDKVDVCIVGGGPAGLATAIRLKQLDN
                     EQGEGNLRVVVLEKSADIGSHIVSGVIMDPRALRELFPESEYYDENGEGIPLPAEIAT
                     KVVDEELKFIMGKLVLPVPAPSHMHNKGKNYVGSLSEITAFLGGKAEEMGVEVYSGIA
                     VSNLLYSEDGKSVVGVATKDMGISKSGKPKDNFERGMAFNARQVVLAEGCHGSLTKEA
                     IKKFDLRKNCQNQSYGLGIKEVWEVSPEKFKKGFIAHTMGYPLSNDVYGGGFQYHFGE
                     NIVTVGLVVGLDYKNPYISPYQEFQKMKQHPYYRNVLEGGKCISYAARALNEGGLQAV
                     PKLNFPGGVLVGASAGFMNVPKIKGSHTAMKSGMLAAEEMYKAISKMPSLEELEESGT
                     EKLVEEPLNLDSYHEAFKNSWVYDELYSVRNVRPSFNSFLGGYGGMMYSGLDTYILRG
                     RSPWTFSFHESDASITEPASKHKPIDYPKPDGVITFDIMTSVSRTGTYHDEDEQCHLR
                     VPEQDLQKHAEIAYPKFKGIENRFCPAGVYEYVKDESSPLGVKFQINAQNCIHCKTCD
                     IKVPTQDINWVVPEGGDGPKYSLT"
     gene            complement(<723994..>726330)
                     /gene="TDEL0H04190"
                     /locus_tag="TDEL_0H04190"
                     /db_xref="GeneID:11501600"
     mRNA            complement(<723994..>726330)
                     /gene="TDEL0H04190"
                     /locus_tag="TDEL_0H04190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683441.1"
                     /db_xref="GeneID:11501600"
     CDS             complement(723994..726330)
                     /gene="TDEL0H04190"
                     /locus_tag="TDEL_0H04190"
                     /inference="similar to DNA sequence:INSDC:YAL041W"
                     /note="similar to Saccharomyces cerevisiae CDC24
                     (YAL041W); ancestral locus Anc_7.32"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683489.1"
                     /db_xref="GeneID:11501600"
                     /db_xref="GOA:G9A084"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR000270"
                     /db_xref="InterPro:IPR001331"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR010481"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G9A084"
                     /translation="MAVQSHMSSASLPLQNPRSNSTAMSNVMNTAVTELDSLYYICAN
                     VKRRLEQLPQLHPYMNLAYASSEVLSERQSLFLSQKQQQQKVNSHQSISSTFSGRDSH
                     PIISSTARTSSISNSSLKEELSLDGITYTSSSQGNGGSNSGNENNNNMEDTLLTFSMG
                     ILPISMDCDPVTQLSQLFQQGSPLCIIFNAVKPQFKLPVVSSDDIKICKKSIYDFILG
                     CKQHFAFNDEELFKISDVFSNSTSDLIKVIDVVRTLMNSQPEIFSTTHDIEEQLLREL
                     QHVPINSEQSKIMKELVATERKYVHDLEILERYRKQLLESNLITTEELYMLFPNLSDA
                     IDFQRRFLISLEINALIDAPKQRIGALFMHSKHFFKLYEPWSIGQNAAIDFLSSHLEK
                     MLRTDFIIRNKLELQSFLYKPVQRLCRYPLLLKELLQASQDVGNSKELEIALDISKGI
                     ARSINENQRRTENHEVVKKLYGRVTNWKGYRIAKFGELLYFDKVYISTNNASEPEREF
                     EVYLFEKIIILFSEVIQKKTASLSLKKKQTNSGSSLSLNLTGSHSSFNTSFNGVSESK
                     LDLRGRIMIVNLNQITPLESHSLTITWESIKEQGNFILKFKNEEIRDNWSSCLQSLVR
                     KARSESFRSVNSNEQASFASPAQFRRAHTSMSSLNSSQGKHVSDMLAKRNTSSYESEY
                     RSISENYKNSIPKSSLLIRIAFNSDFYTVLAELNSTVDEVLLIIQRKLSHSGNVNKIK
                     YQDEDGDYVMLESEEDWTVAKEMLKESEDRILNVWAYG"
     gene            complement(<726526..>727746)
                     /gene="TDEL0H04200"
                     /locus_tag="TDEL_0H04200"
                     /db_xref="GeneID:11501601"
     mRNA            complement(<726526..>727746)
                     /gene="TDEL0H04200"
                     /locus_tag="TDEL_0H04200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683442.1"
                     /db_xref="GeneID:11501601"
     CDS             complement(726526..727746)
                     /gene="TDEL0H04200"
                     /locus_tag="TDEL_0H04200"
                     /inference="similar to DNA sequence:INSDC:YAL042W"
                     /note="similar to Saccharomyces cerevisiae ERV46
                     (YAL042W); ancestral locus Anc_7.31"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683490.1"
                     /db_xref="GeneID:11501601"
                     /db_xref="InterPro:IPR012936"
                     /db_xref="UniProtKB/TrEMBL:G9A085"
                     /translation="MVQKSALLSFDAFSKTEEDVRIRTRSGGLISLSCVVLTIFLLIS
                     EWLNFNQVVTRPQLVVDRDRQLKLDFVVDITFPSMPCAMISLDIMDNAGELQLDIMEA
                     GFTKTRIDSNGKEISTSSFDASDSSSDYVPDDENYCGSCYGAKDQDKNDELPKEERVC
                     CQTCDDVRKAYLEAEWAFYDGKNIEQCEREGYVERINQQLNEGCRVQGNALLSRIQGT
                     IHFAPGRGFQNNRGHFHDMSLYDNTPQLNFNHIIHHLSFGKPINSGAEDRGAATSTHP
                     LDGRQVFPDRDTHLHQFSYFAKIVPTRYEYLDDVVVETAQFSTTYHDRPLRGGVDDDH
                     PNTLHSRGGSPGMFVYFEMSPLKVINKEQHAQTWSGFLLNCITSIGGVLAVGTVLDKV
                     LYKAQKSIWGKKSQ"
     gene            complement(<727922..>728410)
                     /gene="TDEL0H04210"
                     /locus_tag="TDEL_0H04210"
                     /db_xref="GeneID:11501602"
     mRNA            complement(<727922..>728410)
                     /gene="TDEL0H04210"
                     /locus_tag="TDEL_0H04210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683443.1"
                     /db_xref="GeneID:11501602"
     CDS             complement(727922..728410)
                     /gene="TDEL0H04210"
                     /locus_tag="TDEL_0H04210"
                     /inference="similar to DNA sequence:INSDC:YOR357C"
                     /note="similar to Saccharomyces cerevisiae SNX3 (YOR357C);
                     ancestral locus Anc_7.30"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683491.1"
                     /db_xref="GeneID:11501602"
                     /db_xref="GOA:G9A086"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:G9A086"
                     /translation="MREFKSFSTTEQSTLPQGHRNPTYSEIYAEPENFLEVEVINPKT
                     HVPNGSDTRGMFTDYEIICRTNLPSFHKRVSRVRRRYSDFEFFRKCLVKELSMYSNHP
                     KVVIPHLPGKILLSNRFNDDVIEERRQGLNKWVEAVVGHPLLQTGSKTLVRFIEEPKF
                     VG"
     gene            <728545..>729039
                     /gene="TDEL0H04220"
                     /locus_tag="TDEL_0H04220"
                     /db_xref="GeneID:11501603"
     mRNA            <728545..>729039
                     /gene="TDEL0H04220"
                     /locus_tag="TDEL_0H04220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683444.1"
                     /db_xref="GeneID:11501603"
     CDS             728545..729039
                     /gene="TDEL0H04220"
                     /locus_tag="TDEL_0H04220"
                     /inference="similar to DNA sequence:INSDC:YOR358W"
                     /note="similar to Saccharomyces cerevisiae HAP5 (YOR358W);
                     ancestral locus Anc_7.29"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683492.1"
                     /db_xref="GeneID:11501603"
                     /db_xref="GOA:G9A087"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR027170"
                     /db_xref="UniProtKB/TrEMBL:G9A087"
                     /translation="MAENGNREVAAATAVDESGRPEMVNPMEGDDEEELDVFRNVGQG
                     LVGHYREIMIQYWQELINEIESTNEPDSHHQDDFKSHSLPLARIKKVMKTDEDVRMIS
                     AEAPILFAKACEIFITELTMRAWCVAEENKRRTLQKADIGEALQKSDMFDFLIDIVPR
                     HLQQ"
     gene            <729484..>731847
                     /gene="TDEL0H04230"
                     /locus_tag="TDEL_0H04230"
                     /db_xref="GeneID:11501604"
     mRNA            <729484..>731847
                     /gene="TDEL0H04230"
                     /locus_tag="TDEL_0H04230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683445.1"
                     /db_xref="GeneID:11501604"
     CDS             729484..731847
                     /gene="TDEL0H04230"
                     /locus_tag="TDEL_0H04230"
                     /inference="similar to DNA sequence:INSDC:YAL043C"
                     /note="similar to Saccharomyces cerevisiae PTA1 (YAL043C);
                     ancestral locus Anc_7.28"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683493.1"
                     /db_xref="GeneID:11501604"
                     /db_xref="InterPro:IPR021850"
                     /db_xref="UniProtKB/TrEMBL:G9A088"
                     /translation="MSLSEMDQLYRARKLAMENSPDQMLPKVLETSASLYISEGTTPQ
                     LKLELARFTPHLLLDVITHENIGSSQKPFIASQHLNCLWSVCRNVKDSIAYKYSVLAF
                     SASYPLLFELVAKTSNQEMWDTMQQMKAFILSKWNTTYPLQLNSDDNDPFLNDRKNIG
                     SRLATAKFLSEIIIVHTSRNGNNIKAGPISISSVPDGHPVISNKQQLESEAKKFLDIL
                     LNYLIEEPMMVSSVFIGILNCLAFIMKQRSQATMRILSGLLKFNVDAKYQADDLSVLN
                     YRLGKRFVERCYKNFVQFGLKSQIIKNSGQMASQHMKLSKISQTLHVIGEETKSKGIL
                     NFDAEQVENKMAAKDKQKYASLRRRQMASKNGHNASPSITSVNVGATSSTPQPGQTPV
                     DMNPAEKPSDNVTQLLMDLQRYTMSKNNIAVFFNNSPVAIDNSYCAIYSLMNSKNSEQ
                     DMAKLPQDIMIKLCSEAFFKTDTTKMISGLSIVASRYTDLVNKASQQQQQQQQQQAGK
                     KRKVDQHDDGQSSTKKVKKEEEIELRAAQGENYEDEADEDDYYDEIKDTNKNDVELIK
                     PVPMTEDERMKHLHRIVQHIMSAKDSDESSGITTNMGKDQNPLEKVKLLHWNNKESWL
                     HILTRLCTRGVSHQDKMSELIRQILYDYFMEDFNGRIGMALEWLGEEWYYESLAKDLP
                     VNYTNYDQWSIKFLEGLIPFLENQHRRIFIRLMSELPRIEQQHIDKVRPICLDPARSS
                     LGFQTLKFLVMFRPPVKPLVKKLLEQIKAEDSTIEEQCNSILNKYYQ"
     gene            <732072..>733577
                     /gene="TDEL0H04240"
                     /locus_tag="TDEL_0H04240"
                     /db_xref="GeneID:11501605"
     mRNA            <732072..>733577
                     /gene="TDEL0H04240"
                     /locus_tag="TDEL_0H04240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683446.1"
                     /db_xref="GeneID:11501605"
     CDS             732072..733577
                     /gene="TDEL0H04240"
                     /locus_tag="TDEL_0H04240"
                     /inference="similar to DNA sequence:INSDC:YOR359W"
                     /note="similar to Saccharomyces cerevisiae VTS1 (YOR359W);
                     ancestral locus Anc_7.27"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683494.1"
                     /db_xref="GeneID:11501605"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR011510"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="UniProtKB/TrEMBL:G9A089"
                     /translation="MSSAYEDFASGSQSPYNVGRGAHPGAVLLSPQSSVMNLSNSAVS
                     ATVLSPQLTAQSHNLSFNEMLDQQSLLLDPTGSHSQQSNNMSSTHSAAGSAVMSPMIQ
                     SPSRTPTNAQGSSMFLDSFTSSSSNNVVGMHNRSQSLNKSKAQQNLGQTQTVNPKSSQ
                     SKPRGQGDVNPVVNFTQDINQLCSWMSMLSSVQQNTVIDNLLSTLNEDVLQYTKLKLD
                     SLMNSGYISPQIPAIASPVPNRESYSITNLDSVFSNERSMGADSDTGDHLDPSVDHSV
                     IYQQWSPQPTSMTQPIYDYIKEMNQRPKSADPHVSKANINHTVKKPASSHNFNTQTNF
                     YSASTKNRNFNGDFGTANSHTYYGGNRQQPTSNMHMNTTHSSLSPDHSPNSTSSSHTG
                     NVTPNPTINAIPGASNGGGNGHGSSMNPRTLTDPRLLTNIPVWLKSLRLHKYSDALSS
                     KKWDELIYLDDDALEKMGISALGARRKLLKAFAIVRDHKDQGLIDQTAYVS"
     gene            complement(<733761..>735311)
                     /gene="TDEL0H04250"
                     /locus_tag="TDEL_0H04250"
                     /db_xref="GeneID:11501606"
     mRNA            complement(<733761..>735311)
                     /gene="TDEL0H04250"
                     /locus_tag="TDEL_0H04250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683447.1"
                     /db_xref="GeneID:11501606"
     CDS             complement(733761..735311)
                     /gene="TDEL0H04250"
                     /locus_tag="TDEL_0H04250"
                     /inference="similar to DNA sequence:INSDC:YOR360C"
                     /note="similar to Saccharomyces cerevisiae PDE2 (YOR360C);
                     ancestral locus Anc_7.26"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683495.1"
                     /db_xref="GeneID:11501606"
                     /db_xref="GOA:G9A090"
                     /db_xref="InterPro:IPR002073"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR023088"
                     /db_xref="InterPro:IPR023174"
                     /db_xref="UniProtKB/TrEMBL:G9A090"
                     /translation="MSTLFLVGNVDRVRVKELFVRYRDVFDRTVEVEDVRSLFDRLYS
                     DRLAACALEASEAAEDRWNYEEGVSLVVLESRAEVEPQVLDEMFRNFLPVFNLVSVCQ
                     DVDLKHLQKILERLPSEQVECCDRIRRMAHWMYYCPSKGCSSRIYSMVEQLQRVRRKG
                     RRSIPGLIKNIDFNKLMVIPSELNRENYWRLLCTWAFQPHTLTTRELLYCAFILLQKL
                     SADAGLVIPDNQLLLLLFTLEASYHQVNKFHNFKHAVDVMQATWQLCEHIVDDPMQTL
                     LLSMAAIGHDIGHPGSNNMLLSKFGAPVARIYNEESVLENIHKDFFQELLSTHWQELL
                     TISSSSKAHPNYDVISETILATDMALHADYVEKLKIIPKIADTNTLTSLIIKAADISN
                     VTRPLEISAQWSCLITLEFNDCTLLQQHEENVVSRECNDDDESIHSDDEIYRCISNVR
                     LLSPDDLVAKYPCIPRGQIFFIDTFAEQFFQELCEKIPHLEFLIENIRTNKKFWLEKL
                     RTSPSKHN"
     gene            <735865..>736377
                     /gene="TDEL0H04260"
                     /locus_tag="TDEL_0H04260"
                     /db_xref="GeneID:11501607"
     mRNA            <735865..>736377
                     /gene="TDEL0H04260"
                     /locus_tag="TDEL_0H04260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683448.1"
                     /db_xref="GeneID:11501607"
     CDS             735865..736377
                     /gene="TDEL0H04260"
                     /locus_tag="TDEL_0H04260"
                     /inference="similar to DNA sequence:INSDC:YAL044C"
                     /note="similar to Saccharomyces cerevisiae GCV3 (YAL044C);
                     ancestral locus Anc_7.25"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683496.1"
                     /db_xref="GeneID:11501607"
                     /db_xref="GOA:G9A091"
                     /db_xref="InterPro:IPR002930"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR017453"
                     /db_xref="UniProtKB/TrEMBL:G9A091"
                     /translation="MFARALVRPSGTNGILRLFLRAQSTNALTKTSLPFTYSTSGPSK
                     VLYTNQHEWIAAHQDGTAFVGITTYAADALGDATYVELPEPETELEAGESVGSVESVK
                     SASEIYQPVAGTVLEANSALEESPQLINEDPMGAAWIAKIKINDAKDLETSGLLTLEA
                     YEESLKHDEH"
     gene            complement(<736402..>736776)
                     /gene="TDEL0H04270"
                     /locus_tag="TDEL_0H04270"
                     /db_xref="GeneID:11501687"
     mRNA            complement(<736402..>736776)
                     /gene="TDEL0H04270"
                     /locus_tag="TDEL_0H04270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683449.1"
                     /db_xref="GeneID:11501687"
     CDS             complement(736402..736776)
                     /gene="TDEL0H04270"
                     /locus_tag="TDEL_0H04270"
                     /inference="similar to DNA sequence:INSDC:YAL044W-A"
                     /note="similar to Saccharomyces cerevisiae YAL044W-A;
                     ancestral locus Anc_7.24"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683497.1"
                     /db_xref="GeneID:11501687"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="UniProtKB/TrEMBL:G9A092"
                     /translation="MFKRLAIRTMSDLKVPLNRSIEGPIAQSITRKVHENFPDLTHFT
                     IFNDSFKHAGHHGIADSDNRIESHFRLEIASNKFEGLTLPKRHRMVYKLLENEMGEGQ
                     VHALQLTTRTTAEQNKRLGKST"
     gene            <736902..>737210
                     /gene="TDEL0H04280"
                     /locus_tag="TDEL_0H04280"
                     /db_xref="GeneID:11501688"
     mRNA            <736902..>737210
                     /gene="TDEL0H04280"
                     /locus_tag="TDEL_0H04280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683450.1"
                     /db_xref="GeneID:11501688"
     CDS             736902..737210
                     /gene="TDEL0H04280"
                     /locus_tag="TDEL_0H04280"
                     /inference="similar to DNA sequence:INSDC:YAL046C"
                     /note="similar to Saccharomyces cerevisiae YAL046C;
                     ancestral locus Anc_7.23"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683498.1"
                     /db_xref="GeneID:11501688"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="UniProtKB/TrEMBL:G9A093"
                     /translation="MIQLARVSLRSYIRAPSKMLGTRFYSMTPEETLIQEKLVKALQP
                     ERLQVMDISGGCGSMFAIDITSAKFKGLSIVKQHKLVNEILKEDIQKWHGLQLRTKAN
                     "
     gene            complement(<737283..>739481)
                     /gene="TDEL0H04290"
                     /locus_tag="TDEL_0H04290"
                     /db_xref="GeneID:11501689"
     mRNA            complement(<737283..>739481)
                     /gene="TDEL0H04290"
                     /locus_tag="TDEL_0H04290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683451.1"
                     /db_xref="GeneID:11501689"
     CDS             complement(737283..739481)
                     /gene="TDEL0H04290"
                     /locus_tag="TDEL_0H04290"
                     /inference="similar to DNA sequence:INSDC:YOR361C"
                     /note="similar to Saccharomyces cerevisiae PRT1 (YOR361C);
                     ancestral locus Anc_7.22"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683499.1"
                     /db_xref="GeneID:11501689"
                     /db_xref="GOA:G9A094"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR011400"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR013979"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:G9A094"
                     /translation="MATEFEDIKLEDIPVDDVEFGDLEEKYSVKDEFNFDQYIVVSGA
                     PVIPEAKVPVLKKALTGLFSKAGKVVDMEFPIDPETKKSKGFLFVECGSPADGNKIIK
                     AFHTKRLDLKHRLYLYTVRDVERYNSNAFNTEFKEPAMPEFVPSSSLKSWLQDEEVRD
                     QYVLQKDDLTTVFWNTTLEDADNVVESRENWSSNYVRFSPKGTYLFSYHDQGVVAWGG
                     PHFDRLRRFYHPNVRTSSVSPNEKYLVSFSADPIIYNEDDKDSPFTKRNEGHQLCIWE
                     IASGLLMTTFPVVKSPFLHWPLIRWSFNDKYCARMVGGTLVVHDSDNGFAPMENKALK
                     VPGIRDFSFAPSGVKLHPFRQNDEPSVLLAYWTPETNNMSCKGTIVEVPRGRVLKTVN
                     LVQVSNVSLHWQNNADFLCFNVERHTKSGKTLFSNLELCKLTEKDIPVEKIEFKDCVR
                     AFEWEPNGNRFVAIAERDTGDDNPAIPRHVISFFAPEVKEKEQGSNASTGIKRWKLVV
                     DIPDKFSNTISWSPAGRFVVVATLVKPNVRKSDFMFFDVDFAGEKNINEAKDVTASVK
                     DIAKPAYLSATDLKWDPSGRYLAAWSSALKHKIENGYKIFNVGGDVVKEETVSNFKNF
                     AWRPRPASLLSNAEKKKVRKNLREWSAQFEEQDAMEADSAMRDLILRQRELLKEWHEY
                     RAESSEKLLKDFGYKAFDVTPLDEDDEQYTVVEEVKEEILEEKEEKVQDE"
     gene            <739853..>742180
                     /gene="TDEL0H04300"
                     /locus_tag="TDEL_0H04300"
                     /db_xref="GeneID:11501690"
     mRNA            <739853..>742180
                     /gene="TDEL0H04300"
                     /locus_tag="TDEL_0H04300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683452.1"
                     /db_xref="GeneID:11501690"
     CDS             739853..742180
                     /gene="TDEL0H04300"
                     /locus_tag="TDEL_0H04300"
                     /inference="similar to DNA sequence:INSDC:YAL047C"
                     /note="similar to Saccharomyces cerevisiae SPC72
                     (YAL047C); ancestral locus Anc_7.21"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683500.1"
                     /db_xref="GeneID:11501690"
                     /db_xref="InterPro:IPR024545"
                     /db_xref="UniProtKB/TrEMBL:G9A095"
                     /translation="MEDVSSEISGIVTSPRIDGNTLSFNSGPHVEGFSPVGVSPSHNG
                     NFRMNRNGAVDITQRPYVGLQRDIDVLDDEDLTYDSSGLAIPRLRESMTPWRTTESKI
                     KKDPKLHASRAATLVDNQFPTNSRPETRNSLFSLDGAYTVASSTTNDIEHLQKQLTTY
                     KLKVRTLLELIKQLNYGDDEQKNRDSFYGKLLSTLSQSDEVDELRKQLTHVKNNNGIK
                     QKRIDELENDISRLSEQLASTKKEHAETLEYANEYLEHSELLAKNIDEMLTLLLENID
                     LPHEERDALQKTIQISSSFAMVKINALMTTFSRVLQDLKSSDLKSRDVEVPEHDRNNS
                     TTIDAIANSTGINEIAGSVEAVNEEKNDEFSINESAIDTRLEVVIEGLHQEYDKFFHG
                     IRTKIEKSAELEKLLLSRLSQQDKLLSRIAAASNMDSQQQDSHCQKHDSILSSIDETS
                     KRASLELSKSYKDHIDNLNSLVHALNSTMGEKNAELQQLRTQLKDQESLRKTEQKLKN
                     ELKEYKDVCKLKENNWESFANDLEESVRVLQIENDQMSEVVNRLHSELKIKEDEIEEI
                     SASLQETQRRVRDISNLHKEDKLEFKNELSEKMREIESLNEERDQIRAFISETEKTSI
                     HRQKYAREFQGFKDHLLLHLEKVFNTLGKILQQTSVDQSKRKLEVIRRMDGLTATKTM
                     QTKLESLYNFIETAQESIVESYTSMVLLEGERRSTEGTSSKEMQLRIEELERKWISER
                     ERRKLDITAAESRITRLEAENELLREKLYNSTMRK"
     gene            complement(<742283..>743107)
                     /gene="TDEL0H04310"
                     /locus_tag="TDEL_0H04310"
                     /db_xref="GeneID:11501691"
     mRNA            complement(<742283..>743107)
                     /gene="TDEL0H04310"
                     /locus_tag="TDEL_0H04310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683453.1"
                     /db_xref="GeneID:11501691"
     CDS             complement(742283..743107)
                     /gene="TDEL0H04310"
                     /locus_tag="TDEL_0H04310"
                     /inference="similar to DNA sequence:INSDC:YOR362C"
                     /note="similar to Saccharomyces cerevisiae PRE10
                     (YOR362C); ancestral locus Anc_7.20"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683501.1"
                     /db_xref="GeneID:11501691"
                     /db_xref="GOA:G9A096"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G9A096"
                     /translation="MTSIGTGYDLSNSVFSPDGRNFQVQYAVKAVENGTTSIGIKFKD
                     GVVFAVEKLVTSKLLVPKKNVKIQVVDRHIGCVYSGLMPDGRQLVNRGREESSSFKKL
                     YQKPIPIPALADRLGQYVQAHTLYNSVRPFGVTAIFGGIDEEGPHLYMLEPSGAHWGY
                     KGAATGKGRQTAKAELEKLVDKHPEGLTGREAVKQAAKIIHMAHEDNKEKDFELEISW
                     CSLSETGGLHKFVEGELLEEAIEFAKKEANGDEDSDDSGDDEPAGAVDAEGDVQIE"
     gene            <743371..>745332
                     /gene="TDEL0H04320"
                     /locus_tag="TDEL_0H04320"
                     /db_xref="GeneID:11501692"
     mRNA            <743371..>745332
                     /gene="TDEL0H04320"
                     /locus_tag="TDEL_0H04320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683454.1"
                     /db_xref="GeneID:11501692"
     CDS             743371..745332
                     /gene="TDEL0H04320"
                     /locus_tag="TDEL_0H04320"
                     /inference="similar to DNA sequence:INSDC:YAL048C"
                     /note="similar to Saccharomyces cerevisiae GEM1 (YAL048C);
                     ancestral locus Anc_7.19"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683502.1"
                     /db_xref="GeneID:11501692"
                     /db_xref="GOA:G9A097"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR013566"
                     /db_xref="InterPro:IPR013567"
                     /db_xref="InterPro:IPR013684"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR020860"
                     /db_xref="InterPro:IPR021181"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G9A097"
                     /translation="MTKEAIRVVLCGDNGVGKSSLIVALVKDRFIPNLQDVLPPVTIP
                     RDFSSSPYSPKNTVLIDTSNDDPVGLQRELKNADVIWLVYSGHESYERVSLYWMMTFR
                     SLGLNIPVILCKNKCDHCGGTATGADAEDTRVEDEEFIPILMEFKEVDTCIKTSAKTQ
                     FDVNQAFYLCQRSITHPIAPLFDAKIGELKPLVVMALKRVFLLCDKDQDNYLNDEEMI
                     ALQRRCFGRTIDSNELDVIKQTLTDISRPSQEYSNCLLCVPGKGITKDGFLVLNKIYA
                     EKGRHETTWGILRAFQYTDSLSIQDKVLYPKLNVSETSSIELSPKGYRFLVDLFLRFD
                     EDNGGGLNEEELHLLFKCSPGLPKLWTATNFPFSTAVNSRGCVTLQGWLAQWSMTTFL
                     DYKITTAYLVYFGFQEDARLALQITKSRKMRRRAGRLYRSPVTDRKVFNCFVLGKPKS
                     GKSMLLESFLGRSLTEAYSPTLKPQIAVNSLELKGGEQYYLILQEFGQQETAILENKE
                     KLKNCDVLCLTYDSSDPESFAYLVELFDKFECLKNLPTAFVALKADLDKVQQRCRLQP
                     DEFTEQLFVNHPLHVSSTWLSSLNELFMKITEAALLPGKHTPGFPSEATTQESDYRQT
                     AMVLGSAVGFLALCTFGIVKLIRPSRYSQ"
     gene            <745696..>746433
                     /gene="TDEL0H04330"
                     /locus_tag="TDEL_0H04330"
                     /db_xref="GeneID:11501693"
     mRNA            <745696..>746433
                     /gene="TDEL0H04330"
                     /locus_tag="TDEL_0H04330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683455.1"
                     /db_xref="GeneID:11501693"
     CDS             745696..746433
                     /gene="TDEL0H04330"
                     /locus_tag="TDEL_0H04330"
                     /inference="similar to DNA sequence:INSDC:YAL049C"
                     /note="similar to Saccharomyces cerevisiae YAL049C;
                     ancestral locus Anc_7.18"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683503.1"
                     /db_xref="GeneID:11501693"
                     /db_xref="GOA:G9A098"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G9A098"
                     /translation="MASNPPGACCFKGFYHEGTPKGTLSDLYGIDTYVTGSQSNEKVI
                     VIITDIYGHKFNNTQLVADTLGDAGFRVYIPDILFGDAIEKLDGSVDFNEWLGKHNPQ
                     KTKAIVDQFLSGLKKENSPKFVGIVGHCFGAKYAIQQIHATEGLADVCAVAHPSFVSI
                     EEIAAIGKEKPLLISAAENDSIFPPELRHQSEAKLAEIGARYQLDLFSGVSHGFAVRG
                     DTSDPVVRYAKEKALVDQIYWFNHFSD"
     gene            complement(<746566..>749535)
                     /gene="TDEL0H04340"
                     /locus_tag="TDEL_0H04340"
                     /db_xref="GeneID:11501694"
     mRNA            complement(<746566..>749535)
                     /gene="TDEL0H04340"
                     /locus_tag="TDEL_0H04340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683456.1"
                     /db_xref="GeneID:11501694"
     CDS             complement(746566..749535)
                     /gene="TDEL0H04340"
                     /locus_tag="TDEL_0H04340"
                     /inference="similar to DNA sequence:INSDC:YAL051W,YOR363C"
                     /note="similar to Saccharomyces cerevisiae OAF1 (YAL051W)
                     and PIP2 (YOR363C); ancestral locus Anc_7.17"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683504.1"
                     /db_xref="GeneID:11501694"
                     /db_xref="GOA:G9A099"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR002409"
                     /db_xref="UniProtKB/TrEMBL:G9A099"
                     /translation="MQPLRQFGMMVSPKETGDLTNMEDESLSPGFETHVKRRNRISFV
                     CQACRRSKTKCDREKPRCGRCQQHGLQCIYDVEKQAAPKNPSKDATIARLQKDVAYWR
                     EKALREDGEQSEFGHLNKRAQDGDYIPFEGHDTKKSRRGIGFDSNDIEINLYRTHPSM
                     IMNRVMKREVKPLSENYAVTQDTFLSGLIAAVFLNPSKNTMIPALSANASVSRAQPSV
                     RNNVFQLKEILISQCHNESQKERINDFTDRLLQNTSNSGKLRIGMLPIAIRSAFDRNY
                     LEDFCPTDGEYSDLLKSFISEIEEILPPMEILNKYKAHFYENVYLNLAFLNRKLFEET
                     LSSVLFPDELDPSKVRIKLGKSRLRGKMENLSILMVILKLSFISLLFIDEGSEEHSAY
                     INREVLKRYPIGNEAILLAERVLSAENLFACANENIITCLLYIWSFFVYSPEEGDFFL
                     EHPTDVLTGVIVMLATSIGLHRDPSDFLRLAEVEDSSVLNHRRVLWVAITTTVCIESS
                     LKGRHPLSVGSAMDQFMDIRHPNALEVYMERVKRDIIEPDEATLKLHEMCFKRSLLAV
                     HFYDLDKLSLTYGGTFRLNEMEDIREKIESFVSDNFQLIDLQKRLSSNAKLKIDNSIS
                     FNMCGAENSVALHSLIMSRLMLLRASMALFFHFESVLPEKPQLLPFYQKYMIRVCLDS
                     LTLISHITKYFNDEYAANLLPSNSYNITKATQIALSSTFFGVLGVIMRIELAGNTLFS
                     QYQEDLTKNDDENLGSANKKMELLTVLKMDLEAALENIYRVSSKYLRFTYFSVFKMLA
                     LFDVVIQRMKKGELWNLLLRLQHVGEMNCRSVKALSMTLALDMTGKESVISQLRKKNH
                     LINISVEDLEALCREVKSVLQGDECMKQKDDPLNSTSDFSNASPTNSNSMMGNLEKLS
                     SAAAMSQNLEFQSSVKGASDFATMNNLQQPSGNCTEANGKLGIDFDFGTGVSMDFPNL
                     FGGLDLFDYDFLFSNDA"
     gene            complement(<749816..>752116)
                     /gene="TDEL0H04350"
                     /locus_tag="TDEL_0H04350"
                     /db_xref="GeneID:11501695"
     mRNA            complement(<749816..>752116)
                     /gene="TDEL0H04350"
                     /locus_tag="TDEL_0H04350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683457.1"
                     /db_xref="GeneID:11501695"
     CDS             complement(749816..752116)
                     /gene="TDEL0H04350"
                     /locus_tag="TDEL_0H04350"
                     /inference="similar to DNA sequence:INSDC:YAL053W,YOR365C"
                     /note="similar to Saccharomyces cerevisiae FLC2 (YAL053W)
                     and YOR365C; ancestral locus Anc_7.16"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683505.1"
                     /db_xref="GeneID:11501695"
                     /db_xref="InterPro:IPR010308"
                     /db_xref="UniProtKB/TrEMBL:G9A0A0"
                     /translation="MNWLASFFLAILLSVRSLVYAEDVAANSRHLRTSSLLTCMENSE
                     FTASYFDVRYYPGNQSVVFKIDATTTISENVTVKAEVITYGLKIIEQTFDLCSLNEAT
                     LCPLSAGRIDVRSSYTISSDITNQIPNVAYTIPDLDAQVRVVVYSQNDTDHETPLACV
                     QAVLSNDKTVQTKYASWPIAAVSGVGVLTSGFVSVIGYSTTAAHIASNSISLFIYFQN
                     LAITAMMGVSRVPPIAAAWTQNFQWSMGIIKVDFMQKIFDWYVQATNGVSTVVVANKD
                     VLSISVQKRHLERLAKRITLASSADYSFDSILEDSDLYTTTERNTTEYSSRILVLRGI
                     ERVAYKAGIELSNLFLTGIVFFLFFLFCVVVSLIFFKALLEVLTRARLMSESTNFFQY
                     RKSWGSIIKGTLFRLAIIAFPQVSLLAIWEFTQIDSPAVVVVAVVMLIVVTGVLGYGA
                     VRILIKGKESMRLYKNPAYLLFGDASFLNRFGFLYTQFKADKFWWLVPLLSYSFLRSL
                     FVAVLQNYGKAQAMVIFVIELFYFVALCWIRPYMDKRTNIFNIAIHLVNLINALFFLF
                     FSNLFKQPAVVSSVMAVVLFVLNAVFALFLLIFTIVTCTLALLHRNPDARYEPLKDDR
                     VSFIPKIQGPNGAAFENPSKSDAELFDLRKAAMDTNETDQEKIMRADAFENSNANNRT
                     LFDDEATSSYTYSGSSNRMPAQNDIPQPLQPTSAVMGPGSSLGNQGSKASFSNKYEGN
                     LRKPETSFYNSNNSGSHSPYQSNSYI"
     gene            <753248..>755419
                     /gene="TDEL0H04360"
                     /locus_tag="TDEL_0H04360"
                     /db_xref="GeneID:11501696"
     mRNA            <753248..>755419
                     /gene="TDEL0H04360"
                     /locus_tag="TDEL_0H04360"
                     /product="acetate--CoA ligase"
                     /transcript_id="XM_003683458.1"
                     /db_xref="GeneID:11501696"
     CDS             753248..755419
                     /gene="TDEL0H04360"
                     /locus_tag="TDEL_0H04360"
                     /inference="similar to DNA sequence:INSDC:YAL054C"
                     /note="similar to Saccharomyces cerevisiae ACS1 (YAL054C);
                     ancestral locus Anc_7.15"
                     /codon_start=1
                     /product="acetate--CoA ligase"
                     /protein_id="XP_003683506.1"
                     /db_xref="GeneID:11501696"
                     /db_xref="GOA:G9A0A1"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR011904"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:G9A0A1"
                     /translation="MSPSAVPSTEFAQGAMSKIEQLKQKILPTTDEVDQRDSVVEKQK
                     ESAREYEHLTSVPVVKQRPITDRLQKELAAHYSPHLDGIDEYNRLYKQSIQDPAKFFG
                     DRARSFLNWTNDFDQVFVPDPVTGKPSFENNAWFLNGRLNACYNCVDRHALSTPNKTA
                     IIYEGDEPGQGYSLTYRQLLEEVCKVAQVLYHSMGVRKGDTVAVYMPMIPQALVTLLA
                     ITRIGAVHSVIFAGFSSNSLRDRINDADSRVVITTDESKRGGKIVETKRIVDDALKEA
                     PGVRNVLVYKRTNNPSVSYHSSRDLDWDNEVKKYKGYYPCEPVDSEHPLFLLYTSGST
                     GAPKGVQHSTAGYLLGALLTMRYTFDVHQPDVFFTAGDIGWITGHTYVVYGPLLYGCT
                     TLVFEGTPAYPNFSRYWDIIDKYQVTQFYVAPTALRLLKRAGDSYLDGYSLKSLRCLG
                     SVGEPIAAEVWEWFSQKIGKSQIPLVDTYWQTESGSHLVTPMAGGVTPMKPGSASFPF
                     FGIETAILDPNNGKEIVGEHAEGVLAIKSAWPSFARTIWKNHDRYLDTYLRPYKNVYF
                     TGDGAARDKDGYIWILGRVDDVVNVSGHRLSTAEIEAAIIEDSIVAECAVVGFNDDLT
                     GQAVAAFVVLKNKSNWSNASEQELQNIKKHLIMTVRKDIGPFAAPKLIVLVDDLPKTR
                     SGKIMRRILRKILAGEADQLGDVSTLSNPGVVRHLIDSVKL"
     gene            <755516..>756109
                     /gene="TDEL0H04370"
                     /locus_tag="TDEL_0H04370"
                     /db_xref="GeneID:11501697"
     mRNA            <755516..>756109
                     /gene="TDEL0H04370"
                     /locus_tag="TDEL_0H04370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683459.1"
                     /db_xref="GeneID:11501697"
     CDS             755516..756109
                     /gene="TDEL0H04370"
                     /locus_tag="TDEL_0H04370"
                     /inference="similar to DNA sequence:INSDC:YOR367W"
                     /note="similar to Saccharomyces cerevisiae SCP1 (YOR367W);
                     ancestral locus Anc_7.14"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683507.1"
                     /db_xref="GeneID:11501697"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR003096"
                     /db_xref="UniProtKB/TrEMBL:G9A0A2"
                     /translation="MSYDKKADVTSLDEDLKLLRDTKFSQDAIDDIKSWIFVSVLNEE
                     QPRESLIESLKSGVTLCKVANKLKAADETSGFIKWKESKMPFVQMEQISQFLTFARSY
                     GVPEDELFQTVDLFEEKDPAIVYQTLKSVSRYANKKHPDLFPVIGPQLATKRPRPPVK
                     QKPKHLQTGWSTTEYGYMGGASQKSEGIVFGQRRNIQ"
     gene            complement(<756111..>756542)
                     /gene="TDEL0H04380"
                     /locus_tag="TDEL_0H04380"
                     /db_xref="GeneID:11501698"
     mRNA            complement(<756111..>756542)
                     /gene="TDEL0H04380"
                     /locus_tag="TDEL_0H04380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683460.1"
                     /db_xref="GeneID:11501698"
     CDS             complement(756111..756542)
                     /gene="TDEL0H04380"
                     /locus_tag="TDEL_0H04380"
                     /inference="similar to DNA sequence:INSDC:YAL055W"
                     /note="similar to Saccharomyces cerevisiae PEX22
                     (YAL055W); ancestral locus Anc_7.13"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683508.1"
                     /db_xref="GeneID:11501698"
                     /db_xref="InterPro:IPR024359"
                     /db_xref="UniProtKB/TrEMBL:G9A0A3"
                     /translation="MRQTRKSQVGRWIAIVGTVSAIAIAAGAAIHYLSGPPVSDNKDS
                     SKRKSRCVVITDSVAASKEFNWDDFLTRDIVLLVAPGIHFSQESFKVIHCDTMVGLWS
                     CVRHLKKDQLLLEQSEINESIPVDIPRYTKEILNISCLQDD"
     gene            <756661..>757845
                     /gene="TDEL0H04390"
                     /locus_tag="TDEL_0H04390"
                     /db_xref="GeneID:11501699"
     mRNA            <756661..>757845
                     /gene="TDEL0H04390"
                     /locus_tag="TDEL_0H04390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683461.1"
                     /db_xref="GeneID:11501699"
     CDS             756661..757845
                     /gene="TDEL0H04390"
                     /locus_tag="TDEL_0H04390"
                     /inference="similar to DNA sequence:INSDC:YOR368W"
                     /note="similar to Saccharomyces cerevisiae RAD17
                     (YOR368W); ancestral locus Anc_7.12"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683509.1"
                     /db_xref="GeneID:11501699"
                     /db_xref="GOA:G9A0A4"
                     /db_xref="InterPro:IPR003021"
                     /db_xref="UniProtKB/TrEMBL:G9A0A4"
                     /translation="MRGNGTIFAASTVHLDHITTALSCLTPFGTKEEIVIFIDADGLS
                     FVRELNHVMRIQLFLSRELFMSYTYEGPTDEQTKVCVKINHLLDSFSVANRNIDDVVE
                     CTMSYDGYGSPFLLIFEDSTISERAEYSTYVTHGIDEKGLELDRDKVKFECIIKGDVL
                     YAAMCDLKETGCKECYLYVKSDEDGDHTFAIVSRSGLGLSKIKLPSTKSILEKLEVYG
                     TDYETLVHGKPVVANFDFNLFDKIRMSVRIASKVLFRMDSYGNLSVNILSQTGDVIVT
                     DTRAMANRSRSFGNRQVQLPRDYPGIVVEVNLIEKDHYDEASARELESLMETNELGEP
                     KRTSRKRPREDVDIRQPTSDSDMASHVDMQESNGKNKSPSSTNELPLFFNRKTNCIPH
                     IM"
     gene            complement(<757877..>758305)
                     /gene="TDEL0H04400"
                     /locus_tag="TDEL_0H04400"
                     /db_xref="GeneID:11501700"
     mRNA            complement(<757877..>758305)
                     /gene="TDEL0H04400"
                     /locus_tag="TDEL_0H04400"
                     /product="40S ribosomal protein S12"
                     /transcript_id="XM_003683462.1"
                     /db_xref="GeneID:11501700"
     CDS             complement(757877..758305)
                     /gene="TDEL0H04400"
                     /locus_tag="TDEL_0H04400"
                     /inference="similar to DNA sequence:INSDC:YOR369C"
                     /note="similar to Saccharomyces cerevisiae RPS12
                     (YOR369C); ancestral locus Anc_7.11"
                     /codon_start=1
                     /product="40S ribosomal protein S12"
                     /protein_id="XP_003683510.1"
                     /db_xref="GeneID:11501700"
                     /db_xref="GOA:G9A0A5"
                     /db_xref="InterPro:IPR000530"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:G9A0A5"
                     /translation="MSDVEEVVEIQEEVVEQTAEVTIEDALKVVLRTALVHDGLARGL
                     RESAKALTKGQAQLVVLVSSVTEDNIIKLVEGLANDPENKVPLIKVADAKQLGEWAGL
                     GKADREGNVRKVVGASVVVVTNWGAETDERAMILEHFSQQ"
     gene            complement(<758755..>760575)
                     /gene="TDEL0H04410"
                     /locus_tag="TDEL_0H04410"
                     /db_xref="GeneID:11501701"
     mRNA            complement(<758755..>760575)
                     /gene="TDEL0H04410"
                     /locus_tag="TDEL_0H04410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683463.1"
                     /db_xref="GeneID:11501701"
     CDS             complement(758755..760575)
                     /gene="TDEL0H04410"
                     /locus_tag="TDEL_0H04410"
                     /inference="similar to DNA sequence:INSDC:YOR370C"
                     /note="similar to Saccharomyces cerevisiae MRS6 (YOR370C);
                     ancestral locus Anc_7.10"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683511.1"
                     /db_xref="GeneID:11501701"
                     /db_xref="GOA:G9A0A6"
                     /db_xref="InterPro:IPR000632"
                     /db_xref="InterPro:IPR017230"
                     /db_xref="InterPro:IPR018203"
                     /db_xref="UniProtKB/TrEMBL:G9A0A6"
                     /translation="MLSPERRPSMAERRPTMFSSQSHIVVPHLAGIEDPLPDSTPEKV
                     DVLIVGTGMVESVLAAALSWQGSNVLHVDKNDYYGDTSATLTVDQAKRWVKQVNEGAY
                     PQCYSNAKLYVSTSIANGKGKYASRDFGLDLAPRILFAKSDLLSILVKSRVHQYLEFQ
                     SLSSFHTYENDSFEKLTNTKQEIFTDQNLPLMTKRNLMKFIKFVLNWEDQPEVWKAYS
                     ERPITEILVDKFKLEKPQVFELMFSIGLCYNMNTKTPEALQRIRRYLSSFDVYGPFSV
                     LYSKYGGPGELSQGFCRSAAVGGATYKLNESLTSYDPSTRVAYFSDGSKVSVSEKVVL
                     SPTQAPSYNQNIPKQEYEIHRLTCIVEKSCEEWFSEGESAAVVVFPPGSLKSGNQVVV
                     QAFILGQGSETCPQGTSIWYLSTTEQGPRAEMDLDAALEAMEASILRESSSDLENDES
                     ILQIGPNGEAMINSVRLGQSFKEYIPRENIQYLFKLYYTQYTSTPPFAVVEPSFFEMN
                     NNPSKQMVPGASDNGVLYTAMPSAEISYDEVVTAARILYEKIVGSDDDFFDLDFEDDD
                     DVPISKEDYENAIEDDDEDQDINMGVGRHGSTECVGEMEI"
     gene            complement(<760921..>763425)
                     /gene="TDEL0H04420"
                     /locus_tag="TDEL_0H04420"
                     /db_xref="GeneID:11501702"
     mRNA            complement(<760921..>763425)
                     /gene="TDEL0H04420"
                     /locus_tag="TDEL_0H04420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683464.1"
                     /db_xref="GeneID:11501702"
     CDS             complement(760921..763425)
                     /gene="TDEL0H04420"
                     /locus_tag="TDEL_0H04420"
                     /inference="similar to DNA sequence:INSDC:YAL056W,YOR371C"
                     /note="similar to Saccharomyces cerevisiae GPB2 (YAL056W)
                     and GPB1 (YOR371C); ancestral locus Anc_7.9"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683512.1"
                     /db_xref="GeneID:11501702"
                     /db_xref="InterPro:IPR011043"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:G9A0A7"
                     /translation="MSSPQFSFKVPSNIDAELLKDQNVSPWDHEFEHPTTKDANTKET
                     FTKYEPIPYASNYMSLLTPPASEAEQRRLRLENEMWLKKYYLSKKLTSHATLRHGSVT
                     STSDTSVTHSERSKSGTFLNRFLDDTDGIADVFEIRLTHEALNSDARNEEKKKSGTFG
                     SLAARPYYDHYQRLRTMDIRDRTILKRHTLWMPIVGKDFASLRRSHNRGVEVACPLFV
                     DGTSYIPKEYDTYGGCTIISSVFSEHKLPAFAYHCAIDVNDDVFIMGGLVACYKYDEE
                     APNLQDFQVDGVGNLPPPLLPKIINNPSMISNARLYVMSVASSHVIRPKLSGNVPPPL
                     LCMKASKLTERHIFYYGGFEIKTETFLDDKGIYHLKKRAFVNSTGYILDTVSYRFSKV
                     ELVAQPYKFVTYPTLAARFGHMQMSVLTNKGSSYHGSNAKNYGYNESTETDTSSTGEQ
                     SALNSPAMSFYSSSKNCNTTHGSAVYTIIIFGGYRQTGDDNYEAMNDLWKIEVPVISR
                     GKRGYYKFADTATASIIPKNENTDPWPSARAFFGYSRAGSGLLARTSTYDGMLDRLYE
                     NFSINLTSAANVSKTKPIFPNIPHARKEPLSPRQSTPKETRSNSSSSTNFRVGSPLQN
                     SSPVQWKRQPPEGDLFVIHGGSDNTKVLGDMWWFDLDTESWTEVTTYGKDQERGMTPI
                     KVCIVGQSMVTVGDINVSLGGLNQEEIDRLYLGKDEPKDIARHQQQIGNDFLTIFDLN
                     TQCLQGHNVKRIGEGKDSRLVLADDESNNSGFNDGSYHGLNVTGLVTSFGCQVLHTNG
                     TLTLVGGLVAKRLELDCIGFRGAVLESVLPSISLAS"
     gene            complement(<763768..>765252)
                     /gene="TDEL0H04430"
                     /locus_tag="TDEL_0H04430"
                     /db_xref="GeneID:11501703"
     mRNA            complement(<763768..>765252)
                     /gene="TDEL0H04430"
                     /locus_tag="TDEL_0H04430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683465.1"
                     /db_xref="GeneID:11501703"
     CDS             complement(763768..765252)
                     /gene="TDEL0H04430"
                     /locus_tag="TDEL_0H04430"
                     /inference="similar to DNA sequence:INSDC:YOR372C"
                     /note="similar to Saccharomyces cerevisiae NDD1 (YOR372C);
                     ancestral locus Anc_7.8"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683513.1"
                     /db_xref="GeneID:11501703"
                     /db_xref="UniProtKB/TrEMBL:G9A0A8"
                     /translation="MAPSPPPPSLPEESGLAPGLGVQSVTMDQESDANFFKVISENLK
                     YAFHSPLPNTQFPTPYSSNQLQMSQNANQGIQQTGGEHSSSLIENSMLPGMSGAGNLP
                     SGEPLNDFNMQPSSVLQNGNTFPNEFLLASPEQFKEFLLESPAGFSFLHKTPAKTPLR
                     FVSGKTDENNGNLFGNPRVSSQTPLRSIDLNLMFNSNQMAAASSSPSKRVALSLTPYG
                     RKVLNDIRTPYSKNLASSNSALADFQRARKDFNKMHSSPPTAKKMMKTPQSKLQVRAG
                     TGSCSGTTKLSKENLHLYSGIQGTENGDLCGSSPTTIQLNSSITKSTTRLNASTIPVL
                     TREISESNVDERLFKEDVESLQLSPTPKCNTLSSIDTLRIPELPKMGSFKSETPSMPL
                     KNTTTKKSKTSNSTSYTNRTGKVKKSTKKQPKFQIIVANAQKFNVPTSQKNSKKVTSL
                     KRSQSLLAEAPTTWTGNSSTASSTRTTENDTRRGKRSNSLAEKR"
     gene            <765605..>767863
                     /gene="TDEL0H04440"
                     /locus_tag="TDEL_0H04440"
                     /db_xref="GeneID:11501704"
     mRNA            <765605..>767863
                     /gene="TDEL0H04440"
                     /locus_tag="TDEL_0H04440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683466.1"
                     /db_xref="GeneID:11501704"
     CDS             765605..767863
                     /gene="TDEL0H04440"
                     /locus_tag="TDEL_0H04440"
                     /inference="similar to DNA sequence:INSDC:YOR373W"
                     /note="similar to Saccharomyces cerevisiae NUD1 (YOR373W);
                     ancestral locus Anc_7.7"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683514.1"
                     /db_xref="GeneID:11501704"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:G9A0A9"
                     /translation="MEHSPSKDLAEGLQSFHISSPAPQRNSDGEKNHLKQYLLNNEFP
                     DSKFLSYLGDSESKSYIKRLGDWSMNYGTVQQRSKSPAKGDTNGATGSIAVKENLEPP
                     QFKQYLQNNQAANSSKQESYRDPESELILTASLNDISGIPTNTFKRHDHHERRRFLRN
                     SDTNSVAASERSLDEEDEDVDPALEARGVFDNILKVQKSNYDFHQDKPKDEPTARDSD
                     GTSSYLGETPSSLSPNFGVYPEKPAIDGIKLITPEEMGLVFDNVNGVWYKPPTKNQDI
                     SSSRTIDNGDSTISEDQRRSESGRFIATSATTRVARNQPPLPIDDEFSEERDEVEDDT
                     PLDAPQINPQFLLRGHTMRKNMKSVGNTTQNMIGNITTASQVETSFQQNKRELIAVLT
                     DVIAPRKVDWKQLSSINLQGANLNQVMGLGEILPRVIDCNLNDNNLRGLQGIPPGTIR
                     LTCRNNQLSTSYFNLDGLPHLETVDLSHNSIGHNLGLLANCTHLREVDLSHNKLKSLD
                     GNLGPSRVLKLNLSHNKISGIIDFAQLIKYSQESEAGWTTIEELNLSNNNITSVKNVR
                     CLPNLRVLKLDENPIAELIEPNEITNHNLKTLTITNTQGALTRIGQNQLPYRRLRILR
                     TDCFPQLAQWRSMPRSLEELVLTNGTTEKLLPWQILPNALRRLAITKIQGLKDLPSDL
                     GALIPCLQELDISNNQLESCYKLIEALPTLCLVRLNLKNNPICSTKRGSKQQQLVEVS
                     RMACPRLKELLV"
     gene            <768317..>769876
                     /gene="TDEL0H04450"
                     /locus_tag="TDEL_0H04450"
                     /db_xref="GeneID:11501705"
     mRNA            <768317..>769876
                     /gene="TDEL0H04450"
                     /locus_tag="TDEL_0H04450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683467.1"
                     /db_xref="GeneID:11501705"
     CDS             768317..769876
                     /gene="TDEL0H04450"
                     /locus_tag="TDEL_0H04450"
                     /inference="similar to DNA sequence:INSDC:YOR374W"
                     /note="similar to Saccharomyces cerevisiae ALD4 (YOR374W);
                     ancestral locus Anc_7.6"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683515.1"
                     /db_xref="GeneID:11501705"
                     /db_xref="GOA:G9A0B0"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:G9A0B0"
                     /translation="MFARSALVARGSATSQVGRIQLRFFSHLPMSIPIKLPNGLEYEQ
                     PTGLFINNRFVPSKQKKTFEVINPSTEEEICHVYEGREDDVADAVNAADVAFNNGSWS
                     NIDPLQRGNALYKLAQLIEKDKDVIASIETLDNGKAISSAKGDVELVINYLKSAAGFA
                     DKIDGRMIDTGSTHFSYTKREPLGVCGQIIPWNFPLLMWAWKIAPALVTGNTVVLKTA
                     ESTPLSALYVSKYIPQAGIPPGVVNIVSGFGKIVGEAISTHPKVKKIAFTGSTATGKH
                     IYQTAAASLKKATLELGGKSPNIVFADADVKHAVENIILGIYYNSGEVCCAGSRVYVE
                     QSAYDELIKQFKVASEAVKVGDPFDENTFQGAQTSQNQLNKILSYVEIGKDEGATLIT
                     GGERIGDKGYFVKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSLDEVVEMANDSEYGL
                     AAGIHTLNINTALKVADRLKAGTVWINTYNDFHHSVPFGGFNASGLGREMGAETLENY
                     TQVKAVRAKLV"
     gene            complement(<769988..>771136)
                     /gene="TDEL0H04460"
                     /locus_tag="TDEL_0H04460"
                     /db_xref="GeneID:11501706"
     mRNA            complement(<769988..>771136)
                     /gene="TDEL0H04460"
                     /locus_tag="TDEL_0H04460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683468.1"
                     /db_xref="GeneID:11501706"
     CDS             complement(769988..771136)
                     /gene="TDEL0H04460"
                     /locus_tag="TDEL_0H04460"
                     /inference="similar to DNA sequence:INSDC:YAL060W"
                     /note="similar to Saccharomyces cerevisiae BDH1 (YAL060W);
                     ancestral locus Anc_7.3"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683516.1"
                     /db_xref="GeneID:11501706"
                     /db_xref="GOA:G9A0B1"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G9A0B1"
                     /translation="MRALAYFKKGDIHFADDLPEPTINSDEEVLIEVSWAGICGTDLH
                     EYSDGPIFMPQDGGSHPLSGKKLPQPMGHEMSGIVSKIGSKVTKVKVGDHVVVEAGCS
                     CMDVKRWKESPLKGGKTCSACEKGLVNICAHACFTGLGTSGGGFAERLTVSQDHCIPI
                     PKDLPLDVAALVEPLSVTWHAAKVAGFQKGQTACVLGAGPIGLATILTLKGLGASKIV
                     VSELAQIRRDMAASMGVEVFNPAEHKDAIAELRKIPEGATGFDAAFDCSGVKATFNTA
                     LHVTTFRGVSVNIAIWGNKPIDYYPMDITLQEKRLTGSIGYTVQDFKEVVEAIHTGEI
                     PIDDCRQMITGKQKLEDGWEKGFVELMNHKETNVKILLTPNNHNELST"
     gene            complement(<772394..>773773)
                     /gene="TDEL0H04470"
                     /locus_tag="TDEL_0H04470"
                     /db_xref="GeneID:11501707"
     mRNA            complement(<772394..>773773)
                     /gene="TDEL0H04470"
                     /locus_tag="TDEL_0H04470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683469.1"
                     /db_xref="GeneID:11501707"
     CDS             complement(772394..773773)
                     /gene="TDEL0H04470"
                     /locus_tag="TDEL_0H04470"
                     /inference="similar to DNA sequence:INSDC:YAL062W,YOR375C"
                     /note="similar to Saccharomyces cerevisiae GDH3 (YAL062W)
                     and GDH1 (YOR375C); ancestral locus Anc_7.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683517.1"
                     /db_xref="GeneID:11501707"
                     /db_xref="GOA:G9A0B2"
                     /db_xref="InterPro:IPR006095"
                     /db_xref="InterPro:IPR006096"
                     /db_xref="InterPro:IPR006097"
                     /db_xref="InterPro:IPR014362"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G9A0B2"
                     /translation="MSAYPYEPEFQQAHDEIISSLRDSTLFQNKPEYEKVLPIVAVPE
                     RIIQFRVAWENDQGKQEVATGYRVQYNSAKGPYKGGLRFHPTVNLSILKFLGFEQIFK
                     NALTGLDMGGAKGGLCVDLKGRSNNEIRRICYSFMRELSRHIGQDTDVPAGDIGVGGR
                     EVGYLFGAYRSFRNSWEGVLTGKGLNWGGSLIRPEATGYGVIYFAQAMIDFATKGKES
                     FEGKRVAISGSGNVAQYAALKVIELGGKVVSLSDSKGCIISETGITSEQVAAIADAKI
                     HFKSLEQIVGEFSAFAENKVQYIAGARPWTHAGKVDIALPCATQNEVSGDEAKALVAA
                     GVKFVAEGSNMGCTPEAIHTFEANRLTASSNDTVWYVGGKASNLGGVLVSGLEMAQNS
                     QRMTWTREAVDQELKRGMINCFNDCISAAQTYSNETNKQTLPSLVKGANLASFIKVAD
                     AMFDQGDVY"
     gene            complement(<774396..>776108)
                     /gene="TDEL0H04480"
                     /locus_tag="TDEL_0H04480"
                     /db_xref="GeneID:11501708"
     mRNA            complement(<774396..>776108)
                     /gene="TDEL0H04480"
                     /locus_tag="TDEL_0H04480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683470.1"
                     /db_xref="GeneID:11501708"
     CDS             complement(774396..776108)
                     /gene="TDEL0H04480"
                     /locus_tag="TDEL_0H04480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683518.1"
                     /db_xref="GeneID:11501708"
                     /db_xref="GOA:G9A0B3"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G9A0B3"
                     /translation="MSNNKDVFLETEKYSSSASHIEMEHISTKDVYEDPTQAKFDLEN
                     DIGNKTSDLLNKSFNMQEEVAALDQLGSSYKKKQSFWGKLKSVEFEVDFENKNRMVIM
                     LGAFAAFAGILSGIDQSIISGASIGMNKMLHLTKHQASLVSSLMPWVLVGGSILLTPL
                     SETFGRKKALVMSCIFYTVGAIVCAAAGNHHEMYAGRFLIGVGVGIEGGGIGVYIAES
                     VPSSVRGSLVSLYQFNIALGELFGYIVGVIFFDVKGGWRYMVGSSLVFSTILLIGLLF
                     LPESPRWLMHKGRVGESWNVWKRLRDVTDDNNTVEFLELRQAAEKDRDLRANESRFQS
                     LFDLFLVPRNRRALIFSSTMIGLGQLTGINAIMYYMSTLMQQIGFDDKQSVAMSMVGG
                     AALLLGTIPAILWMDRFGRRTWAMTIVIFAVGLVLVGVGYRININTNLAAAEGVYLTG
                     LILYNIAFGSYAALTWVLPSESFSLGTRSIGMTVASVLLYTFAFTVTYNFEKMQDAMT
                     YTGLTLGFYGGIALVIGIPYQLLCMPETKNRTLEEIDDIFAQPTREIIKTNIAYLKKG
                     KLSY"
     gene            777739..777812
                     /gene="TDEL0Htrna3V"
                     /locus_tag="TDEL_0Htrna3V"
                     /db_xref="GeneID:11501709"
     tRNA            777739..777812
                     /gene="TDEL0Htrna3V"
                     /locus_tag="TDEL_0Htrna3V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:11501709"
     gene            complement(<778066..>779013)
                     /gene="TDEL0H04490"
                     /locus_tag="TDEL_0H04490"
                     /db_xref="GeneID:11501718"
     mRNA            complement(<778066..>779013)
                     /gene="TDEL0H04490"
                     /locus_tag="TDEL_0H04490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683471.1"
                     /db_xref="GeneID:11501718"
     CDS             complement(778066..779013)
                     /gene="TDEL0H04490"
                     /locus_tag="TDEL_0H04490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683519.1"
                     /db_xref="GeneID:11501718"
                     /db_xref="GOA:G9A0B4"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR011304"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018177"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:G9A0B4"
                     /translation="MSSHTCAKVAIIGAGQVGSTTAYTLLLSNLVAEVVLIDVDKRKV
                     EGQFMDLNHAAPLTKESRFSAGDYESCAGAAVVIVTGGANQKPGQTRMELAARNVKIM
                     QEIIPKIVKYAPNAILLIATNPVDVLTYASYKLSGFPASKVIGSGTVLDSARLQHNLS
                     KHFNLSSESVNAFIIGEHGDSGVPVWSLAEIAGMKVEDYCKQSKREFDPKILIGMYEE
                     TRDAAAYIIERKGYTNFGIAAGLARIVRAILRDEGALLTVSTVNEHYGMKDLSLSVPT
                     RVDRNGAQHVVDLLLDDKELKLIKESGHKIKSACDELGI"
     gene            complement(<779335..>780216)
                     /gene="TDEL0H04500"
                     /locus_tag="TDEL_0H04500"
                     /db_xref="GeneID:11501710"
     mRNA            complement(<779335..>780216)
                     /gene="TDEL0H04500"
                     /locus_tag="TDEL_0H04500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683472.1"
                     /db_xref="GeneID:11501710"
     CDS             complement(779335..780216)
                     /gene="TDEL0H04500"
                     /locus_tag="TDEL_0H04500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683520.1"
                     /db_xref="GeneID:11501710"
                     /db_xref="GOA:G9A0B5"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G9A0B5"
                     /translation="MKQDTSFKWQPPSIDSLNLASLNVTIVGGTGGLGRAIALVLASK
                     GAQVTVIGRTFRDSEVKNINFIEADMTSIKVSREVAERLPADNINILLFTTGIFASKT
                     KQVTPEGLERDLAVSYLNRLAMIEILAPKMKRSESSLGFGPRIFLMGYPGAGELGTIE
                     DLNQDKNYGLMKAHMNTVAGNEALVLVGAKRYPQLRFFGLNPGLVRTNIRDNMLGQGS
                     WKSYIIEGIIGFFNKTPEQYANTIAPLLVTNEIEKRSGTSYNANGQAITTSDGMTLAY
                     ATSYVEASEELLKTKGL"
     gene            complement(785310..788704)
                     /gene="Tdel_RDN25-1"
                     /locus_tag="TDEL_RDN25-1"
                     /db_xref="GeneID:11501711"
     rRNA            complement(785310..788704)
                     /gene="Tdel_RDN25-1"
                     /locus_tag="TDEL_RDN25-1"
                     /product="25S ribosomal RNA"
                     /transcript_id="XR_002431970.1"
                     /db_xref="GeneID:11501711"
     gene            complement(788962..789119)
                     /gene="Tdel_RDN58-1"
                     /locus_tag="TDEL_RDN58-1"
                     /db_xref="GeneID:11501733"
     rRNA            complement(788962..789119)
                     /gene="Tdel_RDN58-1"
                     /locus_tag="TDEL_RDN58-1"
                     /product="5.8S ribosomal RNA"
                     /transcript_id="XR_002431975.1"
                     /db_xref="GeneID:11501733"
     gene            complement(789413..791210)
                     /gene="Tdel_RDN18-1"
                     /locus_tag="TDEL_RDN18-1"
                     /db_xref="GeneID:11501738"
     rRNA            complement(789413..791210)
                     /gene="Tdel_RDN18-1"
                     /locus_tag="TDEL_RDN18-1"
                     /product="18S ribosomal RNA"
                     /transcript_id="XR_002431967.1"
                     /db_xref="GeneID:11501738"
     gene            792800..792920
                     /gene="Tdel_RDN5-1"
                     /locus_tag="TDEL_RDN5-1"
                     /db_xref="GeneID:11501730"
     rRNA            792800..792920
                     /gene="Tdel_RDN5-1"
                     /locus_tag="TDEL_RDN5-1"
                     /product="5S ribosomal RNA"
                     /transcript_id="XR_002431973.1"
                     /db_xref="GeneID:11501730"
     STS             792800..792912
                     /gene="Tdel_RDN5-1"
                     /locus_tag="TDEL_RDN5-1"
                     /standard_name="PMC99952P2"
                     /db_xref="UniSTS:273711"
     gene            complement(794041..797435)
                     /gene="Tdel_RDN25-2"
                     /locus_tag="TDEL_RDN25-2"
                     /db_xref="GeneID:11501736"
     rRNA            complement(794041..797435)
                     /gene="Tdel_RDN25-2"
                     /locus_tag="TDEL_RDN25-2"
                     /product="25S ribosomal RNA"
                     /transcript_id="XR_002431971.1"
                     /db_xref="GeneID:11501736"
     gene            complement(797693..797850)
                     /gene="Tdel_RDN58-2"
                     /locus_tag="TDEL_RDN58-2"
                     /db_xref="GeneID:11501734"
     rRNA            complement(797693..797850)
                     /gene="Tdel_RDN58-2"
                     /locus_tag="TDEL_RDN58-2"
                     /product="5.8S ribosomal RNA"
                     /transcript_id="XR_002431976.1"
                     /db_xref="GeneID:11501734"
     gene            complement(798144..799941)
                     /gene="Tdel_RDN18-2"
                     /locus_tag="TDEL_RDN18-2"
                     /db_xref="GeneID:11501739"
     rRNA            complement(798144..799941)
                     /gene="Tdel_RDN18-2"
                     /locus_tag="TDEL_RDN18-2"
                     /product="18S ribosomal RNA"
                     /transcript_id="XR_002431968.1"
                     /db_xref="GeneID:11501739"
     gene            801531..801651
                     /gene="Tdel_RDN5-2"
                     /locus_tag="TDEL_RDN5-2"
                     /db_xref="GeneID:11501731"
     rRNA            801531..801651
                     /gene="Tdel_RDN5-2"
                     /locus_tag="TDEL_RDN5-2"
                     /product="5S ribosomal RNA"
                     /transcript_id="XR_002431974.1"
                     /db_xref="GeneID:11501731"
     STS             801531..801643
                     /gene="Tdel_RDN5-2"
                     /locus_tag="TDEL_RDN5-2"
                     /standard_name="PMC99952P2"
                     /db_xref="UniSTS:273711"
     gene            complement(802772..806166)
                     /gene="Tdel_RDN25-3"
                     /locus_tag="TDEL_RDN25-3"
                     /db_xref="GeneID:11501737"
     rRNA            complement(802772..806166)
                     /gene="Tdel_RDN25-3"
                     /locus_tag="TDEL_RDN25-3"
                     /product="25S ribosomal RNA"
                     /transcript_id="XR_002431972.1"
                     /db_xref="GeneID:11501737"
     gene            complement(806424..806581)
                     /gene="Tdel_RDN58-3"
                     /locus_tag="TDEL_RDN58-3"
                     /db_xref="GeneID:11501735"
     rRNA            complement(806424..806581)
                     /gene="Tdel_RDN58-3"
                     /locus_tag="TDEL_RDN58-3"
                     /product="5.8S ribosomal RNA"
                     /transcript_id="XR_002431977.1"
                     /db_xref="GeneID:11501735"
     gene            complement(806875..808672)
                     /gene="Tdel_RDN18-3"
                     /locus_tag="TDEL_RDN18-3"
                     /db_xref="GeneID:11501740"
     rRNA            complement(806875..808672)
                     /gene="Tdel_RDN18-3"
                     /locus_tag="TDEL_RDN18-3"
                     /product="18S ribosomal RNA"
                     /transcript_id="XR_002431969.1"
                     /db_xref="GeneID:11501740"
     gene            complement(<813321..>815075)
                     /gene="TDEL0H04510"
                     /locus_tag="TDEL_0H04510"
                     /db_xref="GeneID:11501732"
     mRNA            complement(<813321..>815075)
                     /gene="TDEL0H04510"
                     /locus_tag="TDEL_0H04510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683473.1"
                     /db_xref="GeneID:11501732"
     CDS             complement(813321..815075)
                     /gene="TDEL0H04510"
                     /locus_tag="TDEL_0H04510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683521.1"
                     /db_xref="GeneID:11501732"
                     /db_xref="GOA:G9A0B6"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:G9A0B6"
                     /translation="MDLKSDKFIKNDTDTLSVSASKEHGAYSSAVRDWRDSFKRQDLL
                     EMPDALEYNDLTEREKTQLKLASQPYKKVLSQRHLTMISIGGTLGTGLFIGLGAALTS
                     GPAALLIGYLLVGASMFCVIQSASELACQFPVTGSYSSHVTRFVDESVGFTVGTNYTL
                     AWLVLFPSELIGCSLTISYWNSTINPAVWVAIFLVFVLWINLFGVRLFAETEFVLSII
                     KVLAIVIFIIIGIVLIAGGGQDSGGYIGTRYWHDPGPFAKPVFKNLCNTFVSAAFSYG
                     GSEMVLLTGTESKNISSIARAAKGTFYRIAIFYITTVVVIGCLVPYNDPRLLNASSSE
                     DISASPFVIALGNTGSMGSKVSNFMNAIILVSVVSVCNSTVYASSRLIQALGAAGHLP
                     GICGYMDMKGRPLVGIAITGAFGLLGFLVATNKQSEVFTWLFALCSIASFVTWFCICL
                     AQVRFRLAMKARKRSKEHIAYRSMLGIYGGIAGCIVNFLLIAGEIYVSAWPVDGKSSA
                     EGFFEYDLSIPIMIIVFLGHKIYRNDWKNWYVKRRDMDLDTGCSIENLELFQSQKESE
                     KEDLACKPLYYRIYRFWC"
     gene            complement(<817439..>819277)
                     /gene="TDEL0H04520"
                     /locus_tag="TDEL_0H04520"
                     /db_xref="GeneID:11501712"
     mRNA            complement(<817439..>819277)
                     /gene="TDEL0H04520"
                     /locus_tag="TDEL_0H04520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683474.1"
                     /db_xref="GeneID:11501712"
     CDS             complement(817439..819277)
                     /gene="TDEL0H04520"
                     /locus_tag="TDEL_0H04520"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683522.1"
                     /db_xref="GeneID:11501712"
                     /db_xref="GOA:G9A0B7"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:G9A0B7"
                     /translation="MVNHFNKVTYSVDYLHRLFGHVNIKSIKDSTKDRSIAGIEVDEV
                     NWTNLAKFQSEVCMAGKSTKGRHLMNSRLKYQKEYKPFQFIHTDLFGPVQVTAVNVPR
                     YLLAFTDECTRYKWVFPLREKDSQSITARFSELVRFIETQLETKVLCFQMDQGTEFTN
                     KTITQFFHDNGIITRFTTVGDSRSNGVAERTNLLLLNDCRTLLTSVKLPDDLWFYAVK
                     FATLMRNSIVTTSTKESPRAKAGLTGLDISTVLPFGQPVIVNKPKTSSKLHSRGWKGY
                     ALCPSSVSFGYLIYVPGAPQDIIDTRHYRAIRDGVEPKETIIDSVIDHAEERDVNDRS
                     DHDIPKEPSPLPNLNFDPKMIPSQNEKLGGTNIQVVTKPKPTFNMDPSLLKIIQSGGT
                     TGARAGSTLPQGDESEQNKVSDPLPTVSDQPDPTEKSHSGGTSALKLPPLMITKKKVS
                     NVPILKPPVKQMVSTPPKLITIATDDENSVEEQNQSEPTSESEWYPSDPVSGGTNNSE
                     EDEASSSEESSPADAPANNMKRKRDDSGEIEDQDGTTSQESPPSSKQRIHYAQVTKNH
                     SETHAERPSLSYKEAITYNSNAEGKEKLIAGYEKEINQLIKMIAFL"
     gene            complement(<822059..>825700)
                     /gene="TDEL0H04530"
                     /locus_tag="TDEL_0H04530"
                     /db_xref="GeneID:11501713"
     mRNA            complement(<822059..>825700)
                     /gene="TDEL0H04530"
                     /locus_tag="TDEL_0H04530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683475.1"
                     /db_xref="GeneID:11501713"
     CDS             complement(822059..825700)
                     /gene="TDEL0H04530"
                     /locus_tag="TDEL_0H04530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683523.1"
                     /db_xref="GeneID:11501713"
                     /db_xref="GOA:G9A0B8"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G9A0B8"
                     /translation="MPLDMICLDRKEDETSWKWVQNMYLQTVQAEVNIGQSSFTTAPE
                     PQAVTMCGKLLNRQYIRDFHFTCQSRIDSLIDKLKEYFYMPSVEDIACGILRNRRVSF
                     ADPMGDIVYNEPSSFFDLIPHQYHGDIIPKFRQGKTGTAAVRALVELVSNEVAPLLMW
                     MVYFGVGHPYRFPELRQMAFAGSQRNVYVNDTTRRLQLYSNYNKNKSSNIVLKTMDGV
                     TSEYLFYFMTVLKQMQFWALGPDYKPINISVETRVLKESISSEKKSERALRTYLFVDT
                     AKGDLVPYKLFRNLLDELPEGDRTRLNFRELRQAMRDVIRYYCNMTLQDQKDLHESLV
                     HELMANHSVLTGFETYAVNHFNMSSLSGSGTTNLQQRASKRYISCLNLDDAVSLETRP
                     SDDFENEHSTQKFKLSSEYRRYEDLEAAGRKIFGPEFSFRDENQRTITNDIYMGELPS
                     RVVHAPTGYGKTEMFHLPLIALASKKNCRHVSFVFLPYTVILADSMRRLKSKNLPRVN
                     DVKHFIDTGYDGITDVYVSVFDDLAQTQFASRIAEWGYANSLRSTERKIKLGYAIIDE
                     FHNFHLEKYRKPQFEPIKRLSFDGFEKLLFFSATAPAQIADAALQSIGFIGLEKPATS
                     LRETVLAEKECMRGIRGCSTPMSDLVQNIPLSHVYKEFKHVSKPYQVAFKLLKSLFMY
                     EQQAKAVVLLNSKRMVEWLAKEWELDFKIVWIHGELNASEKARRADSFIRNQKENVLL
                     GTKLATEGIDVHKLKMVIMVDYKPTIIEFLQAGGRLRTTGMLYVLLDPKTAIKREKSD
                     MAPMDFACPTTQMSRFYGLPLRNTDLHHLQCCGSTNFLPANTEQLVLRVAKAATNTAY
                     ETKKDKDDRLTNNKRKAPDLPFLSMEKRRMNRLFHRNGHYTNIFDHMGHGETLAQCLQ
                     LNGISSHFWPSGTLIEKGSCPNCLKLSDCVCVHKTQLTYRQIACEALAVQRMVLDDEQ
                     YKKHLEESKPYFLDPVGYLLIYDKAKQNLYDTVRSQYVWFENLIRRRVIVAAECLHGM
                     KNSSLFKYTAEQIENIYLDKWASMKEQQTEALEYFWCWEKRKCAKVWERERSKEGTSF
                     ASLIEDHGTYTRLYKSSIASFHGPHYVQNQYYGGHLHSRRLYLSWKNRKVERIFQPSW
                     DMYLSMVLGMFFNERLKSRIYSLVEQVKDIRLIPHWMKLQMIEVVMADGQTIPFFMLC
                     FAIHQEMES"
     gene            complement(<826835..>827683)
                     /gene="TDEL0H04540"
                     /locus_tag="TDEL_0H04540"
                     /db_xref="GeneID:11501714"
     mRNA            complement(<826835..>827683)
                     /gene="TDEL0H04540"
                     /locus_tag="TDEL_0H04540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003683476.1"
                     /db_xref="GeneID:11501714"
     CDS             complement(826835..827683)
                     /gene="TDEL0H04540"
                     /locus_tag="TDEL_0H04540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003683524.1"
                     /db_xref="GeneID:11501714"
                     /db_xref="GOA:G9A0B9"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:G9A0B9"
                     /translation="MSTTVASGITIPQPDPQLPESIMDMFSMKGKVVAVTGASGGIGY
                     EVALGFAQAGADVAMWYNTNPAIEKEVEALSKMYGVKVRAYKCSLTDSEEVGNTIKRI
                     ERDFGKINAMVANAGVAWASGPLVDFAEKDSKACDAEWMRIMDVDVNSVYYVAKHVGS
                     IFKRQGFGSLVITASMSGHIVNVPQLQVAYNAAKAALIHMARSLAVEWAGFARVNTVS
                     PGYVETPIAATRPLELKKKWMSLVPMGRLSSPKEMVGAYLYLASDAATYVTGTDIIVD
                     GGYCCA"
     gap             832340..832889
                     /estimated_length=550
CONTIG      join(HE616749.1:1..833973)
//
DBGET integrated database retrieval system