GenomeNet

Database: RefSeq
Entry: NC_016521
LinkDB: NC_016521
Original site: NC_016521 
LOCUS       NC_016521            1164785 bp    DNA     linear   CON 02-JUN-2017
DEFINITION  Tetrapisispora phaffii CBS 4417 chromosome 2, complete genome.
ACCESSION   NC_016521
VERSION     NC_016521.1
DBLINK      BioProject: PRJNA79335
            BioSample: SAMEA2272094
            Assembly: GCF_000236905.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Tetrapisispora phaffii CBS 4417
  ORGANISM  Tetrapisispora phaffii CBS 4417
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Tetrapisispora.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 1164785)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1164785)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-NOV-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE612857.
            Accession numbers for all the chromosomes/scaffold in this genome
            project: HE612856-HE612872.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1164785
                     /organism="Tetrapisispora phaffii CBS 4417"
                     /mol_type="genomic DNA"
                     /strain="type strain:CBS 4417"
                     /db_xref="taxon:1071381"
                     /chromosome="2"
     gene            complement(<1052..>1927)
                     /gene="TPHA0B00100"
                     /locus_tag="TPHA_0B00100"
                     /db_xref="GeneID:11534900"
     mRNA            complement(<1052..>1927)
                     /gene="TPHA0B00100"
                     /locus_tag="TPHA_0B00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684069.1"
                     /db_xref="GeneID:11534900"
     CDS             complement(1052..1927)
                     /gene="TPHA0B00100"
                     /locus_tag="TPHA_0B00100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684117.1"
                     /db_xref="GeneID:11534900"
                     /db_xref="UniProtKB/TrEMBL:G8BQ86"
                     /translation="MDFLFFILLGPTIADDQTSDLEEYQVMTEALGNGSFAVTSNPKL
                     FKLSLWGAFFHEGTSTAWDLFRCCKTCESWNEVAQSTECDQAARSAIRTVVLGGLLAA
                     GSANGVFRNKRELSSHHAHWTNSMVNGVKSGLYPSLDYHSHYTDSMEKLSYVILGTEK
                     GEPIMNVTLSSESYGNGVVTAKAALTNSTLSKREANLFPLCYGQVSVDYCRNENYLLS
                     TSSSGVYDAATVISNHAAPNGVNDSGYDDYLFDYYKTYVCDEANKNCDWYGSFRLWYA
                     DNTNIYEWSKCDNGL"
     gene            <7999..>8484
                     /gene="TPHA0B00120"
                     /locus_tag="TPHA_0B00120"
                     /db_xref="GeneID:11535103"
     mRNA            <7999..>8484
                     /gene="TPHA0B00120"
                     /locus_tag="TPHA_0B00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684070.1"
                     /db_xref="GeneID:11535103"
     CDS             7999..8484
                     /gene="TPHA0B00120"
                     /locus_tag="TPHA_0B00120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684118.1"
                     /db_xref="GeneID:11535103"
                     /db_xref="UniProtKB/TrEMBL:G8BQ87"
                     /translation="MVDKKIRNKKSRYHKMKLSNIFGILVTLLVCVSGSFPYYDQFAL
                     TTTSCLYQYFDVEDPVKYKIAWWGSFLASPGGPIRWIEKMQDTCDACKADHKDPENTD
                     CEDGIFDLVTGAIQNVVTGTMGWNSGLRLNNALFDGHLNKRNFVLLAAVLIVWVAYIW
                     D"
     gene            complement(<9511..>9645)
                     /gene="TPHA0B00130"
                     /locus_tag="TPHA_0B00130"
                     /db_xref="GeneID:11535133"
     mRNA            complement(<9511..>9645)
                     /gene="TPHA0B00130"
                     /locus_tag="TPHA_0B00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684071.1"
                     /db_xref="GeneID:11535133"
     CDS             complement(9511..9645)
                     /gene="TPHA0B00130"
                     /locus_tag="TPHA_0B00130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684119.1"
                     /db_xref="GeneID:11535133"
                     /db_xref="UniProtKB/TrEMBL:G8BQ88"
                     /translation="MCFSATHKDEWYADVRIKRWKENNYYIKPSWDIPCQNFVLVPSI
                     "
     gene            <12299..>13213
                     /gene="TPHA0B00140"
                     /locus_tag="TPHA_0B00140"
                     /db_xref="GeneID:11535009"
     mRNA            <12299..>13213
                     /gene="TPHA0B00140"
                     /locus_tag="TPHA_0B00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684072.1"
                     /db_xref="GeneID:11535009"
     CDS             12299..13213
                     /gene="TPHA0B00140"
                     /locus_tag="TPHA_0B00140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684120.1"
                     /db_xref="GeneID:11535009"
                     /db_xref="UniProtKB/TrEMBL:G8BQ89"
                     /translation="MFISIISYGPWSIKGSSTKYSKELVYGEIDDSQLSTIFYQLGIN
                     YNERSFTKRIPSAINFMLEQFRAETKVIIAIGKQNTSTLIILAPCWINSKKKNSVLNI
                     DLEEVNRVTVSKINAMETYAPTIFPDSMEMGTLTQQNNYVTEIRNINFVTIRSLKKYY
                     PIMYINCSKKDITLSMEHSKYCTQFFDGLMKHSPFKYVSLLRYPIQYEMKMDGVVRRE
                     KIIKFSSNEHRLGNIVLMCRNRSQNRYEIISQSENVYLKEEYIKRVGDYRYYRTIGTL
                     TAASRPEDDDWRFEKFAQLPTYYEAMTT"
     gene            complement(<13235..>13987)
                     /gene="TPHA0B00150"
                     /locus_tag="TPHA_0B00150"
                     /db_xref="GeneID:11534977"
     mRNA            complement(<13235..>13987)
                     /gene="TPHA0B00150"
                     /locus_tag="TPHA_0B00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684073.1"
                     /db_xref="GeneID:11534977"
     CDS             complement(13235..13987)
                     /gene="TPHA0B00150"
                     /locus_tag="TPHA_0B00150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684121.1"
                     /db_xref="GeneID:11534977"
                     /db_xref="UniProtKB/TrEMBL:G8BQ90"
                     /translation="MNKLLFTHLIDKLKYSNDPFYLKLERAKCTKKFAKLIIILLTFT
                     YETTEHIKIIKKISSNLKNVNTGRWLLFLRAAYMFVNLDTNVGNLNLAEQKNKFIWIR
                     LKKIIFESVQGEDIGTELLETLNDRLQIHEDLVRQLNEDVDYLRKELRVNPQYFASFF
                     MIHYPSIIGMVISAIIVIIDFINNKYEDHKSILYDIKFWISLSSGIFAYILSLSIWYI
                     NDIVYILSCRWMKRNDWYIRVEEHKVCNEDII"
     gap             19328..19347
                     /estimated_length=20
     gene            complement(<19807..>20541)
                     /gene="TPHA0B00160"
                     /locus_tag="TPHA_0B00160"
                     /db_xref="GeneID:11534796"
     mRNA            complement(<19807..>20541)
                     /gene="TPHA0B00160"
                     /locus_tag="TPHA_0B00160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684074.1"
                     /db_xref="GeneID:11534796"
     CDS             complement(19807..20541)
                     /gene="TPHA0B00160"
                     /locus_tag="TPHA_0B00160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684122.1"
                     /db_xref="GeneID:11534796"
                     /db_xref="UniProtKB/TrEMBL:G8BQ91"
                     /translation="MFRTSKKVIVAVGNDKSNTLLVPTPCWISSAKKRTTLNLNLQEI
                     NATTISKINTMNTFSPTLYPDRMELGTLTEQEQCVSPLLKTAFFTVRNLETYVPVIFI
                     NCTQKDAIRSMKLIRYCVQCCEDGLKYSPFIFVSLLDYPVQYELKRSGTARWERLIKF
                     AGNSPNPVTLIEVCRNIAERRYGSGVENAKLFLKEGVIRKRTNCRHYREMGFVIAESN
                     TNNDWKPRRYPNPPTYSEIMPGTSTL"
     gene            complement(<27065..>28297)
                     /gene="TPHA0B00170"
                     /locus_tag="TPHA_0B00170"
                     /db_xref="GeneID:11535048"
     mRNA            complement(<27065..>28297)
                     /gene="TPHA0B00170"
                     /locus_tag="TPHA_0B00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684075.1"
                     /db_xref="GeneID:11535048"
     CDS             complement(27065..28297)
                     /gene="TPHA0B00170"
                     /locus_tag="TPHA_0B00170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684123.1"
                     /db_xref="GeneID:11535048"
                     /db_xref="GOA:G8BQ92"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8BQ92"
                     /translation="MSIVNKIMFWKSSKKEESKKATQNASTQKTAKKATQTKPEMPST
                     MKAVVIEESKPVVKSDIPVPELEEGFALIKVLAVAGNPTDWKHIAYKIGPQGAILGCD
                     AAGEIVKLGAGVDTEKFKVGDKVYGFIHGASVKHPENGAFAEYAAIDTKICYRPAKDI
                     SLAKKDLPAGPVTTLEGAVSFPVSLTTAGLALTNTFKVKLQWEPAEAQLKTDLLIWGG
                     ATALGQPLIQLAKKLNAFNNIVVVASKKHEEQLKAYGATEVFDYHDEDVISQITTKYP
                     NVTKLVDAVSNKETINQLYQCASKTEESTLLQLVTLSIDDIEEANRRDNVKIVGFLLY
                     SATGKEVPFLHMVIPPLPDFRKDAIEFIEFINEKINNGEIHHIPIKVFQKGLEDVPGM
                     LADIEAGKNSGEKYVAVL"
     gene            complement(<29722..>31623)
                     /gene="TPHA0B00180"
                     /locus_tag="TPHA_0B00180"
                     /db_xref="GeneID:11535008"
     mRNA            complement(<29722..>31623)
                     /gene="TPHA0B00180"
                     /locus_tag="TPHA_0B00180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684076.1"
                     /db_xref="GeneID:11535008"
     CDS             complement(29722..31623)
                     /gene="TPHA0B00180"
                     /locus_tag="TPHA_0B00180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684124.1"
                     /db_xref="GeneID:11535008"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G8BQ93"
                     /translation="MSHKQDMYINSDEIVNDDIKLEDYQIRNKILSDKDATESNASEE
                     ITTNKLKPAVSSTGVYNMEIYAKYYANPFQKFLIYFSLFVIYYAYGLDGNVRPTYQTL
                     ATSSFNRHSLNSTVTCINRVTSSAGQIWFARASDIFSREFSMVISILFYVVGTIISSQ
                     ATSVAKYAVGACIYGIGHAGIVLLCEIYMADFSNLNWRVVAENAPMLPAIINTWVSGN
                     ITSDLGSKWQWGLGMWAIIFPASCIPLFVCIYHMRYMAKKNNEKIRKIFEKPSEIAWK
                     KYLIDIFIWKLDFIGLVLLVAVFALILVPFTTSGGLHREWNSANFIVPEVVGWVVALP
                     IFSVWEWKFSRYPILRLDLISDRGIYSALSISFFIQFCLYVNDTYLYTFLLVAVDQTT
                     KSGTRINSLMSFVNVITACCLGLFIVKIRRTQIFIVIGCVSWFVVYGLYVHYNGGLGS
                     RSGIITASCLSGFGYGFIKSPLKASLQASSNSHQNLAIVTALFLAIGNIGTAFGAAVA
                     GAIWSNLLPHRLEKSIGNVTLADSAFDSPIKFIKQYKWHTAVRQHLVSSYGSVWRILN
                     IVCLVLVIPMLVSSFLLRDRKLSNSVAYDQRDFSPTDCEEENIGQDRRSYIGDRYAKF
                     RVLRERIFK"
     gene            complement(<34397..>35341)
                     /gene="TPHA0B00190"
                     /locus_tag="TPHA_0B00190"
                     /db_xref="GeneID:11535021"
     mRNA            complement(<34397..>35341)
                     /gene="TPHA0B00190"
                     /locus_tag="TPHA_0B00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684077.1"
                     /db_xref="GeneID:11535021"
     CDS             complement(34397..35341)
                     /gene="TPHA0B00190"
                     /locus_tag="TPHA_0B00190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684125.1"
                     /db_xref="GeneID:11535021"
                     /db_xref="GOA:G8BQ94"
                     /db_xref="InterPro:IPR001389"
                     /db_xref="UniProtKB/TrEMBL:G8BQ94"
                     /translation="MQMNLFALSAVIFPALIKAATETVTEFSTVLGNGGFTYTTTYDT
                     SIANVTGADGIETQNVIYYVKTPAHIVRTTSLTAWTGSYDDLYSSLITTAVGTDDLTT
                     TTTIYFMRTPGPVSFSTDLRNGGFTYTTTYDTSVAIVTGADGIETQNVIYYVKTPAHI
                     VRTTSLTAWTGSYDDLYSSLITTAVGTDDLTTTTTIYFMRTPGSSSVLVSSSSGPSSS
                     SLGSASSSASSSITTSSSVSSSKTSSTAQSVSVPAAYTTSVEYHGVMMKMIVSYDAVV
                     EADGDIDISTTSYMVDETTTTAVVSVTETNTVTVFTQC"
     gene            complement(<36820..>38970)
                     /gene="TPHA0B00200"
                     /locus_tag="TPHA_0B00200"
                     /db_xref="GeneID:11535015"
     mRNA            complement(<36820..>38970)
                     /gene="TPHA0B00200"
                     /locus_tag="TPHA_0B00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684078.1"
                     /db_xref="GeneID:11535015"
     CDS             complement(36820..38970)
                     /gene="TPHA0B00200"
                     /locus_tag="TPHA_0B00200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684126.1"
                     /db_xref="GeneID:11535015"
                     /db_xref="GOA:G8BQ95"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="UniProtKB/TrEMBL:G8BQ95"
                     /translation="MLLIAFLLIVNSIVAFCDEKIPLKTARKDVWEHNAVASCAAHLN
                     TLNWGFDHEHTAYYALICQYPPAFDSWAMCIQDMINLEVTTETKQVSTFEKSLLYVQV
                     LCSYVDKRSANISLEQYYFGIENGTKFLADIASIEDNTDEIFYHPIKVSVKKLRRLGH
                     AYHGFSRNLDTSQDFGLAICFYFAFVITLISIINFLNFNAFKLLFHKYKLINKFRGRF
                     IIPTLFHKHADYFTFNRYITGLLPTSCEAMMLCGYLILHLIVLFISYEFDPYNIIFKS
                     RGIQVARYFADRTGILAFAHFPLIILFSVRNNLFMHLTGFTYSTFVTLHKWIGRMMIL
                     DAMLHGISYSVYAMLNQTFISSNKLSFWRFGVAAIFFGCIIIIMSFGFLRKHYYETFL
                     YTHILMASLFFYSCWKHVEHIGWKDWIISAMVIWITERIFRIARIITFGFPIAKLQTR
                     GEDMIHINIPKNGKQWHCEPGQYVFAYFMDPLIFWQSHPFTVMDLGNEIIIIIKAKTG
                     LTRRLHKKINDAGGNYMMKVSLEGPYGSSAHVHRFDNILIYAGGSGIPGPLMHAIELS
                     KKFSSEMKKRIKLIISARELSFLLSYKNQLFMLENTSIEVLIYITKPRAEPIELDDLS
                     LVSDDYGSRDSVSIFSNSVSEFEQQLSTFATFHNGRPNTTEILKEEFALEGSLAILAC
                     TPPAFVDGIRNSTAQLMIYHPEKVVHYFEEYQVW"
     gene            complement(<39618..>40814)
                     /gene="TPHA0B00210"
                     /locus_tag="TPHA_0B00210"
                     /db_xref="GeneID:11534905"
     mRNA            complement(<39618..>40814)
                     /gene="TPHA0B00210"
                     /locus_tag="TPHA_0B00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684079.1"
                     /db_xref="GeneID:11534905"
     CDS             complement(39618..40814)
                     /gene="TPHA0B00210"
                     /locus_tag="TPHA_0B00210"
                     /inference="similar to DNA sequence:INSDC:YJR148W,YHR208W"
                     /note="similar to Saccharomyces cerevisiae BAT2 (YJR148W)
                     and BAT1 (YHR208W); ancestral locus Anc_4.389"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684127.1"
                     /db_xref="GeneID:11534905"
                     /db_xref="GOA:G8BQ96"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="InterPro:IPR005786"
                     /db_xref="InterPro:IPR018300"
                     /db_xref="UniProtKB/TrEMBL:G8BQ96"
                     /translation="MLRNQFFRSQTVFAGSKRFYSVRKLAELDASKLIVKQVSEKSSP
                     KPNDQLVFGSTFTDHMLTIEWDAKKGWANPVIKPYGNLSLDPASCVFHYGFELFEGMK
                     AYRTPDNKITLFRPDMNMKRMNKSAARICLPTFNSDELVKLIGKLIEQDKHLVPQGQG
                     YSLYIRPTLIGTTDTLGVGVPDKAMLFVINSPVGPYYKTGFKAVRLEATDYATRAWPG
                     GVGDKKLGANYAPCILPQLQAASRGFQQNLWLFGPEKYITEVGTMNVFFAFKNSKTGK
                     KELVTAPLDGTILEGVTRDSVLTLARENLNPNEWEINERYYSIHEVAERAAKGELIEA
                     FGSGTAAVVSPIKEIGWKDSLINVPLLPGEQSGALTKQVASWIADIQYGRTKHSNWSQ
                     VVADLN"
     gene            complement(<41393..>42139)
                     /gene="TPHA0B00220"
                     /locus_tag="TPHA_0B00220"
                     /db_xref="GeneID:11534768"
     mRNA            complement(<41393..>42139)
                     /gene="TPHA0B00220"
                     /locus_tag="TPHA_0B00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684080.1"
                     /db_xref="GeneID:11534768"
     CDS             complement(41393..42139)
                     /gene="TPHA0B00220"
                     /locus_tag="TPHA_0B00220"
                     /inference="similar to DNA sequence:INSDC:YER182W"
                     /note="similar to Saccharomyces cerevisiae YER182W;
                     ancestral locus Anc_4.387"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684128.1"
                     /db_xref="GeneID:11534768"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:G8BQ97"
                     /translation="MFRRSVGQLFKRTYTQTKFVTNAPRRRWIPYTVFGVSFFSGWLL
                     TQHMTYTDLVAYWRYDKLPSDSEEVNKYKLNLTNRLMNLDVVKGLEAKGYHEVFPVQY
                     KENSSSVANSNKDTTEGKKLISDTLSVPGAIAIPPKFYYDPKTKETIGIYHLGMKLTG
                     YPFLIHGGILATVIEDQMRESVKLIKNKVPKGIKDITVSYKLPTLANQFVVVRTTKVE
                     EFGNNIKLSIEMLDQTGERKLVSARGTFST"
     gene            <42653..>44224
                     /gene="TPHA0B00230"
                     /locus_tag="TPHA_0B00230"
                     /db_xref="GeneID:11535080"
     mRNA            <42653..>44224
                     /gene="TPHA0B00230"
                     /locus_tag="TPHA_0B00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684081.1"
                     /db_xref="GeneID:11535080"
     CDS             42653..44224
                     /gene="TPHA0B00230"
                     /locus_tag="TPHA_0B00230"
                     /inference="similar to DNA sequence:INSDC:YHR207C"
                     /note="similar to Saccharomyces cerevisiae SET5 (YHR207C);
                     ancestral locus Anc_4.386"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684129.1"
                     /db_xref="GeneID:11535080"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:G8BQ98"
                     /translation="MTLKFKTLSLNDSDVYVPNTFIIPSETEMIDEIKRIWDDDNKLS
                     KGNSTQNLIMKELNRRQPEWKIDIFTFHHVMVILNIRADSIKNNNGDNTDPIGEQDLL
                     LKSYNDLIVKPDKNMYDSLNSNDAKDNCFVTDCKDVLSKGRGLFAKKNFKKDELIFKE
                     EPIVIVPPIERLNLIEAGKACALCGRLMNEISEQFIIKNGLDCESCINTVWCSKQCLK
                     RDFTHKYLKHPFKSSTKLKVNSKKWKNFEKCCKESVFIEGYIIGHIYAASMIDHKNEF
                     DIKKKFDYLAYISQKDRYQGNNLTNFEKSLEDTNDSISDEHPSEIWEKSFNYFKEAFP
                     ESDIDYEEYLNYIGRYNLNHKSAQLYSIYSLVNHNCEPNVRVEVDYHTKELKLYARKS
                     ISKNSELLTTYINPLHDVELRRKILLINYGFACNCERCENEIDRIKSEIKETTDITTS
                     PHVRLTVSHSDNIYGTTSQRRKSSMRAARPDFTELLKNGKEFDLEIPENISGKKSRSA
                     SVRFDNHVTLAVEEA"
     gene            complement(<44468..>46525)
                     /gene="TPHA0B00240"
                     /locus_tag="TPHA_0B00240"
                     /db_xref="GeneID:11534716"
     mRNA            complement(<44468..>46525)
                     /gene="TPHA0B00240"
                     /locus_tag="TPHA_0B00240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684082.1"
                     /db_xref="GeneID:11534716"
     CDS             complement(44468..46525)
                     /gene="TPHA0B00240"
                     /locus_tag="TPHA_0B00240"
                     /inference="similar to DNA sequence:INSDC:YHR205W"
                     /note="similar to Saccharomyces cerevisiae SCH9 (YHR205W);
                     ancestral locus Anc_4.384"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684130.1"
                     /db_xref="GeneID:11534716"
                     /db_xref="GOA:G8BQ99"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:G8BQ99"
                     /translation="MSEVQIAPELLSGSSTGNVTPTSGSDSTDRLVTRSGLSRLFNNG
                     NSPNLLNIRYQANEICDSEEERDGLPRYDSASYEMSIVDSETDPSTTSNINQLSSNEN
                     FTKGILKVNVSGISHYNVSSHANSLKMLISYDDVSMSSYGRKSSNIEQAFSSSDTNEN
                     TTSNRFGTWRENESNNNFNTNEYLSPIEWSTTIVFDVTNDNSNVHISLYNGLQEDRLI
                     GNASFIPETKYLTTNIIRGWYTLTGGESSERGDENGEGKYRLYVEYDYQVEHGKKFVP
                     ENFELLKLLGKGTFGRVYQVEKKDTGKLYAMKVISKSHIIKKNEIGHTLNERNILVKN
                     VINSCPFIVNLKYSFQTNENLYLVTDFKSGGELFMHLQYCGTFEESRSRFYAAELVLA
                     LEYLHDNDIIYRDLKPENVLLDASGNISLCDFGLSKLDIKGKTRTFCGTTEYLAPEIL
                     TEKSGYTHMVDFWGLGILMFEMCCGWSPFKAPTIQLVYNNIVFSKIKFPKCNLSQDGR
                     NFIKQLLNRKPDHRLGSNDGARELKKHPFFKDIDWVAMLKKEIEPPFIPILNSDKDTA
                     YFDKEFTKIPKEKLSSHSNYYDNELSNSMQNCFSGFTFEEDSILSTNKKQQWIPAAFP
                     EDSDLLMKDVNIETRVSATQEWRTNRLDTTFEPLDLHDNGNNKYIPLNPSLLRYEGID
                     SRE"
     gene            complement(<47320..>49755)
                     /gene="TPHA0B00250"
                     /locus_tag="TPHA_0B00250"
                     /db_xref="GeneID:11535106"
     mRNA            complement(<47320..>49755)
                     /gene="TPHA0B00250"
                     /locus_tag="TPHA_0B00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684083.1"
                     /db_xref="GeneID:11535106"
     CDS             complement(47320..49755)
                     /gene="TPHA0B00250"
                     /locus_tag="TPHA_0B00250"
                     /inference="similar to DNA sequence:INSDC:YHR204W"
                     /note="similar to Saccharomyces cerevisiae MNL1 (YHR204W);
                     ancestral locus Anc_4.383"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684131.1"
                     /db_xref="GeneID:11535106"
                     /db_xref="GOA:G8BQA0"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="UniProtKB/TrEMBL:G8BQA0"
                     /translation="MVWYYTELYLVLIYFISLLDIATASDHSRGQDFAPYHFTDKELI
                     YYRNEVKSLFYESLDNYLEIAYPFDELLPISCVAKKRNFDDPGDIITNDVLGNFTTTL
                     IDALTTVAVFNDRDKFKELVNLVKETFPNGFAIDSTIQVFETTIRILGSLISAHLYAT
                     DPSKKVFLGDDYDGCLLDLAIDLGDRLLPAFLTNTGLPVPRINLLTGLNGLTMDLVQE
                     NNVAALGCPMFEFTMLSVLTNDAKYEIMTRYAFDKVWSLRSDLDLLPMSLNPQTLAVY
                     TQISGIGASIDSIYEYALKGAILFDDQDLYEVWHDSYTALNINSKQDWLYANVHQYTS
                     MLATPWIDSLSAFFPGLQVLNGDIEAATYQNLMSLKLWDTYGGIPERWNFQPDCPLQG
                     LNNSELVDKVLPLEWYPLRPEFIESTYYLFRATNDPFYLNTGAHILKDLKTRFKQKCG
                     LAGIQDIRTGEPQDRMESFVLSETLKYLFLLFDDKNEIHKTRDNIIFSTEAQPMWIST
                     ELKHRYSRNRYFNETIYVDHIRYVVDEDKRKLEKELKNSKNSKQFDLVKGIKRIYNEE
                     AMSPAMQQIHDRFKYQISEYYKPGMCVISNFTQHKDRYQNKVMLSSNLLNNFSKLFEI
                     ENIYNETLIKPDYLKYYDQMEINDQFYKIWSSGKAISTPSSSTFSMDIVIDLPGKLRW
                     NMLGNGDIQLDTMYGRRKIRLEKIYPNDLDTYGNYAEETVFSRLDRNDIRSERCIEVG
                     NNTSVPYIYRATRINGIFLSESNNIYINKKAFISDEAHEGGAKFNLFDNFGLNKDHHL
                     LLECIPIVNIFLE"
     gene            <51028..>51813
                     /gene="TPHA0B00260"
                     /locus_tag="TPHA_0B00260"
                     /db_xref="GeneID:11535020"
     mRNA            <51028..>51813
                     /gene="TPHA0B00260"
                     /locus_tag="TPHA_0B00260"
                     /product="40S ribosomal protein S4"
                     /transcript_id="XM_003684084.1"
                     /db_xref="GeneID:11535020"
     CDS             51028..51813
                     /gene="TPHA0B00260"
                     /locus_tag="TPHA_0B00260"
                     /inference="similar to DNA sequence:INSDC:YHR203C,YJR145C"
                     /note="similar to Saccharomyces cerevisiae RPS4B (YHR203C)
                     and RPS4A (YJR145C); ancestral locus Anc_4.382"
                     /codon_start=1
                     /product="40S ribosomal protein S4"
                     /protein_id="XP_003684132.1"
                     /db_xref="GeneID:11535020"
                     /db_xref="GOA:G8BQZ8"
                     /db_xref="InterPro:IPR000876"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR013843"
                     /db_xref="InterPro:IPR013845"
                     /db_xref="InterPro:IPR018199"
                     /db_xref="UniProtKB/TrEMBL:G8BQZ8"
                     /translation="MARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPL
                     IVFLRNRLKYALNGREVKAIMMQRHVKVDGKVRTDATYPAGFMDVITLEATNENFRLV
                     YDVKGRFAVHRITDEEASYKLGKVKKVQLGKKGVPYVVTHDGRTIRYPDPNIKINDTV
                     KIDLASGKITDFIKFDAGKLVYVTGGRNLGRIGTIVHKERHDGGFDLVHIKDSLDNTF
                     VTRLNNVFVIGEPGKPFISLPKGKGIKLSISEERDRRRAQSGL"
     gene            complement(<52059..>53870)
                     /gene="TPHA0B00270"
                     /locus_tag="TPHA_0B00270"
                     /db_xref="GeneID:11534926"
     mRNA            complement(<52059..>53870)
                     /gene="TPHA0B00270"
                     /locus_tag="TPHA_0B00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684085.1"
                     /db_xref="GeneID:11534926"
     CDS             complement(52059..53870)
                     /gene="TPHA0B00270"
                     /locus_tag="TPHA_0B00270"
                     /inference="similar to DNA sequence:INSDC:YHR202W"
                     /note="similar to Saccharomyces cerevisiae YHR202W;
                     ancestral locus Anc_4.381"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684133.1"
                     /db_xref="GeneID:11534926"
                     /db_xref="GOA:G8BQA2"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006179"
                     /db_xref="InterPro:IPR008334"
                     /db_xref="InterPro:IPR014485"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8BQA2"
                     /translation="MLLKNSVVLFTLLNEVYCWPIQGVFDSITKHAGFNDGGGDTFRN
                     LNLGSVNFIHTTDTHGWLGSHLTQKNYDADWGDFITFIDLFKSKRLLEDQDLIVIDTG
                     DKEDGNGLSDASFPRAINSSRIFNELDYDLLTLGNHELYNGAITTQEYKYTAMSNKFK
                     DKYVSSNVEYINDSGEAVPFGKKFVYFETQNSKTRILSLSFLFDFNVSNERVKVTPAL
                     EEVKESEWFKKMTEQYSEDSIDMLLVFGHIPMTDHQNKEINKLHEFLRSKYPNIVIQY
                     FGGHSHIRDFVQLDTKATGLQSGRFAETVGFLSINDLKTEKPKFFRRYIDFSKASFCH
                     HLHLDDAELFYTKKGKQISAMIQDIADELELTEVYGHVPQNYYFSTRPVNANDSIYHL
                     LTSTILPRLNTTLSDARVGRYIMINSGSVRYDMFKGDFTKNTEYIVSPFDNNWEYIKI
                     PNKIASKIAAYLNGDNYIITLGQPHMISKSFVKTDSVNDKGNCPSIALPFLTEGYTTS
                     DDFGCDGDDRLHNSQREYKIPNVVQSTENLQFAQDDDIVHFVFYNFMQRNIIDAVNWI
                     IQINKYKDKIISSDNVKKYGGSSVKLLLREYIQEISM"
     gene            complement(<54318..>55223)
                     /gene="TPHA0B00280"
                     /locus_tag="TPHA_0B00280"
                     /db_xref="GeneID:11534789"
     mRNA            complement(<54318..>55223)
                     /gene="TPHA0B00280"
                     /locus_tag="TPHA_0B00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684086.1"
                     /db_xref="GeneID:11534789"
     CDS             complement(54318..55223)
                     /gene="TPHA0B00280"
                     /locus_tag="TPHA_0B00280"
                     /inference="similar to DNA sequence:INSDC:YJR144W"
                     /note="similar to Saccharomyces cerevisiae MGM101
                     (YJR144W); ancestral locus Anc_4.380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684134.1"
                     /db_xref="GeneID:11534789"
                     /db_xref="GOA:G8BQA3"
                     /db_xref="InterPro:IPR009446"
                     /db_xref="UniProtKB/TrEMBL:G8BQA3"
                     /translation="MFLRSRVSARSLDGLGNVVRNIHVSRVVKDYSNDTSAAKPSGYG
                     SSAAKSSSYGSSASKSSNYGSSGATKSATNFPTGASLASTAAPATTSIAVKRVPGYTT
                     TLEKKLNGGVLGNIEASSGNAVENVPGDIDWYKSWHKIGSSPFPQKVQTELEKPLDLE
                     DIEIKPDGLIYLPEIKYRRILNRAFGAGGWGLAPRSDTIVTQKLVTREYALICLGQLV
                     GVARGEQDYFSESGIPTATEGCKSNALMRCCKDLGIGSELWDPVFIKKYKKEHCVEKF
                     VEHVTTQKKKKIWLRKGRPVEYPYK"
     gene            <55686..>57956
                     /gene="TPHA0B00290"
                     /locus_tag="TPHA_0B00290"
                     /db_xref="GeneID:11534959"
     mRNA            <55686..>57956
                     /gene="TPHA0B00290"
                     /locus_tag="TPHA_0B00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684087.1"
                     /db_xref="GeneID:11534959"
     CDS             55686..57956
                     /gene="TPHA0B00290"
                     /locus_tag="TPHA_0B00290"
                     /inference="similar to DNA sequence:INSDC:YJR143C"
                     /note="similar to Saccharomyces cerevisiae PMT4 (YJR143C);
                     ancestral locus Anc_4.379"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684135.1"
                     /db_xref="GeneID:11534959"
                     /db_xref="GOA:G8BQA4"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:G8BQA4"
                     /translation="MAVVKRNKSKSVDVDESENKYSKGVEKVEFIGQRWLSQPLPDAE
                     PTYNTWMYIVTTIAFITRFYKIWNPKEVVFDEVHFGKFASYYLERTYFFDVHPPFAKM
                     MIAFIGFLVGYDGSFKFEEIGMPYDKNPAPYIAYRSFNALLGTLTVPIMFLTLKELNF
                     KAITCAFAALLVAVDNAHVTETRLILLDAILIISIAASLCCYVRFYKEQLKAPFSTSW
                     YIWLYATGLSLSFVISTKYVGVMTYVAIGIPVIVNLWQLLDIRTGLTLHTFARHFLRR
                     LNGLVFAPFIVYLFWFWCHFSILINSGPGDAFMSQDFQETLNESALAKEAKQINYFDI
                     VTFKHKDTEAYLHSHLLNYPLRYEDGRVSSNGQQVTGYVHEDKNNEWEILPVKELKSK
                     IGQPVLQGEQIRLRHVSTDTYLLTHDVASPLYPTNEEVTTVSEEDANGERYQQTLFTL
                     QPVNKKDNGRKIKSKMTSFRIFHVDTAVALWTHNDELLPDWGKSQQEVNGNKKVTSSE
                     NTWLVETIVNLDEARKIYYPKVIKTLPFISKWLEAQRLMFEHNNKLSSEHPFASEPYT
                     WPGSLNGVSFWTDDEKKLQIFFIGNIIGWWFQVISLAVFVGLVCADLITRQRGYYALN
                     EITREKIYGPLLFFFIGWCCHYFPFFLMGRQKFLHHYLPAHLIAALFSAALWEVIFSN
                     TKTEDPSKDDKDAAYNTTAVVIHDKQLSLFFLIVSVAVVGFFIYFAPLVYGDISLTPE
                     QVQSRKWFNLKLHFAK"
     gene            complement(<58246..>59292)
                     /gene="TPHA0B00300"
                     /locus_tag="TPHA_0B00300"
                     /db_xref="GeneID:11535123"
     mRNA            complement(<58246..>59292)
                     /gene="TPHA0B00300"
                     /locus_tag="TPHA_0B00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684088.1"
                     /db_xref="GeneID:11535123"
     CDS             complement(58246..59292)
                     /gene="TPHA0B00300"
                     /locus_tag="TPHA_0B00300"
                     /inference="similar to DNA sequence:INSDC:YJR142W"
                     /note="similar to Saccharomyces cerevisiae YJR142W;
                     ancestral locus Anc_4.378"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684136.1"
                     /db_xref="GeneID:11535123"
                     /db_xref="GOA:G8BQA5"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:G8BQA5"
                     /translation="MLKVEVNDDGKEILVGDRTDTDSLIHVIDRVDSFPVDYQLHTNF
                     RENVYFLLSHDKRSKLGFVLRFVVEEMKRVDLGLFNGIFEEMQYHEGDERVKLMGLRF
                     KDEQFHERNAKSDQLAQILYRKSDLEEIKGWRNEKYTVYQNSKPYILIERSMAGLLGI
                     LTSGIHVNGYTYDKLTRQIKFWIPRRSKTKPTWPYMLDNIIAGGISYPYSVHETVHKE
                     AVEEANLDGKIIERYLIPTGYLSYMHYQGDFFSDSFQSEKSFIVGEHEYIYDLELPED
                     VIPTPNDGEVDSFNLLTLQEILDALYNNQFKPNCGLVMVDFLIRHGYLNTENEVNYEK
                     IIRKMHRKLIYESE"
     gene            <59682..>60854
                     /gene="TPHA0B00310"
                     /locus_tag="TPHA_0B00310"
                     /db_xref="GeneID:11535117"
     mRNA            <59682..>60854
                     /gene="TPHA0B00310"
                     /locus_tag="TPHA_0B00310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684089.1"
                     /db_xref="GeneID:11535117"
     CDS             59682..60854
                     /gene="TPHA0B00310"
                     /locus_tag="TPHA_0B00310"
                     /inference="similar to DNA sequence:INSDC:YHR201C"
                     /note="similar to Saccharomyces cerevisiae PPX1 (YHR201C);
                     ancestral locus Anc_4.377"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684137.1"
                     /db_xref="GeneID:11535117"
                     /db_xref="GOA:G8BQA6"
                     /db_xref="InterPro:IPR001667"
                     /db_xref="InterPro:IPR004097"
                     /db_xref="UniProtKB/TrEMBL:G8BQA6"
                     /translation="MSINLYIEGEGILFKSISLYLSHVKNAYFNGIKNDKRVVNIVCG
                     NEAADFDSIACAISYSYYSFISNQNDIVIPIIDIPIVDFNLRRDVVYALDQMNIKRED
                     LFFRNHLIQLRENFEQINVILSDHNKPSAGLTKLTDKVVGILDHHQDSGLYLDVVPRF
                     IELSGSCSSLVFKYWYERIANLEKMKSAIPLCLGAGVIDTTNFTNRCIDIDLEALKLY
                     KEALPNLNIEEYFKNLKIAKDNIKGLTIKQILKKDYKHFTYANKSGKSISIGISSIVK
                     SMDWLYNEHGGKSNFLKESEVFLQEMHVDIFVIMTSFVDINNKFNRELVIIPSHEYKN
                     ISVEIIKDIQGKLGLQPVLNSNESDAITHYSYSQLNLKASRKQVAPFLEEAFNSLQ"
     gene            complement(<60870..>61955)
                     /gene="TPHA0B00320"
                     /locus_tag="TPHA_0B00320"
                     /db_xref="GeneID:11535111"
     mRNA            complement(<60870..>61955)
                     /gene="TPHA0B00320"
                     /locus_tag="TPHA_0B00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684090.1"
                     /db_xref="GeneID:11535111"
     CDS             complement(60870..61955)
                     /gene="TPHA0B00320"
                     /locus_tag="TPHA_0B00320"
                     /inference="similar to DNA sequence:INSDC:YJR141W"
                     /note="similar to Saccharomyces cerevisiae YJR141W;
                     ancestral locus Anc_4.376"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684138.1"
                     /db_xref="GeneID:11535111"
                     /db_xref="InterPro:IPR019193"
                     /db_xref="UniProtKB/TrEMBL:G8BQA7"
                     /translation="MTKWLIEYLPRIGNISIIIESSQGKKIHIDAIDLDGIHAKVGGE
                     PIRIPFAAKVTLIYNKEEEETLCSQEFNEVAHFKLQYSDLSTNKNSISLMNDDLNWKW
                     SKKELLAMKNFSFGCIDCGNVIFESDDNCRKLNIMPSEFWAELMDNWHCHKPSENNDS
                     EGNNLNASFLKYSQLKPNNFEILIGNSFFICNSATLNSKVIIDSKLNIVGCKNCNSII
                     GEINQDKLCQIFKWKLLLNGEDKYPIYKHVISQILNIVDSTSSRHILLQIEDSTEQIY
                     IWAFSINTMVAATNYVECNNSIKILYKDFEDDADLNFQIKNTNVEKIITKLDAFKAFV
                     EYLSESNSNLPSTVKTWGKWKVSYLPI"
     gene            <62343..>67427
                     /gene="TPHA0B00330"
                     /locus_tag="TPHA_0B00330"
                     /db_xref="GeneID:11535160"
     mRNA            <62343..>67427
                     /gene="TPHA0B00330"
                     /locus_tag="TPHA_0B00330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684091.1"
                     /db_xref="GeneID:11535160"
     CDS             62343..67427
                     /gene="TPHA0B00330"
                     /locus_tag="TPHA_0B00330"
                     /inference="similar to DNA sequence:INSDC:YJR140C"
                     /note="similar to Saccharomyces cerevisiae HIR3 (YJR140C);
                     ancestral locus Anc_4.375"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684139.1"
                     /db_xref="GeneID:11535160"
                     /db_xref="UniProtKB/TrEMBL:G8BQA8"
                     /translation="MSKFNALNQDLHDEEFEVDGHSRELQVEEGFKTFQTALQFLRNK
                     KYDDASDKFDELFQMAILKADKWGLYQFSSPTLDSLRYLAFRNRGMFYYSYLIDEYAS
                     METDEIVNYILKVVEDLLESMQHSYADSSVTELLLMIFRSFRSRKLERLIIEYELKKP
                     DNQFLTLERLNKNKILPKLKNVLDRYTILLNNLHDTKTIETSTIIKDNNINLSSTSEF
                     NIVLNKINQMKTQDDKEMKKLDRFEVNIKNMSWDDILGSFKSLVVHMKSTNMLLRDYD
                     TYAETEYPIEAIKFNLSDKALINSDTSLTMQKNDVSDEKEEIASINATNKSEPDSSLI
                     PETKDNDNIDFEIEGTNKNNDSVKNDKNDKNDDIDSDSNISTDADRHKKKRQSTSVED
                     LSRPAQRVSKRVKNEHVVDEKKVFELHQIFINDFFSSCSMINMESCFNKEGLESIIQD
                     GILQSNKTYYVDFFNCLKNWNSKHADIFIQNAQVPSKSKIGESNTTSQSPELTSLLKY
                     NGSNEYGEKQNYPERLEDADPSILENFIGNINRGKMHFQEVRFKIIDALLSKKNEQER
                     IIISHLWSKSLYQNLEWLLSSVESSMFEFVKTSFNENKYLILSIIEVLINMSGSINDE
                     INHKTLQGTKVNELKVNKYKLQAKINKWIQLAENIDYTDDILWNVEFLWSKFCFFQFC
                     EDFSNKDMINLCTKIEKQLSNYDKKLYIVYPNYNYISCLSRDFVKSNIKKISIIDKLT
                     IIDSYSDNFNTETEFKHDGNMLQLEKVLLRVDGEQARDNDDKEIISFIDQSPFVVQIN
                     LWKVLFNYYIDVEDIQKSIKIYFCILQLLFKKLDSTEYVDHMEQNRHQMLLLYISDID
                     YFTTKVVNILSTNAWSDIGYEPSATDFKGIFEIFSIFYLVFYFETSSKVDSSLKSFFQ
                     RAHKSAGKMKDSIAALSTLILYFFNSSCIKMVSHEEAAPIITKIVWNIHSLLGEFKSC
                     DAASGNFLRFTENLLCRFINDDTYLQLLQTLWCHYHYSLSSDSVSFEYHTTQPVPIDK
                     VNSLPLGTYLIKLQYSGRNPLLVNSNKSTLKQVLDNIINTLEDPCDSPNFFIENNKYK
                     LDEYLSLPLTTDYLKKSFNGLCSLRFSSPNDEFQEAIEIGLYYIASVQALNLYKLRKK
                     SMQARPSELDSIINMIKIDIIYNFNRYESWYLLGLCFSYIVEDDLMWTSDKLNVPEKK
                     NTIASNQRKAILCYLMSINVFYQKNEVDRDDKKVMIKVLEALGMELIIGLYKPMDMEC
                     FQFQRAHKYLQLGDDGELAEKMIVEINSISSFNIEQAALLCFNRSNKFREALVSSKDS
                     KERWQNYYYISRLLFKKGRLTMLHDIEKVILRACKLAMDVSTPKDLIVEPHYYLLVMC
                     YKWVKLNVLSPYNALQILSKDIGFFDVDNDFWDIDNSISIDYQKKSFYKKSIEFLRII
                     QQSDKRKWHHRPTYRISKILFEDFGDLNGAIKEIETMMSLKTMNKNLINIWKPDFERP
                     GKHFVYTYQYITFYIDLLFIKKDHISIGLIAKKIRRFSSGMAYSSEVIKKSVTTYIRC
                     VATSLHLDEKYYSEQFLPNLNYQEFIDISKEVLQDFDPEKYSADILESLQIAYQLKRG
                     NNGIAFDGTCLSIYFKYFYLPYLEAHPRTKTSTESQIVQFVSHETVKIPSASATSIQP
                     KQNNSRKRVSKKDAFETIRTMTEKIH"
     gene            complement(<67479..>72254)
                     /gene="TPHA0B00340"
                     /locus_tag="TPHA_0B00340"
                     /db_xref="GeneID:11534759"
     mRNA            complement(<67479..>72254)
                     /gene="TPHA0B00340"
                     /locus_tag="TPHA_0B00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684092.1"
                     /db_xref="GeneID:11534759"
     CDS             complement(67479..72254)
                     /gene="TPHA0B00340"
                     /locus_tag="TPHA_0B00340"
                     /inference="similar to DNA sequence:INSDC:YJR138W"
                     /note="similar to Saccharomyces cerevisiae IML1 (YJR138W);
                     ancestral locus Anc_4.373"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684140.1"
                     /db_xref="GeneID:11534759"
                     /db_xref="GOA:G8BQA9"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027244"
                     /db_xref="UniProtKB/TrEMBL:G8BQA9"
                     /translation="MFSSLRKKDRNEGKELNITVQKPQNRLERLKRISTTTDSNSSNN
                     LDRSVYSGKADTLNGSTSDNTLSIVSGNFLVGSHNKTLTTSNTDNLSKQNTSGFPIDN
                     GTNFGSSEVQGSATLKNQKYQLELTYHDLTRYPNIPIMVDLSLLPGVKEGELCELMNY
                     DKHEKISSIGDRTENNKHNTIFKKSRRRVKIYFIAKNLITNANRLQHKSQQLSIASGQ
                     LQALLELPSRSKVWVKKRSKEECEIDLLELNVKDLLLNRGDMWCISKQLLASCVFSEQ
                     KLFLTDSLRLVVNGIYRDGRKILSGYIGESTRIVFRSESARLIFIIQITEEMWNFEES
                     GEQLFQKLINSLFPKIFKKWKERDTHHSITIAFAISMDMSTNSYNDLKPGEKLKTTSD
                     YYRIVVDQVNIIDWVQTMEVLRREFMKVTEELKNVTVKQENGTFTVIKGRFTPVIKSN
                     FLELVNFAATILTDPFKQLDLKHTTTHVILISPSSGIYDVDYDLLKLTGKKLMNLEMT
                     MDLICLARSPLHIVPLFRYIDYDNNLHHCTPSWLSIFFWNDGHKSSLDDWQPRCNLYK
                     LRIMGLTENEMMEEVDIAYLSMNNPREVSIHQLITHHDRNVFHSTVTDKDQNTSNSYP
                     DVNNEPNANIISTKFGNNVVESSNKLVWNTSKLSKPKTEKIAEHNVMADLYIQNSEDL
                     IEDVPDIVPKHENAIYSTFSNISMNKVDDSYAIDSLKHISKTDSIKEIFGKQVFKRLL
                     TSVKSKDKIAITQSKSQIDQNKNVGNLAKKPLQAVNNVPSSSQGHENSPIIKKHLGLA
                     IMNTDQNNSHNDLSSCQKSSNTDASSNITIQNRLTPFHDSSTRLTINHGPKAKLFDKY
                     NTNSSWNEIENPSVPVSNEVAGLLLSKKWRDVLPRFVAKKYSKWRSFTIPAELPLTIT
                     TFVNSQEFKEQYEFRNHSVTMNIDQELYNQTSKDLLLHMVYMRLVAGFQICLGDQVED
                     IEYSLTNDKKSKSVNKYISDDDWTSTKFYMMLDTEIHRITCGLDGVIDVQRYLKREQN
                     PLDQVSSYMPLVKTRYEEEYRTIKRDPLHATRKSLNWNQIDQALACYGDYREDGKYAG
                     FKAKFVVLPVEIPLHTLSTVVNGRNEMLSSEELRLEGLRRLTAFIAKSKIKSSDEKVK
                     TVKNDEQPPDIHFYTGSLINFINEEIKSSEFSASKDLIISTPKTLLNKSIDFKTLTIE
                     LQSSEDKLTLVTRKWHWSKFKNCFVGSEMVNWLIRNFSDIETREDAIAYGQYLMDKNV
                     FLHVLNKHGFLDGYYFYQLTSEYALKNKDPEILAPGLKVKENYNEGKYRNRTESSMTP
                     SANKSNSSIVKGSDEILEDVKPTIVLSNSLTIDLDPDCKSYKKETCVVHYDKVHNPDH
                     CFHIRLEWLSATPKLIDDKIKNWSRLCEKYGLLLIEVPWEELCSIPASNPFHTFIEVK
                     LAINPFEEADLNIKNMLTKNKFYYHIYLLKKSDFLLDNRAFHFLNDENSSFVIKYSWG
                     APTFKNAQYIHKSGAYIAEIKDNGDLFLAPNNIYMNRTKQGNIIGKNKKHIRMQFNAQ
                     GVMLEFKNMCSDPVKLRSIFEEAKQIYLDNEDEQIEQKY"
     gene            <73021..>74007
                     /gene="TPHA0B00350"
                     /locus_tag="TPHA_0B00350"
                     /db_xref="GeneID:11535031"
     mRNA            <73021..>74007
                     /gene="TPHA0B00350"
                     /locus_tag="TPHA_0B00350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684093.1"
                     /db_xref="GeneID:11535031"
     CDS             73021..74007
                     /gene="TPHA0B00350"
                     /locus_tag="TPHA_0B00350"
                     /inference="similar to DNA sequence:INSDC:YHR199C"
                     /note="similar to Saccharomyces cerevisiae YHR199C;
                     ancestral locus Anc_4.369"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684141.1"
                     /db_xref="GeneID:11535031"
                     /db_xref="GOA:G8BQB0"
                     /db_xref="InterPro:IPR016087"
                     /db_xref="UniProtKB/TrEMBL:G8BQB0"
                     /translation="MFSNIFNNISARTLRSSLRGTTRVLSKRLLSNASTKTVNQTKFQ
                     NFKWATVGLATGLTILTATSTYQNANSSELHTSTHLIRNDSDAQKEGELSNSVTVYKD
                     VSPFPLVIDNSVYECIKGTYDMLGYGIRTVYFYVKFKVYCMGIYILEDDKAKVGEVLN
                     SSYMSKAIIGAKETLSQKQNVFDALNDPAKSMLVLENLLDSNIRLLAKITPVRNTSFA
                     HLRDGISNTILNHPNIAGHEEEVQAGVQEFKELIAVNHQVLRDDDLFVQLNSDGSLTF
                     SQYSRKKNKYTYYGSVKNPIVGKFLFSQYLGGPKPLCQQTKDNVTEKLVSLV"
     gene            <74267..>75565
                     /gene="TPHA0B00360"
                     /locus_tag="TPHA_0B00360"
                     /db_xref="GeneID:11535004"
     mRNA            <74267..>75565
                     /gene="TPHA0B00360"
                     /locus_tag="TPHA_0B00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684094.1"
                     /db_xref="GeneID:11535004"
     CDS             74267..75565
                     /gene="TPHA0B00360"
                     /locus_tag="TPHA_0B00360"
                     /inference="similar to DNA sequence:INSDC:YJR136C"
                     /note="similar to Saccharomyces cerevisiae YJR136C;
                     ancestral locus Anc_4.368"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684142.1"
                     /db_xref="GeneID:11535004"
                     /db_xref="InterPro:IPR018870"
                     /db_xref="UniProtKB/TrEMBL:G8BQB1"
                     /translation="MFTSADTAEIESLLDESDLKSPGFLNDDVVRRMCEYISHNKNGS
                     NSVNLKIKCIQFVSYCVLGDIVTKEISDLSATTVDSVLSKNIDDKDIIMDGLIANIQN
                     LLYKPSNSFANVRSKSLGSGLNPKLGFNRTDETNLEQWKLNGGLYSIPLLHVILRHLD
                     RKHFSSNIWWITPAILNLLDDTSDLHKIKLKGVKALQTLLKYPFCSLPNGKESQWISF
                     EQTGLFGIFEPILVNMTYFLPPSYPAKETCIIYESIFPALILLYKRQYENNEVQYKTC
                     LQKLLSDNILTNIFPRIVSEHESLTLTTIKFTNQLINELKENITILLSRFIFVLGEYF
                     VKNPFFTTSIAIVEETIKLISLLINFAPIERLNCHKYDFTALLIIIYEKNDLEGTLDS
                     DLLDKLKTTWDSLIDKKCGLDKNEMEQLLKSRNNLEQLLN"
     gene            complement(<75818..>76003)
                     /gene="TPHA0B00370"
                     /locus_tag="TPHA_0B00370"
                     /db_xref="GeneID:11535072"
     mRNA            complement(<75818..>76003)
                     /gene="TPHA0B00370"
                     /locus_tag="TPHA_0B00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684095.1"
                     /db_xref="GeneID:11535072"
     CDS             complement(75818..76003)
                     /gene="TPHA0B00370"
                     /locus_tag="TPHA_0B00370"
                     /inference="similar to DNA sequence:INSDC:YML081C-A"
                     /note="similar to Saccharomyces cerevisiae ATP18
                     (YML081C-A); ancestral locus Anc_4.353"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684143.1"
                     /db_xref="GeneID:11535072"
                     /db_xref="GOA:G8BQB2"
                     /db_xref="InterPro:IPR006995"
                     /db_xref="UniProtKB/TrEMBL:G8BQB2"
                     /translation="MLPKRFPTPIMKPLWPFFIGGATVFCLMGKAADLSAGTKEFIND
                     PRNPRFARGEKPVENPQ"
     gene            <78891..>82823
                     /gene="TPHA0B00380"
                     /locus_tag="TPHA_0B00380"
                     /db_xref="GeneID:11535038"
     mRNA            <78891..>82823
                     /gene="TPHA0B00380"
                     /locus_tag="TPHA_0B00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684096.1"
                     /db_xref="GeneID:11535038"
     CDS             78891..82823
                     /gene="TPHA0B00380"
                     /locus_tag="TPHA_0B00380"
                     /inference="similar to DNA sequence:INSDC:YJR127C,YML081W"
                     /note="similar to Saccharomyces cerevisiae RSF2 (YJR127C)
                     and YML081W; ancestral locus Anc_4.351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684144.1"
                     /db_xref="GeneID:11535038"
                     /db_xref="GOA:G8BQB3"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BQB3"
                     /translation="MVDMLTTNKQSFMDAPIPIPIKSRPIKTDKPRPFLCSICTRGFV
                     RQEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRHQYKLHPSLISKKEAINDTVSEN
                     EGTVNNTNIVKIAGNKKTILPTPLNPLGMTAAELKKQNKIDKRNHTMLKGSSKRIKDI
                     KTDMIKRELDSSNADNNISILSDSSSEISNSVSPTYVSPTGNLKAPPEKFRKRHASFS
                     ASNVYTYRPDNLQVPFPEKDENEMAIDTPHQVGFSTPQVTPNRLLEKVFNSDYPENDP
                     FQFSLDDPLLQNVYNEKFDGNPLIQGNHTNVNGSPLQGNTDGNAYLSSTQDDILSNPK
                     LRNSDGVLNSSYIHSASFLSLANLLTNSSIGQGGYSNNSMIFNNVGINNHSTSMSNLF
                     DYFSNPSELNLADKNNLTNNQSIKSLKNNNNLNDNQLKVEANNSKLPILNNRDNFDDK
                     WLDDFLTGNSQFQNVDLDKFKLSSKHFNDIGFVSQNYSPSEDSQNNSNAVSPRVDPRH
                     LSSETISLENTVSPLTDLGTANDSSLPSFVTDINKSNILTANNPNKLKYINNGRKNSV
                     VTQFFNNRQHAVFNEDCHFMNDSLHSAEGANMFNSNLRTKQDPMNNTNNIKYPEFTEE
                     IRTYIISSNSLSGELFPTVEELNSYTKLFIIKFHSLFQFIHIRSIEIKPDNYTFILSL
                     TVIGALHSFHSTHAMLLSRICWTQIKNIINKLSQTHNYANTPLWVIQAMILLIFVNIF
                     NNNLSVDQKKIIHAQISTLVELIKVTKINLPIESVEKPPIQSNHAMDYQDHPENLSKY
                     LAQFNTSEQIDKDFQYFIKAQQRIRTCHVFLIVSIMFTNMAGIECYFHSTDVKCGIPC
                     YLPEMFDCSDSVQWYEMLQKNKIRLDSKFALLELCNGGETYQNCLNYLANGNKFFYEN
                     EKLSFKTLLSLLIGIHEKIFLENNKLALQYDRNSLEGEIQWRSNSKPIIDFAMKNWEA
                     LYVKNGGVLATADAELIKSFTATNIEALLIIPMHLLACIRKCVNITPIMSTIYQQDWG
                     KLNRILENKFFYCDLDSVHEATEYSLMAINFWIETVAVVDNAQKTSKRTPIFSVMSIF
                     VSIFIIAEQMKRIEDWAFTITNEALTPNSLPSMLKPSDRMMWLKCEQILKKIELYQLP
                     KGYNKETYSEFLRTQANGALDVDVLNDKLAIYAMESSTNIQETANVIKKASLSTRSLY
                     LGVRILGDAPIWPIALLLAHALQSRAIYVRANYNIHNSYMNNISNQLFDSMNVETYYN
                     SVLHSTDPGNEILKNSNTFNQLDNTTMNINNTNKGFQTDSDDDGILRF"
     gene            <83356..>84555
                     /gene="TPHA0B00400"
                     /locus_tag="TPHA_0B00400"
                     /db_xref="GeneID:11534871"
     mRNA            <83356..>84555
                     /gene="TPHA0B00400"
                     /locus_tag="TPHA_0B00400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684097.1"
                     /db_xref="GeneID:11534871"
     CDS             83356..84555
                     /gene="TPHA0B00400"
                     /locus_tag="TPHA_0B00400"
                     /inference="similar to DNA sequence:INSDC:YJR125C"
                     /note="similar to Saccharomyces cerevisiae ENT3 (YJR125C);
                     ancestral locus Anc_4.346"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684145.1"
                     /db_xref="GeneID:11534871"
                     /db_xref="InterPro:IPR001026"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:G8BQB4"
                     /translation="MSLEDTLSNLTIYDAKKYFRKAQNVMFNYTDMEAKVREATNNEP
                     WGASSTLMKQIAQGTYNIREREEILGMVFRRYTEKTASEWRQIYKSLQLTDYLIKHGS
                     ERFIDDVRTSISLIKMLESFHYIDSQGRDQGINVRNKAQSLVAFLKDDDLIRAERKKA
                     RETSKKFNNVAGGSAAAETLGQNPRAGFRSSYNNGISVSADFDSEDEDNSHAAPKITS
                     ASNLPANNDDLFTFNKSSNESINIRNSASQDIAADGDDDDDDDFADFQSAAPVAAQSN
                     VQDSLQNSLFDVGTGISAPSTTYTQMNFPEVVPAIASEQKKVDPFGSLFMNAKTEPIQ
                     AKKSSPPSTNIASPVQAQEDDDNDLFGEMTEAAPIVQPAKLTQPAQPAQPAQPTSNND
                     VVDLLDL"
     gene            complement(<84722..>87559)
                     /gene="TPHA0B00410"
                     /locus_tag="TPHA_0B00410"
                     /db_xref="GeneID:11534947"
     mRNA            complement(<84722..>87559)
                     /gene="TPHA0B00410"
                     /locus_tag="TPHA_0B00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684098.1"
                     /db_xref="GeneID:11534947"
     CDS             complement(84722..87559)
                     /gene="TPHA0B00410"
                     /locus_tag="TPHA_0B00410"
                     /inference="similar to DNA sequence:INSDC:YML076C"
                     /note="similar to Saccharomyces cerevisiae WAR1 (YML076C);
                     ancestral locus Anc_4.344"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684146.1"
                     /db_xref="GeneID:11534947"
                     /db_xref="GOA:G8BQB5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8BQB5"
                     /translation="MVVFNTGLTNISGVDSDDVRLLKPTAIDPDLWQKRKRNTVACIT
                     CHSSKQKCVPSDLNNIFWKPCIRCLKSKRQCTFDLSKRTRNRRTPKSSSHSSPSSQSI
                     SSVKRQKIDNDIDFIKPEEPNITYSNNSQYLNNSNISGGKFTDSNNISIASNNTGKPL
                     KLGHFTPSSLPTQANNLNQQYSPNETIPNNNIQSYQASSQNPNSEGTRMLPDTSTILS
                     SVTPPVSSLWPNITKSISLDNIHSMDSRLSKNQQYNNHNTNTAYNINNNYKSRLPIPN
                     FYSNGNIYSTPASCSKHNSEYYDNDLPSIVDNSINTGVNIIQSVNSLPETQNEISKAL
                     VHSDLSNIMTDSSASQFKKKLKSLLIKQKGKVHNLYDVLNVLAVKWSDTLVKSSYADR
                     VTDPISLNLLTYEEADRRLNLYRDVIDRDCRLPFVKISKDTTVDKLRTEKPIFFTTII
                     CIVSILMKQDETTEETIFNLNSFTLHLIKNEIFQHNRKSIELLESLLTLCLWYNFPEW
                     SNNTHYHLFNYISCSLTKELGPTSRNRSFAMFPEESNHFNRFKKVSPLEAYENGYKIQ
                     IINYISATNIALFLRQRSHIQWSSTLENACDKIINYKNSNEPSHNFTDDEMWVVFLKL
                     NHLLEKIQTYLHEPFDTHEERDDPEYSERHINNLCTRYKKQLDIIFVQIPDDRHRILS
                     FYFSVESFLHQFIVRRFLILNGNFKELPSNITTSFVRCCECCILALKEFLKLTPRLVA
                     SLPLFHMSRIIYTVGMLLLRCRYSSIAIPVLNKYITQTDGVVDLVNQVSDLLEKTSKI
                     YVYNTFILKFQYVIALFVQTYASRVLEDKKILKHKKTNGQKAASKNVNNKKHDSSSST
                     FKHNHNQELFTNTQNIPNVMQNIPAHTTSSFGNNLGLKHNKTTPLTETEDSPSTSVGN
                     LTEYLSDMDSLALGFNHLNDEFWSDIFSGYT"
     gene            complement(<88557..>91859)
                     /gene="TPHA0B00420"
                     /locus_tag="TPHA_0B00420"
                     /db_xref="GeneID:11535184"
     mRNA            complement(<88557..>91859)
                     /gene="TPHA0B00420"
                     /locus_tag="TPHA_0B00420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684099.1"
                     /db_xref="GeneID:11535184"
     CDS             complement(88557..91859)
                     /gene="TPHA0B00420"
                     /locus_tag="TPHA_0B00420"
                     /inference="similar to DNA sequence:INSDC:YLR450W,YML075C"
                     /note="similar to Saccharomyces cerevisiae HMG2 (YLR450W)
                     and HMG1 (YML075C); ancestral locus Anc_4.343"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684147.1"
                     /db_xref="GeneID:11535184"
                     /db_xref="GOA:G8BQB6"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR002202"
                     /db_xref="InterPro:IPR004554"
                     /db_xref="InterPro:IPR009023"
                     /db_xref="InterPro:IPR009029"
                     /db_xref="InterPro:IPR023074"
                     /db_xref="InterPro:IPR023076"
                     /db_xref="InterPro:IPR023282"
                     /db_xref="InterPro:IPR025583"
                     /db_xref="UniProtKB/TrEMBL:G8BQB6"
                     /translation="MSFLLKKLTPVSKILALFAKFSAKHPIHVIFTTLLLAAITYLSV
                     IQHYVINWKLDSRSISGLNHFNAQHIINSCTHYYTDSHTNGWKNYKLNSSEFSMNGKN
                     HYYLFTLNFDHLDAYSPVKNLSNVIHENSDYKYILQEDNQLSPEYVSHSSSNSSDDVV
                     WRLTNKQNHLFEVQYLFWSIYNNLMTRFSESEPFDILIILVAYLMVLQTVYSLFVEMS
                     KTGSKFWLSLATICNSGCAFFFSLFTFQLFLKNNVSATSLVEGLPFIIVIVGFKHKIR
                     LAERSTKLFQKVGLSKKTTIDEIIYESMSIEGTKLVHDHLLCIIAFVGCSLYARDLQV
                     LSYFCAFCALMLIYELVLTSTFYSAVLSLKLEMNIIYRSTIIKQALEEDGVVPTTADL
                     IYGQENESKHSLFGSHSSYIINGIKFSVVALFILINLYNFGVRWASETVSLLYRDDMV
                     LNDLPDFIKTNKSLSLNEPIIVSVAPIQYYQTRNTYHKIEDQIMLVLHYISKVISDRF
                     VSKVIFAAFIVSCSVNIYLLNATRIHTLYTAVEFSKRKALNQDTKNTKSATSKSSKTG
                     KGKSGSKNKSGLSKIIASAATVIEAKAPLTTSSSSSLSSSVSTTATSSDYETDTDDLT
                     VNVRPIDVLEGIMKEGNVSTLRNKEVTLLVVSGKLPLYALEKQLGDTTRAVVVRRKAL
                     SVLANAPVLSSDRLPYKHYDYDRVFGACCENVIGYMPLPVGVIGPMIIDNVPYHIPMA
                     TTEGCLVASAMRGCKAVNAGGGITTVITKDGMTRGPCVRFPSLSRAGACKIWLDSTEG
                     QNKIKKVFNSTSRFARLQHIQTAMAGDLLFIRFRTTTGDAMGMNMISKGVEYSLKQMT
                     EEFGWEDMEIVSVSGNYCTDKKPAAINWIEGRGKSIVAEATIPGDVVRNVLKSDVKAL
                     VELNISKNLIGSAMAGSVGGFNAHAANLVTAVYLAVGQDPAQNVESSNCMTLMKEVDG
                     DLKISVSMPSIEVGTIGGGTILEPQSAMLDLLGVRGPHPTEPGTNARQLARIVACAVL
                     AGELSLCAALAAGHLVQSHMAHNRKQPAANTANAAAVTPAVPAIVAHPADEVGEENIE
                     RLKEGSKICIKS"
     gene            complement(<92587..>93117)
                     /gene="TPHA0B00430"
                     /locus_tag="TPHA_0B00430"
                     /db_xref="GeneID:11534929"
     mRNA            complement(<92587..>93117)
                     /gene="TPHA0B00430"
                     /locus_tag="TPHA_0B00430"
                     /product="60S ribosomal protein L6"
                     /transcript_id="XM_003684100.1"
                     /db_xref="GeneID:11534929"
     CDS             complement(92587..93117)
                     /gene="TPHA0B00430"
                     /locus_tag="TPHA_0B00430"
                     /inference="similar to DNA sequence:INSDC:YLR448W,YML073C"
                     /note="similar to Saccharomyces cerevisiae RPL6B (YLR448W)
                     and RPL6A (YML073C); ancestral locus Anc_4.341"
                     /codon_start=1
                     /product="60S ribosomal protein L6"
                     /protein_id="XP_003684148.1"
                     /db_xref="GeneID:11534929"
                     /db_xref="GOA:G8BQB7"
                     /db_xref="InterPro:IPR000915"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:G8BQB7"
                     /translation="MSAQAAPKWYPSEDVAAPKKTRKASRPQKLRASLVPGTVLILLA
                     GRFRGKRVVYLKHMEDNTLLVSGPFKVNGVPLRRVNARFVIATSTKVSVEGVNVEKFN
                     AEYFAKEKLTKKQKQEANMFPEKQVKELKAERVEDQKNVDKTLLAEIKKTPMLKQYLA
                     ASFSLKNGDKPHLLKF"
     gene            complement(<93810..>98177)
                     /gene="TPHA0B00440"
                     /locus_tag="TPHA_0B00440"
                     /db_xref="GeneID:11534879"
     mRNA            complement(<93810..>98177)
                     /gene="TPHA0B00440"
                     /locus_tag="TPHA_0B00440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684101.1"
                     /db_xref="GeneID:11534879"
     CDS             complement(93810..98177)
                     /gene="TPHA0B00440"
                     /locus_tag="TPHA_0B00440"
                     /inference="similar to DNA sequence:INSDC:YML072C"
                     /note="similar to Saccharomyces cerevisiae TCB3 (YML072C);
                     ancestral locus Anc_4.340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684149.1"
                     /db_xref="GeneID:11534879"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR017147"
                     /db_xref="UniProtKB/TrEMBL:G8BQB8"
                     /translation="MSSSEQENSLRRNSSVTGSSKPSLYKTISKASLLKGKQPVIAAR
                     THDIGDIPAPGGEGYVGSVPVEKLASQQRKSHLVSRKLNRVDTSLDPKYKELSTVSKT
                     EIEQIKSELSEYRKDNLFPWDHVAEFFPSSASAPTAANSRAIKDFIIENFYNDWYFNS
                     VLISCTCFYSWLLAYMGFSWFALIFIFICTATNYNFEYTRFNRNIRDDLKRTTVHETL
                     SSKTETTLWLNSFLQKFWVIYMPVLSQQVFDQVNPILDESAPGYGIDALALEHFTLGS
                     KAPSIRGVRTHTKGGKNFAEVEMAFAFTPNDESEMTPKEAKEKINPKISLGITLGKGF
                     VSKTMSVIVENINVSGRIRLVAEFGDIFPNIKIVSVQLLEAPMMDFVLKPVGGDTLGL
                     DVMSFLPGLKSFVKSMINSNIGPMLIAPNKMDIDVEDLLAAQSNDAIGMLAVKVTSAS
                     NLKSSERIGNSIDPYVVISTENEVQGNSTEVRTSVKSDVKNPRWNETKYILVNTLNQK
                     LTLKCFDFNDVRKDTLIGSTEIDLKELLQEPIMESLSSELTLGTYTRGAIEYSLYWYP
                     TIDTKAVPSESENVSSGLETDLEDEIEQTTNSDVGIAKITLQNIKELNTSIALGGIIS
                     PSAEFFIDGKLVKTYRTIKKNREPAWNETIEVFIPSMSSSKVQMKVFHNVSKSKKLLI
                     ASKTCAFEELLNISAVGTNYMSLDPQGIAFFTTQWKPLCVSDEFSVMKTYQKPIGSLI
                     IEVSDTNIKTELQGVGDIDPFFTISINHKLSYKSKYVSDTKHAVFNENIYLPYNNKNQ
                     LVTIAVYDYQSVGKNRLIGSLQCTVGEIISSINVSGNSQNGPDFSEVNTWPLKSETNK
                     LTGSTINLRFGHVPLTPVFTPDEAIQIKELKKSLDEKKEEFQKEQANFKLEMEKNPDY
                     WEVDEIKDPFEDEEKIINAKNMLTLDQLLSSSSGMLNVEIVSGFIKKPNGYLQILFDD
                     IYFPSITSAMAKNGKLANERGNAFIRDLEASKMYLRVSKKHIAKDTEDIITEARFNTI
                     DILKKSYCKPLELNFEGCTISLKTIFEPASVKLPKCETIINTGYLNLNLISAKDLLAA
                     DRNGKSDPYVDVVVNGITVYTSKTVKKSLSPTWNERTKVPIPSRKFSEVKLDVYDWDR
                     AGNNDPLGYVKLDLDNLEPGKVYNWDLPLSKQGTIQISAIFEPEYIKPTLDAKQSKLS
                     TMPFKVVSNVAGAGAGVAGAGLGLGVGGIKGGGRLLKKGLGGDFGRRKSSDVESRSNS
                     NNGLSPLEENETLPNGTYAPVPRNNYGETATQTPDNTGSNHTRTDSVVSSSARTLAPN
                     GIYNGKIQIVAAENLGKHIDVKISLAQNSKLKRIFKSKPKKADAKGVVYINENCVFKS
                     SPDATLIFNAVSHHTLAKDKDLGITKLNLSDPQISSTGNIGVKLGEGMIVVKIDYGDV
                     NDISTVSETNQSPSTYQES"
     gene            complement(<98591..>100288)
                     /gene="TPHA0B00450"
                     /locus_tag="TPHA_0B00450"
                     /db_xref="GeneID:11534835"
     mRNA            complement(<98591..>100288)
                     /gene="TPHA0B00450"
                     /locus_tag="TPHA_0B00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684102.1"
                     /db_xref="GeneID:11534835"
     CDS             complement(98591..100288)
                     /gene="TPHA0B00450"
                     /locus_tag="TPHA_0B00450"
                     /inference="similar to DNA sequence:INSDC:YML071C"
                     /note="similar to Saccharomyces cerevisiae COG8 (YML071C);
                     ancestral locus Anc_4.339"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684150.1"
                     /db_xref="GeneID:11534835"
                     /db_xref="GOA:G8BQB9"
                     /db_xref="InterPro:IPR007255"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="UniProtKB/TrEMBL:G8BQB9"
                     /translation="MDVVLSELNLPGPKLTKQQIDYCNAELENILQSDTKDYTTYFSS
                     KPIPGSIVEDIAEVDAEIAVLEKKIKTILVENKETVLEDILKNNGSHRLQSIHRELQQ
                     LKELNNVSKDTLTGNHTNGKTNNEEHDRIDDLMNTEEQTDVKSKKEDDFQNVLEKLRK
                     RSMLNSNYDKFGNNLNNLPLVLENLDNITDLMELPFLVRTCIKTGHYQEAIMLFTHSK
                     SLQSKFAGSSIIDDICEKVLNEISTTMLTGLVKLLATNVTVNSLKKILKYLSAIPPFD
                     EKDNSSTLLQVFLTMRYIFIQREIESYAIEKNNSNSYIVEMMIKRKIEVLREYTFTSV
                     NLFETSFPLFKESLSIPNLINMNINMDEEADNKKNEPEAEEKIETEDNNETNKGNEEN
                     LAKEGENNFIKKESNNETPKENSTEQDDSIAEISLKEDLKKPETKGETTDDKESNNLD
                     KNNDVTIDTTKGSLTEKTTERAENLLESADTNALMLQFVSNCITFLLQELSVANTKGT
                     LSDSICLQLVYCSFRLRDLNINYHHLLLNKIKEANLFNEQQIVSAINRRAELASKYT"
     gene            complement(<100564..>101283)
                     /gene="TPHA0B00455"
                     /locus_tag="TPHA_0B00455"
                     /db_xref="GeneID:11534901"
     mRNA            complement(join(<100564..100746,100837..>101283))
                     /gene="TPHA0B00455"
                     /locus_tag="TPHA_0B00455"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684103.1"
                     /db_xref="GeneID:11534901"
     CDS             complement(join(100564..100746,100837..101283))
                     /gene="TPHA0B00455"
                     /locus_tag="TPHA_0B00455"
                     /inference="similar to DNA sequence:INSDC:YLR445W"
                     /note="similar to Saccharomyces cerevisiae YLR445W;
                     ancestral locus Anc_4.331"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684151.1"
                     /db_xref="GeneID:11534901"
                     /db_xref="UniProtKB/TrEMBL:G8BQC0"
                     /translation="MENTNIENTATQVEVTNDKDNEKTMENVGVQTYEEVTSSKDFTS
                     LVKEWKSDAFKTTIQEKLNTNEILIRIKEVTELMNYENDSSEKCLKKSKEESEAKNNT
                     NVTDGGFLNSKTEKLDWDKVYAVSTNIIDNYTQEVDVILTQLDELSKKQYLWQESAFI
                     IDAHRGVSIFNESKNWISTKEAYLDLKRSKLGSSAEIIKETIQKLTNKK"
     gene            complement(<101623..>102672)
                     /gene="TPHA0B00460"
                     /locus_tag="TPHA_0B00460"
                     /db_xref="GeneID:11534941"
     mRNA            complement(<101623..>102672)
                     /gene="TPHA0B00460"
                     /locus_tag="TPHA_0B00460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684104.1"
                     /db_xref="GeneID:11534941"
     CDS             complement(101623..102672)
                     /gene="TPHA0B00460"
                     /locus_tag="TPHA_0B00460"
                     /inference="similar to DNA sequence:INSDC:YML067C"
                     /note="similar to Saccharomyces cerevisiae ERV41
                     (YML067C); ancestral locus Anc_4.330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684152.1"
                     /db_xref="GeneID:11534941"
                     /db_xref="InterPro:IPR012936"
                     /db_xref="UniProtKB/TrEMBL:G8BQC1"
                     /translation="MAGLKTFDAFPKTEERHVKKSKKGGLSSILTYAFLLLIAWTEFG
                     SYFGGYIDKQYSVDKDIRKVVQINMDIYVKMPCEWLHVNVLDDTNDRKIVSEELIFED
                     MPFFVPHGSKVNNLNKVVTPELDDILAEAIPAEFREKIETKPLLGPDGKPIFELTGCH
                     VYGSVTVNRVAGEMQITAKGYGYRDRKRAPKDLIDFNHVVNEFSFGDFYPYIENPLDG
                     TCKMYPNSPFSSYNYFMSVVPTFYQKLGAEIDTNQYSIREYHVDLKNSNVNAKLSTIP
                     GIFLKYDFEPLAIIISDVRLTFLQFIVRLVAILSFVLYIASWIFRAVDKSLIFVLGPK
                     WSLHYQPAANSQGIL"
     gene            complement(<103065..>104345)
                     /gene="TPHA0B00470"
                     /locus_tag="TPHA_0B00470"
                     /db_xref="GeneID:11534938"
     mRNA            complement(<103065..>104345)
                     /gene="TPHA0B00470"
                     /locus_tag="TPHA_0B00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684105.1"
                     /db_xref="GeneID:11534938"
     CDS             complement(103065..104345)
                     /gene="TPHA0B00470"
                     /locus_tag="TPHA_0B00470"
                     /inference="similar to DNA sequence:INSDC:YLR443W"
                     /note="similar to Saccharomyces cerevisiae ECM7 (YLR443W);
                     ancestral locus Anc_4.328"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684153.1"
                     /db_xref="GeneID:11534938"
                     /db_xref="UniProtKB/TrEMBL:G8BQC2"
                     /translation="MNVILNGIRQFTYQVSHNISTFERTIFVLRLLTSFLGLAFGLIT
                     ILSSTISPLTFYLFRFNFSLTNLKDGLVEYLEGSVNNSDSSLSTSEVLLLGKYANTQI
                     QHAPSYIVMSLNQICYITYPEVIGSTNFKETTVLSNCESIDFSFIFNYKQTLYKYGLS
                     IILFFAYGDTKYDIEESDQNNTYARFLRNASNKKEIAFIFLVVTILLEFIVLLLTPYY
                     YSIKNKTINGLKEVFILHSISTLTLISLATGATGCGIFSWLCWALKLRIEKELGGFGL
                     SINLGKAWFICLGIFTGSASLSAFFWCGLEWCVTNIETPDYADTIQSDKQNILDYKPG
                     VITNFNTETFSNIDKDQIKSDTRFRGFSNSSTFNKNTDVYLERISQVDDINSDTIENI
                     FEDEAFELNSLSKSLSDESTSTSIDHPIRPSRLF"
     gene            <104783..>107569
                     /gene="TPHA0B00480"
                     /locus_tag="TPHA_0B00480"
                     /db_xref="GeneID:11534842"
     mRNA            <104783..>107569
                     /gene="TPHA0B00480"
                     /locus_tag="TPHA_0B00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684106.1"
                     /db_xref="GeneID:11534842"
     CDS             104783..107569
                     /gene="TPHA0B00480"
                     /locus_tag="TPHA_0B00480"
                     /inference="similar to DNA sequence:INSDC:YLR442C,YML065W"
                     /note="similar to Saccharomyces cerevisiae SIR3 (YLR442C)
                     and ORC1 (YML065W); ancestral locus Anc_4.327"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684154.1"
                     /db_xref="GeneID:11534842"
                     /db_xref="GOA:G8BQC3"
                     /db_xref="InterPro:IPR001025"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BQC3"
                     /translation="MAATLKDLEGWKIIMRDENNNIIDENKRRSRRRNENITIDITRD
                     SDGVSFTRGDSIITKDKNISADLGSYSVYYIHDIRLNTMTSVVELIAMTYLRWFEINP
                     FNYYSYFEKSTFDNTKSIDYYKDRFNEEVDRNQLYLTAELKEISLKEFTQLANIRPVS
                     DWKDELETKVINRDFSVRFLCDPDSTNFIEIDFEKLRNKMLTQEPKAAVQYFKKISIG
                     GVDAVKGKQLATKSKADPVKEVSIREIKVESDSENNLSLSEEEEEDDGDDNDYHSDYE
                     ENKGAEDVEGIEDENTPSELSDSENDCANSDEKLISEEEYGESKKSTRTTKKRKISEV
                     KEPKSSKKKIKATTPQYRTAKIKRFTKKNVDRARKKYTPFSKRFKNISDIPDLTKYAD
                     FNQSNLDLQMANYEAKLTAPTNSKVVETIFSKIKKQLYSSHGREKLIDNNDFDAYIPG
                     RGKDFATIYLSLYTAIEAGTASTVYIAGTPGVGKTMTVREVIKELQSSMYQEELPEFQ
                     YVEINGLKMVKPTDSYEVLWNKISGERLTWGAAMESLEFYFNKVPKQKKRAVVVLLDE
                     LDALVTKAQDIMYNFFNWTTYSEAKLIVIAVANTMDLPERHLGNKVSSRIGFTRIMFT
                     GYTHEELINIINSKLQGLNDTYFYVDSTNGNAVLMNSADAENGETLKMSSNIKKVKLR
                     MSNDAIEITARKVASVSGDARRALKVCKRAAEIAEVAYMAKHGFKYDGSLVKADSDDD
                     NDDNFADDKDVIALRKLKGVDNGVSNNEEEDDSVQTVHISHIMKALNEIVNTYNVEYI
                     RKLPFSARLFLYAFLSLIRKTTFQEQEIGSIVDEIKLLADVNGNNKYISAVKNTLYQR
                     ENDRPDNNGDNSNSSTGQIRILSWNYIINNLIEAGVMSKQTMRHERLSTLKLNISIED
                     IKKALDFDETLKNL"
     gene            <108488..>109255
                     /gene="TPHA0B00490"
                     /locus_tag="TPHA_0B00490"
                     /db_xref="GeneID:11535002"
     mRNA            <108488..>109255
                     /gene="TPHA0B00490"
                     /locus_tag="TPHA_0B00490"
                     /product="40S ribosomal protein S1"
                     /transcript_id="XM_003684107.1"
                     /db_xref="GeneID:11535002"
     CDS             108488..109255
                     /gene="TPHA0B00490"
                     /locus_tag="TPHA_0B00490"
                     /inference="similar to DNA sequence:INSDC:YLR441C,YML063W"
                     /note="similar to Saccharomyces cerevisiae RPS1A (YLR441C)
                     and RPS1B (YML063W); ancestral locus Anc_4.325"
                     /codon_start=1
                     /product="40S ribosomal protein S1"
                     /protein_id="XP_003684155.1"
                     /db_xref="GeneID:11535002"
                     /db_xref="GOA:G8BQC4"
                     /db_xref="InterPro:IPR001593"
                     /db_xref="InterPro:IPR018281"
                     /db_xref="InterPro:IPR027500"
                     /db_xref="UniProtKB/TrEMBL:G8BQC4"
                     /translation="MAVGKNKRLSKGKKGLKKKVVDPFTRKEWFDIKAPSTFENRNVG
                     KTLVNKSTGLKNAADALKGRVVEVCLADLQGSEDHSFRKVKLRVDEVQGKNLLTNFHG
                     MDFTTDKVRSMVRKWQTLIETNVTVKTADDYVIRIFAIAFTRKQSNQIKRHAYAQSSH
                     IRAIRKVISEIMTREVQNSTLAQLTSKLIPEVMNKEIENATKDIFPLQNIHIRKVKLL
                     KQPKFDLGALMALHGQASGEEKGKKVSGFKDEVLETV"
     gene            complement(<109658..>112504)
                     /gene="TPHA0B00500"
                     /locus_tag="TPHA_0B00500"
                     /db_xref="GeneID:11535118"
     mRNA            complement(<109658..>112504)
                     /gene="TPHA0B00500"
                     /locus_tag="TPHA_0B00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684108.1"
                     /db_xref="GeneID:11535118"
     CDS             complement(109658..112504)
                     /gene="TPHA0B00500"
                     /locus_tag="TPHA_0B00500"
                     /inference="similar to DNA sequence:INSDC:YML061C"
                     /note="similar to Saccharomyces cerevisiae PIF1 (YML061C);
                     ancestral locus Anc_4.322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684156.1"
                     /db_xref="GeneID:11535118"
                     /db_xref="GOA:G8BQC5"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010285"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BQC5"
                     /translation="MITKCNTKTLYRLIKFGNIQLTTSIFYQSSRVFTKYLISNYHTM
                     SGNYEDLKELLSDSSDWDINESRSRATINTKTAAVNIAHISTPKKIGTLKKNDSEDLS
                     FIDDLEEDSSLLKLLHKKKTNDKTLFGALNQRPKNKSLLKTPQDISPNFWNDIKNNSS
                     PLFTKNTSTQLTNIHKVLHSQRDYSTGSSNISSNEHNQKSIDKKKTFKDIQEEELELL
                     LASQSNESTINEENSLKYKQSDEALQEQLDDDFDHVDEIDVDLVDEVDIEAKINYDNF
                     IKEQRKNLEISSENAKPTHISISDESSPIVIKKREKTRYGNKFHLLTQRPGLNSDDNP
                     IKTLNLPKDNKIMIPIRLSEEQENVIKLAEEGRNIFYTGSAGTGKSVLLRQMIKVLKR
                     KYGHARVGITASTGLAACNIGGITVHSFTGIGLGKGDEENLYKKVRRSRKHLKRWQNI
                     SALIIDEISMLDGILLDKLNYIAQKIRKNKAPFGGIQIIFCGDFFQLPPVVKDNSPLK
                     FAFESDIWKNGIDVTIMLQKIFRQQGDSVFIDMLNKMRVGNVDSDTEMEFKKLSRPLP
                     DDEIIPAELYSTRYEVDSANNSRLAKLPGDIITYNSIDGGSLEDEEAKSRLLQNFLAP
                     KQLKLKIGAQVMMIKNIDSTLVNGSLGKVIDFIDPDTYMFYDTIVNNPRIPTEELEKF
                     RSNPELLKEAYEKKEEKEDNIQTSKRGRNTLIKKAFNENEETPVAALGESLFDFLADV
                     TGNDSSIVENLNRKRELLNDIHRSSTGQRRLPLVRFKTTDLTTRTVLVEPEDWAIEDE
                     DEKPIVSRIQLPLMLAWSLSIHKSQGQTLPKVKVDLKRVFEKGQAYVALSRAISRDGL
                     QVLNFDRNKIHAHVSVVKFYDTLVSADDAIKDLKQRDQVKQEQKVNENSAPSYTYNKN
                     TFKKDTNQYYVNKNKLPGIEQMLQNSKRHKSSGL"
     gene            <113092..>114231
                     /gene="TPHA0B00510"
                     /locus_tag="TPHA_0B00510"
                     /db_xref="GeneID:11535050"
     mRNA            <113092..>114231
                     /gene="TPHA0B00510"
                     /locus_tag="TPHA_0B00510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684109.1"
                     /db_xref="GeneID:11535050"
     CDS             113092..114231
                     /gene="TPHA0B00510"
                     /locus_tag="TPHA_0B00510"
                     /inference="similar to DNA sequence:INSDC:YML060W"
                     /note="similar to Saccharomyces cerevisiae OGG1 (YML060W);
                     ancestral locus Anc_4.321"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684157.1"
                     /db_xref="GeneID:11535050"
                     /db_xref="GOA:G8BQC6"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR012904"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:G8BQC6"
                     /translation="MTGANYGSFIVRKKELLLDNVLQVGQSFRWVYNESSQEYVTTMK
                     ISGQYHVVLLKQVELNQDDESDLKNTIVQYATLGDTCDSKSLESHLMDYFRMDVSVEN
                     LYNKYWLPNDVRFKAHYPTGNRMLAQEPWETLVSFICSSNNNISRITKMCHELCRNFG
                     TELKPEIDRDDTGSSHYTFPSSDDIVNKATEDKLRELGFGYRAKYIMETAKLLVEQKK
                     ANDFTDDSEYLLSVKDSSSYIELREHLMGYTGVGPKVADCVCLMGFRHDDVVPVDVHI
                     SRIAKRDYKFQVNKKSMENLRKQYASYPVTKKKINLELDLIRVMFVKKWGKYAGWAQG
                     ILFSNEIGKSSGATTNGDVKKRQLELDIQVKEETVENSDKIKRKK"
     gene            complement(<114427..>115401)
                     /gene="TPHA0B00520"
                     /locus_tag="TPHA_0B00520"
                     /db_xref="GeneID:11535178"
     mRNA            complement(<114427..>115401)
                     /gene="TPHA0B00520"
                     /locus_tag="TPHA_0B00520"
                     /product="mitochondrial 54S ribosomal protein YmL4"
                     /transcript_id="XM_003684110.1"
                     /db_xref="GeneID:11535178"
     CDS             complement(114427..115401)
                     /gene="TPHA0B00520"
                     /locus_tag="TPHA_0B00520"
                     /inference="similar to DNA sequence:INSDC:YLR439W"
                     /note="similar to Saccharomyces cerevisiae MRPL4
                     (YLR439W); ancestral locus Anc_4.320"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL4"
                     /protein_id="XP_003684158.1"
                     /db_xref="GeneID:11535178"
                     /db_xref="GOA:G8BQC7"
                     /db_xref="InterPro:IPR010729"
                     /db_xref="UniProtKB/TrEMBL:G8BQC7"
                     /translation="MLAFKRGFHNTVNTAARTRYTKPKPKHVPKVIAPPPSQVTHHYN
                     NLKITAPVPPVVQNIVCPDDHPLWQFFADKKFMRSPSDVDSTSRAWSIPELRRKSFDD
                     LHSLWYICLKERNILARENHLLRNIVNGNQGTFEDVSEKIRTTMWRIRHVLSERDWAF
                     KNAQLAFENERANFIKEFETDFLKMTQEEDEVAFESLARFQKSIFGISEYLDENVVDR
                     TFVDGLKIVANLKLQKFAPREEAIRKFIDALENNRLDDVGEAFVIFTAENGAKDVKDA
                     CDAVLDLRDSNNKIARIDEINTVSQYIKSLAEVQKQPEVENENESQTF"
     gene            <115903..>116160
                     /gene="TPHA0B00530"
                     /locus_tag="TPHA_0B00530"
                     /db_xref="GeneID:11534965"
     mRNA            <115903..>116160
                     /gene="TPHA0B00530"
                     /locus_tag="TPHA_0B00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684111.1"
                     /db_xref="GeneID:11534965"
     CDS             115903..116160
                     /gene="TPHA0B00530"
                     /locus_tag="TPHA_0B00530"
                     /inference="similar to DNA sequence:INSDC:YLR438C-A"
                     /note="similar to Saccharomyces cerevisiae LSM3
                     (YLR438C-A); ancestral locus Anc_4.319"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684159.1"
                     /db_xref="GeneID:11534965"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:G8BQC8"
                     /translation="MSLATPLDLLKLNLDERVYVKLRGARELVGTLQAFDSHCNFVLS
                     DAVETIYQLIDGELKSREKSSEMIFVRGDTVALITTPLPDE"
     gene            complement(<116377..>121023)
                     /gene="TPHA0B00540"
                     /locus_tag="TPHA_0B00540"
                     /db_xref="GeneID:11534904"
     mRNA            complement(<116377..>121023)
                     /gene="TPHA0B00540"
                     /locus_tag="TPHA_0B00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684112.1"
                     /db_xref="GeneID:11534904"
     CDS             complement(116377..121023)
                     /gene="TPHA0B00540"
                     /locus_tag="TPHA_0B00540"
                     /inference="similar to DNA sequence:INSDC:YML059C"
                     /note="similar to Saccharomyces cerevisiae NTE1 (YML059C);
                     ancestral locus Anc_4.318"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684160.1"
                     /db_xref="GeneID:11534904"
                     /db_xref="GOA:G8BQC9"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR001423"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:G8BQC9"
                     /translation="MIYKIWYILSFVLLRIPSWIFVTANAIKFTIPFTTLFVTFIITS
                     YVIYYIVKSRVLSQYKKLTPEKEELKSLGSSSSKCSSVNLDQARSSAQDKSSKHEKKN
                     IFFHYEDDRSFSSYLDQFLSAIKIFGYLEKPVFNDLTKNMKTQKLNEGEILLLDDAIG
                     LAIVVEGSLQIYHNVSDNSGNGIISNSYTKNCANDYINSASVNYSSEHSSISDNLKVE
                     NSCLDTNSNNSETSSNNDNYEESDGFSEDSNTYIRFKNGSGKYQLLNTVKPGNPVSSL
                     VNILNLFTSKKSKQNSNNNAQENITNNNSTSNLSNSQNFSHFGAKDLSTLTFDDANPV
                     FYPLPNIVARAATNCTIAIIPPKSFSKLVETYPRSASHIIQMVLTRLYRVTFQTAHDY
                     LGLTSEIMEIEYLLNKNVRYELPYFLKEAVVNCYKHTKQAYSTNNNSKGSSIINLNSK
                     TSNKSSSSTKSFLSEIPLKFSVPKSKSNSQLNTNNIFESFGGGSRNFVLKSSKDHSNP
                     GDLLSNVPLTRRDLSTSDAVTPISSNNNFSAILDNALSPLLEFENEKRPVKIKNGFPE
                     VSNNKSEKTQRGTLNSHSDSENDGKIKYFSLQEGTDEATLRFALVEAIFNILSINEES
                     FYAKKSRTASLTTPTLTHRISNSSDNSLESSIYSTQQDYPDSAIKILPSEYAITSHKF
                     KPKLSTTYKEEVPTSIDFESVKKEFSDNIDLQYHPKGETIVEQNNNSKGLFYVISGSI
                     DVTYTNSPGMDYVPEMNSSNKEFNEDLKKVEQFLYTVESGGIAGYLASLVNSKSFVNL
                     KARTDVYVGFLSNQTLERFYDKYCLLHLRLAEILTTLISPRMLKLDHALEWIHLSASE
                     TLFNKGDPANGIYVILNGRVRQVSDKHYFQSPELAQGESFGEVEVLTAMNRMSSIQAV
                     RETELARIPRTLFGILALEQPSIMFRISRLVARKILDINLGSDVPTRVTADNGYKYDF
                     NLMIPSLNGNAHKGAHPKNKNSYRTITILPVTEGLPVNSFANKLVQAFRQVGRNTIGL
                     NMRTALNHLGRHAFDKLAKLKLSGYFAELEVMYQTVVYIADSPVNSSWTNTCISQGDC
                     ILLLADANDSADIGEYELLLQKVGTTARTELILLHPERYVEPGSTYNWLKQRNWVDAH
                     HHMQFLVNPLSERLNMRSHNKNASRLALVDRIMNTEFSKLTQENISKYVPESIKSKVE
                     TISRRIRGRSHQYYSSSDPNKNDFLRLARILSDQAIGVVLGGGGARGISHLGVLQAIE
                     EQGIPIDLIGGTSMGAFVAGLYAKDYDIVPIYGRLKSFCARIGSLWRMIGDLTWPVTS
                     YTTGHEFNRGIWKTFGDTRIEDFWIQYYCNSTNITESIQEIHSFGYAWRYIRASMSLA
                     GLLPPLEAKGSMLLDGGYVDNLPVDEMKGRGCDIVIAVDVGSVDDRTPMNYGDSLNGF
                     WILFNKWNPFSSYPNIPTMAEIQMRLGYVSSVNALERAKRTPGIIYTRPPVADFATLD
                     FGKFEQIYNVGLDYGRSYLKTLIENKNMPFIAGSKATLIDTAIPEFLSRRRNSI"
     gene            <123270..>127262
                     /gene="TPHA0B00550"
                     /locus_tag="TPHA_0B00550"
                     /db_xref="GeneID:11534873"
     mRNA            <123270..>127262
                     /gene="TPHA0B00550"
                     /locus_tag="TPHA_0B00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684113.1"
                     /db_xref="GeneID:11534873"
     CDS             123270..127262
                     /gene="TPHA0B00550"
                     /locus_tag="TPHA_0B00550"
                     /inference="similar to DNA sequence:INSDC:YLR436C"
                     /note="similar to Saccharomyces cerevisiae ECM30
                     (YLR436C); ancestral locus Anc_4.315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684161.1"
                     /db_xref="GeneID:11534873"
                     /db_xref="InterPro:IPR026705"
                     /db_xref="UniProtKB/TrEMBL:G8BQD0"
                     /translation="MGNTDSRLNALYREHVFKIAGHENGDIPIFKTDDSKNVRLKDLI
                     ALYNSNILIDDTHFNEFYLEFVIAGTELKFSLLNDIINNDELREIMKRNENNYLNLIR
                     FTALQIYNLSNSLNVPSIELLKFRLSRLLCCVRILTKLLPLYFEYERENNRCLNGADI
                     FWSNDARVLFGLGYDDDEDISDEDDNQEDLQNEKIVNDKNIIEPLGVNILKACLKLLF
                     IEGFTIPADGSPGSVSYLLWENGISTQDSLYHKQNPKVDSNRLEIINLLLSLCSVDLY
                     AKQASKSKNYFLYCFSNLMPEYDSICLIASIINVTCRFCSNYQTEMNLPYKGVPIKVS
                     QQQQYPQLRSSFIMSSLQLLNIITSKYWIEIEQEIVEELVKLKIITDSSQINNIALSY
                     TSTINKEHDLKLLLSAFARIFKYPIDSAIKNETSPFGSFSSKTQNNAYNNYHPNNNPN
                     IVNHNGEKQNNNNGNNYSNNENNNKAAQNGNNSYNNINMGPNTRNVGTDSDSNNNIAP
                     LPILPQIFSDIIIFTLNLMNNNKNFENYVADKLANKLVLFSIYYVSYYSQSIEIHSTV
                     IPLISTLSLYLTSKKLVLSKMLETFTTDYYTNKLPNFFKITSNVNIENLTYRDFAIVH
                     LSNIIMNDVRDNIQPRPWCYQMLYNLIQIPSNLRDNELVTLSGKRSSINSSNNNRRIS
                     YNTSTIIITLLAKLSSMNYLSTYSTSVYGKNFKSSYRYSPGYKMDLLSLLLRSVTNYI
                     IHSYEDAVNLAFALCRHQRVLLQLRETLLMIGKTVDGNGNIDDPNIIQLKDYYDFSLN
                     PLLLKTGVPGHKQPSLLKRATNNNYNNGNGITNNTNNRLKWSYESTNTNINSAEVIGQ
                     MILLDRKLKRESSNGPETNEDNVNTNLNAYKTGINSISFDQENISNRSSSENLDNSSN
                     QDMTRTRSNSITAATKVREIFEHMNYYENLSLNNRQTFASLAAPFPVDLSNIAKSKQL
                     AKNNFIKSFASYSSFNLLVKIIKILVKKFPTITSIKTSEYFNLLQRIGKFEGEFLTEI
                     KVFLPTYHENVNEFVPLALDISNKNACLRKWFYILCWGAIFDTHSGLYNTSENTFEST
                     INAVSSSTSIDSLGIISGKDNANEYGSHLNGERKNPACLYKTNSNNSVLTSYFSNQSN
                     ELSSQMPLDISDMHSASPKTKSSVIKHKRSNSTSSNTILSKFSWSNFTKSDNDHDSIM
                     EEEYDEDESSTLNRNPESQFYFDIGLIKPNIWSSTRIRLFSVVKEEKKEFSFLDMTSS
                     ILKRFRLGNNNSVETVGSPNVANAGGYHTLNRTYSDSSINSGNQRSRTPRSPKVNISN
                     YSYFGSPKLL"
     gene            complement(<127432..>128067)
                     /gene="TPHA0B00560"
                     /locus_tag="TPHA_0B00560"
                     /db_xref="GeneID:11534906"
     mRNA            complement(<127432..>128067)
                     /gene="TPHA0B00560"
                     /locus_tag="TPHA_0B00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684114.1"
                     /db_xref="GeneID:11534906"
     CDS             complement(127432..128067)
                     /gene="TPHA0B00560"
                     /locus_tag="TPHA_0B00560"
                     /inference="similar to DNA sequence:INSDC:YLR435W"
                     /note="similar to Saccharomyces cerevisiae TSR2 (YLR435W);
                     ancestral locus Anc_4.314"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684162.1"
                     /db_xref="GeneID:11534906"
                     /db_xref="InterPro:IPR019398"
                     /db_xref="UniProtKB/TrEMBL:G8BQD1"
                     /translation="MSLQFDEAAFVEATNGKANLKFDDEKQQARFELGVSMMVYRWDA
                     LEIAVANKWGGPDSAEKRDWISGIIIDAFKTEKTIDVAYIEEMLLYAMTDEFDTNVED
                     DSALPIAAGIIELYKQADALDFSNIESLYLDYQNKQNNKSIDHGHHVHVTEDPLNPNV
                     SSSEEDDDSEGEDDDEDMMEEDQNEPQNNIPEPIIDDDGFELIQKKGKNRY"
     gene            <128576..>130249
                     /gene="TPHA0B00570"
                     /locus_tag="TPHA_0B00570"
                     /db_xref="GeneID:11534750"
     mRNA            <128576..>130249
                     /gene="TPHA0B00570"
                     /locus_tag="TPHA_0B00570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684115.1"
                     /db_xref="GeneID:11534750"
     CDS             128576..130249
                     /gene="TPHA0B00570"
                     /locus_tag="TPHA_0B00570"
                     /inference="similar to DNA sequence:INSDC:YLR433C,YML057W"
                     /note="similar to Saccharomyces cerevisiae CNA1 (YLR433C)
                     and CMP2 (YML057W); ancestral locus Anc_4.313"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684163.1"
                     /db_xref="GeneID:11534750"
                     /db_xref="GOA:G8BQD2"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8BQD2"
                     /translation="MSSQAELNTKQINNALKIIESKANDSDIKEIDPSLTMYTMEDGS
                     KVSTVERVVKSIPPIIGKTPTDEELFDKVTGLPNHELLREHFKREGRLTPEQASKIIM
                     MATKCLSQEPNLLSVPAPITVCGDIHGQYFDLLKLFEVGGDPKTTPYLFLGDYVDRGS
                     FSFECLIYLYSLKLNFSDHIWLLRGNHECKHLTSYFTFKNECLHKYDLKIYELCCSSF
                     NALPLAAIMNGQYFCVHGGISPELRSVQDVHKINRFREIPSRGLMCDLLWADPSEDYD
                     NAPEERDSESFIPNKVRGCSYAFTYKASCEFLQRTGLLSIIRAHEAQDAGYRMYKSTK
                     SLGFPSLLTLFSAPNYLDTYKNKAAILKYEANIMNIRQFNMSPHPYWLPDFMDVFTWS
                     LPFVGEKVTEMLVSILNICTEDELDESVPVIEEQVGKYSTSINEQEAVPANNDNSEKA
                     LSKNDVNDDAVRVRGNVPILNDERRRAALRNKILAIAKVSRMFSVLREESDKVQYLKT
                     MNSGVLPRGALAHGSEGLNETLSVFELARKQDLINEKLPPSLEELEKKK"
     gene            complement(<130664..>132595)
                     /gene="TPHA0B00580"
                     /locus_tag="TPHA_0B00580"
                     /db_xref="GeneID:11534870"
     mRNA            complement(join(<130664..131778,132139..>132595))
                     /gene="TPHA0B00580"
                     /locus_tag="TPHA_0B00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684116.1"
                     /db_xref="GeneID:11534870"
     CDS             complement(join(130664..131778,132139..132595))
                     /gene="TPHA0B00580"
                     /locus_tag="TPHA_0B00580"
                     /inference="similar to DNA sequence:INSDC:YML056C,YLR432W"
                     /note="similar to Saccharomyces cerevisiae IMD4 (YML056C)
                     and IMD3 (YLR432W); ancestral locus Anc_4.312"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684164.1"
                     /db_xref="GeneID:11534870"
                     /db_xref="GOA:G8BQD3"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001093"
                     /db_xref="InterPro:IPR005990"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR015875"
                     /db_xref="UniProtKB/TrEMBL:G8BQD3"
                     /translation="MAAFKDCAQALNDLASYSRRDGISVAELMDSVSRGGLTYNDFLV
                     LPGKIDFPSSAVTLEAKLTKKITLNAPLVSSPMDTVTESEMAISMALLGGIGIIHHNC
                     SPEDQAEMVRKVKNYENGFINSPIVVSPETTVAEAKQMREQFGFSAFPVTEGGAQKGV
                     VVGIITSRDIQFIEDDSIPVSKIMTTELVTAKQGISLTDGNEILKKTKKGKLLIVDEQ
                     GHLLSMLSRTDLMKNQNYPLASKSATTKQLLCGAAIGTIEADKERLKLLVAAGLDVVV
                     IDSSQGNSVFQINMIKWIKQTFPDLEVIAGNVVTREQAASLIASGADGLRIGMGSGSI
                     CITQEIMACGRPQGTAVYNVCEFANQYGVPCMADGGIQNIGHIVKALCLGASTAMMGG
                     MLAGTTESPGEYFYQDGKRLKSYRGMGSIDAMQKTDKKANASSSRYFSESDAVFVAQG
                     VAGAVVDKGSIKKFVPYIYNGLQHSCQDIGVRSLTELRTSVDAGLTRVEFRSASSQLE
                     GNVHDLHSYEKRLHN"
     gene            complement(<134906..>136672)
                     /gene="TPHA0B00590"
                     /locus_tag="TPHA_0B00590"
                     /db_xref="GeneID:11534822"
     mRNA            complement(<134906..>136672)
                     /gene="TPHA0B00590"
                     /locus_tag="TPHA_0B00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684117.1"
                     /db_xref="GeneID:11534822"
     CDS             complement(134906..136672)
                     /gene="TPHA0B00590"
                     /locus_tag="TPHA_0B00590"
                     /inference="similar to DNA sequence:INSDC:YLR429W"
                     /note="similar to Saccharomyces cerevisiae CRN1 (YLR429W);
                     ancestral locus Anc_4.309"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684165.1"
                     /db_xref="GeneID:11534822"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015048"
                     /db_xref="InterPro:IPR015049"
                     /db_xref="InterPro:IPR015505"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8BQD4"
                     /translation="MSGKFVRASKYRHVFGQAAKKELQYENVKVTSNAWDSNIIKTNG
                     KYISVNWNASGGGAFAVIPVGEVGKCPDQIPLFRGHTAQVLDTDFDPFDDKKLASSAD
                     DSKIAIWEIPEDYTLKSYVDEDGEPKVIKPVKILSGHKRKVGHILYHPVAQNVLASSS
                     LDYTVKIWDIENEKDMLTLTHPDMVTSMSFSYNGNFLATVARDKKLRVWDVREGKIVS
                     EGPAHTGAKNQRVVWLGNSDRLATTGFSRLSDRQLGVWDAFNLEKGDLGGFYNVDQSS
                     GILMPFYDDSNKILYVAGKGDGNIRYYEFQNDELFDLSEFQSTEPQRGFAVAPKRTAN
                     VKENEVLKCFKTVVDQNIVPISFYVPRKSDQFQDDIYPPAPSDKAALTADEWFSGKSV
                     EGPLLCNMEDIYEGSTEMHYSESKKSTSAPTSKQATPEPTPVVKKEPVKKEEVPVKEA
                     TPVSTSSTPKPVGNVNEMLKGDNSVDKLLAKSSELDSVNNAEDPSKGSDEWEEEEIKP
                     KSPVVKEEPKKETPKKEEPKKENASTSSTSKALGLKQSVEKLSALVVHLEDVVVKLTE
                     ANISKDERLKSLEEKIENLLKK"
     gene            complement(<137317..>139434)
                     /gene="TPHA0B00600"
                     /locus_tag="TPHA_0B00600"
                     /db_xref="GeneID:11535122"
     mRNA            complement(<137317..>139434)
                     /gene="TPHA0B00600"
                     /locus_tag="TPHA_0B00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684118.1"
                     /db_xref="GeneID:11535122"
     CDS             complement(137317..139434)
                     /gene="TPHA0B00600"
                     /locus_tag="TPHA_0B00600"
                     /inference="similar to DNA sequence:INSDC:YLR427W"
                     /note="similar to Saccharomyces cerevisiae MAG2 (YLR427W);
                     ancestral locus Anc_4.308"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684166.1"
                     /db_xref="GeneID:11535122"
                     /db_xref="GOA:G8BQD5"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:G8BQD5"
                     /translation="MTPDDDLNKVKDKQSNSGSNPKQTGKASQKSQKRPKSKHNPNEH
                     SLNNSTSRRGRYNKGRGSYERSSNRGQSTNTQIYSGADQADFEGSIQEEIFSGNYKLN
                     GRKTKISINHLLDFQLPEIERERNGFSGNHNTKINRQKHSHQEYILLQGDSFINVNYK
                     LLIDKNGTYSEQNIDPNKLVSSENIVRVVVPKGQSCPICLCDVPVAPRMVICGHYFCF
                     TCLLTFFSIKEVIKNPDTGYEKPKKYKECPLCNSIIRPSNVKDVLYEDDIFSNNIEIP
                     KPSDNIKIKLICRPHTSLLGLPVMMNIDPNIVGNFPPINFKEIFDYAKMIKCDDSAQL
                     QFLQNDLNAIQDQLEVDKALFNINDEFTKEAIEAINAKIMNILSKEGLELSDDNHLEF
                     KSLDISDVNISDKYNDSNAFYYYQYIVNSSSTKFFLSQLDIKILKAAFQEYSKFPVEL
                     DTKVENVHYGNVITKDFIAKNKYMHHLALGTEIAFIELDWRNSNIIPKEIFDKFSAEL
                     KQRRRRFNIKQKREDIQRKQYEYQLEKETAEFYKRENGELIEPYQVIEHRLNDKQAFN
                     HSNMFADSLNEFTYSEDEEDEKKESKNPGGKNKSYNETTIWGTSIEVQMDEKTLQENK
                     EFEEMLFNKIRGGEVTIESESTTPGNDVESNDIGADSGLVSSNRSTEEQSTDSLPKGK
                     KSKKQKPKSKSKVLLFSNSYQTL"
     gene            complement(<139975..>143637)
                     /gene="TPHA0B00610"
                     /locus_tag="TPHA_0B00610"
                     /db_xref="GeneID:11534974"
     mRNA            complement(<139975..>143637)
                     /gene="TPHA0B00610"
                     /locus_tag="TPHA_0B00610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684119.1"
                     /db_xref="GeneID:11534974"
     CDS             complement(139975..143637)
                     /gene="TPHA0B00610"
                     /locus_tag="TPHA_0B00610"
                     /inference="similar to DNA sequence:INSDC:YLR425W"
                     /note="similar to Saccharomyces cerevisiae TUS1 (YLR425W);
                     ancestral locus Anc_4.305"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684167.1"
                     /db_xref="GeneID:11534974"
                     /db_xref="GOA:G8BQD6"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G8BQD6"
                     /translation="MSTPYPISSSSPERKSKSNRPPPPPISNLHDNIISLNQQKNREP
                     LKSPDSYRSPFIFESSTSISPTNRNNSPTYPSPFIGENDPNIYKTSSDLTNNSNFRSG
                     SNLSSSQNNFRKISSQFGLLSGTISDNPTFFERPSMPKSIPVSSRNISWTSRISDSID
                     SVYTDSNYTFNNSNARHSSFNSLLGGKPLELAPSLTAPIQPFSMNFLDENKLYQCYSV
                     SKLSDIYEWILKVYFEWFNECFFNKIEFFQMIQLLLEFQMPKTFDQDIIDSNVDRIIE
                     SLVSQGAVRFEVDSDNFSSSAALNNTNLNSNNEIAIIVSGLDVSGIFTELLPCYSFLD
                     TTETDGNSNLCYSYTCLNRFSGDGRDKVELSEIINKSVGLWTEYWKLTPEELSEINPR
                     EIQRQSFIFDLIILEERSLNMANAAVEIYGKRFSPDLLPEDTDFSSLAFDIFEPLIRI
                     HKELLLDPIFWKLKTRGKFIDLIGKIYLKWCHEAKDMYINYAVSMATVHEIITWEKQH
                     NTAFARWLKDIDNLPDIRRSKMYYDVIFFGGFFKSLQNLPITLNSVWKNTDASMEDYH
                     DLQLAIKEIENLSSEVDRVHGIAIDRRKLVRFSKQLVYDKKNSFPVGYVNLSSTQEEK
                     EKTQDKLELGLSDNNRKLLMSGIVHKKRELWLDPTEIYLALLDNFLLITERVIKGDVE
                     NYKLVERPIPIEYLNLEKRKKQEEDRSSSYIPNTPISSVRPNLISAASTVSKSLIATP
                     TKETYHSTEISNVGGASEFSFKVRNLATNESYTFLTSTNDENERWIASFLVCFKQNDN
                     LLSTIVFSLNVITDQFLYAEKDAPVNLPMAPEGSELDNALRKYEEENVDNSSKILLPS
                     AIFCSVSISFEGNRYTLLAIEQGVFMKKEDKIGRNFVKLLDCKAVKCMEVNIKLGLLF
                     ILDNRRLCYYNIPSILGAYYAPKKYLPNNRIVGILIRDKVSCFKMAEDFGNSKHLLYE
                     RKGKIVILTPEFDKLTNSFKFYKIYKKYLLPISTSSLLTLEIHDIVVFKKSFIVCTSK
                     GNFVFNDSFNDTGISIPTFFNDKDIYPSIKSSHFTNTIKNTVEPSSKKEASKYKMVEY
                     VKKDIANKKTKTCTCFQISNTSQFIVVYDEAVILLNQFGEIADWKNDIMVLDFCCTNA
                     SLIKNYLLLVSDNLIQIYNINSNIKLSKLTPIQILKGKKIKMINSNKTENLIVSISHP
                     NIPNRQLLASLNLVDI"
     gene            complement(<145067..>146107)
                     /gene="TPHA0B00620"
                     /locus_tag="TPHA_0B00620"
                     /db_xref="GeneID:11535082"
     mRNA            complement(<145067..>146107)
                     /gene="TPHA0B00620"
                     /locus_tag="TPHA_0B00620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684120.1"
                     /db_xref="GeneID:11535082"
     CDS             complement(145067..146107)
                     /gene="TPHA0B00620"
                     /locus_tag="TPHA_0B00620"
                     /inference="similar to DNA sequence:INSDC:YKL193C"
                     /note="similar to Saccharomyces cerevisiae SDS22
                     (YKL193C); ancestral locus Anc_4.298"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684168.1"
                     /db_xref="GeneID:11535082"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:G8BQD7"
                     /translation="MSGQDTVDLTKNTSDLQIIDTSKGFTPEVVPDEKLEYIGADLDL
                     TADLEDDVASINLIQLKIRSMEELELPRFRKLEQLCLRQNLIENISEVDVLPYDAMVD
                     LDFYDNRIKHISSNLNKLTNLENLDLSFNLIKRIKNIDKLVKLKNLYLVQNKISKIEN
                     LSTLTELENLELGGNEIKEIEEDSFVGLSKLKEIWLGKNSIPRLINLHHLKSLKILSI
                     QGNKLKKIEGLEELENLEELYVANNFISKIEGLENNKKLTTLDITSNKITEISNLSHL
                     TELTDLWASFNKIDQSFESLGEELKNCKQLDTIYLEGNPIQLRNETSYRRKLVLNLGP
                     SLQKIDATYIQG"
     gene            complement(<146530..>147639)
                     /gene="TPHA0B00630"
                     /locus_tag="TPHA_0B00630"
                     /db_xref="GeneID:11535035"
     mRNA            complement(<146530..>147639)
                     /gene="TPHA0B00630"
                     /locus_tag="TPHA_0B00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684121.1"
                     /db_xref="GeneID:11535035"
     CDS             complement(146530..147639)
                     /gene="TPHA0B00630"
                     /locus_tag="TPHA_0B00630"
                     /inference="similar to DNA sequence:INSDC:YLR420W"
                     /note="similar to Saccharomyces cerevisiae URA4 (YLR420W);
                     ancestral locus Anc_4.294"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684169.1"
                     /db_xref="GeneID:11535035"
                     /db_xref="GOA:G8BQD8"
                     /db_xref="InterPro:IPR002195"
                     /db_xref="InterPro:IPR004721"
                     /db_xref="UniProtKB/TrEMBL:G8BQD8"
                     /translation="MAQIDLGIPCDMHVHVREGPMCELVTPTIKEGGVSVAYIMPNLQ
                     PPVTSIDRVSEYKTKLSKISPDTTFLMSFYLSDLLTPEVVEEAAKNKLIHGIKCYPAG
                     VTTNSTQGVDPNDFSKFYPIFEKMQEFGLILNLHGEKPSTESCFSEKDKEDITVLNAE
                     EYFLPALRKLHTDFPDLRIVLEHCTTQKAIDTIMDINKEIKDPRDIRVAATITTHHLF
                     LTIDDWAGNPINFCKPVAKLPSDKRALIDAATSGKPYFFFGSDSAPHPLSNKARISSV
                     CAGVYTQSLEIPYLAQVFNDHNSIDKLKDFVSKFGREFYNLGPHEIISKDHCILYQKS
                     QVVPNVITNADNSVEVCPFKAGESLNWSVKWEPVF"
     gene            148539..148621
                     /gene="TPHA0Btrna13L"
                     /locus_tag="TPHA_0Btrna13L"
                     /db_xref="GeneID:11534988"
     tRNA            148539..148621
                     /gene="TPHA0Btrna13L"
                     /locus_tag="TPHA_0Btrna13L"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUA"
                     /db_xref="GeneID:11534988"
     gene            <149234..>150499
                     /gene="TPHA0B00640"
                     /locus_tag="TPHA_0B00640"
                     /db_xref="GeneID:11534964"
     mRNA            <149234..>150499
                     /gene="TPHA0B00640"
                     /locus_tag="TPHA_0B00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684122.1"
                     /db_xref="GeneID:11534964"
     CDS             149234..150499
                     /gene="TPHA0B00640"
                     /locus_tag="TPHA_0B00640"
                     /inference="similar to DNA sequence:INSDC:YKL189W"
                     /note="similar to Saccharomyces cerevisiae HYM1 (YKL189W);
                     ancestral locus Anc_4.289"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684170.1"
                     /db_xref="GeneID:11534964"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013878"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR028637"
                     /db_xref="UniProtKB/TrEMBL:G8BQD9"
                     /translation="MFKKHKNQDLDMSFLWKKNPKPPNEYVKYSLELTSKLPGTTTLD
                     NKKKLQDDLLKYLTEIKEILISKDDLELTNALHLEINKMNFFIVLINNLHELNLDIMK
                     ELNTIFTVALNYSIDNKLVTVDYFVLHPKTVQLLLVKIESILQQKTKYSNSTNSRNDM
                     FSITGKMILECTKYEQLCRIILIKDTNFWKFFSFAKMNNFEISSLSFQILISLFTTNE
                     KLVSKEFFNIESNSNKFIINMNKLIAHGNYVTKRQSLKLLHDLIIVKSNNIMMSYINS
                     PENMKLIMTVMTDKSKLLQLDAFNIFKIFVANPRKTKPILDILIKNRDKLLLYLNNFA
                     DDSFDRMFKDEKEFIIQEIESLPRLFSSTTDSIASTTPPTHKNSMSNGSLNSTANIVH
                     TGASMNPHKIIGSPSSNSLSRTYQDSISH"
     gene            complement(<150707..>151228)
                     /gene="TPHA0B00650"
                     /locus_tag="TPHA_0B00650"
                     /db_xref="GeneID:11534994"
     mRNA            complement(<150707..>151228)
                     /gene="TPHA0B00650"
                     /locus_tag="TPHA_0B00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684123.1"
                     /db_xref="GeneID:11534994"
     CDS             complement(150707..151228)
                     /gene="TPHA0B00650"
                     /locus_tag="TPHA_0B00650"
                     /inference="similar to DNA sequence:INSDC:YKL186C"
                     /note="similar to Saccharomyces cerevisiae MTR2 (YKL186C);
                     ancestral locus Anc_4.284"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684171.1"
                     /db_xref="GeneID:11534994"
                     /db_xref="InterPro:IPR019488"
                     /db_xref="UniProtKB/TrEMBL:G8BQE0"
                     /translation="MSSNQSGIIQTFVKKILAHLDDADPQRLNSFLSLFNQTGNCKII
                     LNGNPIAQPTEFLTAWQQQVVQSQHNLTSLDYHIIPGSGTLICDVGCKIRFDESGRNK
                     LDQDAVVNPTNTGTTSNAGGIKGRPFWGPFHGVSIQLIMDDRIFKNDQNGVITAINYN
                     IIYKPDDSLINLE"
     gene            complement(<151897..>152607)
                     /gene="TPHA0B00660"
                     /locus_tag="TPHA_0B00660"
                     /db_xref="GeneID:11534832"
     mRNA            complement(<151897..>152607)
                     /gene="TPHA0B00660"
                     /locus_tag="TPHA_0B00660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684124.1"
                     /db_xref="GeneID:11534832"
     CDS             complement(151897..152607)
                     /gene="TPHA0B00660"
                     /locus_tag="TPHA_0B00660"
                     /inference="similar to DNA sequence:INSDC:YLR407W"
                     /note="similar to Saccharomyces cerevisiae YLR407W;
                     ancestral locus Anc_4.272"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684172.1"
                     /db_xref="GeneID:11534832"
                     /db_xref="InterPro:IPR025124"
                     /db_xref="UniProtKB/TrEMBL:G8BQE1"
                     /translation="MTKVKESSESGTNNILQKHNLKTSISQSLQKWRNTFKRITHEAL
                     VTLDEASSTTDDKIDALFHNGDSASSLNTSLSSNSRTAARNSANLNARVEMRLTDETE
                     SLDGSSSDNSLGDSTSADENEDGQRTVSYDTYDAPVRCKKLRQELGEPFWQADIIWRE
                     RRDLWVEPVQFNEYVKDANSKKTRKAFKKIPIDYYPRIYQKLAVDDKPLREPLNLEDA
                     VQVINSGWTETKKWSNMR"
     gene            <154803..>155812
                     /gene="TPHA0B00670"
                     /locus_tag="TPHA_0B00670"
                     /db_xref="GeneID:11532805"
     mRNA            join(<154803..154859,155528..>155812)
                     /gene="TPHA0B00670"
                     /locus_tag="TPHA_0B00670"
                     /product="60S ribosomal protein L31"
                     /transcript_id="XM_003684125.1"
                     /db_xref="GeneID:11532805"
     CDS             join(154803..154859,155528..155812)
                     /gene="TPHA0B00670"
                     /locus_tag="TPHA_0B00670"
                     /inference="similar to DNA sequence:INSDC:YDL075W,YLR406C"
                     /note="similar to Saccharomyces cerevisiae RPL31A
                     (YDL075W) and RPL31B (YLR406C); ancestral locus Anc_4.270"
                     /codon_start=1
                     /product="60S ribosomal protein L31"
                     /protein_id="XP_003684173.1"
                     /db_xref="GeneID:11532805"
                     /db_xref="GOA:G8BQE2"
                     /db_xref="InterPro:IPR000054"
                     /db_xref="InterPro:IPR020052"
                     /db_xref="InterPro:IPR023621"
                     /db_xref="UniProtKB/TrEMBL:G8BQE2"
                     /translation="MAGLKDVVSREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHM
                     GTEDVRLAPELNQEIWKRGIKGVPLRLRLRISRRRTEEEDAKNPLFSYVEPVFVASVK
                     GLHTTVVEEDA"
     gene            <156512..>158554
                     /gene="TPHA0B00680"
                     /locus_tag="TPHA_0B00680"
                     /db_xref="GeneID:11534950"
     mRNA            <156512..>158554
                     /gene="TPHA0B00680"
                     /locus_tag="TPHA_0B00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684126.1"
                     /db_xref="GeneID:11534950"
     CDS             156512..158554
                     /gene="TPHA0B00680"
                     /locus_tag="TPHA_0B00680"
                     /inference="similar to DNA sequence:INSDC:YDL073W"
                     /note="similar to Saccharomyces cerevisiae YDL073W;
                     ancestral locus Anc_4.267"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684174.1"
                     /db_xref="GeneID:11534950"
                     /db_xref="InterPro:IPR013887"
                     /db_xref="UniProtKB/TrEMBL:G8BQE3"
                     /translation="MVTTDDNDPLRNYSEKILEDTDHDIEIDELYQGLNKFILLIGDK
                     RYLKEAGSTKHIANFLRLNFLSYLRKETSYKLVRHKEDVRIILTQWWVTLLNFLNSDA
                     DECSMEVLIYSSDIDVLSVCLECISKILSKTLLTLSNAVDNLETFSHHILITLHYMTN
                     RLILSSRLLRDPSAHLSKRIAFLQKYNSLLRSFLGKLNAYAFFFLPDSLNFDIQLLME
                     LQPNISLEDHKTAFSWKKRKFFITDEGKTSMDPKSIETEDTQFFKIIISYLKQDMIFT
                     SFYWHYWYIIMTLTSSTDELQNTLKKSDEIPGLAILLKYVTWNFLSSDLHRLRSFNSS
                     KLKQNKDANSTASSIIEANESMPDSDMDLDVQSVQRSKNSKIRKVSDQEYNNFIICNF
                     RSFKLWECLRSLSYDFGLHISPILGLHDGSLLSFISTIPAYDSFASNIVYNKLFQFIL
                     FQFDSIFTDQFINWRFWCRGILMMLKTFSIKSEIIGLTSLFNIWKYIPNSYLRSLEEN
                     LIYNYWDLLIDKSSDNLTKILFVRLIVFKILQTDNNSLKMNLKKKLYAIDKEASSFAE
                     SNSDFVYESDSSILSFNGNRIFSITANKQLSEGDILLRKKKLAEVTKGKKSPIIFSSI
                     IDIATSRVSVVLKNGKYPYDVIDELSTRATLLDLTQNIQKINNTVIPIQKTSTRFK"
     gene            <158717..>159370
                     /gene="TPHA0B00690"
                     /locus_tag="TPHA_0B00690"
                     /db_xref="GeneID:11534728"
     mRNA            <158717..>159370
                     /gene="TPHA0B00690"
                     /locus_tag="TPHA_0B00690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684127.1"
                     /db_xref="GeneID:11534728"
     CDS             158717..159370
                     /gene="TPHA0B00690"
                     /locus_tag="TPHA_0B00690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684175.1"
                     /db_xref="GeneID:11534728"
                     /db_xref="UniProtKB/TrEMBL:G8BQE4"
                     /translation="MQYYIQKRYFTGLKPIVFKPGSIFSKVDEANREWNIVTARTYDK
                     PLPTPQRSEVDNLVKEMNAMGLGTQTNMELNFSTTNDTSSIRIPPYIEDKTIAFPQID
                     FSIFSESMASDGDSINETELLKESFFHIVANHNDQIIYSEIESSNVFPNDSQEKNEFK
                     ESIRKQNKKKYIFGKYQKMFDFIYIYNNTVMQYYEAQKLIDIDTLFLDFEVREYNSQ"
     gene            complement(<159525..>160361)
                     /gene="TPHA0B00700"
                     /locus_tag="TPHA_0B00700"
                     /db_xref="GeneID:11534791"
     mRNA            complement(<159525..>160361)
                     /gene="TPHA0B00700"
                     /locus_tag="TPHA_0B00700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684128.1"
                     /db_xref="GeneID:11534791"
     CDS             complement(159525..160361)
                     /gene="TPHA0B00700"
                     /locus_tag="TPHA_0B00700"
                     /inference="similar to DNA sequence:INSDC:YLR404W"
                     /note="similar to Saccharomyces cerevisiae YLR404W;
                     ancestral locus Anc_4.266"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684176.1"
                     /db_xref="GeneID:11534791"
                     /db_xref="UniProtKB/TrEMBL:G8BQE5"
                     /translation="MLINVSKPFQILQWITYISIIVGVQLLIVLPISVLIFHDFYTRL
                     IPPDSSQYVPVSTFEQYDELTYRHLITRVPIEKPLYSVEDNGLDQNLPLRDNILYKMD
                     IDMKFFCLNENDLSRNNLEVLDFQVRVRNNYQKTKATSVIYRRKIPITCLNEHDSIVE
                     DEIHKYGKNRLAMYQREWLNSIYVDDLIYIPSEIRQIQYHFVLPGQRLILQPESNIYM
                     RMEFKQGIRNMMLRWKKLTYLIGITVFYIFITTLFFISTGSSFYYMKSQNFITPVADI
                     KL"
     gene            complement(<160987..>162735)
                     /gene="TPHA0B00710"
                     /locus_tag="TPHA_0B00710"
                     /db_xref="GeneID:11534882"
     mRNA            complement(<160987..>162735)
                     /gene="TPHA0B00710"
                     /locus_tag="TPHA_0B00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684129.1"
                     /db_xref="GeneID:11534882"
     CDS             complement(160987..162735)
                     /gene="TPHA0B00710"
                     /locus_tag="TPHA_0B00710"
                     /inference="similar to DNA sequence:INSDC:YLR403W"
                     /note="similar to Saccharomyces cerevisiae SFP1 (YLR403W);
                     ancestral locus Anc_4.265"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684177.1"
                     /db_xref="GeneID:11534882"
                     /db_xref="GOA:G8BQE6"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BQE6"
                     /translation="MFSPSVTMQENFIESNDRKGSVRLDAASARADFSKESSQHGNSG
                     DVEKSSSNSGNLDLFQGGGANQINLNIPSNISKLRRDSVAHLQGVGGVSWGSLAIGSW
                     LKDEVAFHTTLKQSRDHDAALHYNSASRDNQLHIRRLSQIDGGATTGNNLNINVNGNA
                     TGYGSPVGLFNATSPPIAYSSYLPNLEKQYCKDYSCCGLSLPSLHDLLRHYEEAHISI
                     SPRTFGNNMNVSVNLRNSMASQKKNGLKTNDIGVTKQSLPSHNIIRQELSDPSINVSL
                     AQSPFSSHNTNQPIHYQPSEQHRNSNVPYLYLNGGSVGAVSTNDVFLTQKLKRTQESK
                     KIPNADNSNIADISSIGKIPNTKSSGNTSNMPYTENDFILNNYGAKESGKQQMFMSIS
                     GNQIAVSSEQLQISMGDIGQGNNDPSMLLHRQTNDDDTRYDDDADGDGDEDEDEDDED
                     DDEDDDEFSNNIAFAKTSHRDSTNQVGYIDDPARRLYVMDHEEDKPFKCPVIGCGKTY
                     KNQNGLKYHKLHGHQNQKLHENPDGTISVIDPHSNEPYLDGIGDEKDKPYRCEVCGKR
                     YKNLNGLKYHRGHSTH"
     gene            <163503..>165524
                     /gene="TPHA0B00720"
                     /locus_tag="TPHA_0B00720"
                     /db_xref="GeneID:11534979"
     mRNA            <163503..>165524
                     /gene="TPHA0B00720"
                     /locus_tag="TPHA_0B00720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684130.1"
                     /db_xref="GeneID:11534979"
     CDS             163503..165524
                     /gene="TPHA0B00720"
                     /locus_tag="TPHA_0B00720"
                     /inference="similar to DNA sequence:INSDC:YLR401C"
                     /note="similar to Saccharomyces cerevisiae DUS3 (YLR401C);
                     ancestral locus Anc_4.264"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684178.1"
                     /db_xref="GeneID:11534979"
                     /db_xref="GOA:G8BQE7"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:G8BQE7"
                     /translation="MSGVKHGLEAHGEPDLKRQANDTREKGVAYLKKEYILVDSGSSR
                     SIAEYNDEEEAGAEDRPGLEAQGDGRRKGKGKGRNKKDRGQNKNRDLRQVKEAKQLCP
                     KYIQGDPTAEGAAGPVCAFGDNCRFVHNIQEYLDSKKPEIVSEAFPTCPVFETLGYCP
                     MGFKCKFLSSHYDKDHMELFKRGTEDERKKLWDANHEVNIISGDQKFDLIKRKFPFTK
                     TAHILDIIDSIQQEARDRINQPSANKEGDKKDEESKPATDAPQIVEREKELNERREKQ
                     RELYLQYKDTRYFAQEKKTLDFRGKKIVSPLTTVGNLPYRRLMKKLGADITYSEMALA
                     TPLIQGTNSEWALPKAHVSEYPGFGVQIACSKAWQAAKAAEALSTNCSNISEINLNSG
                     CPIDLLYKQGSGSALLDNAARMIRCLNAMNYVSNDVPISVKIRTGTKDSHPIADTLVK
                     RLVFETDVAAITLHGRSRQQRYTRSADWDYISKVAKSLREAESEFAESPQGKESRDGK
                     TRIQFVGNGDIYNFEDWTNILQNDHNIDSIMVARGALIKPWIFEEIDSQQYIDKSSTE
                     RLEILKDYAKFAMDHWGTDEYGISQSRRFFCEFMSFFHRYIPMGICERFPVKLNERPP
                     SWKGRDDLETLLGGTNVQDWIKVSELFFGKVDDSFVFLPKHKSSSFPAA"
     gene            <165929..>168259
                     /gene="TPHA0B00730"
                     /locus_tag="TPHA_0B00730"
                     /db_xref="GeneID:11534903"
     mRNA            <165929..>168259
                     /gene="TPHA0B00730"
                     /locus_tag="TPHA_0B00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684131.1"
                     /db_xref="GeneID:11534903"
     CDS             165929..168259
                     /gene="TPHA0B00730"
                     /locus_tag="TPHA_0B00730"
                     /inference="similar to DNA sequence:INSDC:YLR397C"
                     /note="similar to Saccharomyces cerevisiae AFG2 (YLR397C);
                     ancestral locus Anc_4.259"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684179.1"
                     /db_xref="GeneID:11534903"
                     /db_xref="GOA:G8BQE8"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BQE8"
                     /translation="MAPKTSSSSGKKKAATPSGQTVKAPKFKLPSEFITRPYPGVVKD
                     ENIATALIHPSVLKELEISSGSICVICKQGMNGVAAIAKNGDEKNQPANVIMLSKQLR
                     SVSNIILGDRLELMKIDKQPPYTVSVTVGTRQHIEITEADTRKKVAKLLQNCGLIMPG
                     MVFENFKVSEEEAIDIVITETIDDSVPDVRSITLEDQHLIESTQFVCPPSIFRKDSSR
                     LLFSNSANASSKYNLPMAVSYNSVGALSKEIEVLRNAVELPLNQSQLFADFGITPPRG
                     ILLHGPPGTGKTMLLRCVASSSDAHVLTIDGPSIVSKYLGDTENTLRDIFREAQKYQP
                     SIIFIDEIDSIAPNRTNDDSGEAESRVVATLLTLMDGMNGSGKVVVVAATNRPNSVDP
                     ALRRPGRFDQEVEIGIPDVEGRLDILSKQFSKMSPKRHNLSDEDIKVIAAKTHGYVGA
                     DLTALCRESVMKTIQRGLKTASDMSSDSLKITVNDVEDAMLEIRPSAMREIFLEMPKV
                     YWSDIGGQEELKRKMKEMIQLPLEAADTFDRLGVSAPKGVLLYGPPGCSKTLTAKALA
                     TESGINFLAVKGPEIFNKYVGESERAIREIFRKARSASPSIIFFDEIDALSPDRDGGS
                     SSSAASHVLTSLLNEIDGVEDLKGVVIVAATNRPDEIDPALLRPGRLDRHIYVAPPTY
                     DARLQILKNNTKNFQVEKANIDLEELARRTDGCSGAEVVLLCQEAGLAAIMENIDTDF
                     VTPEHFEKALQGIARGITPEMLEYYQEFASRSGASI"
     gene            <168690..>170732
                     /gene="TPHA0B00740"
                     /locus_tag="TPHA_0B00740"
                     /db_xref="GeneID:11534847"
     mRNA            <168690..>170732
                     /gene="TPHA0B00740"
                     /locus_tag="TPHA_0B00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684132.1"
                     /db_xref="GeneID:11534847"
     CDS             168690..170732
                     /gene="TPHA0B00740"
                     /locus_tag="TPHA_0B00740"
                     /inference="similar to DNA sequence:INSDC:YLR396C"
                     /note="similar to Saccharomyces cerevisiae VPS33
                     (YLR396C); ancestral locus Anc_4.258"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684180.1"
                     /db_xref="GeneID:11534847"
                     /db_xref="GOA:G8BQE9"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027121"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:G8BQE9"
                     /translation="MNLSSNIRSFSKVVKRRLYNTLSGFNSQGQLLVVQDNVLPYLNS
                     LLTFSELTENTRVQKIVTIKNNVGNDITDVLSAVPGLDLLFLIDIRLELKLNSDLHAY
                     LKLNNLPIVNVIFVSWETQNSNNLLSIEINEEVKIHHFIEQQLLETTPASQINLKPWE
                     ILPIPHIDDNLLICDVLFNDKNESLYTPKISSMNKATKNILKDNMINALQSILKQTNT
                     NITHSVAFGDLSKSMVYILKQRIESQRDTTDEFIVETLYSGNNSLIETDLLIFERSID
                     PLTPLLTQLTYSGIIDDIYSLGSDGKIKGKDIKFDYIKDSNWQNLKFSNFGTLGPMLN
                     KLAKDLQAQYDSRHQAETVGEIKKFVDSLGSLQEQQKYLKEHTNLCSEVLDDVENNET
                     LNFKKLLDLEQDILLNNIDHSNSCEVILEIIYENSVNRKHIIRLLCIISLCHGGIKDS
                     YYSTIKSELIDTYGIEICFLLEKLAETGLFVSKSQLTNAKKYPQLFNNNSDVKALWNK
                     EYKLISTIFDTFPDDGNDALVDISEQILQSNEPTFAYCGVVPLFYRLIQMLHDRTTLS
                     KSYSSHQPFMVSEIPNLAKTDELLEQVYGNSNIAESIIWNPVTKEITKPLKKNNNKKG
                     HYNISILVFIGGISYSEVAVIKLLQEKIKAKGISKRFIIITDGIINGERYINCLDV"
     gene            complement(<170775..>171875)
                     /gene="TPHA0B00750"
                     /locus_tag="TPHA_0B00750"
                     /db_xref="GeneID:11534933"
     mRNA            complement(<170775..>171875)
                     /gene="TPHA0B00750"
                     /locus_tag="TPHA_0B00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684133.1"
                     /db_xref="GeneID:11534933"
     CDS             complement(170775..171875)
                     /gene="TPHA0B00750"
                     /locus_tag="TPHA_0B00750"
                     /inference="similar to DNA sequence:INSDC:YLR394W"
                     /note="similar to Saccharomyces cerevisiae CST9 (YLR394W);
                     ancestral locus Anc_4.255"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684181.1"
                     /db_xref="GeneID:11534933"
                     /db_xref="GOA:G8BQF0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="UniProtKB/TrEMBL:G8BQF0"
                     /translation="MFDQWFVYCGVCYRRSSAEDPLLLTSCAHILCSQHWNSSFNSCS
                     ICQAVDISVIELAEGRRMPPDIMAFFQPFNQLLETVYNVSQFQTIGLVNQCKHFQEYV
                     IKLQATCSKQRQILYQTKAEIDSIPKLRQKIKFLESELENERMLKSNRGTKRNITNNG
                     TNNNNKMNFLTSSSKDSFRHHSLKRSESHGFLRGSNNMSRNPPPTVDLTIDDDNNADE
                     IFLKKLKKNANSLNTSSFPKTPDIVAESTQISESFTKDSMNGSSDPMGSLLQRRSSKE
                     AESSITNTTDTKQKVKLPAALEKLRIIKRSNTTTVIPSRTPTDDIKKGIINHMKSSGH
                     FNRRELSRGRSSFSSQRRNASSQQVLSKFSRK"
     gene            complement(<172254..>173285)
                     /gene="TPHA0B00760"
                     /locus_tag="TPHA_0B00760"
                     /db_xref="GeneID:11534946"
     mRNA            complement(<172254..>173285)
                     /gene="TPHA0B00760"
                     /locus_tag="TPHA_0B00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684134.1"
                     /db_xref="GeneID:11534946"
     CDS             complement(172254..173285)
                     /gene="TPHA0B00760"
                     /locus_tag="TPHA_0B00760"
                     /inference="similar to DNA sequence:INSDC:YDL065C"
                     /note="similar to Saccharomyces cerevisiae PEX19
                     (YDL065C); ancestral locus Anc_4.250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684182.1"
                     /db_xref="GeneID:11534946"
                     /db_xref="GOA:G8BQF1"
                     /db_xref="InterPro:IPR006708"
                     /db_xref="UniProtKB/TrEMBL:G8BQF1"
                     /translation="MTDQDYDDFDDLDDLLDEDPSKLYLSEESDIKKNSEALDDPVKT
                     DATGDSSTDTGKASDTSQELKTMVEQLQSEFNGLMVKDPNNLNEEIVDSFKELMGMLN
                     NTTARSGTLDKDGSNSSGTDSKQSVMNNGDFKNIVQSTLHKIRENGNNVDDEIKEEKK
                     KATEAGMNNPNIIQDTLLNKMFSELTASGMDENIDDTILKLLTEMSNKDIIYQPMKDL
                     YEEYEEFFEEYGKFEVGTEKDDIKIIPAEQMARYRNQMEVVKNLIALLELDDFNDTTH
                     KSQVSDFLDELERLGESPMSSKFMKDLKGDTTKSSNDTSLPDLDKLDLENIDLKDIEK
                     EMQESCPQQ"
     gene            <173656..>174129
                     /gene="TPHA0B00770"
                     /locus_tag="TPHA_0B00770"
                     /db_xref="GeneID:11534836"
     mRNA            <173656..>174129
                     /gene="TPHA0B00770"
                     /locus_tag="TPHA_0B00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684135.1"
                     /db_xref="GeneID:11534836"
     CDS             173656..174129
                     /gene="TPHA0B00770"
                     /locus_tag="TPHA_0B00770"
                     /inference="similar to DNA sequence:INSDC:YDL064W"
                     /note="similar to Saccharomyces cerevisiae UBC9 (YDL064W);
                     ancestral locus Anc_4.249"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684183.1"
                     /db_xref="GeneID:11534836"
                     /db_xref="GOA:G8BQF2"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="InterPro:IPR027230"
                     /db_xref="UniProtKB/TrEMBL:G8BQF2"
                     /translation="MSSLCLQRLQEERKKWRKDHPFSFFAKPLKKADGTMDLQHWEAG
                     IPGKAGTLWADAVYPISIEYPDEYPSKPPKVKFPAGFYHPNIYPSGTVCLSILNEDQD
                     WRPAITLKQIVLGVQDLLDSPNPNSPAQEPAWRAFSKNKEEYQKKVASQAKAYAK"
     gene            complement(<174406..>176292)
                     /gene="TPHA0B00780"
                     /locus_tag="TPHA_0B00780"
                     /db_xref="GeneID:11534833"
     mRNA            complement(<174406..>176292)
                     /gene="TPHA0B00780"
                     /locus_tag="TPHA_0B00780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684136.1"
                     /db_xref="GeneID:11534833"
     CDS             complement(174406..176292)
                     /gene="TPHA0B00780"
                     /locus_tag="TPHA_0B00780"
                     /inference="similar to DNA sequence:INSDC:YDL063C"
                     /note="similar to Saccharomyces cerevisiae YDL063C;
                     ancestral locus Anc_4.248"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684184.1"
                     /db_xref="GeneID:11534833"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BQF3"
                     /translation="MGKSKKRSRTTANRLNPLRNGKSKNGNSKSDLNKDNATVTKKIQ
                     PLLKQLQSAVPNDRSMALSSVTLFAEDPYMRKLLLKEKLVQIILSRLLTDSNTDIIVE
                     SFGLLRNLVLEEGYDIATHLWRSNIWISITDGFTKAQSSLNSINSDTSKTSKESKRML
                     FDYIDNLLSLIVALANGSDSILGEILNEDKLNQLFQILIDLLNFGYDKIPANLFNTIL
                     DLIYDFSSESFEFIETISNNNVLGEFIKGLPELMKTSKDKNTFNELSVVLTQGIYLQF
                     LDTDINTNQITEIVQNVLEAINDVDLKNIKENLAVLDNDEELAKADDAAVAEKIRDYS
                     KKRNEAMMRLQSIEIAIDLITAVIEITATLYEDKSSNLQISDDFMKVFTDILPHVFQT
                     LSEAFTSRILIAWNNLLWLFITLGVSIFELSNNQFDQLWHFIIDLEEKQKEDLGVKLG
                     RLSVIWAILKTVTVNDKETISQILEKLSIFNNMSFINTIIEDYKSAPKEISDIEECIE
                     LKQRYCGILGTMASIQGQISINEIIGKFLLSELASKETPTVLLVEITNLLFEIYPDSN
                     FDYDGPVFIQQGFLNILRDQVVPNLKAQFKFVDKNKDELLKEKCTETFNNLNSFINYK
                     ANEK"
     gene            complement(<177381..>177551)
                     /gene="TPHA0B00790"
                     /locus_tag="TPHA_0B00790"
                     /db_xref="GeneID:11535161"
     mRNA            complement(<177381..>177551)
                     /gene="TPHA0B00790"
                     /locus_tag="TPHA_0B00790"
                     /product="40S ribosomal protein S29"
                     /transcript_id="XM_003684137.1"
                     /db_xref="GeneID:11535161"
     CDS             complement(177381..177551)
                     /gene="TPHA0B00790"
                     /locus_tag="TPHA_0B00790"
                     /inference="similar to DNA sequence:INSDC:YDL061C,YLR388W"
                     /note="similar to Saccharomyces cerevisiae RPS29B
                     (YDL061C) and RPS29A (YLR388W); ancestral locus Anc_4.245"
                     /codon_start=1
                     /product="40S ribosomal protein S29"
                     /protein_id="XP_003684185.1"
                     /db_xref="GeneID:11535161"
                     /db_xref="GOA:G8BQF4"
                     /db_xref="InterPro:IPR001209"
                     /db_xref="InterPro:IPR018271"
                     /db_xref="UniProtKB/TrEMBL:G8BQF4"
                     /translation="MAHENVWFSHPRRFGKGSRQCRVCSSHTGLIRKYGLNICRQCFR
                     ERANDIGFNKYR"
     gene            <178915..>181323
                     /gene="TPHA0B00800"
                     /locus_tag="TPHA_0B00800"
                     /db_xref="GeneID:11534732"
     mRNA            <178915..>181323
                     /gene="TPHA0B00800"
                     /locus_tag="TPHA_0B00800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684138.1"
                     /db_xref="GeneID:11534732"
     CDS             178915..181323
                     /gene="TPHA0B00800"
                     /locus_tag="TPHA_0B00800"
                     /inference="similar to DNA sequence:INSDC:YDL060W"
                     /note="similar to Saccharomyces cerevisiae TSR1 (YDL060W);
                     ancestral locus Anc_4.244"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684186.1"
                     /db_xref="GeneID:11534732"
                     /db_xref="GOA:G8BQF5"
                     /db_xref="InterPro:IPR007034"
                     /db_xref="InterPro:IPR012948"
                     /db_xref="UniProtKB/TrEMBL:G8BQF5"
                     /translation="MAGHSHRTSVKNGHKTFKSKHASKGALKRLYKGKVEKTIANGKM
                     IKTITKFQRKNTAKQLRSKKISSTLEIRKLFEGKNGAEKIITVILLTEDISANDIISK
                     LVKSDDIEIPEKDDSPLVNDVFITKYKTNLKFIVPDMSNFLNILDSAKVADFVVFGLS
                     GTSEVDQEFGEQVIRALELQGISSYIGVVTNLSKVHKKEKFQLDVKQSLESYFKHFFP
                     NEDHIFNLEKSSEALNALRFLCQRYPRPVSWRDNRGYLVAQKVDFVENNNDPNSENGN
                     LVIEGTVRGVGFNADRLVHIPGLGDFQVNGIERILNSTRGPKPSTTTLDEVELLDAEL
                     SNKFEANQATRETLEEYALEDLDIEEWSDYDDDFEYENLTSARYDDHGFLPGRETAAK
                     KVKLPKGTSEYQAKWYLDDVIDIDEDDEIEDHIGEEDLVEKLQTEYDEDMNMDTDDLA
                     SNHVAFSTTDAQTEAGDDDFIDLSPEEEERQWREFKAQESDDRDFPDEIELNPTESGI
                     ERMKRYRGLKNLHSCVWNYNEKDPYAPAEWKRILKIGDYKNIRNRLLKEAKKSAQVIA
                     GDRIKIYIQFPKCLLEKITDPTQILVSVYSLLPHEHKNAMVNFSVERWEAYDEPVPSH
                     EPLIVQYGVRRYTIQPLFSSASNSSNNVHKYERFLHHDTISIATCIAPVDFTQSPAIF
                     FKSNPNDPKGLELVGQGSFLNADHTRILAKRAVLTGHPFRFHKNVVTVRYMFFNADDV
                     EWFKSIPLFTKSGRSGFIKESLGTHGYFKASFDAKLSAQDIVGMALFKRMWPNTSLPW
                     YGEE"
     gene            <181791..>185786
                     /gene="TPHA0B00810"
                     /locus_tag="TPHA_0B00810"
                     /db_xref="GeneID:11534720"
     mRNA            <181791..>185786
                     /gene="TPHA0B00810"
                     /locus_tag="TPHA_0B00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684139.1"
                     /db_xref="GeneID:11534720"
     CDS             181791..185786
                     /gene="TPHA0B00810"
                     /locus_tag="TPHA_0B00810"
                     /inference="similar to DNA sequence:INSDC:YLR384C"
                     /note="similar to Saccharomyces cerevisiae IKI3 (YLR384C);
                     ancestral locus Anc_4.240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684187.1"
                     /db_xref="GeneID:11534720"
                     /db_xref="InterPro:IPR006849"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BQF6"
                     /translation="MRNLVTLNHGKFKPTSMDVEEFDVAMEVVDSVFDTLTDSITCVL
                     VNSEIGKYEVQQFMKDGSKNVLVSSNFETYNDTLLSFVHFADINQLVFIFKGGDIISC
                     TYDSTTFDPLLTVVEIVGSIDNGIEAAEWSSDEETLVLVTADSNVVVLSKLFEPISEV
                     PLQVEDLKMSKHVNVGWGKKETQFRGAGAREMERQALESLKASGLVGNELRDPTMPYM
                     VDSGIATNHDNGSVSISWRGDCEYFAVSRLQTVTDPDDETLTINRRVLRVYNRECVLD
                     SVSEPVDGMEHNLSWKPQGSLIASIQRKTHLPGEESLDLIFFERNGLRHGEFDTRLPL
                     DEDIIDICWNNNSEVLTIVMKNKIQLWTSKNYHWFLKQELYTNGVTYAKWHPEKDLTL
                     MFGSEDFVNIVDFSYKMIQGSTFAPFDYGTTVVIDGTTVHITPLSIATVPPPIYFRDF
                     ETPDNVIDVAVNISSEVYAALNKDALVLASVNSIEEMRDGKHPDIRCILPKTEFANES
                     DTLRQVAFINDSIVAVLFDSGNLSQISIIDIQDINNPYVLNTIEIFNKVLLLRSSFEY
                     NSLVYQLRDGSIHKLDAEGQIEQIAQFPRIVCDFRVKRVHNSQQSSVNEWNSSSSELV
                     AIGLTSNGKLYANDVQLSSSVTSMEITDTMLLFTSAHHHLQFIHLNSTEFKPVPIVEG
                     LVVDERIRSIERGSIIVNVMPSKSSVVLQANRGNLETIYPRIMVLSEVRKDILAKKYK
                     EAFVICRTHRINLDILHDYAPELFFDNIELFINEIKKVSYLDLFISCLLEEDVTETKY
                     KETLNSDIDEAFKLAPAPLTEIQQYVNKKHFDPSKSKVNKICDALLNVFLNKPEYKKN
                     NLQSILTAYASYKPQKLEEALTLISSLESPSEQDESITYLCFLQDVNLVYKVALSLYD
                     VKLSLAVAQKSQMDPREYLPFLQTLHEADTIQCKFLIDDHLKNYEMALSHLIEGEKSE
                     SSVSETIISYVEDHNLYKHALALFRYDTSKQNYIYEIFAKFLSSQQDYTEAGIIFEML
                     ERYEESLNAFISGKRWKEALSIVLSYFPERLNDIADDLISSLKFEHKYLDVAEIQLHF
                     LNNVKDAMENYCKAYGYDIAMLLAIKNDRKDLIESVVDINLSEGFAVVAELLADCKGQ
                     VNSQLKRLRELRAKKEEDPYAFYGQETEQADDVSIAPSETSTKESFFTRYTGKTGGTA
                     KTGASRRSSKNRRREERKRARGKKGTIYEEEYLVKSIGRLIERIDQTKPDAIKLIDAL
                     CRRNMREQAYQIQKNFSEVLALLKEHLVEIYTISEKDRERFDDNGVIYYLPEIPIPNI
                     AEFPVNKVIDY"
     gene            complement(<185937..>186539)
                     /gene="TPHA0B00820"
                     /locus_tag="TPHA_0B00820"
                     /db_xref="GeneID:11535144"
     mRNA            complement(<185937..>186539)
                     /gene="TPHA0B00820"
                     /locus_tag="TPHA_0B00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684140.1"
                     /db_xref="GeneID:11535144"
     CDS             complement(185937..186539)
                     /gene="TPHA0B00820"
                     /locus_tag="TPHA_0B00820"
                     /inference="similar to DNA sequence:INSDC:YDL059C"
                     /note="similar to Saccharomyces cerevisiae RAD59
                     (YDL059C); ancestral locus Anc_4.239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684188.1"
                     /db_xref="GeneID:11535144"
                     /db_xref="GOA:G8BQF7"
                     /db_xref="InterPro:IPR007232"
                     /db_xref="UniProtKB/TrEMBL:G8BQF7"
                     /translation="MSVNSSNRICYDNTVFSAGSGINIKELNVLEDWDGRPNSKWSVN
                     CINKFRTKIEKYSYRYHNNGVLNKFDLAQLLPSHLIIQYANDCFGYDGWHMDVLHVET
                     GECLTIPNYDPDSRYKEKFTVQSEAKVKITLKDGTNSAHFCKRASTMHSRGEVYNKSK
                     KEVVTYAMKEAFLNFQNIMEDYELKVETNYFKDGLFGSKT"
     gene            <187071..>194681
                     /gene="TPHA0B00830"
                     /locus_tag="TPHA_0B00830"
                     /db_xref="GeneID:11535139"
     mRNA            <187071..>194681
                     /gene="TPHA0B00830"
                     /locus_tag="TPHA_0B00830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684141.1"
                     /db_xref="GeneID:11535139"
     CDS             187071..194681
                     /gene="TPHA0B00830"
                     /locus_tag="TPHA_0B00830"
                     /inference="similar to DNA sequence:INSDC:YDL058W"
                     /note="similar to Saccharomyces cerevisiae USO1 (YDL058W);
                     ancestral locus Anc_4.238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684189.1"
                     /db_xref="GeneID:11535139"
                     /db_xref="GOA:G8BQF8"
                     /db_xref="InterPro:IPR006953"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024095"
                     /db_xref="UniProtKB/TrEMBL:G8BQF8"
                     /translation="MDIIQGIIQPPRVQSAEETIPTLCDRLSNSTLINDRRSAILGIK
                     SFSRQYRETVIASGLKPLIKTLQRDLVDEDIVKAVLETLLILFIRGDGDEDLTREWIS
                     QQSRIQNGKYPSPLVMKSENQQADQFSLWIADALTQSDELIHLIIELMDTSNFHIRLY
                     TIQLLEAIIVTRPARARSAITSLPTSISTIASLLDDSNELVRDEAILLLMTVVNDSPH
                     VQKLVAFENIFEKLFIIINEEGGLRGSLVVNDCLSLIINILKYNTSNQTLFLETGHLA
                     KLAYILNEPITGEEEFFWNEQRIVNIISALDIVSLTIEPGISTTRKHQDSLLDGKVLM
                     ITLRLIFYHNTPKEVRSIALLTTADMIRNNEIAQNEFRKVDVPYIDPSLLNGSKAKDV
                     IYLPVISLLVNWALYANSVHTFAIRGAAIDLLKAYFHGNSELQELFLQDQLEEYKNEN
                     KKRQNEQLADFRSNIFEAILDYDPDLRLNPYKLYFASEIVMYFIQEENPSNASHREAI
                     IKVTSGTQLEDDTDTMNPIQTLSELLLASLNESDIRIPIFYTSFLIVWLYADFNAVDD
                     LLSNKPNLQSILSFSYQLQGDDITIKCLVTMLLGVSYEFSTKNSPYPRADYYAFITKT
                     MGIDNYTSRIKQFKEDSLFAKAQTGIDFINPDIDETGLPEVYFNSYFIELVQKNYYRI
                     KAALSHDPNEEPVSTLSFEIFEKLQSDCTNLKNSLSALENDSSSKIDTLEEKLTELQN
                     DFNILSEKHSILSGDNISLNSNYENIKNELNSISEQLSMASKENENLKATNASQEVDV
                     KSLNKELNEKEKSIYELEKQLNLTKTEKDKAQEGINKMNNELRKLMTSIDTLNEDKSR
                     LQNEIKLQKIELDDKETKINSEMEKTSKEYDNLKKLLALKEEEIEELKSKLLISARDL
                     KEYKGKFQSHDSLVPKLTEKLKTLATSFKELEIERDALLQSLKTNEENTSSELSLLTS
                     KLDIIKSENATLEKNKKTLLENISNLESKIEDMITAHTNEKKALEESKEELEEFVISL
                     NEQLEDLETSKLESSNKASELEAKIKSFNNEVNSYKNQLDTANNLISKLQISLDEANS
                     KIEQLEEDKVSDLKNLTKKDQKLEARDNELSNAKLQNDELLRERQSLKDELLSTKEKF
                     NSVNDDLEELNSKYVTIEEEKRTLENSINENQFTIKELKDNISGLTNDYNALESSKLD
                     LEEELSSQTTELDQKDTSLAELSKKLEEISSEKLKLNSLLQNTETNLKDLEKVNEDKE
                     IRIQSLEKELKVVKSNSKETDNKLQELSDKHDQMSREYEILKADKESLLNSKEKLYKQ
                     YNDNVEKINNYEESLKQLKKEKTTLQANLKTTEAELNDLQEKYSANVNSYNDIISEKD
                     KLTEEIKLSDDKIKELELVLEEKDKVITNQNAEIKNIKLDFEEKGNDYKRTIVDLKAK
                     LSDLTKESAESKLLMEKTIKDLEKNMETLKSESVISSNLSTERITSLELEIAKLTEEK
                     KINQTNFNDKISELKSDIINLEKEKDDSKEKNKTESAELKSEIEELQNKNFKMIEEHT
                     ITLDALKTDVERLEKAKEDFQVQNNSLTSDLETKNELLHKLKEKSANTISSLKEDLET
                     QNLQLKEKTKCAEESAIELSNISKDLNELSAKYESLNSKLSLKQDALSEITNENAELN
                     SQLEKHKEEIADLNSSLNDINSRLDLKIKNFDSIESKNSDLEKELLKVNEELAHLKES
                     SSKTILSLNDKITSLSEEFEKERTQLTEGSDSITKEYSEKINRLEESLRKVELDKDKE
                     TLEYKNKLTSIIDQLSETEKDLTAAEEDKKILTETLNDQKTSLDKSHEELELLNKQLS
                     DALSDAQSKVNCISELQSNNEALIKEVESLHLQITDLDSKLNEANVNSNSKENEISDL
                     LIKAKDNSDQLSEMHSRIKTLTNEFELNEKLLNEKSEELSAIKAVTEGKENEIKKLTQ
                     ELALSEEEIAVIKSKLKNSDETAASTERKLLETKEILSQMPTDLTTANKDKSDLSIQL
                     TETKKQLDVLNLQINENGDLLSSKIESLKEKEDQLEKLQIESDNSKEEIEKLKHQLSK
                     LSENHDSILLDKNDLEAKVHDYENAIAERENEVKRYQLLLNEKERTSNDFKDKITVAE
                     EEIHSLKSELDRLKIAFDEQKKSLDLASEEKYNTNSILEDKLRISRDNFEKQLSEKDD
                     KISELIIANTDATEKYSSLQTEIQSLKHLIDEIKEERDLYESNNKNKNDTIKDLTASI
                     ANIKSDCKMKIYEKDEEIELLKANTKYEERRLDEELTSLKQKYDDLKSKSTEEAILLK
                     DKLQHKALNIETLNTEITRLETNISELNLDTSKFKSLNEDILLKQSDNDSLSKKIDEI
                     VKEKTDLKSANEELVIKSRTLEEEMKELSNSKNALQAELKTLSKLKEEKEIQTSLNEK
                     SKEENIQLSKSNDELQSKIAELNKDSMEQKRLLDKSRQDLSELDILKEQIKILQKENT
                     ELKDNQNDSSEVDDLMLLVTDLDEKNTFYKKKLEELGVNFSSDEEEDEDDEDSDRA"
     gene            complement(<194812..>198171)
                     /gene="TPHA0B00840"
                     /locus_tag="TPHA_0B00840"
                     /db_xref="GeneID:11534776"
     mRNA            complement(<194812..>198171)
                     /gene="TPHA0B00840"
                     /locus_tag="TPHA_0B00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684142.1"
                     /db_xref="GeneID:11534776"
     CDS             complement(194812..198171)
                     /gene="TPHA0B00840"
                     /locus_tag="TPHA_0B00840"
                     /inference="similar to DNA sequence:INSDC:YLR383W"
                     /note="similar to Saccharomyces cerevisiae SMC6 (YLR383W);
                     ancestral locus Anc_4.237"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684190.1"
                     /db_xref="GeneID:11534776"
                     /db_xref="GOA:G8BQF9"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR027132"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BQF9"
                     /translation="MDGATEVRKRPREADHEIAHEAELLVAQQSNALNGTGEDIDAST
                     HPTKKRRRHEFAAMTQYSSSIGTQYEGINTEYIEESPSGYIKKIKLRNFMCHENFEME
                     FGPRLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGNSLKDLIREGCNSTKITIVLE
                     NSKYGSYNQGEFGSEIIIERTIKKDGVSHFSLRAESGKEISFKRKDMQTIIDYFSVPV
                     SNPMCFLSQDAARSFLAASSPVEKYGHFMKGTLLQDINDNLDRAREITKTVQEKMTTH
                     LDSLNGLKEEYEDAKSLLNELGQTSNFTERKKLLQGKSLWIDIKFNKKNCDKLKGESL
                     AYKKKMKAIEDKRKVKTDKMERYDNDKLAMEKEIENQTKLVSEKDSIHQQAKDSLRKV
                     RLKYDEEKRNQSEAEKNIEQCKEKIKVLDKNILHLEQQLQKEMGGDKDQMGVDLKKYE
                     SENEKLVATVDILTVQLQDLQNEESNIIQEAKTEINSLENSIREKQNELKGISAGNNN
                     FLHNFDHRLPQLLHLIERRSNEFSRKPFGPLGSYVTVKSEYEKDWTRAIQRYLSSSLN
                     AFIVSTLEDNELLRRMFKEVGIRNDIRIFTYPKLEALDYSYGKAKSKFPVLVDAIEFS
                     NLGVQSLFIDQHKIEKVILIPNHNEAKSYLDRKPINVNLALSLRNETSGYQLVGGFRL
                     DTVDYQNKLQIKVGSSSKNEETYLKEFIKQETNELNAKKQRYQERMSEVRNKLRSVVD
                     ESSEARLQLKQNSKHITDLKVNMNKVVDTGALISKQTDKDNQKKAIIAYENSIQQIRN
                     NLDQITEEAQPLKVNFDETLNDLTASQKSLKEAKEEVINRESLMEKYQYDLKIYSEKI
                     KSYTDIIKKIDENVQSLEEGIEKQVITASEFCTPERVNDPDLPSTQEEIKEELEKITR
                     MIKKAENKAGFTQQQAIELFEKSRDKYRESQEKYLAIDKTLEVLYKSIQIRVQNLQTA
                     QKATCLDADLDFRASLRVRNLSGNLSFNTKSKRLEIYILTSNGGKPRTIDNLSGGEKS
                     FAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQTRTQTIIITPQ
                     DIGKISDIDSAGVNIHKMKDPERQNNSNFYG"
     gene            complement(<198563..>200764)
                     /gene="TPHA0B00850"
                     /locus_tag="TPHA_0B00850"
                     /db_xref="GeneID:11534898"
     mRNA            complement(<198563..>200764)
                     /gene="TPHA0B00850"
                     /locus_tag="TPHA_0B00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684143.1"
                     /db_xref="GeneID:11534898"
     CDS             complement(198563..200764)
                     /gene="TPHA0B00850"
                     /locus_tag="TPHA_0B00850"
                     /inference="similar to DNA sequence:INSDC:YLR381W"
                     /note="similar to Saccharomyces cerevisiae CTF3 (YLR381W);
                     ancestral locus Anc_4.235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684191.1"
                     /db_xref="GeneID:11534898"
                     /db_xref="UniProtKB/TrEMBL:G8BQG0"
                     /translation="MSGLLDETITLLVDSTDTSSNNLLKGWLDDLFNLVPEYGLNCTQ
                     LKSIIRFVTISPVITATTKVFIIENYLLPNEAIDLMVIKTIIDGLGTSSLSQQYKYYA
                     SRQIQVSLVKWLVQNYFLWDHISDEINGSIWLHIWQYEYLQKWLTYIIIWTTKSRNDV
                     RKWKLQYLQKFAFNPGYLEANIYSAAILDRYTSIVGHSQSISDIKAKLACNQRSLQNF
                     YNLEINESQLKLVANILSSSVKGRAFTQDYINSSVESLKLQLTSSQQHISSNFNSYLH
                     NPPAGHIYIPTVKNNKELICNWRTVVVPKNLEYIFDDRIASSVIITTLIKEGNNMSSQ
                     SQIYNWIEVQLKRCFNLNGNLSEHEVIIIIRKIMMQCMINKQLIPKIASEFLTSEYLN
                     RRLFSFNFLSTSLIPLLNPTNNNDMRKYVLKMLAMCHLWQQDNNNSTTLFFNLMRSFV
                     VMIKIWLNDSAIYNSKENMLVAADIINDISKLIVTVYLNEVTDRKVTIALVLLFESIL
                     SFPSQCYKDDKILKKIMIPPSLMNNILLSDDPIIVNVCCKYLIKSKQLLHEKSSDYMI
                     VNWGNQYILDLTNYLWRNKITISKKIFGLPNEFIKSITNNLYFPNVSNISRAVFTITG
                     VPSLSFICSKYLLDLEERTYTKVHYNRTLTEEGFKMFMTHINNTYAGNIPGIWLSDTN
                     AIIELRIKILKEMITSNSSYSMIPLFLFTYLKSLSKYNENNKDIERTGQLA"
     gene            complement(<201067..>202284)
                     /gene="TPHA0B00860"
                     /locus_tag="TPHA_0B00860"
                     /db_xref="GeneID:11535081"
     mRNA            complement(<201067..>202284)
                     /gene="TPHA0B00860"
                     /locus_tag="TPHA_0B00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684144.1"
                     /db_xref="GeneID:11535081"
     CDS             complement(201067..202284)
                     /gene="TPHA0B00860"
                     /locus_tag="TPHA_0B00860"
                     /inference="similar to DNA sequence:INSDC:YLR380W"
                     /note="similar to Saccharomyces cerevisiae CSR1 (YLR380W);
                     ancestral locus Anc_4.234"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684192.1"
                     /db_xref="GeneID:11535081"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:G8BQG1"
                     /translation="MNVEEENKSLEYNKQLVLKQLWFYLLRFWGEPLEESILLELLDT
                     INDNKVVTEPKKSSSYFGWGSKSTSGDTKGKTDMSFDPFTKYGIDKDASESLFWNSLN
                     IETPDDYVLKFLRARKWHFEKSISMLVKALEWRLSKFDTLKIIRGGERKFYNDNKQGV
                     VKNLELQKAVICGYDLKGRPIIIVRPHLHYSKDQTPEELEEYALLVIEQTRLFFKEPV
                     LSATILFDLTDFTMANMDYAPVKFLVEVFEAHYPECLGHLMIHNAPWLFSPIWNVIKA
                     WLDPIVASKIMFTYNTKDLLTWISKENLPEYLGGELGFDFDSYVCPDESADETLTDVE
                     QRDPIQKEREAIIRSLKDKTIEWIKTKDETKSQELFNERIEIMEKLSKNYASLDLYVR
                     SRSTYDINGSLKL"
     gene            <203049..>204086
                     /gene="TPHA0B00870"
                     /locus_tag="TPHA_0B00870"
                     /db_xref="GeneID:11535124"
     mRNA            <203049..>204086
                     /gene="TPHA0B00870"
                     /locus_tag="TPHA_0B00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684145.1"
                     /db_xref="GeneID:11535124"
     CDS             203049..204086
                     /gene="TPHA0B00870"
                     /locus_tag="TPHA_0B00870"
                     /inference="similar to DNA sequence:INSDC:YDL057W"
                     /note="similar to Saccharomyces cerevisiae YDL057W;
                     ancestral locus Anc_4.233"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684193.1"
                     /db_xref="GeneID:11535124"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR029059"
                     /db_xref="UniProtKB/TrEMBL:G8BQG2"
                     /translation="MKLKEVREKICVHQHCTSHQRLQRCKVYEMTESRGICYRVVNEI
                     PSHLKLTDSESFVYIKNPKYHIGEGIAGILTLPQSIPNCNKTIKFVLLLHGMQSHKNA
                     IYQPRLAKRLAQLGYMVLRIDFRNNGDSESIVDDNKGRCLQRDLEDIETIYDLVTRES
                     KLLLGGGENELSFDSIVSHSRGVISMFEFVRTTKACIRNLINCSARYEGLTLYDKLTK
                     QHPNWILDNGYEATLLQHNKFVKQWIYKDEMLSFINASEDNFKQIDPQINLLSCYGAL
                     DDVVPQSAPSQFATLFHDHHHKLVIIPNANHNYYGHSNDPNILFKPLNKGRVDYNDDL
                     TSVLVSFIAAG"
     gene            <204456..>206855
                     /gene="TPHA0B00880"
                     /locus_tag="TPHA_0B00880"
                     /db_xref="GeneID:11534856"
     mRNA            <204456..>206855
                     /gene="TPHA0B00880"
                     /locus_tag="TPHA_0B00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684146.1"
                     /db_xref="GeneID:11534856"
     CDS             204456..206855
                     /gene="TPHA0B00880"
                     /locus_tag="TPHA_0B00880"
                     /inference="similar to DNA sequence:INSDC:YDL056W"
                     /note="similar to Saccharomyces cerevisiae MBP1 (YDL056W);
                     ancestral locus Anc_4.232"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684194.1"
                     /db_xref="GeneID:11534856"
                     /db_xref="GOA:G8BQG3"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="InterPro:IPR018004"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8BQG3"
                     /translation="MSNQIYSAKYSNVDVYEFLHSTGSVMKRKKDGWVNATHILKTAN
                     FAKAKRTRILEKEVIQETHEKVQGGFGKYQGTWVPLSVAISLAQKFEVYDELKVLFDF
                     EQAAGETPPPPAPKHHHASKAKALRAKSLNDLPAKTTTLNQPPIELDTNVKIQKKRGR
                     PASTTPKVVAKPKRKLTAKAKREAQSNDALLVKPHIPSSTINTNQLPYISNNGKSLSI
                     DEMPSNTELSVEPDNIIQHQLIQDHQQFKEIDLNDGLSSDVEQPSYLPTNKPFEHDVN
                     HYHAEEKGDTTRNRQYSMDNDHTFLQNSPNASTPTLPSSPSDLNDAAPFDNRYSVGTS
                     PVISTIPRYTNHKATENITTDINDEVNTYLSRLVDYFTSTDMKSNTEISVELLNPPKN
                     SAPYIDVPIDPEIHTAFHWACSMGNLPIVEALYNVGTSIRSVNSQGQTPLMRSVMFYN
                     CYSRRSFPKIFELLHETVFDIDNSGQTILHHIVKRKSSTPSAMYYLDLVLSKVKDYSP
                     QYKIEELLNCKDSNGNTALHIAAKNADTLFYKTLVDNGALKSILNNENLSSEDIINSQ
                     GQDVRTISQLRNLKDNELFESFVSLQASIKNKNGQFKSKSSKSISENLPKVINLFKTL
                     AEKYDESYGKSEDVVESLQQNIFNVSKSIKNVNVKTAEILKISNINEIPEVLVKNMKK
                     LEQLKIDKEVIQNKLKYQYRTEKSKLFNDIIKEVKKDNDEGKLDKIHDRDEILASHKE
                     AKEEGEILIRKIINKIQDNSKIHKYRKMISEGTAIDLVEVDNNLDTILTSLTSENMNE
                     A"
     gene            complement(<207124..>208209)
                     /gene="TPHA0B00890"
                     /locus_tag="TPHA_0B00890"
                     /db_xref="GeneID:11535128"
     mRNA            complement(<207124..>208209)
                     /gene="TPHA0B00890"
                     /locus_tag="TPHA_0B00890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684147.1"
                     /db_xref="GeneID:11535128"
     CDS             complement(207124..208209)
                     /gene="TPHA0B00890"
                     /locus_tag="TPHA_0B00890"
                     /inference="similar to DNA sequence:INSDC:YDL055C"
                     /note="similar to Saccharomyces cerevisiae PSA1 (YDL055C);
                     ancestral locus Anc_4.231"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684195.1"
                     /db_xref="GeneID:11535128"
                     /db_xref="GOA:G8BQG4"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BQG4"
                     /translation="MKGLILVGGYGTRLRPLTLTQPKPLVEFANRPMILHQIEALANA
                     GVTDIVLAVNYRPEVMVETLQKYEKEYGVSITFSVETEPLGTAGPLKLAEKILKKDNS
                     PFFVLNSDVICEYPFKELADFHNAHGGKGTIVATKVDEPSKYGVIVHDIQTPNLIDRF
                     VEKPVEFVGNRINAGLYILNPEVIDLIEMKPTSIEKETFPILVEQKSLYSFDLEGFWM
                     DVGQPKDFLAGTVLYLSSVAKKNEEKLAKGSNIVGNVIVDPSAKISPSAKIGPNVTIG
                     PNCVIGDGARIERSVILANSTVKEHSLVKSTIVGWNSTVGRWCRLEGVTVLGDDVEIK
                     DEIYINGGKVLPHKCISTNVPQEAIIM"
     gene            <209514..>210545
                     /gene="TPHA0B00900"
                     /locus_tag="TPHA_0B00900"
                     /db_xref="GeneID:11534790"
     mRNA            <209514..>210545
                     /gene="TPHA0B00900"
                     /locus_tag="TPHA_0B00900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684148.1"
                     /db_xref="GeneID:11534790"
     CDS             209514..210545
                     /gene="TPHA0B00900"
                     /locus_tag="TPHA_0B00900"
                     /inference="similar to DNA sequence:INSDC:YLR377C"
                     /note="similar to Saccharomyces cerevisiae FBP1 (YLR377C);
                     ancestral locus Anc_4.227"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684196.1"
                     /db_xref="GeneID:11534790"
                     /db_xref="GOA:G8BQG5"
                     /db_xref="InterPro:IPR000146"
                     /db_xref="InterPro:IPR020548"
                     /db_xref="InterPro:IPR028343"
                     /db_xref="UniProtKB/TrEMBL:G8BQG5"
                     /translation="MPALLENDLRRLSESNFETDIITLSRFLLDNQKDIKFATGEFTL
                     LLNALQFAFKFISQTIRKAELINLVGLSGTSNSTGDDQKKLDVLGDEIFINTMKGSGN
                     VKVLVSEEQEDLIVFNNAEGGYAVCCDPIDGSSNLDAGVSVGTIVSIFRLLPGSKGSI
                     KDVLRSGNDMVAACYAMYGASTHLLLTTGAGVNGFTLDTEKGEFILTQPDLRLPSSRS
                     IYSINEGNTKHWDAKIQKFIDSLKTCENNYSSRYIGSMVADMHRTFLYGGLFAYPADK
                     KSPNGKLRLLYEAFPMAFLVEQAGGKAVNDEGKRILDLVPKNIHDKSSVWLGSQDEID
                     NYLKFISQP"
     gene            complement(<210738..>211532)
                     /gene="TPHA0B00910"
                     /locus_tag="TPHA_0B00910"
                     /db_xref="GeneID:11534740"
     mRNA            complement(<210738..>211532)
                     /gene="TPHA0B00910"
                     /locus_tag="TPHA_0B00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684149.1"
                     /db_xref="GeneID:11534740"
     CDS             complement(210738..211532)
                     /gene="TPHA0B00910"
                     /locus_tag="TPHA_0B00910"
                     /inference="similar to DNA sequence:INSDC:YDL052C"
                     /note="similar to Saccharomyces cerevisiae SLC1 (YDL052C);
                     ancestral locus Anc_4.226"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684197.1"
                     /db_xref="GeneID:11534740"
                     /db_xref="GOA:G8BQG6"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="InterPro:IPR004552"
                     /db_xref="UniProtKB/TrEMBL:G8BQG6"
                     /translation="MKSALYYARFVLFIILLMISALYGAIVSVICTLVNKQEYSQYLC
                     ARFFYFVMKNFFGIDVKVINEQYISNLPYIVVSNHQSTLDILMLGRMFPPGCTVTAKK
                     SLKWIPFLGWFMSLSGTYFLERTNREKSVATLNRGLQAVKDEKKALWIFPEGTRSYTT
                     DLEILPFKKGAFHLAQQGKIPILPVVVSNTSTLMNPKNGVFNRGCITVKVLEPISTEN
                     LKPEDVGTFSEKIREKMLKELKENVGYSEYINDTNIPATIDNKKHS"
     gene            <211903..>212754
                     /gene="TPHA0B00920"
                     /locus_tag="TPHA_0B00920"
                     /db_xref="GeneID:11534787"
     mRNA            <211903..>212754
                     /gene="TPHA0B00920"
                     /locus_tag="TPHA_0B00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684150.1"
                     /db_xref="GeneID:11534787"
     CDS             211903..212754
                     /gene="TPHA0B00920"
                     /locus_tag="TPHA_0B00920"
                     /inference="similar to DNA sequence:INSDC:YLR376C"
                     /note="similar to Saccharomyces cerevisiae PSY3 (YLR376C);
                     ancestral locus Anc_4.225"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684198.1"
                     /db_xref="GeneID:11534787"
                     /db_xref="UniProtKB/TrEMBL:G8BQG7"
                     /translation="MDVLKNCRVYKLSSFKNPTEQFIKLEKNEINITNNPVSLSLILD
                     KIKYLHLIEHEFKLSNFKCSLAQSCIKNLQADGKGNEKCILVIDIISAWKKYLLNKEY
                     IASDVKGSSYSETDGETTSHENSQIPEPDSTENNEVGVYYLNSSDILNMEGILKFFSK
                     LNENPIETLEKYCHFPKTVNFKQQLSGIIVDNISYFAHDNHMNIQQNTAHYSTLLNMF
                     KTLRKTFGCWVISVSYGMEFYDGVELSTSSIYRSGSHTRVPINYTSGMDTILLRDTES
                     TGRFCNI"
     gene            complement(<212983..>214026)
                     /gene="TPHA0B00930"
                     /locus_tag="TPHA_0B00930"
                     /db_xref="GeneID:11534993"
     mRNA            complement(<212983..>214026)
                     /gene="TPHA0B00930"
                     /locus_tag="TPHA_0B00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684151.1"
                     /db_xref="GeneID:11534993"
     CDS             complement(212983..214026)
                     /gene="TPHA0B00930"
                     /locus_tag="TPHA_0B00930"
                     /inference="similar to DNA sequence:INSDC:YDL048C,YLR375W"
                     /note="similar to Saccharomyces cerevisiae STP4 (YDL048C)
                     and STP3 (YLR375W); ancestral locus Anc_4.222"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684199.1"
                     /db_xref="GeneID:11534993"
                     /db_xref="GOA:G8BQG8"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BQG8"
                     /translation="MTLTSTYSATAATVSGVRSPTANKITLPPISSFDHTIRSAEYHH
                     VPINLALQSLSSSGLSTPYGSSRQNSAVSLDSTFSHDTVASSVVSSMSNSSYSAKSRS
                     HSLLCLPSTKNGYQGAFQKHNNQFILSSSGSSESLDGQNSIVSPASVDNKVSKKQRKK
                     KECQICHNFYANLSTHKSTHLTPENRPHKCDICGHGFARNNDLIRHKKRHWKDEFSLG
                     TGTNTQYKYSDTEPSKEIKFDQLKSLHSIKGSFRCPFNSTLIKLDMELYSYKSMDLNF
                     DTSNCHQTGIFSRCDTYKNHLKALHFEYPPGTKKVNRSAVAGRCRHCGKKFPNVNYWL
                     KNHVTKTCGYSYH"
     gene            <215868..>217640
                     /gene="TPHA0B00940"
                     /locus_tag="TPHA_0B00940"
                     /db_xref="GeneID:11535042"
     mRNA            <215868..>217640
                     /gene="TPHA0B00940"
                     /locus_tag="TPHA_0B00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684152.1"
                     /db_xref="GeneID:11535042"
     CDS             215868..217640
                     /gene="TPHA0B00940"
                     /locus_tag="TPHA_0B00940"
                     /inference="similar to DNA sequence:INSDC:YGR065C"
                     /note="similar to Saccharomyces cerevisiae VHT1 (YGR065C);
                     ancestral locus Anc_4.212"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684200.1"
                     /db_xref="GeneID:11535042"
                     /db_xref="GOA:G8BQG9"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G8BQG9"
                     /translation="MQFLPRLRIISDVYDDTDSDQSSAKVSIIDTVSLEDQTKKLSIA
                     IQEEVTSFDGNDSVLRLKKNFPYELRDEKDRRWYSYFNEYEYRLNKHYRNTKRGAWYE
                     FLYPNHSKKSRAERHLLYKLDMVIAFYFLMLCWSKSVDTSNYTNAYVSGMKEDLHMKG
                     NDFIYTSTIANVGSIIFQLPFMYLLPRFPAHIILPCMDMGWTWFTFACYRAKSLAELR
                     AYRFILNAFGAAYYPVSQYILGCWYAPDELSSRVCMFYCGQLLGTVTSGLLQSKIYDA
                     LNGVHGIAGWRWMFLIDAVAISLPTAIIGFFVIPGVPSKCYSLFLTDEEIRIARTRNR
                     LNNIKDAVPKEELKKLWDLSIWKKVFGTSTFWVLVVFDACSWNNFGSTGGAYSLWLKA
                     NPDYSISRVNQLSALPASLGFFYVILCSFGADLFRCKWIFMVFAAIMNTISCAILIKW
                     DVSAATKWFAFLLTYFSVAASPCLWTFINDFLRFDPQIKAVTWIAIYSVSQSTYAWIP
                     TLVWPTVDSPRFKTGYISSLIFGAIYGLWTFVVLYFYKRNEKRNALNNGIIIYNSDKE
                     EKPAFVENMLTEDEDGFYYRNDNI"
     gene            complement(<217773..>218099)
                     /gene="TPHA0B00950"
                     /locus_tag="TPHA_0B00950"
                     /db_xref="GeneID:11534997"
     mRNA            complement(<217773..>218099)
                     /gene="TPHA0B00950"
                     /locus_tag="TPHA_0B00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684153.1"
                     /db_xref="GeneID:11534997"
     CDS             complement(217773..218099)
                     /gene="TPHA0B00950"
                     /locus_tag="TPHA_0B00950"
                     /inference="similar to DNA sequence:INSDC:YLR364W"
                     /note="similar to Saccharomyces cerevisiae YLR364W;
                     ancestral locus Anc_4.211"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684201.1"
                     /db_xref="GeneID:11534997"
                     /db_xref="GOA:G8BQH0"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:G8BQH0"
                     /translation="MSDFDGKVKELITSSEFFQFSASWCPDCVYANSIWTKFHVSDKV
                     TIFDIGSLPKEEQEQWRQAFQRVTGSRNLPTIFVNGVIWGTESELHKFENNGSIQQEL
                     EKINLL"
     gene            complement(<218395..>218739)
                     /gene="TPHA0B00960"
                     /locus_tag="TPHA_0B00960"
                     /db_xref="GeneID:11535055"
     mRNA            complement(<218395..>218739)
                     /gene="TPHA0B00960"
                     /locus_tag="TPHA_0B00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684154.1"
                     /db_xref="GeneID:11535055"
     CDS             complement(218395..218739)
                     /gene="TPHA0B00960"
                     /locus_tag="TPHA_0B00960"
                     /inference="similar to DNA sequence:INSDC:YLR363W-A"
                     /note="similar to Saccharomyces cerevisiae YLR363W-A;
                     ancestral locus Anc_4.208"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684202.1"
                     /db_xref="GeneID:11535055"
                     /db_xref="InterPro:IPR019034"
                     /db_xref="UniProtKB/TrEMBL:G8BQH1"
                     /translation="MAQKPLKVTKKVKDPRRITKKQKNLRKAAVLQIKSKKKSLQHLK
                     KLNKASSLTVATERLLSSKVGHLELLKGTRRELERSKDKQLYEKKIIKYCFLHTEDLN
                     FLPASAFTTLIL"
     gene            <219705..>223760
                     /gene="TPHA0B00970"
                     /locus_tag="TPHA_0B00970"
                     /db_xref="GeneID:11534916"
     mRNA            <219705..>223760
                     /gene="TPHA0B00970"
                     /locus_tag="TPHA_0B00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684155.1"
                     /db_xref="GeneID:11534916"
     CDS             219705..223760
                     /gene="TPHA0B00970"
                     /locus_tag="TPHA_0B00970"
                     /inference="similar to DNA sequence:INSDC:YGR061C"
                     /note="similar to Saccharomyces cerevisiae ADE6 (YGR061C);
                     ancestral locus Anc_4.207"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684203.1"
                     /db_xref="GeneID:11534916"
                     /db_xref="GOA:G8BQH2"
                     /db_xref="InterPro:IPR000728"
                     /db_xref="InterPro:IPR010073"
                     /db_xref="InterPro:IPR010918"
                     /db_xref="InterPro:IPR016188"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:G8BQH2"
                     /translation="MPAKFYPGPIALSRFRINNLVKNIIQNYNSSDDSLITDIHTSFI
                     HFVDFNENLISDEDDLNLLKILLTYDNELTENDKLLSDAIENNLKNASLPENYHIIRI
                     VPRYGTISPWSSKATNIIQVCGLGEKIKRVERGIAILFKCNDEKLIEFWKNESFNSFT
                     SVFDKMTHSIFIDDEFPALEKIFNNDTPKPLVHVPLVSNDKDPREVLKKANIKLGLAL
                     DDDEINYLVNAFVNILHRNPTDVELFMFAQVNSEHCRHKIFNADWTIDNEKKDLSLFK
                     MIQNTHNLTKEFIISAYSDNAAVIDTQNEAYYFAPEFNTKNWTSVKENIPLLIKVETH
                     NHPTAVSPFPGAATGSGGEIRDEGATGRGSKTKCGLSGFSVSDLLIPNHRQPWELDVS
                     KPSHIASAFDIMKEAPLGSAAFNNEFGRPCINGYFRTLLTKVLDSDNKEELRGFHKPI
                     MIAGGFGTVRPQFALKDKPITPGSCLVVLGGESMLIGLGGGAASSVASGVGSADLDFA
                     SVQRGNPEMERRCQQVIDACVSLDTKNPIQSIHDVGAGGLSNALPELVHDNNLGAVFN
                     IRNILSLEPGMSPMEIWCNESQERYVLGVAKEDLTVFEEICKRERAPYSVVGHATEEQ
                     RLVVEDPLFESKTIDLDLSILFGKPPKMSKSAITEPLNLPEIDYSVIPSLDDAVSRVL
                     SLPAVGSKSFLITIGDRSVTGLIDRDQFVGPWQVPVADVGVTGTSLGPEIVSTGEALA
                     MGERPINALISASASAKLSVAESLLNLFAADVKSLKHVKLSANWMSSASHKGEGTKLY
                     EAVQAIGLDLCPDLDISIPVGKDSMSMQMRWDDKEVTIPLSLVVTAFAPVNNTSKTWT
                     PLLDRSSENSLLVHVDLSNLQKEKSLGGSSLLQVYNQVGNRSPTVYDNKVLKSFLEAI
                     IELHQTDIVSAYHDVSDGGLLVTLLEMSFASRCGLDITIDFSRYESEYIPLFNEEIGS
                     VFQVSESKIDLFRNILKDHGISEDFIQIVAKPTFNSQAIRILSEDNMLVYENTRGKLQ
                     SIWSKTSYLMQKLRDNPDSADEEFENIKDDSDPGLHYDLSFDVTDDMKIGSQLSSFKP
                     KVAILREQGVNGQMEMAWCFQQAGFTSVDVTMTDLINGRVHLNDFIGFAACGGFSYGD
                     VLGAGAGWAKSVLYHEHVRQQFITFFQERQDTFAFGACNGCQFLSRLKSIIPGAKNWP
                     SFEKNVSEQYEARTSMVEIVHTTGPETVFLNGMIGSRMPIAVAHGEGKTTFASDSEMN
                     KFENASLTAIRYIDNYGNHTSKYPYNPNGSAHAIAGIRSPNGRVLAMMPHPERVCRLE
                     ANSWYEPDKYDEWKGYGPWIRLFRSARRWVG"
     gene            <224012..>224695
                     /gene="TPHA0B00980"
                     /locus_tag="TPHA_0B00980"
                     /db_xref="GeneID:11535017"
     mRNA            <224012..>224695
                     /gene="TPHA0B00980"
                     /locus_tag="TPHA_0B00980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684156.1"
                     /db_xref="GeneID:11535017"
     CDS             224012..224695
                     /gene="TPHA0B00980"
                     /locus_tag="TPHA_0B00980"
                     /inference="similar to DNA sequence:INSDC:YLR363C"
                     /note="similar to Saccharomyces cerevisiae NMD4 (YLR363C);
                     ancestral locus Anc_4.205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684204.1"
                     /db_xref="GeneID:11535017"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="UniProtKB/TrEMBL:G8BQH3"
                     /translation="MNAYHLILEASAFEKGLGNIKKWCANTSNEVKLSLYIPTFTLKE
                     LDFQRYKNKSFIARESLKFIEQVEERNERIKKNQKSNLDIIIEFPDMLDLVLWSEVLE
                     LAGSKHEDAFNKLPKRLKNLLKSCIYLCHLSSEFDDDRKWLLVSENHEIQELACICKI
                     PVISVIDADAELSKNMNRREFQLTQNFNKKITESGRTEKNNEGQNVVKTKFDKTVYAS
                     RGSGILWAP"
     gene            complement(<225810..>227525)
                     /gene="TPHA0B00990"
                     /locus_tag="TPHA_0B00990"
                     /db_xref="GeneID:11534819"
     mRNA            complement(<225810..>227525)
                     /gene="TPHA0B00990"
                     /locus_tag="TPHA_0B00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684157.1"
                     /db_xref="GeneID:11534819"
     CDS             complement(225810..227525)
                     /gene="TPHA0B00990"
                     /locus_tag="TPHA_0B00990"
                     /inference="similar to DNA sequence:INSDC:YGR059W"
                     /note="similar to Saccharomyces cerevisiae SPR3 (YGR059W);
                     ancestral locus Anc_4.204"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684205.1"
                     /db_xref="GeneID:11534819"
                     /db_xref="GOA:G8BQH4"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BQH4"
                     /translation="MFYSKINCEVIKTKEDKNMEKETLISQGQYATHSTPIQVVSNGV
                     TDVNDSVLLESNQEAFKNINNFEASENEDNIGDDNNKNDDNDYNKYCHNSGGSAEINN
                     ILESYQQLSIFEKEKVSNSSVSKTMSESTNFKEDYHVGIDLIIKQKERIIKDKGINFT
                     VMVAGQYGLGKSTFINTLFGENLLSVSDYRTHTMEVDITMPPTKLITIHKANLVGNNC
                     KVNLTVIDTPGFGSKMNSAFSWTPLTNHIDEKIRTNIFQEEQPDRTMMNDGRVHCCIY
                     FIEPINKGLTTLDVVTMKELSKRVNLIPVIAKADTLTKKELVDFKLDIRQILEIQNIE
                     VCQFLDSNDSYYDDLIKNAPYSIISSDKRIKNERGEIVYGRNYGWGKVEVENPGHSDF
                     ALLRDLLFNKYLPDLIFNTEDYYETCRATLLKTRLLKCKEIVQTQSSELVGGVEISQE
                     LRDILSTFDYEDFDKNGLKNYICYQIFDKNFIDSIVLEWSQEYVHKQWETKKKFNDVV
                     ALEETKFQDWRKAILQKQEQFNNEINSMHSKIERLQIDCKNLETKGISGEVDNELYTT
                     KLVQS"
     gene            complement(<227853..>229058)
                     /gene="TPHA0B01000"
                     /locus_tag="TPHA_0B01000"
                     /db_xref="GeneID:11535013"
     mRNA            complement(join(<227853..228872,229014..>229058))
                     /gene="TPHA0B01000"
                     /locus_tag="TPHA_0B01000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684158.1"
                     /db_xref="GeneID:11535013"
     CDS             complement(join(227853..228872,229014..229058))
                     /gene="TPHA0B01000"
                     /locus_tag="TPHA_0B01000"
                     /inference="similar to DNA sequence:INSDC:YGR058W"
                     /note="similar to Saccharomyces cerevisiae PEF1 (YGR058W);
                     ancestral locus Anc_4.203"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684206.1"
                     /db_xref="GeneID:11535013"
                     /db_xref="GOA:G8BQH5"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:G8BQH5"
                     /translation="MCAKKLNYAAGDDLKLYATPEEAMREGKRQLEEEKLRRQRMYEV
                     NNNKVGVDTRIYSAPPSVGIPPGNGRDARNWSHNSYNQSYANRTPPVNNIQSQFQNTP
                     PNNISYKYQHNAVHNSVPVFDRNKAIIQQRPPLINNVPNPSLPQVDQQRHSSLSSLGA
                     VNQTPITNSPSAKEDRDNKIALTLFSNHDSKGRGRLTAEELQNFLQNDDGSYFCISAI
                     DALVNLFGATRFGTINQQEFVALYKKVKNWRVIYVDNDINRSCTLNVNEYHNALQELG
                     YLIPFEVTEKLFEQYAEFINQAVNSKELKFDKFVESLIWLVRLSKLFRKHDVNKEGIA
                     SIQYKDFIDMVLYLGRFLPH"
     gene            complement(<229538..>231634)
                     /gene="TPHA0B01010"
                     /locus_tag="TPHA_0B01010"
                     /db_xref="GeneID:11534821"
     mRNA            complement(<229538..>231634)
                     /gene="TPHA0B01010"
                     /locus_tag="TPHA_0B01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684159.1"
                     /db_xref="GeneID:11534821"
     CDS             complement(229538..231634)
                     /gene="TPHA0B01010"
                     /locus_tag="TPHA_0B01010"
                     /inference="similar to DNA sequence:INSDC:YLR362W"
                     /note="similar to Saccharomyces cerevisiae STE11
                     (YLR362W); ancestral locus Anc_4.202"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684207.1"
                     /db_xref="GeneID:11534821"
                     /db_xref="GOA:G8BQH6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011510"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR029458"
                     /db_xref="UniProtKB/TrEMBL:G8BQH6"
                     /translation="MGTLFMEQFLHDLNCGKYVEAFKECEILNRDDIEHLDREILEEL
                     GVSKLGDRIRILNKAKLLRERRCEKLTDQLNGIIEKINSLSTTNMNVTDDLIAMDKHS
                     SIFILNDGSAKKVNVNGCFNAELIKKRLIKRLPSELIALDQSGEETKSAEDYDVFVVN
                     YEKNILHLLYDVELVTICHSSDRIEKNRLIFISKDQTPSDKALATSKKLYLRTLNFTN
                     KKHVLQPENLLGSNNLIFSGYAQNENIGVGQPLKMDNTKGQLRRIFNQRPPSELISTN
                     LTGYFPKADMKHLQKTLKDSFRQSVRLTNGRRRTIDSESNKVGDIILKHNTAVDNALL
                     GSLPQNDPHSTVNNKISTTPGNPGHTQATADPNHIKLVPEIPDDIYDSENDIFSLPTT
                     VSTPKAWLKGACIGSGSFGSVYLGMNATTGELMAVKQVEIPADILGTEMNINDKKKKS
                     SVYKKMVDALQHEMNLLKELHHENIVTYYGSSQEGQNFNIFLEYVPGGSVSSMLKNYG
                     PFEESLIINFTRQILIGVAYLHRKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPL
                     NKINAENNEESPEKNEKVRPQENEKINKRVSLQGSVYWMAPEVVRQTAATEKIDIWST
                     GCVIIEMYTGRHPFPELSQMQTIFKIGTNTAPELPSWASPNSVDFLKKTFEINYEKRP
                     SAVELLLHPWLDARIK"
     gene            complement(<232252..>233757)
                     /gene="TPHA0B01020"
                     /locus_tag="TPHA_0B01020"
                     /db_xref="GeneID:11534772"
     mRNA            complement(<232252..>233757)
                     /gene="TPHA0B01020"
                     /locus_tag="TPHA_0B01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684160.1"
                     /db_xref="GeneID:11534772"
     CDS             complement(232252..233757)
                     /gene="TPHA0B01020"
                     /locus_tag="TPHA_0B01020"
                     /inference="similar to DNA sequence:INSDC:YLR360W"
                     /note="similar to Saccharomyces cerevisiae VPS38
                     (YLR360W); ancestral locus Anc_4.199"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684208.1"
                     /db_xref="GeneID:11534772"
                     /db_xref="UniProtKB/TrEMBL:G8BQH7"
                     /translation="MTMMIKDNGLVTRRLRHLRSIKIQNIDIMQHSINNQYRMSLLQQ
                     KYEYFLTIENLKDEIIYVSEVQHTWLNRLYFNEIPINEYPDYELTLKLMLKFPNTLLD
                     ESDSSFNEPTDNLNANAAETWIEIVNLDVNLNHLIELVNEKNVIESPNLFLFQFTNGT
                     YIFPHQGLKMEPTSIFNDMEHNKSRTTNKSRLSANFNSLLKVNKSNDFISHIYDEINL
                     ISEKLHDRTYNKKSALIGNNNLIQKYINQLTVSIDRKQRHLEAIGLSFESLIKTEHNE
                     EDKNYELKFHADSGQYFNEVEENDNSYGNKSYQLIKINNKLDLIRAKKCGQLVDIFKE
                     YHLFDVENGGYIILNKPSNGPDQNNHVAPSDEFNLTSWKSRIELDDGKEKTHGIINQL
                     QFKKVQVNDIMTLIEGINSNKADENEINTVNTLLGQYMLFTLMISKVIYHIPLPNDME
                     YCGSTCFINKTLPFFIPEKKKLTKTSIASLIKAIDLFNINIKQLQLHLQRY"
     gene            <234399..>235241
                     /gene="TPHA0B01030"
                     /locus_tag="TPHA_0B01030"
                     /db_xref="GeneID:11534770"
     mRNA            <234399..>235241
                     /gene="TPHA0B01030"
                     /locus_tag="TPHA_0B01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684161.1"
                     /db_xref="GeneID:11534770"
     CDS             234399..235241
                     /gene="TPHA0B01030"
                     /locus_tag="TPHA_0B01030"
                     /inference="similar to DNA sequence:INSDC:YGR057C"
                     /note="similar to Saccharomyces cerevisiae LST7 (YGR057C);
                     ancestral locus Anc_4.198"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684209.1"
                     /db_xref="GeneID:11534770"
                     /db_xref="InterPro:IPR021713"
                     /db_xref="UniProtKB/TrEMBL:G8BQH8"
                     /translation="MNKNKGLNNEYFLQNEQLPNEDTEPKNVTGIELLPINKFLFSIL
                     LGHFCDKHGPTIVMVTQVGSISTGGDELLVPDFPTDSYCESCSMHISNNLVKDSSTKT
                     DTKSMRSVIADSVYVSTQYSLIRYQLMTQVIRKAFSEETISYDSSPLIFFDDIRGLNF
                     VMGFKLYDDQARGNERRYSLIFNINTKNSKAAMNILANNWDFIEGGFLKIIHYIQHKH
                     EEDIKRQLEKENEDGGFTPMVGTFLRANKVKTSKNLSELTKDELIFIKLHKWNSYILK
                     SLLV"
     gene            complement(<235467..>236915)
                     /gene="TPHA0B01040"
                     /locus_tag="TPHA_0B01040"
                     /db_xref="GeneID:11534841"
     mRNA            complement(<235467..>236915)
                     /gene="TPHA0B01040"
                     /locus_tag="TPHA_0B01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684162.1"
                     /db_xref="GeneID:11534841"
     CDS             complement(235467..236915)
                     /gene="TPHA0B01040"
                     /locus_tag="TPHA_0B01040"
                     /inference="similar to DNA sequence:INSDC:YLR359W"
                     /note="similar to Saccharomyces cerevisiae ADE13
                     (YLR359W); ancestral locus Anc_4.197"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684210.1"
                     /db_xref="GeneID:11534841"
                     /db_xref="GOA:G8BQH9"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR004769"
                     /db_xref="InterPro:IPR008948"
                     /db_xref="InterPro:IPR019468"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="InterPro:IPR022761"
                     /db_xref="InterPro:IPR024083"
                     /db_xref="UniProtKB/TrEMBL:G8BQH9"
                     /translation="MTEYDKYTTPLSSRYASEEMSSIFSLRNRFSTWRKLWLNLAIAE
                     KELGLDVITDEAIEQMKANLIITDKELARASAQEAIVRHDVMAHVHTFGETCPAAAGI
                     IHLGATSCYVTDNADLIFLRDAYDVIIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPA
                     QLTTLGKRSTLWIQELLWDLRNFVRARNDLGLRGVKGTTGTQASFLALFHGNHDKVEE
                     LDERVTELLGFDTVYPVTGQTYSRKIDIDVLAPLASFAATAHKMATDIRLLANLKEVE
                     EPFEKSQIGSSAMAYKRNPMRCERVCSLARHLGSLYSDAVQTASVQWFERTLDDSAIR
                     RISLPGAFLTTDILLSTLLNISSGLVVYPKVIERRIKSELPFMATENIIMAMVEKGAS
                     RQDVHENIRVLSQQASDVVKKQGGENDLIERIQNDAFFEPIWKDLDTLLKPSTFVGRA
                     PQQVEKFVSRDVKNALEPFQVMINNEEVKLNV"
     gene            complement(<237560..>240346)
                     /gene="TPHA0B01050"
                     /locus_tag="TPHA_0B01050"
                     /db_xref="GeneID:11535018"
     mRNA            complement(<237560..>240346)
                     /gene="TPHA0B01050"
                     /locus_tag="TPHA_0B01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684163.1"
                     /db_xref="GeneID:11535018"
     CDS             complement(237560..240346)
                     /gene="TPHA0B01050"
                     /locus_tag="TPHA_0B01050"
                     /inference="similar to DNA sequence:INSDC:YGR056W,YLR357W"
                     /note="similar to Saccharomyces cerevisiae RSC1 (YGR056W)
                     and RSC2 (YLR357W); ancestral locus Anc_4.196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684211.1"
                     /db_xref="GeneID:11535018"
                     /db_xref="GOA:G8BQI0"
                     /db_xref="InterPro:IPR001025"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR027180"
                     /db_xref="UniProtKB/TrEMBL:G8BQI0"
                     /translation="MSRRSGENRAPQSDDGDNQLLHKRIRHFYDQLYTVKEQNGIEIY
                     PVFITLPTKKDYPDYYALITKPVSINTLKKRVPHYTDPQNFINDLAQMIWNAKAFNDE
                     GSEIFKYAQVLEKYVRGTVFEKMKEYYPEISYPNLGLLPHELEAKGLTVKDVIKKEKK
                     IKDDAKEPNTQQKINATKLSTNNISQTKTSHKSSSNIPNLQRKPIYTNSVNTSNKINT
                     AESSPTPRYSQSASPRPQKQIKKHIKRGRPPVIDLPYVQRMKNVVKYLRRELDGNRRP
                     LTAPFERIPTDNNDNTADYLSIISNPMTLEDIFKKIKTRKYKDFQGFQNDINLMIANY
                     RQYYRSNPQLIQLANLLEKQYTIFARHELSKPDTDFMPEGELRYPIDEVIVNGMKYRI
                     GDWALINNPNDVTKPTVGQIFKLWKTSDGQQWLNACWYIRPEQTVHRVDRLFYKNEVF
                     KTGQYRDHLASELVGKGYVVHFTRYQRGDPDVKLEGPLFVCEFRYNENDNAFNKIRTW
                     KACLPEEIRDQDEITIPVNGRKFFKYESPIKHLLPPNATINDPPPEPTHGVPNNPPIV
                     GGVFIGPKLKRDDLGEYASSDDCPRYIIRPNEPTGEGKIDYETGTLTTTAITATGLPR
                     TVHPPPRLAAMKQNELNGHSGSGTPISVSAGQSFYPTGFGHGSSLDNKSYSPLPYPLP
                     FDSNHNAKNNNITVQGLKQRQAFRMQQQQEQNQLNKKSEASSYNLTTIVNNLTSRASK
                     INLGKIVVDTPNAYVLPLTISKKIEVLQRSDFGNQCRLLGKDEALKKQPKGDILWFKG
                     VSVSVEERMLNSGYRNINSNLNECFESDFKTQQRRKKQKLNYEEIEEKLEEEPESNED
                     NNIQNTDTSNVSNEVSLPKTEPESEESEEDIPLINDIYSKAYYLPGSFALGLKPSANF
                     MAFKLNKNLSSAQD"
     gene            complement(<241062..>242822)
                     /gene="TPHA0B01060"
                     /locus_tag="TPHA_0B01060"
                     /db_xref="GeneID:11534775"
     mRNA            complement(<241062..>242822)
                     /gene="TPHA0B01060"
                     /locus_tag="TPHA_0B01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684164.1"
                     /db_xref="GeneID:11534775"
     CDS             complement(241062..242822)
                     /gene="TPHA0B01060"
                     /locus_tag="TPHA_0B01060"
                     /inference="similar to DNA sequence:INSDC:YGR055W"
                     /note="similar to Saccharomyces cerevisiae MUP1 (YGR055W);
                     ancestral locus Anc_4.195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684212.1"
                     /db_xref="GeneID:11534775"
                     /db_xref="GOA:G8BQI1"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:G8BQI1"
                     /translation="MSDTKNSFVSQLNIFNKDNYKSSNSTHEIEGSDGEQPSDVEAGQ
                     QFVTELDQGEKRLGLFSCIGLICNRMLGTGVFAVSSTIYTQAGSIGLALILWAVGAII
                     ATSGLYVYMEFGTAIPKNGGEKNYLEAIFKKPKFLITSMYASYVFFLGWASGNSVNTA
                     VMFLNAAGTEATEWRQRGLAIAVIFFAFLINAISVKTGLYIQNALGIFKVVIVIFISI
                     TGWVALGGGLKNGYKTDNFHNAFAGTENATAYGVVNALYNVIWSFVGYSNVNYALGEV
                     KNPVRTLKIAGPTSMVFVSIIYIFVNIAYFAVVPKETLKSSKLVLAADFFDIVFGESG
                     KKAASVIVGLSALGNVLSVIFSQGRIIQQLGREGVLPFSSFFASSKPFNSPMVGLFQH
                     FVVCVVTIIAPPAGDAYNFILNLISYPMNIVNFCVSAGLLHIYWQRRKGLIEWNPPIK
                     AGVYITTFFALSNLYLIVAPYVPPSEGQSVYVSLPYWIHCVIAWLVFAIGGIYYCVWT
                     QILPRVFHYKLVTKDVLGDDGFWKISIIKVYDKDVSEKDDDETSEQASKIGDDSLIVQ
                     TVSPENLKSNKESMSSGIEY"
     gene            <243887..>244723
                     /gene="TPHA0B01070"
                     /locus_tag="TPHA_0B01070"
                     /db_xref="GeneID:11535044"
     mRNA            <243887..>244723
                     /gene="TPHA0B01070"
                     /locus_tag="TPHA_0B01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684165.1"
                     /db_xref="GeneID:11535044"
     CDS             243887..244723
                     /gene="TPHA0B01070"
                     /locus_tag="TPHA_0B01070"
                     /inference="similar to DNA sequence:INSDC:YJL115W"
                     /note="similar to Saccharomyces cerevisiae ASF1 (YJL115W);
                     ancestral locus Anc_1.242"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684213.1"
                     /db_xref="GeneID:11535044"
                     /db_xref="GOA:G8BQI2"
                     /db_xref="InterPro:IPR006818"
                     /db_xref="InterPro:IPR017282"
                     /db_xref="UniProtKB/TrEMBL:G8BQI2"
                     /translation="MSIVSLLGIKVLNNPAKFSDPYEFEITFECLEPLKHDLEWKLTY
                     VGSSRSLEHDQELDSILVGPVPVGVNKFVFAADSPSAELIPASELVSVTVILLSCSYD
                     GREFVRVGYYVNNEYDSDELRENPPAKVQVDHVVRNILAEKPRVTRFNIVWDNENEAD
                     FYPPEQQEVEENEEEEEEEDEDEEDEDEEDEDEDEDEDTNDQGTEDVEEEIDIEEEEV
                     DNGNAAEDAEDEQAAEGDVTVNGDDEQDSKRRKIETPTTENPAETVTTPKDIHSPVKT
                     AD"
     gene            complement(<244840..>245643)
                     /gene="TPHA0B01080"
                     /locus_tag="TPHA_0B01080"
                     /db_xref="GeneID:11535024"
     mRNA            complement(<244840..>245643)
                     /gene="TPHA0B01080"
                     /locus_tag="TPHA_0B01080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684166.1"
                     /db_xref="GeneID:11535024"
     CDS             complement(244840..245643)
                     /gene="TPHA0B01080"
                     /locus_tag="TPHA_0B01080"
                     /inference="similar to DNA sequence:INSDC:YKR041W"
                     /note="similar to Saccharomyces cerevisiae YKR041W;
                     ancestral locus Anc_1.243"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684214.1"
                     /db_xref="GeneID:11535024"
                     /db_xref="UniProtKB/TrEMBL:G8BQI3"
                     /translation="MNEGSGTDDSSSNEYSDSDDINYVRPVYQSPDNSIKKKKSTKRP
                     NKSLLNKVYSNLNLEEEPKLKFIKFKRFERDIKSPAKINSFRTQQHFNETVKEYGEDI
                     AGYKFLVTGQEFEKLEMKNKSNLNKKSSEGFAKLEKEQRTINELLMNAPARNIDNIEM
                     QFPIDLLEKYWDAEDNTLTIVPVFGKGSLLDIEADDINSESISEFYEKSCHHFSRDLR
                     SVLKAERVRWHPDRVCNALIRSQLAVSIDVYRKINKIFQIINELWGNER"
     gene            complement(245777..245849)
                     /gene="TPHA0Btrna11A"
                     /locus_tag="TPHA_0Btrna11A"
                     /db_xref="GeneID:11535026"
     tRNA            complement(245777..245849)
                     /gene="TPHA0Btrna11A"
                     /locus_tag="TPHA_0Btrna11A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:11535026"
     gene            complement(<246708..>248528)
                     /gene="TPHA0B01090"
                     /locus_tag="TPHA_0B01090"
                     /db_xref="GeneID:11534897"
     mRNA            complement(<246708..>248528)
                     /gene="TPHA0B01090"
                     /locus_tag="TPHA_0B01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684167.1"
                     /db_xref="GeneID:11534897"
     CDS             complement(246708..248528)
                     /gene="TPHA0B01090"
                     /locus_tag="TPHA_0B01090"
                     /inference="similar to DNA sequence:INSDC:YKR039W"
                     /note="similar to Saccharomyces cerevisiae GAP1 (YKR039W);
                     ancestral locus Anc_1.244"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684215.1"
                     /db_xref="GeneID:11534897"
                     /db_xref="GOA:G8BQI4"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:G8BQI4"
                     /translation="MSSSEGFQMSNQDYKDAKTNINTEFIDPDLESESIDIKKETFNY
                     NQTGEEKGSKWRQFIDSFKRVEVPELDPNLTEQERIAIITAHTPLKHHLKSRHLQMIA
                     IGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEMAVLYPISGGFTT
                     YATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRDGFVALFWLVI
                     VIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGAKYWHDPGAF
                     VGATAGAQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVPPAAKQVFWRILLFY
                     ILSLLFIGLLVPSNDSRLIGSSNVDAAASPFVIAITVHGIRGLPSVINVVILIAVLSV
                     GNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVAFVAQSDKEGD
                     VFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPLGVFGSYWGLFL
                     IVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWTKNWKIFIPLGQL
                     DLDTGRKQLDLDLLRQEVAEERATLAARPRWFRIYTFWCA"
     gene            250290..250361
                     /gene="TPHA0Btrna10D"
                     /locus_tag="TPHA_0Btrna10D"
                     /db_xref="GeneID:11535023"
     tRNA            250290..250361
                     /gene="TPHA0Btrna10D"
                     /locus_tag="TPHA_0Btrna10D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:11535023"
     gene            <250769..>251929
                     /gene="TPHA0B01100"
                     /locus_tag="TPHA_0B01100"
                     /db_xref="GeneID:11534932"
     mRNA            <250769..>251929
                     /gene="TPHA0B01100"
                     /locus_tag="TPHA_0B01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684168.1"
                     /db_xref="GeneID:11534932"
     CDS             250769..251929
                     /gene="TPHA0B01100"
                     /locus_tag="TPHA_0B01100"
                     /inference="similar to DNA sequence:INSDC:YKR038C"
                     /note="similar to Saccharomyces cerevisiae KAE1 (YKR038C);
                     ancestral locus Anc_1.245"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684216.1"
                     /db_xref="GeneID:11534932"
                     /db_xref="GOA:G8BQI5"
                     /db_xref="InterPro:IPR000905"
                     /db_xref="InterPro:IPR017861"
                     /db_xref="UniProtKB/TrEMBL:G8BQI5"
                     /translation="MVNLNKIPPKNGRKYYVALGLEGSANKLGVGVIKHPFLENHESG
                     DLSHDCGVEILSNIRDTYITPPGEGFLPRDTARHHRNWCVRIIKKALIEAQIKDPGLD
                     IDVICFTKGPGMGAPLHSVVIAARTCSLLWEVPLVGVNHCVGHIEMGREITKAENPVV
                     LYVSGGNTQVIAYSENRYRIFGETLDIAIGNCLDRFARTLRIPNNPSPGYNIEQLAKK
                     STHKDSLVLLPYTVKGMDLSMSGILAYVDILAKDLFRGNKKNKVLFDQKTGEQKVTVE
                     DLCYSLQENLFAMLVEITERAMAHVNSNVVLIVGGVGCNVRLQEMMGTMCRDRADGKV
                     HATDDRFCIDNGVMIAQAGLLQYRMGDIVTDLNETVVQQKFRTDEVYVSWRE"
     gene            <252500..>253360
                     /gene="TPHA0B01110"
                     /locus_tag="TPHA_0B01110"
                     /db_xref="GeneID:11534778"
     mRNA            <252500..>253360
                     /gene="TPHA0B01110"
                     /locus_tag="TPHA_0B01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684169.1"
                     /db_xref="GeneID:11534778"
     CDS             252500..253360
                     /gene="TPHA0B01110"
                     /locus_tag="TPHA_0B01110"
                     /inference="similar to DNA sequence:INSDC:YKR037C"
                     /note="similar to Saccharomyces cerevisiae SPC34
                     (YKR037C); ancestral locus Anc_1.246"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684217.1"
                     /db_xref="GeneID:11534778"
                     /db_xref="GOA:G8BQI6"
                     /db_xref="InterPro:IPR013966"
                     /db_xref="UniProtKB/TrEMBL:G8BQI6"
                     /translation="MVDYLDELVAEINHSVTSISTLDFKAPGIFQNAIKRSNYDVNDL
                     LERLVKDVDDERQAPLFTIDKVHKIPTRKDGKKGILDYLTERDDNLKRNRHIGLPEQL
                     PVIHIPNDYYEKLENERNTKNRRLTRNDILLDVDAVTSSMSTASPTAINILNKKFKNN
                     RIVTQLLSALKNGTVISDIGNGNRRKTMFVDDFPTEAIFEVLQEILTIWPSDAYEQDY
                     MNLFSKYKDLIGEIETLQDEIRVQDGQLTAQRRSETEVSSGLSNVAQRLIAKEKRDIA
                     KLESQINDLT"
     gene            <254017..>256176
                     /gene="TPHA0B01120"
                     /locus_tag="TPHA_0B01120"
                     /db_xref="GeneID:11535146"
     mRNA            <254017..>256176
                     /gene="TPHA0B01120"
                     /locus_tag="TPHA_0B01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684170.1"
                     /db_xref="GeneID:11535146"
     CDS             254017..256176
                     /gene="TPHA0B01120"
                     /locus_tag="TPHA_0B01120"
                     /inference="similar to DNA sequence:INSDC:YJL112W,YKR036C"
                     /note="similar to Saccharomyces cerevisiae MDV1 (YJL112W)
                     and CAF4 (YKR036C); ancestral locus Anc_1.247"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684218.1"
                     /db_xref="GeneID:11535146"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8BQI7"
                     /translation="MSGSDHFAQVKEAISATTSILFSNEAVENTILSSQSPYKKLLQK
                     AITNMDGDSTNAISNLQSFQEELDQDFSHLEGKEAYLRKSGDDYFTNSFVDSKTGFKV
                     MTYLDDEILNENVSNGKTKLLLDGTREKESDTTDSRNEEQLEGGKKSSLFQGFEASLP
                     VVDKVIEKKKATHGLITEDKDKENTGDFLSLLVSDLPDFENEKQFDTDRISRSYSLKY
                     LKGLSENIIRTINLLLIKKDMIDDEVEAADKKLQEALKKSEKAKKKLKTAETNELQLD
                     NILSLVKERISFIEEYDLEVETSCSKDSENVEGKTDEKTPDNTEVHTNTNLNTREDNR
                     DDVTRKEEIKSSRISHSLNEKISSKRKSKQNKLQLFFDEELGKSKKGRTTLQHHYDSG
                     DNILTFKGAHANGVSCLDFDVPFGTLSTAGYLDPIVKVWDLTRKVQMATLNGHMATIT
                     CMQSSPHYSMLITGSKDATIKLWNLKLASQLYLEENADIGNSNQSCIHTFSSHLDELT
                     AISYDTINLVSGSQDKTIRQWDLLSGKCVQTIDLSFIKSRNNDFYSNQLLGEKPLVGA
                     IQCFDAALATGTKDGIVRLWDLRSGVPVRTLEGHTDAVTALKFDSSSIVTASSDKQVR
                     IWDLRTGTLSNAFALEKPITSLDFDSTSIICSTKTSNFQVFNKIENRHWNCGPTHDSE
                     QSGTSNEPSESNIITIRVKDNYTVAGSDDGTISAWRV"
     gene            <256951..>258606
                     /gene="TPHA0B01130"
                     /locus_tag="TPHA_0B01130"
                     /db_xref="GeneID:11535148"
     mRNA            <256951..>258606
                     /gene="TPHA0B01130"
                     /locus_tag="TPHA_0B01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684171.1"
                     /db_xref="GeneID:11535148"
     CDS             256951..258606
                     /gene="TPHA0B01130"
                     /locus_tag="TPHA_0B01130"
                     /inference="similar to DNA sequence:INSDC:YJL111W"
                     /note="similar to Saccharomyces cerevisiae CCT7 (YJL111W);
                     ancestral locus Anc_1.248"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684219.1"
                     /db_xref="GeneID:11535148"
                     /db_xref="GOA:G8BQI8"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012720"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:G8BQI8"
                     /translation="MNFGNRTPTIVVLKEGTDSSQGRGQIISNINACIAIQETLKPTL
                     GPLGSDILIVSSNQKTTISNDGATILKLLDVVHPAAKTLVDISRAQDAEVGDGTTSVT
                     ILAGELMKEAKPFLEEGISSHIIMKGYRKAVQLATAKINELAVDITSNNTDSRELLER
                     CARTAMTSKLIYSNADFFVKMVVDAVLSLNRDELDEKLIGIKKIAGGAMEESMFIDGV
                     AFQKTFSYAGFEQQPKRFTDPKVVCLNVELELKAEKDNAEVRVEHVEDYQSIVDAEWQ
                     IILDKLKQIEDTGASIVLSKLPIGDLATQYFADRNIFCAGRVSTDDMIRVIKAVGGSI
                     QSTTTEIQPEHLGTCKLFEEIQIGSERYNLFKGCPKAKTCTLLLRGGAEQVIAEVERS
                     LHDAIMIVKRALQNKFVVAGGGAIEMELSKHLRDYSKTIAGKQQLMINAFAKALEVIP
                     RQLCENAGFDAIDILNRLRMAHSNGEKWCGINFETEDIDDNFAKFVWEPALVKINALG
                     SATEATNLILSIDETIKNQESQSANAGMMPPQGAGRGRGMPMQ"
     gene            complement(<258872..>259486)
                     /gene="TPHA0B01140"
                     /locus_tag="TPHA_0B01140"
                     /db_xref="GeneID:11535022"
     mRNA            complement(<258872..>259486)
                     /gene="TPHA0B01140"
                     /locus_tag="TPHA_0B01140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684172.1"
                     /db_xref="GeneID:11535022"
     CDS             complement(258872..259486)
                     /gene="TPHA0B01140"
                     /locus_tag="TPHA_0B01140"
                     /inference="similar to DNA sequence:INSDC:YKR035W-A"
                     /note="similar to Saccharomyces cerevisiae DID2
                     (YKR035W-A); ancestral locus Anc_1.249"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684220.1"
                     /db_xref="GeneID:11535022"
                     /db_xref="GOA:G8BP55"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:G8BP55"
                     /translation="MMSRNPSAGLENTLFQLKFTAKQLQKQAQKASKDEKQEMNKLKK
                     ALNESEEIAKIYASNAIRKKNERLQLLKLASRIDSVASRVQTAVTMRKVSSSMAQVCK
                     GMDRALQSMNLQQITMVMDKFEQQFEDLDASVNVYEDMGVSSDAVIVDGDRVDELMNK
                     VADENGLELRQSARIDNLPEIEETETPSEEKEDKLAQRLKALRG"
     gene            complement(<259998..>262070)
                     /gene="TPHA0B01150"
                     /locus_tag="TPHA_0B01150"
                     /db_xref="GeneID:11534987"
     mRNA            complement(<259998..>262070)
                     /gene="TPHA0B01150"
                     /locus_tag="TPHA_0B01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684173.1"
                     /db_xref="GeneID:11534987"
     CDS             complement(259998..262070)
                     /gene="TPHA0B01150"
                     /locus_tag="TPHA_0B01150"
                     /inference="similar to DNA sequence:INSDC:YJL128C"
                     /note="similar to Saccharomyces cerevisiae PBS2 (YJL128C);
                     ancestral locus Anc_1.225"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684221.1"
                     /db_xref="GeneID:11534987"
                     /db_xref="GOA:G8BP56"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BP56"
                     /translation="MNEKFSKLSLNSEAATESTNPVASAIENNGSSGSLKKPMYSSSG
                     ANASSSSQYSNINANLQARVIAFQEQRVLKRSNSEKHVKTQNSSSSSPTESLSRKTSD
                     KRNSEMIMNRTSVLSGSNVTNVTTETTTIESQNIQQIINKPLPPLPPLNPPSSPEKSI
                     ASDVSKQVGDNLATMEKNTAKNIPSGKKPKLKLPTGSDLNPNRTAPRRPPSIIRPVPG
                     SPTTASPSITPNFNRKPSLMARRGLQLPGGGMSLKQLAKTPPENPKHQEFEPVPSNKH
                     LSTKSETAGQRSNPGSLLNAVPRTSTSSSTDDRTDTAGTNPELENSVNKNIAINSTGS
                     NSGGSSGSGGLFANFSKYVDIKSGSLNFAGKLSLTSKGINFNNGSSSNITLDELEYLG
                     ELGHGNYGNVSKVLYKPTNVIMAMKEVRLELDETKFRHILMELDVLHKCNSPYIVDFF
                     GAFFIEGAVYMCIEYMDGGSLDKIYDYSSDEKGIDEPQLAYITESVIRGLHELKEVHN
                     IIHRDVKPTNILCSASQGTIKLCDFGVSGNLVASLAKTNIGCQSYMAPERIRSLNPDK
                     STYSVQSDVWSLGLSILELALGDYPYPPETFDNIFSQLSAIVDGPPPKLPERFSPEAQ
                     EFVTLCLQKNPDRRPTYTQLLMHPWLLKYRDVDVNMKEYITERLEKRKETLVDTEVRK
                     PALHMGGL"
     gene            complement(<263016..>264194)
                     /gene="TPHA0B01160"
                     /locus_tag="TPHA_0B01160"
                     /db_xref="GeneID:11532801"
     mRNA            complement(<263016..>264194)
                     /gene="TPHA0B01160"
                     /locus_tag="TPHA_0B01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684174.1"
                     /db_xref="GeneID:11532801"
     CDS             complement(263016..264194)
                     /gene="TPHA0B01160"
                     /locus_tag="TPHA_0B01160"
                     /inference="similar to DNA sequence:INSDC:YJL125C"
                     /note="similar to Saccharomyces cerevisiae GCD14
                     (YJL125C); ancestral locus Anc_1.229"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684222.1"
                     /db_xref="GeneID:11532801"
                     /db_xref="GOA:G8BP57"
                     /db_xref="InterPro:IPR014816"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BP57"
                     /translation="MNSVFSEYKDFIQEGDLALAWISRNNIKAITIEKDGVFNTRYGS
                     FLHSGMIGKPYGSQIAIRTKGNNKFAFIHILQPTPELWTLSLPHRTQIVYTPDSSYIM
                     QRFNCGPNTRVIEAGTGSGSFSHAFARSSNHLFTFEFHEVRYEQALEEFQDHGLIGND
                     DAKSNEAFKNVTITHRDVCENGFTIKQTDKTSYKFAEGEDEVKINANVVFLDLPAPWN
                     AIPNLDQVISKNEKVGVCCFSPCIEQVDKTIESLIGNGWTEIEMVEIQGKQYEARRQM
                     ERTLDDALIRLKDIKSRKLEGVERRKRLLEETMNDISHEEKTEDKDSKRPSVAKTRYN
                     PFGKGQRIKEGDSNYSWLQVTKVESEIKSHTSYLTFAYKTISKERDVELVSKLIENSG
                     "
     gene            complement(<264835..>265308)
                     /gene="TPHA0B01170"
                     /locus_tag="TPHA_0B01170"
                     /db_xref="GeneID:11535000"
     mRNA            complement(<264835..>265308)
                     /gene="TPHA0B01170"
                     /locus_tag="TPHA_0B01170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684175.1"
                     /db_xref="GeneID:11535000"
     CDS             complement(264835..265308)
                     /gene="TPHA0B01170"
                     /locus_tag="TPHA_0B01170"
                     /inference="similar to DNA sequence:INSDC:YJL124C"
                     /note="similar to Saccharomyces cerevisiae LSM1 (YJL124C);
                     ancestral locus Anc_1.230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684223.1"
                     /db_xref="GeneID:11535000"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:G8BP58"
                     /translation="MMSQKKDSKKITEGEADLYLDQYNFTTTAAIVGSVDRKVFVLLR
                     DGRILFGVLRTFDQYANLILQYCVERIYFTEENKYAEELRGVFMVRGENVVMLGEVDI
                     DKEDKPLEMMEKIPFKEALKIQKEQNQQKCKLETQKSKDMAAYGLVHDFHKSDMY"
     gene            complement(<265794..>267122)
                     /gene="TPHA0B01180"
                     /locus_tag="TPHA_0B01180"
                     /db_xref="GeneID:11534806"
     mRNA            complement(<265794..>267122)
                     /gene="TPHA0B01180"
                     /locus_tag="TPHA_0B01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684176.1"
                     /db_xref="GeneID:11534806"
     CDS             complement(265794..267122)
                     /gene="TPHA0B01180"
                     /locus_tag="TPHA_0B01180"
                     /inference="similar to DNA sequence:INSDC:YJL123C"
                     /note="similar to Saccharomyces cerevisiae YJL123C;
                     ancestral locus Anc_1.232"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684224.1"
                     /db_xref="GeneID:11534806"
                     /db_xref="InterPro:IPR018814"
                     /db_xref="UniProtKB/TrEMBL:G8BP59"
                     /translation="MSKTSDADEVFEFLDSLPSKKDGGASTTEAKNAGKKDDDILDFL
                     DELEKSNINKATAKKEPAKEEPIAEQEPVKEQTPAKEEEQAQEQEPREDTPVNDPITS
                     ISNWWSSSGSTTVSNLWNRTTEQASHLQKKLAEEQKKLLDEQNIQLSASQLKGITSNI
                     SKFTDNLDASKFADLANKLQEIVVGETEEVLRIHLVHDFVNYPLLQYHVEEKFHSILN
                     SQVQGGIRIFVDEWTNPQEGKEPADESESDSKKRQLSIFNGKIIDGEKLAFANLDNAI
                     KLFNKSREAITKQQQQSATEDADDSTDPKEEKDLITDIFISIVAVSPPGDNKNDTIKT
                     TDCSSPGNFSFTVVLKDITNNITSITRSQGFPNKWAQWLEGSIETKSAAEAISEAKEK
                     KESSESNETASETEHTEVDQSEWVKEWVEDGLSLTFGTAAQNYIIERMGF"
     gene            <267707..>268222
                     /gene="TPHA0B01190"
                     /locus_tag="TPHA_0B01190"
                     /db_xref="GeneID:11534860"
     mRNA            <267707..>268222
                     /gene="TPHA0B01190"
                     /locus_tag="TPHA_0B01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684177.1"
                     /db_xref="GeneID:11534860"
     CDS             267707..268222
                     /gene="TPHA0B01190"
                     /locus_tag="TPHA_0B01190"
                     /inference="similar to DNA sequence:INSDC:YJL122W"
                     /note="similar to Saccharomyces cerevisiae ALB1 (YJL122W);
                     ancestral locus Anc_1.233"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684225.1"
                     /db_xref="GeneID:11534860"
                     /db_xref="GOA:G8BP60"
                     /db_xref="InterPro:IPR015218"
                     /db_xref="InterPro:IPR022784"
                     /db_xref="UniProtKB/TrEMBL:G8BP60"
                     /translation="MASKNSVNKPKLTVNVSKRNQHKANKRAQMEKNGEFQPSRSSGN
                     FVSNQVKSIPVQLYFKDESSLNSSNSNLSSATTTKTLSKKRAKKIARNLKYVQQRKLL
                     VDVQAKHENDMAIDADSVAKVERQKGNGKEKTVLARMKDALWNVLEDSSSQPLVLATG
                     QGTTLGGPSFP"
     gene            <268675..>269952
                     /gene="TPHA0B01200"
                     /locus_tag="TPHA_0B01200"
                     /db_xref="GeneID:11534715"
     mRNA            <268675..>269952
                     /gene="TPHA0B01200"
                     /locus_tag="TPHA_0B01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684178.1"
                     /db_xref="GeneID:11534715"
     CDS             268675..269952
                     /gene="TPHA0B01200"
                     /locus_tag="TPHA_0B01200"
                     /inference="similar to DNA sequence:INSDC:YKR048C"
                     /note="similar to Saccharomyces cerevisiae NAP1 (YKR048C);
                     ancestral locus Anc_1.235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684226.1"
                     /db_xref="GeneID:11534715"
                     /db_xref="GOA:G8BP61"
                     /db_xref="InterPro:IPR002164"
                     /db_xref="UniProtKB/TrEMBL:G8BP61"
                     /translation="MTDPIKTNKPKSSMKIENAPTPHNTPANNFDFLKNGNPMKKSGS
                     GNASAKQGAAQSVNEEDIKSALSANQPLLLQSIQEKLGSLVGADSGYLESLPKNVKDR
                     IFALKSIQEDLFQLEKDFQIELFDLEKKFIAKYKPLHDSRASIINGESKPTDEQIEKG
                     KELAAPEEEEEAEEEEDESLVGIPSFWLTALENLPIVADTITDRDAEVLDFLTNVRLE
                     YLDNGKPGFKLIFDFNAEENPFFTNSSITKTYYYQSELGYSGDFIYDHADGEEIDWVD
                     NESNVTVQIEKRKQRNKTTKQVRTIEKITPIESFFNFFDPPRMKEHIHNHGKGEECDD
                     EEDEEELADLEERLALDYSIGEQIKDKLIPRAVDWFTGSALEFEYDNEEMGDEDDNEE
                     DYDEDFDEDDFDEEEEDDFANTKKEQPPECKQS"
     gene            <270571..>271167
                     /gene="TPHA0B01210"
                     /locus_tag="TPHA_0B01210"
                     /db_xref="GeneID:11535019"
     mRNA            <270571..>271167
                     /gene="TPHA0B01210"
                     /locus_tag="TPHA_0B01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684179.1"
                     /db_xref="GeneID:11535019"
     CDS             270571..271167
                     /gene="TPHA0B01210"
                     /locus_tag="TPHA_0B01210"
                     /inference="similar to DNA sequence:INSDC:YKR046C"
                     /note="similar to Saccharomyces cerevisiae PET10
                     (YKR046C); ancestral locus Anc_1.236"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684227.1"
                     /db_xref="GeneID:11535019"
                     /db_xref="UniProtKB/TrEMBL:G8BP62"
                     /translation="MTKKHNSTTHTSATVTEKSYSSPTLHYIGDLSYVKDNKDNKVVE
                     KYTRLILDISLVQTVMKKISELNSKYKDANNKYYLILEQFVHLVDQLFFVVIIQNGIQ
                     QFNNVLVNEKNNKLGLWCIRWFYKDYLYTTLLLNLFYKQLFLSLKKEKYDVLINDLNK
                     KYSDKLSQNDNNLPKTIINTGIELGSTTIKKIRQTASI"
     gene            <271516..>272408
                     /gene="TPHA0B01220"
                     /locus_tag="TPHA_0B01220"
                     /db_xref="GeneID:11534717"
     mRNA            join(<271516..271549,271642..>272408)
                     /gene="TPHA0B01220"
                     /locus_tag="TPHA_0B01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684180.1"
                     /db_xref="GeneID:11534717"
     CDS             join(271516..271549,271642..272408)
                     /gene="TPHA0B01220"
                     /locus_tag="TPHA_0B01220"
                     /inference="similar to DNA sequence:INSDC:YKR045C"
                     /note="similar to Saccharomyces cerevisiae YKR045C;
                     ancestral locus Anc_1.237"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684228.1"
                     /db_xref="GeneID:11534717"
                     /db_xref="UniProtKB/TrEMBL:G8BP63"
                     /translation="MSSNTVNVNGQVKKNKLSVWVKKIMQAKDNNSSTIISAGNIESN
                     NAKPKIISNTPALPTVENGLEKSNSNMASEYDDAYTMNSSLRPLFDLESKYNNSNNNN
                     TNTSSQNENENENDRYDDHIMSSPTYNHRDKPSNTSNHSNKQKLQKLSWDERPKKDYT
                     IQGIDNASIQPLLSICSSSIKSSIFSDTNSLQSTKATITSARTQETNSSTIAIPPASI
                     LDRSRYSSSTNNNTNSNTGTSTNNSIRHPHLHRVNSNRTSASIMTIKS"
     gene            complement(<272584..>273921)
                     /gene="TPHA0B01230"
                     /locus_tag="TPHA_0B01230"
                     /db_xref="GeneID:11534989"
     mRNA            complement(<272584..>273921)
                     /gene="TPHA0B01230"
                     /locus_tag="TPHA_0B01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684181.1"
                     /db_xref="GeneID:11534989"
     CDS             complement(272584..273921)
                     /gene="TPHA0B01230"
                     /locus_tag="TPHA_0B01230"
                     /inference="similar to DNA sequence:INSDC:YKR044W"
                     /note="similar to Saccharomyces cerevisiae UIP5 (YKR044W);
                     ancestral locus Anc_1.239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684229.1"
                     /db_xref="GeneID:11534989"
                     /db_xref="GOA:G8BP64"
                     /db_xref="InterPro:IPR005052"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:G8BP64"
                     /translation="MNQNIHNISTANPPNLKLGGFVVFLFILFQIITQSYYGSSSVEV
                     VNDHFSFSNEGSHISKIFNLDASLSIPFLDKVNRFWHVGGEALIRNEKHIRLTSAGVR
                     NSHGVVLSNGIGDNVINDFEVIVEFQLTGKQSSNKGTSSSNMGEGMVFLITPENEFIR
                     KDFSTPQSREEYISASGGVVGHDTSMMGFPKNLPGLALVIDTFQNSKRSTSGASIPFM
                     DAMLNVNPLKDYYDRDSDGDASTSTSLKLNDHHIQLDDSIMKGDITKIRIIYLESISF
                     LKVDIQYAKEGDFWIELFHATEDVLIPKNAQTGQRFIGIGASNGRATENVDILNVQTN
                     EFHWDNHDESSEESFDYVKEVQKYLAAEYGQMISMEMDQYKRWKMIKAQPNYQSTREV
                     KTGSYFVSFILRSISFIILITVAYMASIFVRVNMKHKLNDMRRGQKIFGKLPE"
     gene            complement(<274472..>275125)
                     /gene="TPHA0B01240"
                     /locus_tag="TPHA_0B01240"
                     /db_xref="GeneID:11534781"
     mRNA            complement(<274472..>275125)
                     /gene="TPHA0B01240"
                     /locus_tag="TPHA_0B01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684182.1"
                     /db_xref="GeneID:11534781"
     CDS             complement(274472..275125)
                     /gene="TPHA0B01240"
                     /locus_tag="TPHA_0B01240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684230.1"
                     /db_xref="GeneID:11534781"
                     /db_xref="GOA:G8BP65"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:G8BP65"
                     /translation="MELESGNIDKTTDDSYNGVNNHDSRVQNNNASTIKLRRSGRTKH
                     KNNIPNTEEHESVEFAPEITLLSDEGFRKERGKQYRTRQLSTASMEDLPLSDLTKIKT
                     EDIDKSLVAELPDSQRSSVNSTVPPVPNNTGVPTSPKIQNTAQGDRIGSLQNNQANAK
                     VGRKRSKRLLRNSQRLSKLTKLEKVQLKKRGVCLRCRKGKHSLNNCPISISNRNISH"
     gene            complement(<275172..>275792)
                     /gene="TPHA0B01245"
                     /locus_tag="TPHA_0B01245"
                     /db_xref="GeneID:11535149"
     mRNA            complement(<275172..>275792)
                     /gene="TPHA0B01245"
                     /locus_tag="TPHA_0B01245"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684183.1"
                     /db_xref="GeneID:11535149"
     CDS             complement(275172..275792)
                     /gene="TPHA0B01245"
                     /locus_tag="TPHA_0B01245"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684231.1"
                     /db_xref="GeneID:11535149"
                     /db_xref="InterPro:IPR005162"
                     /db_xref="UniProtKB/TrEMBL:G8BP66"
                     /translation="MYIVAPNVSPKLLKINDLYDLRSMIFKVNLRNDNNPGLTNYKRI
                     CQVAQNFEGELLDWYIMFHEQNASILEEMTFDEFLEELKKFISTKPVMQQLYDNYYDV
                     DQCGSVEEYNAEFYRIIFFLSREYFTEISLISRYLNGLKKVVKEALINLSEQPSLLAE
                     VMNVAKTQETIVQNQIYQSYIIDTDIYREYQHMNHDKEQVSSTTKK"
     gene            278219..278290
                     /gene="TPHA0Btrna11D"
                     /locus_tag="TPHA_0Btrna11D"
                     /db_xref="GeneID:11534811"
     tRNA            278219..278290
                     /gene="TPHA0Btrna11D"
                     /locus_tag="TPHA_0Btrna11D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:11534811"
     gap             278306..278325
                     /estimated_length=20
     gene            278629..278700
                     /gene="TPHA0Btrna12D"
                     /locus_tag="TPHA_0Btrna12D"
                     /db_xref="GeneID:11534863"
     tRNA            278629..278700
                     /gene="TPHA0Btrna12D"
                     /locus_tag="TPHA_0Btrna12D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:11534863"
     gene            complement(<278851..>280035)
                     /gene="TPHA0B01250"
                     /locus_tag="TPHA_0B01250"
                     /db_xref="GeneID:11534944"
     mRNA            complement(<278851..>280035)
                     /gene="TPHA0B01250"
                     /locus_tag="TPHA_0B01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684184.1"
                     /db_xref="GeneID:11534944"
     CDS             complement(278851..280035)
                     /gene="TPHA0B01250"
                     /locus_tag="TPHA_0B01250"
                     /inference="similar to DNA sequence:INSDC:YJL110C,YKR034W"
                     /note="similar to Saccharomyces cerevisiae GZF3 (YJL110C)
                     and DAL80 (YKR034W); ancestral locus Anc_1.250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684232.1"
                     /db_xref="GeneID:11534944"
                     /db_xref="GOA:G8BP67"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:G8BP67"
                     /translation="MKVSSETREEVVLQSSDNSNLKFISDSGSMPHSSSYEDLDKPVC
                     NNCLTSKTPLWRRDEFGSILCNACGLFLKLHGKPRPVSLKTDVILKRNRIPSNARSSK
                     ADVKDDSDSSVCGTGTPGDGNKKRKNASISLDSSSRENNKIKNPTTAHDLRILNLMQM
                     ESIKPKLKPKLPRPSSGRTEFGTPSENHSRNNSYDSGTVSDLNSSENSSTDESHYNLT
                     VPQLNKQDTKIHLLPSAHQHNQKKKPEYYNQHNHHNHRNTANKLPGLQSLIRDVEKST
                     SNTSLYGDSRPQSEADYILNHPTKLVPNPKLTSDDTVVSNNTTLLMDTSGKPDSLLHL
                     RTVLQYEEEIIRLKSKINELESVKHLYKKHIDQLDKKCGDLEIKLRESDTATQNSIKE
                     II"
     gene            <281006..>283360
                     /gene="TPHA0B01260"
                     /locus_tag="TPHA_0B01260"
                     /db_xref="GeneID:11534722"
     mRNA            <281006..>283360
                     /gene="TPHA0B01260"
                     /locus_tag="TPHA_0B01260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684185.1"
                     /db_xref="GeneID:11534722"
     CDS             281006..283360
                     /gene="TPHA0B01260"
                     /locus_tag="TPHA_0B01260"
                     /inference="similar to DNA sequence:INSDC:YJL105W,YKR029C"
                     /note="similar to Saccharomyces cerevisiae SET4 (YJL105W)
                     and SET3 (YKR029C); ancestral locus Anc_1.256"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684233.1"
                     /db_xref="GeneID:11534722"
                     /db_xref="GOA:G8BP68"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:G8BP68"
                     /translation="MNASSKYEVEGSGENISLMEDASVLLMLSKNVPKNDKQSVDDIK
                     KTNASSDDNMKRVISNNESLIKGEVEVKRQKLDNGDELKENNEKKEKVWPVSDDYIVD
                     PDAGVITCICGFDDDDGFSIQCDHCFRWQHAVCYGIYDNENVPEIYLCDVCEPRNVDK
                     EKAKKIQLQRFTNQEVPVNETYEDEDTGKHDTINILTSENGYIRKHTKPEAVNNDNKE
                     VQESDVESINMESKSNKEESNNSDENDGKDRSRNIKEHIRTPTRNTRSRNDAIQNQGR
                     IQSNDINDQNADITDTTVQSKKKQEVFYLSAKSSYEAMYLPMKKFSVQNNYVTLFLEK
                     HLNDDVVTEVENATDFKNMPIEVKSYVESSYLRTFPGFTKLGVYLNKDCEEGKLIHDI
                     TGDVNFKSNYIRDPGSYYRVWGTSKPKIFFHPTWPLYIDTRLSGNSTRYIRRSCNPNV
                     EIATIKTLNNKTKDYEIKFMLKAKRDIEEDEELHLPWDWDKKHIIWKIINNSSNPTHI
                     LENLKDSDKYLLLNSIDTILRSCDCACGNNSKECFLLIIKKFQQSLIKAIRSKMSNRY
                     KINEILNRYQGKRRRPPPILQRLQDENIINQEKSLYLLNEFNTQKLRFLEGQDASSTN
                     LSSKLYNAKKGKNFLDSNDRSMDSISSMIEKDFNKPFKWKILHNKLDEQSRRKSTSKD
                     IDSNLISNFTEYNETQITNLEDLPIIIDLKINQTKVNYIVESRKSVVNNNENISLIPG
                     SSLAPDIELKAVSEAVNNYSAGNETDPLESLISATTQVKPSKKN"
     gene            complement(<283532..>285754)
                     /gene="TPHA0B01270"
                     /locus_tag="TPHA_0B01270"
                     /db_xref="GeneID:11535034"
     mRNA            complement(<283532..>285754)
                     /gene="TPHA0B01270"
                     /locus_tag="TPHA_0B01270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684186.1"
                     /db_xref="GeneID:11535034"
     CDS             complement(283532..285754)
                     /gene="TPHA0B01270"
                     /locus_tag="TPHA_0B01270"
                     /inference="similar to DNA sequence:INSDC:YKR024C"
                     /note="similar to Saccharomyces cerevisiae DBP7 (YKR024C);
                     ancestral locus Anc_1.261"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684234.1"
                     /db_xref="GeneID:11535034"
                     /db_xref="GOA:G8BP69"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BP69"
                     /translation="MSDDDGMLLNFTMSDEPNVAISKRATVTSGTWKERRMMKMKLEG
                     KEPKKRSNGKDDGSNRRNKRRDVAVDDLEMTNDAKATWESFSGESGASDNQKGKQKKD
                     GPSNVIPAHISSQVVTSLFTSNRKIDTLKNINQKNEDEETNPSNAPLIADDFESSGVS
                     DILVKHLHEKLKIDKPTSIQKLVLPQLLSNNNEDLFIHAQTGSGKTLAFLLPILSRIL
                     NMKTRVDRKSGCFAIIIIPTRELAQQIYQVLISLTGCCHYLVPCLLIGGESKKSEKAR
                     LRKGCNFIIGTPGRVLDHFQNTESVKTQLGKSLRYLLFDEGDKLMELGFEETLSQILS
                     LIHSIPIDTSAFPSLPSRIVNILSSATTKGDVTKLGNVALKNYKMISNGKMDNNALTS
                     VPDQLVQSITIVPPKLRLVTLGAYLDSLCKKHKQQKTKDASHVSRTIIFLSCADNVDF
                     HYEVFSSSDSHHGNLVGDSVRILTKGNTIFPSVDPEINPDVICYKLHGSLTQQMRTST
                     LQHFSKESETVAGKHLIMFCTDVASRGLDLPQVGTVIELDPPFAVEDHLHRIGRTARA
                     GKSGESLLFLLPGEEEGYMEYIKPYHPKGWKMLNYTDDILKPTFQNAAVSRNDKSKAR
                     NSDEWDINATTWHLNLERRLLEDNYMKELAVKAYISHTRAYATHISKEKKFFNIKFVH
                     LGHLAKSFGLRERPRTMGFQTAKHEEAESKKAKRENPKNKMFRLAREAQKQSFSEFNY
                     "
     gene            <286287..>287114
                     /gene="TPHA0B01280"
                     /locus_tag="TPHA_0B01280"
                     /db_xref="GeneID:11535003"
     mRNA            <286287..>287114
                     /gene="TPHA0B01280"
                     /locus_tag="TPHA_0B01280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684187.1"
                     /db_xref="GeneID:11535003"
     CDS             286287..287114
                     /gene="TPHA0B01280"
                     /locus_tag="TPHA_0B01280"
                     /inference="similar to DNA sequence:INSDC:YKR025W"
                     /note="similar to Saccharomyces cerevisiae RPC37
                     (YKR025W); ancestral locus Anc_1.262"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684235.1"
                     /db_xref="GeneID:11535003"
                     /db_xref="GOA:G8BP70"
                     /db_xref="InterPro:IPR006886"
                     /db_xref="UniProtKB/TrEMBL:G8BP70"
                     /translation="MDSGNKLFVTDEGEDINVDQEQIVALETESRETNSKMDVDDEAK
                     GEDEKGSAQPYEDDADPVVSEIPLNLLGTSKDLHVFQYVNRTKISGRKPLKLPAAGKV
                     RYQENSSMWELDIPLDDSIFFNKEKINKDWEANDYQTLRGVGVPNAGQYAGFESNGQM
                     YLVPVNSVAQLRPYFKYIDDSNYKKKQDDIKQQTSNVPQRAHVVTMSVKSVSEQQQNR
                     LTGSLMAHKILDEEEPLNLEWDRSENGIKLKEDIIEEMKKHRLKAVCTEEQYLSNLV"
     gene            complement(<287417..>288367)
                     /gene="TPHA0B01290"
                     /locus_tag="TPHA_0B01290"
                     /db_xref="GeneID:11535099"
     mRNA            complement(<287417..>288367)
                     /gene="TPHA0B01290"
                     /locus_tag="TPHA_0B01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684188.1"
                     /db_xref="GeneID:11535099"
     CDS             complement(287417..288367)
                     /gene="TPHA0B01290"
                     /locus_tag="TPHA_0B01290"
                     /inference="similar to DNA sequence:INSDC:YKR026C"
                     /note="similar to Saccharomyces cerevisiae GCN3 (YKR026C);
                     ancestral locus Anc_1.263"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684236.1"
                     /db_xref="GeneID:11535099"
                     /db_xref="GOA:G8BP71"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:G8BP71"
                     /translation="MSEFNITETYLGFLEEDTEVTMPIAAIEALVTLLTVKNPETAAE
                     MINSIKSATEELINSIPNSMSLRAGCDVFMRFVLKNTQLYGDWESCKRHLIENGQLFV
                     SRSKQSRDKIAKIGKDFITDDDTILLHGHSRAVFSLLSHAAENFIRFRCVITESRPSD
                     QGIRCYNALKAKGIPVTMIVDSAVGSIIHRIDKVFVGAEGVTESGGIVNIIGTYSIGV
                     LAKIARKPFFVVSESHKFVRMFPLSPDDLPLVGDSLNFNRSDNAIAANTDKLEDNDFD
                     ITQGRKTDYTSQDYITALITDLGVLTPSAVSEELIKMWYD"
     gene            <288840..>289502
                     /gene="TPHA0B01300"
                     /locus_tag="TPHA_0B01300"
                     /db_xref="GeneID:11535030"
     mRNA            <288840..>289502
                     /gene="TPHA0B01300"
                     /locus_tag="TPHA_0B01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684189.1"
                     /db_xref="GeneID:11535030"
     CDS             288840..289502
                     /gene="TPHA0B01300"
                     /locus_tag="TPHA_0B01300"
                     /inference="similar to DNA sequence:INSDC:YJL097W"
                     /note="similar to Saccharomyces cerevisiae PHS1 (YJL097W);
                     ancestral locus Anc_1.269"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684237.1"
                     /db_xref="GeneID:11535030"
                     /db_xref="InterPro:IPR007482"
                     /db_xref="UniProtKB/TrEMBL:G8BP72"
                     /translation="MAKKLISCTSPLALYNLFSALAWGSILFYVVFVYNFVGQPDFFI
                     KSNKLVIFVQCGAIIEIFNSLFGIVRSPLFTTVAQVASRLLVVIGVFYLLPETPACHD
                     FVYVTLLFAWSLTETVRYLFYFYQLTTEKGAPTFLLLLRYNLFIVLYPLGVTSELVII
                     YSSLAVAERLYSTTYKYTLIFSMLTYMPGLPMLFTHMVVQRSKIMQAYYEEQEASSKK
                     KE"
     gene            <290113..>293373
                     /gene="TPHA0B01310"
                     /locus_tag="TPHA_0B01310"
                     /db_xref="GeneID:11535054"
     mRNA            <290113..>293373
                     /gene="TPHA0B01310"
                     /locus_tag="TPHA_0B01310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684190.1"
                     /db_xref="GeneID:11535054"
     CDS             290113..293373
                     /gene="TPHA0B01310"
                     /locus_tag="TPHA_0B01310"
                     /inference="similar to DNA sequence:INSDC:YJL092W"
                     /note="similar to Saccharomyces cerevisiae SRS2 (YJL092W);
                     ancestral locus Anc_1.274"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684238.1"
                     /db_xref="GeneID:11535054"
                     /db_xref="GOA:G8BP73"
                     /db_xref="InterPro:IPR000212"
                     /db_xref="InterPro:IPR013986"
                     /db_xref="InterPro:IPR014016"
                     /db_xref="InterPro:IPR014017"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BP73"
                     /translation="MPNNEDAILENIISSLNKYQEIAVKFDYNQALQVIAGPGTGKTK
                     VLTSRVAYMLLKHKIRPQNIIVTTFTNKAAKEMIDRLASLLKETDIKVSDLMIGTFHS
                     ICMKILTRFGSRIGLPNGWRIADEKEVETIVTDLVKRVPDQIRDYANSRTRKVNLCVP
                     SKNNSDEWVLNAKVIKKIIEKLKTDAIIPESYFKLDEHDPALAYFYKAYQEELQKLNA
                     LDFDDLLMFAFILLSKERCLPNIRHVLVDEFQDTNGIQIDLMYLLAKGNHHQSRGVTV
                     VGDPDQSIYAFRNALSHNFNVMSERCPIQISQVILEENYRSSQKILDTSEVLISQQTK
                     GRTKRVPLKAQFDIDFPPVYMKFPTNFLQAPSLIREMLYLKSLPSLFTYNDFAILVRQ
                     RRQIKNLEKALIENRIPYKIIKGHAFWEAKEVISMLALIKCVYSDNDKSSIISSLLYP
                     SKGLGQVSADRIKSKIEESGNLAPFLVLKMIGSGELTCDVPDKSVKVVKNFISLIEEC
                     RGMLNSPSSSLYINLFNKLYEKSGLKHEYLYVDGKKKSEVNDDDEPNEMNPRHQNILL
                     LRDYFTGNKNSNSTDPSNFKINQQVLSPHEYIREFFNGLSLNTVDNNQEIETEEERFK
                     RELLDREGYVTISTIHSSKGLEWPVVFIPGCDDGIIPCIFNDDTKGASSDSDDDDDDD
                     DHKNGKNKKKSKVNSTDENENEERRMFFVAQTRAKFLLYLSSVESMDEQFPSKASRFL
                     TPGLLATMADDQRVFASIENIKQLYLAMKNNMSIPEQFSLSTLVKDYNKFVENRREFF
                     YWNENIVRDIMRLDLKTNSVDIKSNPFTTAAFQLGLDNKPSNKVRKNQYSPKGKERIK
                     VNKSPGKVYAPGNDISPFKSTYSKKTTFAPQYTPSRTIFELEQNTNPKFAPKVKNNTQ
                     SSKPVLNKKTSPKRRLFVSDSNARVSSNLGHDMSASVKSNPDVTSKVSSTSIRATSKV
                     GRKICVSAINIDDNVPLTSQKLEYTSESNSIIDTTAAELLHNPNDSSIDNRPIIASAK
                     ILADAVKKSKSTNEGKSGRKPKVKQELNASQFDIFTQLSKAKKKAKGNNSEIIIID"
     gene            complement(<293509..>295770)
                     /gene="TPHA0B01320"
                     /locus_tag="TPHA_0B01320"
                     /db_xref="GeneID:11534996"
     mRNA            complement(<293509..>295770)
                     /gene="TPHA0B01320"
                     /locus_tag="TPHA_0B01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684191.1"
                     /db_xref="GeneID:11534996"
     CDS             complement(293509..295770)
                     /gene="TPHA0B01320"
                     /locus_tag="TPHA_0B01320"
                     /inference="similar to DNA sequence:INSDC:YJL090C"
                     /note="similar to Saccharomyces cerevisiae DPB11
                     (YJL090C); ancestral locus Anc_1.276"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684239.1"
                     /db_xref="GeneID:11534996"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:G8BP74"
                     /translation="MKPFHGITFCPTAIQAEEASRLISKQIIKLGGNFSKDLTKYVNV
                     LVIGQSKNTEKYKFAVKYRADIIFINVATLNQIYQLWLSGDDVTLENHSNFEHLKGDG
                     RLKARMMAVLQAKYSIPPLENFRVFIGRISQKLKFPDDKPATAELPKILDLEKVCTKL
                     GVASCNSNNFIKDCRSTTSSPAVFITDNPQGARVDAARSQGLAIIHYKWLLDCLKRNA
                     MLQFDPYYLLDNVLNSLYDDIGSNACECWDKIGDYNLMKTRNKDVDNINKDSDTGDST
                     IITSTMLNKFKTEGNKLWNKVISNNLSQGTNMEKNKPIIHNGIDQKIALRADTGRCFD
                     KYKFHIHNSFSEKHQRILEKVIQQNDGTIIEDMPDSNIDETVFIIIPCDRSIEELGVS
                     SNSNLVTEFFVERCLHYKKLLLPLDSWSKPFLLTKEFEIKPNKKLLHSENLHLNVSIT
                     GFHGVELLHLTKIFDILKPMGINYMKYLNRTTDLLIINLSSLPSIPEDHVLWKNEYSD
                     LFIEDHKTNQEKNNKQVFRNSMKKKIEFIKEEHSIPVVTPVFLLEMFHKANEVSDAEI
                     GQLIHLNNMNWCIMCPRGKKDDFSCTIKQKSKLNTVDSVSDLFQVKNDFTYPSIKSSK
                     DEFLNKLKAYSPNKPSDVKINSHFLKQDPLPSKVSLEMDSTPSIKRQKLSPSKSIEPV
                     KRLASWGKLMSDKDPVENNQLNHIKISSKDEKDDDSNSAFSYGHTQVTYGVSETSNKN
                     VKKLTRKHMKNID"
     gene            <296334..>297851
                     /gene="TPHA0B01330"
                     /locus_tag="TPHA_0B01330"
                     /db_xref="GeneID:11534753"
     mRNA            <296334..>297851
                     /gene="TPHA0B01330"
                     /locus_tag="TPHA_0B01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684192.1"
                     /db_xref="GeneID:11534753"
     CDS             296334..297851
                     /gene="TPHA0B01330"
                     /locus_tag="TPHA_0B01330"
                     /inference="similar to DNA sequence:INSDC:YPR045C"
                     /note="similar to Saccharomyces cerevisiae YPR045C;
                     ancestral locus Anc_7.471"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684240.1"
                     /db_xref="GeneID:11534753"
                     /db_xref="InterPro:IPR005062"
                     /db_xref="UniProtKB/TrEMBL:G8BP75"
                     /translation="MSNSYNSVAPFKLGSARSRKKDDSSNNNKTATANNLDDSEDGYN
                     VIDILPLSNSSKSATNEINMKNKINSDNLNNNTAPNQNNFPFAFQPQNMGQVPFNPYL
                     LPNISNNIPANPQLPFITPNFISNLVPTSSGTMNDIGLNQKRPKRTNHNMNSNIKNRN
                     SIESNKNNGSSIKGSMDLFMNDTERRRKRAEKFNTPTKTVNKKIDIVDNFNDLNAISS
                     KSEMYDKNKKIVGCCQTLEKSYLRLTSEPDPNLVRPLTILKKHFANLEKLNKKGTTTY
                     KYLCDQLKAIRQDLRVQMIENQFTVKIYQEHARIALENGDIGEFNQCLSRLYTLFEKP
                     NIKTSCIEEFTTYRILYYILTENYAQITALKLDLLKNKLAVHNNFVVQIAFLMAEAHI
                     VNNYNEFMELAALLDGRAQSLINIFIDKTRMKALLSICKAYNQISIDFLIKELRFSNY
                     EDIERFFTKNKLSQHIVVRNEGQENEFRYLESKNCRAYLAQFYSSFRKIEIKGQK"
     gene            complement(<298110..>299045)
                     /gene="TPHA0B01340"
                     /locus_tag="TPHA_0B01340"
                     /db_xref="GeneID:11534818"
     mRNA            complement(<298110..>299045)
                     /gene="TPHA0B01340"
                     /locus_tag="TPHA_0B01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684193.1"
                     /db_xref="GeneID:11534818"
     CDS             complement(298110..299045)
                     /gene="TPHA0B01340"
                     /locus_tag="TPHA_0B01340"
                     /note="ancestral locus Anc_7.469"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684241.1"
                     /db_xref="GeneID:11534818"
                     /db_xref="GOA:G8BP76"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:G8BP76"
                     /translation="MISIEENGFCLVRSISSIGTGLVPMDYLDENVELSKSLGLPPIF
                     TKNKPLVSITPPTSPMTIISKNFSIASISRSKTISQSNLKGGSTVDKIDEDNRDHVNT
                     FLSAIEYCKLTHIESKENRLLYHLAVRSSSTHKEYTSERYYESFYRLHSMIAELAPPS
                     LKIPRLPIPHCCTNNMKPDSYLDSNRMTTLNNYLTELVNVIVNCTSPILRQLLFVWLT
                     KDTVELLDYRLMMIKVRYNNQYFAINCKDNEIAVLKELKEVIKKRIPGIPEEETYKIK
                     ANLDGWYIVELSNDDIYQQAFIKGWQVKFLDLEIE"
     gene            complement(<300788..>301876)
                     /gene="TPHA0B01350"
                     /locus_tag="TPHA_0B01350"
                     /db_xref="GeneID:11535086"
     mRNA            complement(<300788..>301876)
                     /gene="TPHA0B01350"
                     /locus_tag="TPHA_0B01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684194.1"
                     /db_xref="GeneID:11535086"
     CDS             complement(300788..301876)
                     /gene="TPHA0B01350"
                     /locus_tag="TPHA_0B01350"
                     /inference="similar to DNA sequence:INSDC:YJR095W"
                     /note="similar to Saccharomyces cerevisiae SFC1 (YJR095W);
                     ancestral locus Anc_7.467"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684242.1"
                     /db_xref="GeneID:11535086"
                     /db_xref="GOA:G8BP77"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8BP77"
                     /translation="MSQKKNVSSPAINLVAGGTAGLFEALCCHPLDTIKVRMQIHKKI
                     SLGNIKNPGFLKTGSNIYRNEGFIALYKGLGAVVIGIIPKMAIRFSSYEQYRSLLTDK
                     STGKLSTGNTFIAGVGAGITEAVIVVNPMEVVKIRLQAQHLAAPVKQMAQTVASPVTL
                     AATSEGIVQTSAATTATAGAATSAATTTAATNAAPRYKNAIHAAYTIVKEEGAGTLYR
                     GVSLTAARQATNQGANFTVYSKLKEYLTKKQNTEVLPSWQTSSIGLVSGAIGPFSNAP
                     LDTIKTRLQKDKSVSKIKTSSWKKIYDIGVQLVKEEGVAALYKGITPRVMRVAPGQAV
                     TFTVYEFVRKRLEDSGVLTSKPKQMKNI"
     gene            <303332..>303997
                     /gene="TPHA0B01360"
                     /locus_tag="TPHA_0B01360"
                     /db_xref="GeneID:11535100"
     mRNA            <303332..>303997
                     /gene="TPHA0B01360"
                     /locus_tag="TPHA_0B01360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684195.1"
                     /db_xref="GeneID:11535100"
     CDS             303332..303997
                     /gene="TPHA0B01360"
                     /locus_tag="TPHA_0B01360"
                     /inference="similar to DNA sequence:INSDC:YJR094C"
                     /note="similar to Saccharomyces cerevisiae IME1 (YJR094C);
                     ancestral locus Anc_7.465"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684243.1"
                     /db_xref="GeneID:11535100"
                     /db_xref="UniProtKB/TrEMBL:G8BP78"
                     /translation="MKPPGSAIIRKYLNIDKLEDSLSLLGCSKEISRGGSSHLELDIS
                     FDQNDESFDVYLDLFDNDFSISSDFDTSGIIDTNNHKKDNNDNNDSNNKNRTKKRNYY
                     DLINSSYITGNNTNLLYNNKSVTCEFHSENSSAPSYLKLSAIENENPLTINNEKVLPK
                     RNRKKKKTDKVDLQFVKLITEKLNRYDSRNLIMNNKYNDDLDYFDKVRFQEILYKFSK
                     TYF"
     gene            complement(<304248..>308387)
                     /gene="TPHA0B01370"
                     /locus_tag="TPHA_0B01370"
                     /db_xref="GeneID:11535025"
     mRNA            complement(<304248..>308387)
                     /gene="TPHA0B01370"
                     /locus_tag="TPHA_0B01370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684196.1"
                     /db_xref="GeneID:11535025"
     CDS             complement(304248..308387)
                     /gene="TPHA0B01370"
                     /locus_tag="TPHA_0B01370"
                     /inference="similar to DNA sequence:INSDC:YJR092W"
                     /note="similar to Saccharomyces cerevisiae BUD4 (YJR092W);
                     ancestral locus Anc_7.463"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684244.1"
                     /db_xref="GeneID:11535025"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR012966"
                     /db_xref="UniProtKB/TrEMBL:G8BP79"
                     /translation="MDANDVTDAMDSLLKEIDNEMENTIDELSFSTVNNELNMHEFSM
                     PLNEIGDDTMDMLVKHNTLSNIKNVLIDVNDGDDKTSTFESKKPMVLVYTNNKRKSIS
                     FEDEIEELEIQNNDESSEELLIDMSVDNSSKLPFINTVDINQFASKKDNANATLNEEV
                     NKVLIDTSLDDSEISQLNTTIENDQISLVAGSLSQIYNDENKTYDKDQRVNNQVFSAE
                     LNSKGHEDNSNVGNNNIRTEQIDNESENEKSELDKDITEAAADFEPIMEAHTKETEVQ
                     EVSSIKGIQDASSLSSESIGDLDIATIPKDELELKDMNLDKSLNIQDEELENLSEQED
                     SINEPESMDENLELPSESNKIETREMQDSEAVPRINDVTEQNSSIILEKDNGVLKAEN
                     KADLISQKSVSDHELESNIDNNQTSIDYGTAIEGKLTDIESNINPIESKPGLKQGTDE
                     EILDSNMSDVNADINSSESEFILKEKSTSTASIARTSTLTKDEEIRGSVESEKPTIKE
                     TRMLNNYGIAAETSNLVDEPEITIDEGKPSSTKTSNESNPNISYNEESHENIISKLPE
                     LPKIEKMFVEDTFTDLFETSNTSVDMDNVISSNDYLSIWHLQEDTLKVKPSPATDANS
                     QFSSRTPSSGSSVQSSAASRQSSSTFKYKPRLVSRSRIYNPESRQSSFKLEEEMFIAN
                     LSGSLDPVRRKVSNSRVLQNKMKQNRKSYDTSHSRALSYSDVETFKTANETANDVLHY
                     DNLLPGAFVNEYTTNNSEHLIFEESITPNKINDTYMVLGNSFDFLPAILDEKINDGDD
                     SNNSDSNSVYQSSLLDVYEMNKTSNNKYGLWESEYDIKSQISHDHKSLSSEMLSKILS
                     TASNRVVSQVTTEKTVKRALENNIHVNHGINTFGIDVDVSGEQTETLSIDEDEINHIL
                     EARTVSVAELKAASGKPTNSNDILTSMHIGSPFKVIKTGKFQSFNEVQNKPDLHILTE
                     KLKHVEQDNEKIQEPLQLEKPKDIELVDNSPGRHPKEAVQQKAQLSDLGSAYITLKDI
                     SVLNLPGIKHHQATYCIEFDNGINVIKTKWQEMSVTGKMQLSENFESIVKQLGTNIIL
                     TLKLKYKKPEFEIAEVTQKVPVNKKSLFGKKSYTYEKKYIQRPTKVHDEWDSLVATDG
                     SYGKAEIKIDEELLEKVKFSRHILSFDLINEWSKKASKAHNSSANATRLPAYKVGKIS
                     LDICYLERVDNLEKFPTSLEKCNKIVSKYQEQQLITKEGYLLQEGGDVANVLTRRYFK
                     LRGSSLIGYHVASMQPVVTINLLNVKSILNGNESVTNGNGQHDKGDEANIKRNFTDQI
                     LFSGSIQIVFNDDEVINLNTDTSSVDKDDWFMKFQRAIELNICHQPWVKKYYQKNYEQ
                     K"
     gene            <309332..>312799
                     /gene="TPHA0B01380"
                     /locus_tag="TPHA_0B01380"
                     /db_xref="GeneID:11534984"
     mRNA            <309332..>312799
                     /gene="TPHA0B01380"
                     /locus_tag="TPHA_0B01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684197.1"
                     /db_xref="GeneID:11534984"
     CDS             309332..312799
                     /gene="TPHA0B01380"
                     /locus_tag="TPHA_0B01380"
                     /inference="similar to DNA sequence:INSDC:YJR091C,YPR042C"
                     /note="similar to Saccharomyces cerevisiae JSN1 (YJR091C)
                     and PUF2 (YPR042C); ancestral locus Anc_7.462"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684245.1"
                     /db_xref="GeneID:11534984"
                     /db_xref="GOA:G8BP80"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BP80"
                     /translation="MENYSSSYLNNNHANKSGNENGNILNGNENVNTSFIPGVINPGV
                     TIPIFEDSESINFNNEQTYTNTQGHRANSNNDFNSNSYQTINSLSDHSNSEQEHDINQ
                     MENGEQSQKLGIYRTRTEKLSNTLSNLLPSISARLHSSSKKKNKNKNQNDEFVDLRDL
                     QVNLPFPKNNINSDFISNKSEYNKNMKNKQFREKLFSFTKNSNEQIGDATKITTINGI
                     TINNDGAPYIISSAAQDYDYDSLINLPDATSFFMDQQSSATNNKLSTSGMENLHQPRV
                     SLDSFNLLPPNISRSRHNTISSKISNISSNVQPQQHNQTSTLWLGNNNSNATGTINNG
                     DDIHLDNNNINLGRNRAPSNASSVYIDAAAFEQKYKKKEPSIHSFDTGNGIIQNIDNV
                     DTFSDNISAINRVMNQAVPLVADDIDPISINWVTMDTSVPLINQISNLLPTDTISISN
                     VFSLQKQQIQFTNAVNLTSTSLVTLCSKFGEVKSARTLSGFNMALVEFSNVASAVRAL
                     EHLQGKEVSMIGAPSTVCFAKILPMNHQQQQQQQFVIPSNVNGNDHANRPLLHDQLYN
                     GSLTFQQQGNLSVPLFNPNNGFNQSSNNTLGVNSINNTNGSSEHNHHENNVVSSNENE
                     VCPFALPLPSFKEETQNLNKMIDSLGVPYDKSKVDHIMSKTITTKVATDTSNFGMLPS
                     HMNSKDFDASKLRELRKIMEANEMSNLEIEQLAMVMLDELPELSSDYLGNTIVQKLFE
                     HSSDIIKDIMLRKTYKYLSSMGVHKNGTWACQKMIKLSDTPRQKYLVSQGVKEYCTSL
                     FNDQFGNYVIQCVLKFGFLWNNFVFEAILANFWILVQNRYGARAVRACVEADKYVKQE
                     QILILSAYIVLYSHYLTTNSNATLLVTWFLDSSSIPQRYSILAAKLSENIVKLATHKL
                     ASLTLLKILTYRGDDNSRNIIMTAIFGDKHNEEPTDELFRILSDTDTGMTFIHKVLSM
                     TTLDTELRSHAVKMTRKIILDNSTMQQNRRLLEEVSLTAMNSKSIPGQIRSYSTISHN
                     NSDINHLRQQSISSGISTGSRQTSNHISSHVPQLNVSQSIQTNSPPNVGYFNYPGNFI
                     GSFSNMFGGNGNAVNFNNGDDLISQLDMLALDNGEVVLPKLSLSNYNSDGTISTQSNA
                     IDNKNYMNE"
     gene            complement(<313019..>315697)
                     /gene="TPHA0B01390"
                     /locus_tag="TPHA_0B01390"
                     /db_xref="GeneID:11534706"
     mRNA            complement(<313019..>315697)
                     /gene="TPHA0B01390"
                     /locus_tag="TPHA_0B01390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684198.1"
                     /db_xref="GeneID:11534706"
     CDS             complement(313019..315697)
                     /gene="TPHA0B01390"
                     /locus_tag="TPHA_0B01390"
                     /inference="similar to DNA sequence:INSDC:YJR089W"
                     /note="similar to Saccharomyces cerevisiae BIR1 (YJR089W);
                     ancestral locus Anc_7.460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684246.1"
                     /db_xref="GeneID:11534706"
                     /db_xref="InterPro:IPR001370"
                     /db_xref="UniProtKB/TrEMBL:G8BP81"
                     /translation="MLMSDDNRNLMHNLETRIKSFESSVTINKKKVRWRFTVIPGKSL
                     ARLGFYYSPCKNKDTNKLDNSAITCVYCKKILFNIASCKSKKRNTLETIINILQAHLT
                     TNEDTNCLSAHLRLLLMKRYQLSKNKLISNVDWKNDKFFNDPLSIETLEFRKFTYNND
                     WKYNDKDVQNLSITKLAEAGLMLYDRFLTNFEEDTTVEDIDDVNGDFCYCIYCNNIIG
                     SWQEDDDPLEEHFKSSKGPSCYFFKCLESSNQHKSIVEELRKKHKVTNNDERYSDDEK
                     LLESVAPAKKKIKLTKRTTKMLSNSSEEEEALAITKEPDTSLIINVKEHIKRGKIQQK
                     ELKNKILDDSVDDLSFSNVGNESFSLPAPISPSKILQNESSPSHPLKGKTSMTFNALL
                     KSPLVSPSKSSSSFNESLHISKRIRKHASTVIQVPNLEDINLSYSLSSDEYTSSSDLS
                     TVSTPINSPSKSKIKDNSLEGASDRFSIEPVDLKNDHNTNILTKEVEKVISVSSFQIK
                     NSKNYHNNVKEYSSLSEDSDVNISLVDTGKLILETKVKSKESNSTSKEESSNAHGDKN
                     NGQAQYSDRDRNTDQKLNVNNSLRLKEDTIENENRSNNSIDKDTGPDLNKVKDIILMD
                     DDLHDISNIELDLNHSTPKVTKKDILISDIKQPRILEHDTKYSQSPSEKSNKPFNTQS
                     QTKLPSPIKYIHEQSTPLLTKTSDKNMDKHHISSLSVSNSPDINFTKSLILEEGSRLD
                     NISDNDHPATIKNITNEEDVQKSVEVPIISKNFSKGTIETYSKITNHDKDFEIVKEYF
                     QSLLKYVNVNDAHLANDINGDLRFFYNQIPKEELELTFDSWIDLKLATIREDFNKRTE
                     QKLTIMKDEFRHIKQKIDSCDDDATLLEISKQFGIL"
     gene            complement(<316365..>317576)
                     /gene="TPHA0B01400"
                     /locus_tag="TPHA_0B01400"
                     /db_xref="GeneID:11535129"
     mRNA            complement(<316365..>317576)
                     /gene="TPHA0B01400"
                     /locus_tag="TPHA_0B01400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684199.1"
                     /db_xref="GeneID:11535129"
     CDS             complement(316365..317576)
                     /gene="TPHA0B01400"
                     /locus_tag="TPHA_0B01400"
                     /inference="similar to DNA sequence:INSDC:YPR041W"
                     /note="similar to Saccharomyces cerevisiae TIF5 (YPR041W);
                     ancestral locus Anc_7.459"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684247.1"
                     /db_xref="GeneID:11535129"
                     /db_xref="GOA:G8BP82"
                     /db_xref="InterPro:IPR002735"
                     /db_xref="InterPro:IPR003307"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016189"
                     /db_xref="InterPro:IPR016190"
                     /db_xref="UniProtKB/TrEMBL:G8BP82"
                     /translation="MSINICRDNLDPFYRYKMPPIQAKVEGRGNGIKTAVLNVADVAR
                     ALNRPAPYIIKYFGFELGAQTSISVDKDRYLVNGVHEPAKLQDILDGFINKFVLCGSC
                     KNPETEIIVTKDDDLVRDCKACGKRTPMDLRNKLSSFILKNPPDSMNAGKGKKKAATA
                     SANVRGGGVSISDIAQGKSKASDDGSDNSGAAAGEEDELARQINAAASNLEDIEVKDE
                     DWAVDMSEEAIRKRALELQVDSGTVDGELSKLDEFGQWILTEASEDKENIPSDVELFK
                     KAAELDLLKEPKVAAVLAQCLFDEDIVNEISEHAAFFNKIFISPEYEYNFLGGIERFL
                     GLEHKELIPVLPKILVQLYNNDIISEEEIMHFGKKSSKKFVPKDVSKKVRRAAKPFIE
                     WLENAESDDEE"
     gene            <318162..>319058
                     /gene="TPHA0B01410"
                     /locus_tag="TPHA_0B01410"
                     /db_xref="GeneID:11534981"
     mRNA            <318162..>319058
                     /gene="TPHA0B01410"
                     /locus_tag="TPHA_0B01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684200.1"
                     /db_xref="GeneID:11534981"
     CDS             318162..319058
                     /gene="TPHA0B01410"
                     /locus_tag="TPHA_0B01410"
                     /inference="similar to DNA sequence:INSDC:YJR088C"
                     /note="similar to Saccharomyces cerevisiae YJR088C;
                     ancestral locus Anc_7.458"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684248.1"
                     /db_xref="GeneID:11534981"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G8BP83"
                     /translation="MDVARARLLSIHSSKYYTQMEPAELFDLYKELRLYLDVQNDSSL
                     DEMHFLSLMEMLFYVAVYLNKDIEAEVIYKTITDEFGENSPVIYVLKSILLQIKENDQ
                     KAIEYINDLIEERLKHDTDPLSYLLVSKRKLSMLLKNNSTEVVLDNCLKLIEEFPNDP
                     ELWWFVGETYLSAGKFDESIFAFEEVVLIQPFNYMAFYKISEVIFFKYKSLTMNSNKK
                     GNAKDKNEILNKSLQNALRSIELNEFFLRGWSIVALVSHQLGTKVEILNLAHKKLNEI
                     AELKNSSEKDKTTAKVIIEKTK"
     gene            complement(<319169..>320326)
                     /gene="TPHA0B01420"
                     /locus_tag="TPHA_0B01420"
                     /db_xref="GeneID:11534980"
     mRNA            complement(<319169..>320326)
                     /gene="TPHA0B01420"
                     /locus_tag="TPHA_0B01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684201.1"
                     /db_xref="GeneID:11534980"
     CDS             complement(319169..320326)
                     /gene="TPHA0B01420"
                     /locus_tag="TPHA_0B01420"
                     /inference="similar to DNA sequence:INSDC:YPR040W"
                     /note="similar to Saccharomyces cerevisiae TIP41
                     (YPR040W); ancestral locus Anc_7.457"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684249.1"
                     /db_xref="GeneID:11534980"
                     /db_xref="InterPro:IPR007303"
                     /db_xref="UniProtKB/TrEMBL:G8BP84"
                     /translation="MANNEENRDIRSRQGINTIIVNSARNMHMKTVNARIPQKSTPQP
                     LSQQQNPQWNNFMVNRGTQNTSTIHQRFKSPLAPRTQSTRHVCNNPNNPPCAHCGTTI
                     IPSPKAFMPLEDNPEIIINNWKISTKKKPILNSVELEDWENNKLKGLALPEMIFGNNA
                     ITIQNIEKDWTLQFNTLDALKMVKLEDSGIRVSYSNKWLDAKKNNATKNSNQKSDIDE
                     SSLKIVHNYDWTYTTEYKGTIKQNSKDSVEYNFQRDDEVQLPIDKLSRSDKILFFDDM
                     ILFEDELADNGISVLNCKIRVMDERLLLLSRFFLRVDDVLIRVIDTRIYVEFDENIII
                     REFKKYEDQYSSVLSRHRLSHSYDPKAALRDSNWVVANSPLVTRECEILKF"
     gene            <320595..>321200
                     /gene="TPHA0B01430"
                     /locus_tag="TPHA_0B01430"
                     /db_xref="GeneID:11535045"
     mRNA            <320595..>321200
                     /gene="TPHA0B01430"
                     /locus_tag="TPHA_0B01430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684202.1"
                     /db_xref="GeneID:11535045"
     CDS             320595..321200
                     /gene="TPHA0B01430"
                     /locus_tag="TPHA_0B01430"
                     /inference="similar to DNA sequence:INSDC:YPR037C"
                     /note="similar to Saccharomyces cerevisiae ERV2 (YPR037C);
                     ancestral locus Anc_7.456"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684250.1"
                     /db_xref="GeneID:11535045"
                     /db_xref="GOA:G8BP85"
                     /db_xref="InterPro:IPR017905"
                     /db_xref="UniProtKB/TrEMBL:G8BP85"
                     /translation="MRFLNYRNGVFVRILAIAILVSIWVFFSKPELSYIKPTIDINNK
                     DVKEEDIKLSAEEKKAELKRVDGSIMPSMPDLEAKQELGRASWKYFHTLLARFPDTPT
                     DEERDKLSVFINLFAELYPCGECSYHLQKMIKKYPVQTSSRTSASLWGCHIHNVVNKH
                     LKKPEYDCSTILEDYDCGCGDDEKNIKLNKVSINKEEKQLG"
     gene            complement(<321512..>321727)
                     /gene="TPHA0B01440"
                     /locus_tag="TPHA_0B01440"
                     /db_xref="GeneID:11535089"
     mRNA            complement(<321512..>321727)
                     /gene="TPHA0B01440"
                     /locus_tag="TPHA_0B01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684203.1"
                     /db_xref="GeneID:11535089"
     CDS             complement(321512..321727)
                     /gene="TPHA0B01440"
                     /locus_tag="TPHA_0B01440"
                     /inference="similar to DNA sequence:INSDC:YPR036W-A"
                     /note="similar to Saccharomyces cerevisiae YPR036W-A;
                     ancestral locus Anc_7.453"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684251.1"
                     /db_xref="GeneID:11535089"
                     /db_xref="UniProtKB/TrEMBL:G8BP86"
                     /translation="MSSFLQLTSDIQQPFIIPNLSPVSQPNSRKNSLNEPINKELLNK
                     DNKQESVNDDAAADAITRPRTNSICLL"
     gene            complement(<323468..>324580)
                     /gene="TPHA0B01450"
                     /locus_tag="TPHA_0B01450"
                     /db_xref="GeneID:11534999"
     mRNA            complement(<323468..>324580)
                     /gene="TPHA0B01450"
                     /locus_tag="TPHA_0B01450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684204.1"
                     /db_xref="GeneID:11534999"
     CDS             complement(323468..324580)
                     /gene="TPHA0B01450"
                     /locus_tag="TPHA_0B01450"
                     /inference="similar to DNA sequence:INSDC:YPR035W"
                     /note="similar to Saccharomyces cerevisiae GLN1 (YPR035W);
                     ancestral locus Anc_7.449"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684252.1"
                     /db_xref="GeneID:11534999"
                     /db_xref="GOA:G8BP87"
                     /db_xref="InterPro:IPR008146"
                     /db_xref="InterPro:IPR008147"
                     /db_xref="InterPro:IPR014746"
                     /db_xref="InterPro:IPR027302"
                     /db_xref="InterPro:IPR027303"
                     /db_xref="UniProtKB/TrEMBL:G8BP87"
                     /translation="MADIEMEKTHILQKYLDLDQRGKVIAEYVWIDGTGNLRSKGRTL
                     NKKVTSIDQLPEWNFDGSSTNQAPGNDSDVYLKPAAFYPDPFRRGDNIVVLAECFNND
                     GTPNKFNHRHEAAKLFQAHESEEIWFGLEQEYTLFDQYDQVYGWPKGGFPAPQGPYYC
                     GVGAGRVHARDLIEAHYRACLYAGLEISGINAEVMPSQWEFQVGPCTGIKMGDELWMA
                     RYLLHRVAEEFGVKISFHPKPLKGDWNGAGCHTNVSTKNMRAPGGMKYIDEAIDKLAK
                     RHSEHIKLYGTDNEMRLTGRHETASMTSFSSGVANRGASIRIPRSVAKEGYGYFEDRR
                     PASNIDPYLVTGIMCETICGAIENADMSKEFDRESQ"
     gene            complement(<325847..>327304)
                     /gene="TPHA0B01460"
                     /locus_tag="TPHA_0B01460"
                     /db_xref="GeneID:11534971"
     mRNA            complement(<325847..>327304)
                     /gene="TPHA0B01460"
                     /locus_tag="TPHA_0B01460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684205.1"
                     /db_xref="GeneID:11534971"
     CDS             complement(325847..327304)
                     /gene="TPHA0B01460"
                     /locus_tag="TPHA_0B01460"
                     /inference="similar to DNA sequence:INSDC:YPR034W"
                     /note="similar to Saccharomyces cerevisiae ARP7 (YPR034W);
                     ancestral locus Anc_7.448"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684253.1"
                     /db_xref="GeneID:11534971"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="UniProtKB/TrEMBL:G8BP88"
                     /translation="MDNTNYVVIHNGTASTIAGFSCSESPKCMIPSSYIQKANGDIVF
                     GTFEMLDEAAKNEDNDEVFTIMDSKFGVPYNWEALEKQWRYIYEEHLKVSPDQLPLAI
                     TVPSILTKNVELETKIIEEYCKIAFLKLGIPSLRVVNESLAISLSLGKKNSLIIDLSG
                     SGCSVTPILDGILIKNGILKSKFGGDFLDFEVNKIINEKIKESDKEEMDEDKKSTEMW
                     LESQTWIKDFKRSMIQVSDRSLEETERINKEQIELQKKYSLSTVSGAGDVEMDLNPLS
                     VKEHYLYKPKDMTLSFELRECYKLGEYLFQPKTANEQFNNEDGIGELINRSILTATTA
                     ATASNNNSVGIQNSNISMITKTPSGSILNSTANSDSANNDYTSSIDIMNSTSISTESV
                     NNLVTNIIIKGSTSLITGIETRIINEISMKFPNHKISVFANQILNDRILQSWLSCSVI
                     LKLSDIAIGMGNELYCKEDYEKKLSLANKNYSKST"
     gene            <327632..>328123
                     /gene="TPHA0B01470"
                     /locus_tag="TPHA_0B01470"
                     /db_xref="GeneID:11535043"
     mRNA            <327632..>328123
                     /gene="TPHA0B01470"
                     /locus_tag="TPHA_0B01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684206.1"
                     /db_xref="GeneID:11535043"
     CDS             327632..328123
                     /gene="TPHA0B01470"
                     /locus_tag="TPHA_0B01470"
                     /inference="similar to DNA sequence:INSDC:YJR082C"
                     /note="similar to Saccharomyces cerevisiae EAF6 (YJR082C);
                     ancestral locus Anc_7.447"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684254.1"
                     /db_xref="GeneID:11535043"
                     /db_xref="InterPro:IPR015418"
                     /db_xref="UniProtKB/TrEMBL:G8BP89"
                     /translation="MDYISRRTIDLLYYPDILLSRSTTEKKMSDKVSNDNNTKANSKN
                     NANNTNHLTDEQKKEYEKLKQDLKKSLKKRNALEDEFDKLNQEIYEKETEYLSNSTTG
                     VTSYQSHGNQVKTHYWGNIVKGFEGFSKPHGHDSNNAFTKEDRIFSLSSIQYTKQPEA
                     LEK"
     gene            <328660..>329880
                     /gene="TPHA0B01480"
                     /locus_tag="TPHA_0B01480"
                     /db_xref="GeneID:11534874"
     mRNA            <328660..>329880
                     /gene="TPHA0B01480"
                     /locus_tag="TPHA_0B01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684207.1"
                     /db_xref="GeneID:11534874"
     CDS             328660..329880
                     /gene="TPHA0B01480"
                     /locus_tag="TPHA_0B01480"
                     /inference="similar to DNA sequence:INSDC:YJR080C"
                     /note="similar to Saccharomyces cerevisiae YJR080C;
                     ancestral locus Anc_7.446"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684255.1"
                     /db_xref="GeneID:11534874"
                     /db_xref="InterPro:IPR002838"
                     /db_xref="UniProtKB/TrEMBL:G8BP90"
                     /translation="MRIGGGASTTIGNKRWISLLKPASIVNSGAKDTSTSVELFSLNR
                     ASVSDANESKFDVIGEPSTMAALTVPPTIPLYIRRGSLMAIYNNSDSPIAMSFHWKFL
                     LHNLLKFGSLSSTVYQKLECKDRLNVLVTPTFLNFNVFPSARRNEFRTLSNLTLNGTT
                     DWNVYGRDSIVSYEDNTSLEVSTPRANMNIRNLFKRNLKSPFSNKYKVIKGRGNVLLS
                     GNGSVYAIDLHNDTEEIIIKSEYLLAINGINQVHINNSIEQYKLIDPQVEKLYDYKKL
                     SLTVEEAKAFGAKQWLNYFKKVMGSLVNLTQITYFRWLSKPNKFLKIAGPRTVLIQTA
                     NNVYMPNVIKNGKSKRTNLSEINLKNINDNSIPNEKESLTKNEERLNQELKYTNIVTI
                     HPKGDVNFKSTKAF"
     gene            <330413..>332047
                     /gene="TPHA0B01490"
                     /locus_tag="TPHA_0B01490"
                     /db_xref="GeneID:11534908"
     mRNA            <330413..>332047
                     /gene="TPHA0B01490"
                     /locus_tag="TPHA_0B01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684208.1"
                     /db_xref="GeneID:11534908"
     CDS             330413..332047
                     /gene="TPHA0B01490"
                     /locus_tag="TPHA_0B01490"
                     /inference="similar to DNA sequence:INSDC:YPR033C"
                     /note="similar to Saccharomyces cerevisiae HTS1 (YPR033C);
                     ancestral locus Anc_7.445"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684256.1"
                     /db_xref="GeneID:11534908"
                     /db_xref="GOA:G8BP91"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004516"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR015807"
                     /db_xref="UniProtKB/TrEMBL:G8BP91"
                     /translation="MLNRLLKPSNSITKRLFTMMSEKVAVDQPKVAATLVGNVNKKES
                     KKNKLQVSLKTPKGTKDWADTDMVIREAIFSTLSNLFKKHGGVTIDTPVFELKEILAG
                     KYGEDSKLIYDLKDQGGEICSLRYDLTVPFARYVAMNNIQNIKRYHIAKVYRRDQPAM
                     TKGRMREFYQCDFDVAGSYEIMVPDAEILSILVEGLTSLGINDFKIKLNHRKILDGIF
                     QIAGVKDEDVRKISSAVDKLDKSPWEVVKKEITEEKGQSEETANKIGEYVKLNGSLKE
                     VHDILSKDEAILANEKAMSGLSEIATLITYAEAFQIEDFISFDLSLARGLDYYTGLIY
                     EAVTAASAPPTDASELKKKAKTDDDASAYVGVGSIAAGGRYDNLVNMFAEASGKKSTQ
                     IPCIGVSFGVERIFSLIKQRAVAAAAIKPTATQVFVMAFGGGKDWTGYLPERMKVAKQ
                     LWEAGIETEYVYKSKANPRKQFDAAEKSGCPLAVILGKEEYLENKLRVKRLGQEFAED
                     DGELVDADKIVEVVQQKLSEINQDGVNDVIRLLKGL"
     gene            complement(<332417..>333718)
                     /gene="TPHA0B01500"
                     /locus_tag="TPHA_0B01500"
                     /db_xref="GeneID:11534807"
     mRNA            complement(<332417..>333718)
                     /gene="TPHA0B01500"
                     /locus_tag="TPHA_0B01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684209.1"
                     /db_xref="GeneID:11534807"
     CDS             complement(332417..333718)
                     /gene="TPHA0B01500"
                     /locus_tag="TPHA_0B01500"
                     /inference="similar to DNA sequence:INSDC:YJR078W"
                     /note="similar to Saccharomyces cerevisiae BNA2 (YJR078W);
                     ancestral locus Anc_7.444"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684257.1"
                     /db_xref="GeneID:11534807"
                     /db_xref="GOA:G8BP92"
                     /db_xref="InterPro:IPR000898"
                     /db_xref="UniProtKB/TrEMBL:G8BP92"
                     /translation="MTGILNYIRGVRNDDITLEKYAISAKYGFLSTKQPVQFINIEYY
                     KPWEDIIENLPDLLKEGNLREEIDTNLPILEVSDELLNNVFYLRRAYSILTFLTNAYV
                     WGNKFNGETPIEILSDNIAKPLLKIANILGLPPLSTYAGLILWNFKTVSANNLCCETD
                     PIQIEILNTFTDLDDERWFYIISVFYEKIGGSVLECGVEILNAIKNEDIRLLKSRLNL
                     ISSYTYILGDLFTRMNEHTNPDIFYNVLRPFLTGWENSKDLGLPNGVKYGRHGKYKKF
                     AGGSNAQSSLIQFIDILLNVEHKNEEGVANGLSYILEMRKYMPYLHRKFLEHFSAACK
                     LKEFVLKHADDHPDLVKDYDDCLDNLKMFRDKHVKLVTTYIITPSRKAKTLETNKRKH
                     HINNGLAIKGTGSTSFVLFLKQCRTDTVDAGINFKKGKRSS"
     gene            complement(<335099..>335764)
                     /gene="TPHA0B01510"
                     /locus_tag="TPHA_0B01510"
                     /db_xref="GeneID:11534975"
     mRNA            complement(<335099..>335764)
                     /gene="TPHA0B01510"
                     /locus_tag="TPHA_0B01510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684210.1"
                     /db_xref="GeneID:11534975"
     CDS             complement(335099..335764)
                     /gene="TPHA0B01510"
                     /locus_tag="TPHA_0B01510"
                     /inference="similar to DNA sequence:INSDC:YBL107C"
                     /note="similar to Saccharomyces cerevisiae YBL107C;
                     ancestral locus Anc_7.443"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684258.1"
                     /db_xref="GeneID:11534975"
                     /db_xref="InterPro:IPR016805"
                     /db_xref="InterPro:IPR019171"
                     /db_xref="UniProtKB/TrEMBL:G8BP93"
                     /translation="MAENKIEESKNEMTLDLSWKQIDPNLIFRDNYYENNDIKDISGH
                     EQQLTLTRARCVNPTLVNSFLNILRHKSDDIIRQRLNDYEKIVNTGKSGSSEISKLGK
                     CGYFLEKELYPNWEVRRQAIQFCENESIKMEKELENSSKNSDVSSKSVVEARLDPYAS
                     RDRQAEENSRYNELNSVKLWIKNNKKIESILKNTANEILRQRCDQNTDYINKFWTFSN
                     NQH"
     gene            complement(<336164..>339616)
                     /gene="TPHA0B01520"
                     /locus_tag="TPHA_0B01520"
                     /db_xref="GeneID:11535110"
     mRNA            complement(<336164..>339616)
                     /gene="TPHA0B01520"
                     /locus_tag="TPHA_0B01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684211.1"
                     /db_xref="GeneID:11535110"
     CDS             complement(336164..339616)
                     /gene="TPHA0B01520"
                     /locus_tag="TPHA_0B01520"
                     /inference="similar to DNA sequence:INSDC:YBL105C"
                     /note="similar to Saccharomyces cerevisiae PKC1 (YBL105C);
                     ancestral locus Anc_7.441"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684259.1"
                     /db_xref="GeneID:11535110"
                     /db_xref="GOA:G8BP94"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002219"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011072"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:G8BP94"
                     /translation="MYSNIQAEIHKKLEREKNIIQGASNLKKKTDNAMVVQKCNTNIR
                     EARQNIEYLEDQLRKIEISASKAQNNSSSSKDQNRMSTINQNEHVFSRLDLVKYDCPS
                     LSQRIEYMLQQLEFKLQVERQYQEANAKLTKLYQIDGDTRSSTAAEGGVVESKNRIKL
                     LTKILKKYQAINVDFTQLESSDDLNNVQPKFRRKQQVGTLNIAISAIRDVDHIQSPMF
                     SKKPESYIIIKIDDVIKARSKFTRTDRWNDVFNIPVEKGNEVEIVIYDKMNDTIMPVA
                     IMWFLLSDIVEEIRKKKVDHSSQQQGWVNASRLMSGSASSGTPAGQSRLQMGSNSINS
                     DINGRSPYGNDNSSSTVSESASGPVTIDSWFVLEPAGQVLVSLGFDKTQPLATSALGG
                     LHRQGAIINRKEEVFEQHGHHFVQKSFYNIMCCAYCGDFLRYTGFQCQDCKFLCHKKC
                     YSNVVTKCIAKSDLDSDPDEAKLNHHIPHRFEPASNLGTKWCCHCGYILPWGKHKVRK
                     CSECGIMCHSQCAHLVPDFCGMSMEMANTILKTIQDTKRTQAQRKKQMSMMGSNVNVE
                     KNKNRDQIKKIATSPMKQTGRQEDELRQYRTNPLPVAPYSATKQKTNDSSAWDEASKS
                     ASGYPSLQGNISTTNNNDTYNNFTADAGNNVSPDMKTNMLKNFTQPNNNDPYHNNGDQ
                     WQTKQESIAEENRLWNQQRIDMDNELKLDSQQHRKSQIQEIIPDNIMDDIKAGTISLN
                     TVQDEAIMKPIEKSSTNSTNPFREMDKETFNSEKRISAVKDDGSEMTYSPKNASITAS
                     PQKSTASGRHKKKGPKRRKVSLDDFILLKVLGKGNFGKVLLSKSKNTGRVCAIKVLKK
                     DHIIQNHDIASARAEKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWH
                     VQNDRLSVRRAKIYAAEVLLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKD
                     EMWYGNTTSTFCGTPEFMAPEILKEQAYTRAVDWWAYGILLYQMLLCQSPFSGDDEDE
                     VFNAILSDEPLYPIDMAGDIVQIFQGLLTKDPTKRLGAGPRDALEIMEEPFFHNINFD
                     DVINLRIEPPYIPKISSPEDTSYFEQEFTSAPPTLTPLPSLLTTSQQEEFRGFSFMPN
                     DLEL"
     gene            complement(<340332..>343493)
                     /gene="TPHA0B01530"
                     /locus_tag="TPHA_0B01530"
                     /db_xref="GeneID:11535088"
     mRNA            complement(<340332..>343493)
                     /gene="TPHA0B01530"
                     /locus_tag="TPHA_0B01530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684212.1"
                     /db_xref="GeneID:11535088"
     CDS             complement(340332..343493)
                     /gene="TPHA0B01530"
                     /locus_tag="TPHA_0B01530"
                     /inference="similar to DNA sequence:INSDC:YBL104C"
                     /note="similar to Saccharomyces cerevisiae YBL104C;
                     ancestral locus Anc_7.440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684260.1"
                     /db_xref="GeneID:11535088"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BP95"
                     /translation="MGLIKRVNTWSYDDQLDYLSVNPTRDEVTHYKVDPHNYSDESIV
                     KLNTVKDFGSITCLDYSESEAGLIGVGEKSGYARILNIIEDSENDYYYDFKVRAKKVR
                     CINALVINNSGLVAVGLDRHRNDASLQIWDANYQNTDSDIINPSFSYCVNENIVSLRF
                     LQDTSLLVSSTKFLKEIDIRSSNPVFQLPTRLSYDIKLNPFNGWQFSTYGDDGTLAIW
                     DRRRLASHDNSAGLSLPQPLIQFDKLVGTGAASRKYMNSCFRWSTVRNWEFSTLHHGN
                     TIKRWNLGSTMQQDENSNEYEELFVSKVQEVMTTFDRVVTFDYIPQDNYRTSLICMRQ
                     SGTVYRMPILETYSKAKFDNYNSLILSNSDSPQFDELRVSDDDDNAAFGTIQNSIKEL
                     SFEDLDIADEMIASNNINDENSDHGTETTKDGSSVIENDDTESLLDNEDDYALFWKPQ
                     KLLKQDISVIMKKRAKLEYGLDPVTTVEKIDCSKDLQNFSYIRNTWRWIAIAKAAVDD
                     GSMASKNLDLGYEGILGIWNGLSSISVQRRYYDDSLLTEKQLNKEIEKIMKARRKNKS
                     TQGQKNPLTKWSDSPKHIQRKLCLIISGWDLTTSDYEDKYKKIIANGNHEKAAAWAVF
                     FGDIPKAVEILSSAKNERLQLIATAVSGYMVYKDHLGNNPWRQQCRKMASEFENPYLR
                     VIFAFIADNDWWDVLYEPAISLRERLGVALRFLNDSDLTIFLERTSSSVISNGELEGL
                     ILTGITPSGIDLLQSYVNKTSDIQSAAMVSIFGSPRYFHDKRVDEWVSTYRDMLNSWE
                     MFAMRAKFDVLRSKLSKTRGGTITANVRPRQLYIQCINCKKNINQPSPHINLKRNATS
                     NSLNDGSTGNSSTNLVASNANGSQSSMVTNKRMFGTVNNAMNSNKKVKQKYNCPHCGA
                     QLPRCAICLLPLGTSNLPFTIKGIEDQSAAGGVNKDNLTGNEDEHNTAINKKNESNTE
                     NALENKNIDNKDLINKNDTAFLDEALLMNEELKEQKRLRMNEWFSFCLSCNHGMHSGH
                     ADEWFVRHNFCPVPGCNCQCNKK"
     gene            complement(<343801..>346005)
                     /gene="TPHA0B01550"
                     /locus_tag="TPHA_0B01550"
                     /db_xref="GeneID:11535084"
     mRNA            complement(<343801..>346005)
                     /gene="TPHA0B01550"
                     /locus_tag="TPHA_0B01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684213.1"
                     /db_xref="GeneID:11535084"
     CDS             complement(343801..346005)
                     /gene="TPHA0B01550"
                     /locus_tag="TPHA_0B01550"
                     /inference="similar to DNA sequence:INSDC:YPR031W"
                     /note="similar to Saccharomyces cerevisiae NTO1 (YPR031W);
                     ancestral locus Anc_7.439"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684261.1"
                     /db_xref="GeneID:11535084"
                     /db_xref="GOA:G8BP96"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019542"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:G8BP96"
                     /translation="MSGELKDDGPKLREERNFEEFYDDLTKNTIIPLTLYKDNNDSAD
                     DNLNSGDHAEHKDTEKDQVPKVQLKQLIFNGKVTIEPIILNRHRNDIKKTTISINQLD
                     TPKYPKRVARPSKRPRTDSSLHPSINDDSKIAYINKFNDIYSSPNIQPKILKALSSIV
                     PNSNKFNIGYDMDEQDALYLESLNQKLAKGNMTPEIFETTISILEMKWHNLEKHIPPK
                     SLTADINSQDYQRKASQIHYQLYGSDDGTGSIEHACAVCGGGESTQTNAIVFCDGCNL
                     AVHQECYGIIFIPEGQWLCRLCLVSKDRKVDCLFCPSTTGAFKQTDTGSWAHVVCALW
                     LPELYFANLNYMEPIEGMKNINKSRWRLNCYICDQKIGACIQCSNKNCFTAYHVTCAK
                     RSNLYMSFNNIPVSSVAQNQTVNDLTIESFCDKHSPRFWPDCKEGLIKTKRYFKNLMH
                     NNNIIKSTSSNSSNGKIAKHIWRTNRGTPIAPQIFADNLSTFLTVLNFENTNKLSYEL
                     CKYWSMKRELKRGAPLVRIFDANSYNLLDITQINQRMEFANLLLRDISSLKHMTGLIK
                     KRIILKDEIDKLDDTLKMSTRFSEYKILKEFFYPKFLNSNHIKVLERNVKNVCFSNFI
                     EKCRSESYDSTGEILQAFELATKEIEEDMTTSRIVDSSIDSLKTLLAELIADIKSKDS
                     SQYLKQDFIVENNKIIGERPWRGPYLMEEEGLSDVEDLSQKDVRILKGLLHN"
     gene            complement(<346421..>349642)
                     /gene="TPHA0B01560"
                     /locus_tag="TPHA_0B01560"
                     /db_xref="GeneID:11532802"
     mRNA            complement(<346421..>349642)
                     /gene="TPHA0B01560"
                     /locus_tag="TPHA_0B01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684214.1"
                     /db_xref="GeneID:11532802"
     CDS             complement(346421..349642)
                     /gene="TPHA0B01560"
                     /locus_tag="TPHA_0B01560"
                     /inference="similar to DNA sequence:INSDC:YBL101C,YPR030W"
                     /note="similar to Saccharomyces cerevisiae ECM21 (YBL101C)
                     and CSR2 (YPR030W); ancestral locus Anc_7.436"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684262.1"
                     /db_xref="GeneID:11532802"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="UniProtKB/TrEMBL:G8BP97"
                     /translation="MVNSNKHGLKNVLTSIVPNAGVQTDERDGASQLPKSAVAVNIQP
                     PQPAMVDMSKNRLHPRSLSNSFTDEENDLSSPVSTLQPNHLKIKNRRYSTNSTPIVNN
                     GNVNVGMYRNFDPLNEINTSAVAKIEEATRSHVEDLDDFETKRLILRRKHINDRNGKN
                     GSVITNESFGKEFLEEYLTERGFLQPKVITTDVSNDLRISMASTGDCVFLPTVSTTDD
                     EYLARLHGSTEEEEIENNLSANRNLNSQQTETNDTLTNNNGGESTESTPENQSTVNSN
                     IDIDIDDSMFSYSIAVILSLNKTMTLSDINVELCARVRIYWNEGVPPTKTFKEEIYNA
                     GSSNWLLGIHNYNLYIPLIIDESKADDNKIIENNNINLIKGINKENGKNNSTSKETFF
                     KVSDPYKRIYTDKLKNKKKLFEEISKSDNENVFQPGDYMFILPIIFTNNIPESIYLPS
                     ARVGYRLCVALKELDKGSALQTKKNTNPKNSTNKSTTNDGAPFAHKFNLFKKVKEQLH
                     TNTSSASGSSNVVSNSTTDMYSEMPINIIRSPPPISISTANKSIYINRVWSKSLSYEI
                     SFGQKYVPVNNKFPIKIKLAPLTKDIKVKRVRVSIVEKITFVSKDLEYEYDQIDIVAK
                     DPYNPYFMEFDQKRKKERNLSLLEIRTKDKGSRSIREEIIDNCIDDNILSYTEIPDEG
                     SPKSKHKKKEVKGFNEPLTIVSQLEFPKYFDMDQKSAKLIPPYGIDLYSLETNSEKEN
                     EQPHKSGVMGFFSSRRASIISRESDKHSAAPDPRLHETKFYTNAENTVQCHTRINKAK
                     RGLYLDSLHFSNIHCRHKLEIMLRICKPDADDSAKLRNYEVLIDIPIFLISELCNAEN
                     LELPTYEMALTTDKNPSSPVITSSLPTFEQAISVPGSPINSPFLFSVNSGNPEDERYI
                     DDLHIQQLNLSRASSVSGESSNPHAHRTSEDLNNILTRTKTFSGDGTSKFDPRLKSSV
                     GSNYGNLDGLLAPNVSNKQRNRATSFNHVSMPQNNIFNPNYSVGKYHDNEHAIQDDED
                     EDGSNNDDTVSCSTESIGSYRGETDLHEPPNYNEIIPLMSNDN"
     gene            <350814..>351362
                     /gene="TPHA0B01570"
                     /locus_tag="TPHA_0B01570"
                     /db_xref="GeneID:11534991"
     mRNA            <350814..>351362
                     /gene="TPHA0B01570"
                     /locus_tag="TPHA_0B01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684215.1"
                     /db_xref="GeneID:11534991"
     CDS             350814..351362
                     /gene="TPHA0B01570"
                     /locus_tag="TPHA_0B01570"
                     /inference="similar to DNA sequence:INSDC:YML078W"
                     /note="similar to Saccharomyces cerevisiae CPR3 (YML078W);
                     ancestral locus Anc_4.347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684263.1"
                     /db_xref="GeneID:11534991"
                     /db_xref="GOA:G8BP98"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:G8BP98"
                     /translation="MFRNTLTKQVRLFSTTNAKFGTKVFMEPSINGTKVGRIEFELYD
                     DVVPKTAENFRALCTGEKGFGYKNVPFHRIIPNFMLQGGDTDLANGMGGKSIYGDRFN
                     DENFVKLHTKPGLLSMANAGPNTNGSQFFITTVPCKWLDGHHVVFGEVTKGMDIVKKI
                     ESYGSENGTPSAEIIIEEAGEL"
     gene            <351797..>352282
                     /gene="TPHA0B01580"
                     /locus_tag="TPHA_0B01580"
                     /db_xref="GeneID:11534998"
     mRNA            <351797..>352282
                     /gene="TPHA0B01580"
                     /locus_tag="TPHA_0B01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684216.1"
                     /db_xref="GeneID:11534998"
     CDS             351797..352282
                     /gene="TPHA0B01580"
                     /locus_tag="TPHA_0B01580"
                     /inference="similar to DNA sequence:INSDC:YML077W"
                     /note="similar to Saccharomyces cerevisiae BET5 (YML077W);
                     ancestral locus Anc_4.345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684264.1"
                     /db_xref="GeneID:11534998"
                     /db_xref="GOA:G8BP99"
                     /db_xref="InterPro:IPR007233"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:G8BP99"
                     /translation="MTIYSFWIFDKHCNCIFNREWTLSSDSSSGTTNSKQNSETAKLL
                     YGLIYSLRNITQKLSNTESGNKNDIRTISTGKYRVHTYCTATGLWFVLLTDFFQQSYL
                     QVLQHIYSHIYVKYVSHNLLLPYDLTENQPILMRGQGTRKITNRHFIAALESFLSPIV
                     E"
     gene            complement(<352396..>354834)
                     /gene="TPHA0B01585"
                     /locus_tag="TPHA_0B01585"
                     /db_xref="GeneID:11534808"
     mRNA            complement(<352396..>354834)
                     /gene="TPHA0B01585"
                     /locus_tag="TPHA_0B01585"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684217.1"
                     /db_xref="GeneID:11534808"
     CDS             complement(352396..354834)
                     /gene="TPHA0B01585"
                     /locus_tag="TPHA_0B01585"
                     /inference="similar to DNA sequence:INSDC:YML076C"
                     /note="similar to Saccharomyces cerevisiae WAR1 (YML076C);
                     ancestral locus Anc_4.344"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684265.1"
                     /db_xref="GeneID:11534808"
                     /db_xref="GOA:G8BPA0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8BPA0"
                     /translation="MSLHSTKADDLEYSKASIVGVPENDPRLNSAVHIDSRLSSKSKR
                     SAFACVRCHRLKQKCLPSDLADIYRKPCSKCKRMRLKCVFDLTKRKRNRKRNSNITDY
                     KQDGLSIDINIDDSVRLKKYDTFSSISGKKIITDIQPNNTANSLPAPHSLPIHILQSD
                     AGVLHSNLFPNTYSINNGVTQFSHQKMHANTGSDFNTLKNDKRFKNSNDTNSDLKVRY
                     NYHISSTFENDLYSLLIAQKDKLQTSNKKLEEMSHYGIELLKNTDFPLNIRDIFLFDI
                     LTEEEATFRLAYYRNNFSVKFPICSIKISKDITVRQFWKEKPILLSAIMSCVSIKLDS
                     SQTTLEKNVRLDGLTVHLISNSIFLKGEKSIEQIESMLTICTWYNFPEWFSKTKFHIF
                     NYMCCSLVKDLGPTSVSQIFGILSDEDPEYHKLKVTSPLLGVPNGYNLILMNYISSIN
                     ISIFLRQTIQTPWSPLIEQVCKYLETTSSNDLLYPDKGNRQLVIFVRINHALEEIHLF
                     LYENIYTEEVFESIPHPNKPLLSLINELEEQLDRLRLEISPDNTKVLSFLYSVDVYLH
                     EYTISKYIQNRSQYGNNVIQGNTLPNEVKIAFLKCQKYCQLCLKTFLKFDSDSISNIP
                     LYLINRIVYTVGVLLLKLRYFTIVLAEFHSLEEITKGTTSLINQVTLKIKDASILNPF
                     NNYLIKMQYVIALFAQTFATKVKDLISVSVMDRPLLNKQKSNLQFNDTFLSSDPHVAN
                     NKISVTNTESYERGSSKNPSNEVNSDAYELTPWVDDSLQLNDIFSDLNSIESGYTAMN
                     DEFWNYFFDSTNVI"
     gene            complement(<355289..>358459)
                     /gene="TPHA0B01590"
                     /locus_tag="TPHA_0B01590"
                     /db_xref="GeneID:11535039"
     mRNA            complement(<355289..>358459)
                     /gene="TPHA0B01590"
                     /locus_tag="TPHA_0B01590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684218.1"
                     /db_xref="GeneID:11535039"
     CDS             complement(355289..358459)
                     /gene="TPHA0B01590"
                     /locus_tag="TPHA_0B01590"
                     /inference="similar to DNA sequence:INSDC:YLR450W,YML075C"
                     /note="similar to Saccharomyces cerevisiae HMG2 (YLR450W)
                     and HMG1 (YML075C); ancestral locus Anc_4.343"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684266.1"
                     /db_xref="GeneID:11535039"
                     /db_xref="GOA:G8BPA1"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR002202"
                     /db_xref="InterPro:IPR004554"
                     /db_xref="InterPro:IPR009023"
                     /db_xref="InterPro:IPR009029"
                     /db_xref="InterPro:IPR023074"
                     /db_xref="InterPro:IPR023076"
                     /db_xref="InterPro:IPR023282"
                     /db_xref="InterPro:IPR025583"
                     /db_xref="UniProtKB/TrEMBL:G8BPA1"
                     /translation="MIIKFKEMYLSFPGLIKIIGSASRTAAEYPIQLIITVLLISMYA
                     YLSTIELLFEDWSSELKGYIMSMDNLKSADTNNYDDWNSKKYENFIKYKGTSSWINID
                     DQYSKTFGNIYNNDNFHHYYLFNVVIDDEEIETLSLTNLWPNVIQENSTLYILSENNS
                     LNLNDIIGISNNTGWELIDPTPKLNFLELLLQRYNHQNFELKNILTNGTGFLIMAYFQ
                     IFYLIINLFLQMKNNGSNFWLGFMALVSSACSIILALFLNWHINGIKTTLTELFTGLP
                     FILVIVGFKHKIMIAKDITKTISLINIIDRKEISKIISDSIINNGTYFLQEYLVSIIS
                     FIICSFLCKELKFAKHVCILSACVLSCGLLLTVTFYCAILSLKLELNIIHRDTALNIS
                     SWENTNERLNEDPDRGLRNFALKSPKIIRIAKVLLISIIILVNVFELLLIFVRNTKSQ
                     IKSSSNIEIPGRKIQDILQLFNQDSKNIVLSVSASYFFHIAKQVHKESWMDFMLIEIY
                     KFISYAIRDKLISKLMLCLLAISCSSNIYLLNVANIHTAQTRKTIHNQRKEAKKEKKH
                     HSVTKLEKIEDVDNKLETPELKCKGLVGDTLAIKKIYSDSHNYLEKNNLKDFQKQDIQ
                     KQVTLNKNESSKRQPAISSDDQQVIDEVINGKIPLYSLETYLNDKERAVYIRRKSIAK
                     MANIPILDTELLPYRQYNYERVFGACCENVIGYMPIPVGLIGPLIIDGTVYHIPMATT
                     EGCLVASAMRGCKAVNEGGGLTTVITKDGMSRGPCVQFPSLKRSSECKMWLDSEIGLE
                     KMKVAFNSTSRFARLQNIKTALAGDLLYIRFVTTTGDAMGMNMISNGVEHCLSKMKEE
                     YNWNDLEVISISGNYCTDKKAAAINWIEGRGKSVVAEAIVPGETVRKILKTDVKRLVE
                     VNISKNLIGSAMAGAIGGYNAHAANLVTAVFIAMGQDPAQNVESSNCITLMSEVNGDL
                     KVSVSMPSIEVGTIGGGTVLDAQGAMLDLVGVRGPHLTEPGANARKLASVVASAVLVG
                     ELSLISALSSGHLVKSHMALNRSKKV"
     gene            complement(<359179..>360423)
                     /gene="TPHA0B01600"
                     /locus_tag="TPHA_0B01600"
                     /db_xref="GeneID:11534857"
     mRNA            complement(<359179..>360423)
                     /gene="TPHA0B01600"
                     /locus_tag="TPHA_0B01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684219.1"
                     /db_xref="GeneID:11534857"
     CDS             complement(359179..360423)
                     /gene="TPHA0B01600"
                     /locus_tag="TPHA_0B01600"
                     /inference="similar to DNA sequence:INSDC:YLR449W,YML074C"
                     /note="similar to Saccharomyces cerevisiae FPR4 (YLR449W)
                     and FPR3 (YML074C); ancestral locus Anc_4.342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684267.1"
                     /db_xref="GeneID:11534857"
                     /db_xref="GOA:G8BPA2"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /db_xref="InterPro:IPR026257"
                     /db_xref="UniProtKB/TrEMBL:G8BPA2"
                     /translation="MADMLPLATYSLNVEPFTPTPAIDVNTPVTIRITMAALNPDSYD
                     DEKKPSTLRIIKRNPDFDDEDDDILGDYDDEEIDNEDDEDEEEEEEEPMTAEETMKKL
                     AEVKKSKNAKKQSKKDEAEEEEEEVEEEEDDDYDEDDEDDEFHEYILLTLSPDSAYQQ
                     TLDLTIAPEEDVQFVVTGSYAISLTGNFVKHPFDTPMVDFDDFDEEDIYGDDSSDDDD
                     YDLTPDEDEIIDDELDDLEDASDVEGRIEELVAEEETQKKGKDKKDKKRKQEEETKKE
                     AKKAKKVEFKKDLEEGPTKKKEEPKKPKTKVLEGGIIIEDRKTGTGPLAKRSSKIGMR
                     YIGKLKNGKVFDKNTSGKPFNFKLGHGEVIKGWDIGVAGMAVGGERRIVIPAAYAYGK
                     QALPGIPANSELTFDVKLVSMK"
     gene            complement(<361146..>364658)
                     /gene="TPHA0B01610"
                     /locus_tag="TPHA_0B01610"
                     /db_xref="GeneID:11534719"
     mRNA            complement(<361146..>364658)
                     /gene="TPHA0B01610"
                     /locus_tag="TPHA_0B01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684220.1"
                     /db_xref="GeneID:11534719"
     CDS             complement(361146..364658)
                     /gene="TPHA0B01610"
                     /locus_tag="TPHA_0B01610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684268.1"
                     /db_xref="GeneID:11534719"
                     /db_xref="GOA:G8BPA3"
                     /db_xref="InterPro:IPR003100"
                     /db_xref="InterPro:IPR003165"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:G8BPA3"
                     /translation="MSSLQDVSSGDDLSNLNGKVKPERNQVPALKPKKETRPESGSKK
                     ESRAAPKTKKEGSPAPKTKKGPKLNANEKKAIPFNSESGKETAQNIKSKSKLEQTQKP
                     DTKKEPKSKFNTKTDKKQDDKHLIPSTKNGIPTFDLTPKEVVEPAEVSSNPYQIQGRE
                     DYGTKGTKVDVLTNQMLLSLGNDTVVDAKTEKLKTPIDVWWKQAFIYTYHIDFIQKPA
                     EPKFDKFNKGGRNLKKSSPPNIPVLVPLSKPKKYDLIESLFDEDETLLKYKKNISFNG
                     EDTIYSLTPLEEFTLFDGCWDVSAKQKKKADDKQDKVIPEKKLVSRPSDAEPLDLASQ
                     IILKFTSKISLKGIYSSTVEQDPSFQEEKFSNVDKASLLHLLGVKLRSSDETIFQVNG
                     NKFFVFNEAAKPMPFLAGGYLMHGFTISLRYIYSAVALNVINTIGAFVKHTKYLPGDK
                     RFNQKENNQFSLLDFIIECYQYENSKYKKFTTSQKSNVLPSARDLNNFIKMNKTLNAQ
                     LKGMKVHRPYINYSVNPDGTPKPPCKIKSKEVIGFTRETATSMKIKSKDRSFPDNIST
                     TTYFKEKYNINLKYPDLQLVNLGNSITVPAECCMIMPGQKVKGLIKDNKEYMEYGAVR
                     PNEKFNIISNLALPRIANGLYPDSKPSNNSSFFFLKVPSRIIDAPVVQYKNSIVAYKD
                     RPYSETAKVQKGMWNLSTHGLSVTEDRPFNMKIILVSNTSSVPPVSLKDDIKSSLEAF
                     IKHTTDLGMNFKMDGEPRLVNNFTAPKKPFAPRGSKNGRATPGGLQISSGEKNLVEML
                     KSYPPDTYILYLLNNNDDAILYNRLKYLSDLKFGVLNSCCQLRNFLKKSPQLNANLAL
                     KMNLKLLGSNQLLSEKCNEKLTDTATNLPVLILGADVTHYPEKDQNSIAAMVGSIDDK
                     FSQFPGDYMLQDEPGEEIIKNIDEMFLNRLIAYQEHNKGKLPTKILYFRDGVSEGQLN
                     QVVNIEIRKLKESARRFGKSLIGINSYNPSITCVVTVKRNQIRFMPLEENAKNEKGDL
                     VAVQSMGNVMPGTVVDRGITSVAHFDYFLQSQQALKGTGVPCHYWCVYNENNYTSDDL
                     QEISHNLCYIFGRSTTSIKCPAPIYYADLLCTRATCYFKANFEVVKNSVPKNKNPDAD
                     APAIPKLKLLPNMHKRVNDIMYYI"
     gene            complement(<365604..>366825)
                     /gene="TPHA0B01615"
                     /locus_tag="TPHA_0B01615"
                     /db_xref="GeneID:11534928"
     mRNA            complement(join(<365604..366119,366811..>366825))
                     /gene="TPHA0B01615"
                     /locus_tag="TPHA_0B01615"
                     /product="60S ribosomal protein L6"
                     /transcript_id="XM_003684221.1"
                     /db_xref="GeneID:11534928"
     CDS             complement(join(365604..366119,366811..366825))
                     /gene="TPHA0B01615"
                     /locus_tag="TPHA_0B01615"
                     /inference="similar to DNA sequence:INSDC:YLR448W,YML073C"
                     /note="similar to Saccharomyces cerevisiae RPL6B (YLR448W)
                     and RPL6A (YML073C); ancestral locus Anc_4.341"
                     /codon_start=1
                     /product="60S ribosomal protein L6"
                     /protein_id="XP_003684269.1"
                     /db_xref="GeneID:11534928"
                     /db_xref="GOA:G8BPA4"
                     /db_xref="InterPro:IPR000915"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:G8BPA4"
                     /translation="MSAQQAPKWYPSEDVAAPKKTRKASRPQKLRASLVPGTVLILLA
                     GRFRGKRVVYLKHMEDNTLLVSGPFKVNGVPLRRVNARFVIATSTKISVEGVNVEKFN
                     AEYFAKEKLTKKQKQEANMFPEKQVKELKAERVEDQKNVDKSLLAEIKKTPMLKQYLA
                     ASFSLKNGDKPHLLKF"
     gene            <367886..>368923
                     /gene="TPHA0B01620"
                     /locus_tag="TPHA_0B01620"
                     /db_xref="GeneID:11534701"
     mRNA            <367886..>368923
                     /gene="TPHA0B01620"
                     /locus_tag="TPHA_0B01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684222.1"
                     /db_xref="GeneID:11534701"
     CDS             367886..368923
                     /gene="TPHA0B01620"
                     /locus_tag="TPHA_0B01620"
                     /inference="similar to DNA sequence:INSDC:YLR447C"
                     /note="similar to Saccharomyces cerevisiae VMA6 (YLR447C);
                     ancestral locus Anc_4.338"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684270.1"
                     /db_xref="GeneID:11534701"
                     /db_xref="GOA:G8BPA5"
                     /db_xref="InterPro:IPR002843"
                     /db_xref="InterPro:IPR016727"
                     /db_xref="UniProtKB/TrEMBL:G8BPA5"
                     /translation="MEGVYFNVDNGFIEGVVRGYRNGLLTSNQYLNLTQCDTLDDFKL
                     QLSSTDYGNFLSSVATEGLTTSIIQELASQKLYQEFNYIRNQTRRFNKKFMDFITYGY
                     MIDNVTLMITGTIHDRDKAEILQRCHPLGWFDTLPTLSVATDLESLYETVLVDTPIAP
                     YFSNCFDNAEELDDLNIEIIRNKLYKAYLNDFYNFISSELPEPAKEAMQDLVVFEADR
                     RSINIALNSLQSEDIAPDLKRELLPDLGKLYPIATAHLAEAQDFETVRAIVGSVYEYK
                     GILESGNLEDHFYKYEMELCRDAFTQQFAVSTIWAWMKSKEQEVRNITWIAECIAQNQ
                     REKINNYISVY"
     gene            <369171..>369728
                     /gene="TPHA0B01630"
                     /locus_tag="TPHA_0B01630"
                     /db_xref="GeneID:11535076"
     mRNA            <369171..>369728
                     /gene="TPHA0B01630"
                     /locus_tag="TPHA_0B01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684223.1"
                     /db_xref="GeneID:11535076"
     CDS             369171..369728
                     /gene="TPHA0B01630"
                     /locus_tag="TPHA_0B01630"
                     /note="ancestral locus Anc_4.337"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684271.1"
                     /db_xref="GeneID:11535076"
                     /db_xref="GOA:G8BPA6"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:G8BPA6"
                     /translation="MTQGISDKKTDEIISRTDEVEIKFRPSDYLRMLIGIILFTSIIS
                     KLSTGRFIVYPLSNGTTKNNLEISSFWYDNYQNVPIAFSESDLKQYSGDSVSERIVLS
                     IKGNVFDVTRGARFYGKWGPYKKFSGKDCSNVFGYNSWDLSSLSKECNSNISELSTVE
                     LERIDSWLSFFKRKYPYIGYVRYDD"
     gene            complement(<369865..>371133)
                     /gene="TPHA0B01640"
                     /locus_tag="TPHA_0B01640"
                     /db_xref="GeneID:11535073"
     mRNA            complement(<369865..>371133)
                     /gene="TPHA0B01640"
                     /locus_tag="TPHA_0B01640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684224.1"
                     /db_xref="GeneID:11535073"
     CDS             complement(369865..371133)
                     /gene="TPHA0B01640"
                     /locus_tag="TPHA_0B01640"
                     /inference="similar to DNA sequence:INSDC:YLR446W"
                     /note="similar to Saccharomyces cerevisiae YLR446W;
                     ancestral locus Anc_4.336"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684272.1"
                     /db_xref="GeneID:11535073"
                     /db_xref="GOA:G8BPA7"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR022672"
                     /db_xref="UniProtKB/TrEMBL:G8BPA7"
                     /translation="MTVNSRIVGEVRKKFIPKDDAAELKVKFLAELEWRLQNSKYSML
                     PSRLVHGSIKAPNSNNRYISIDFGGTTLKIAIMKYDSDEKNFEIAYQNSMNITSKIVD
                     WKFFEELVFWICQQLNEQCDFSNELTFLISTTFSSPLDDNNKIVSMGKGFELMDELKD
                     ISLNAILKKLFNKYKSNNIAFTNARFQICDIINDSVAVYITGKFTCLKSQIALILGTG
                     LNSCFELPNFMLPEYKAQHYDIETSQKVIINAEAGFLGKDFIKLSRFEKGFELDNLNM
                     PMEFITSGKYIPSSFLRLLTYYNIPISKEIEFDGSTFGAIINGNSNITSSEFKNVCRE
                     LALLYLERASIYLVAMLEGILELTNNSTTVESDTVNIGYVGSFLANIEEYRNMVEIRS
                     GHKFKLIFLEDSNLKGATIATCTNIRHHWI"
     gene            <372324..>373298
                     /gene="TPHA0B01660"
                     /locus_tag="TPHA_0B01660"
                     /db_xref="GeneID:11535001"
     mRNA            <372324..>373298
                     /gene="TPHA0B01660"
                     /locus_tag="TPHA_0B01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684225.1"
                     /db_xref="GeneID:11535001"
     CDS             372324..373298
                     /gene="TPHA0B01660"
                     /locus_tag="TPHA_0B01660"
                     /note="ancestral locus Anc_4.335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684273.1"
                     /db_xref="GeneID:11535001"
                     /db_xref="UniProtKB/TrEMBL:G8BPA8"
                     /translation="MVEIESRGIKVKEKYKEPAPGYLLQQSIKNSKLFDIDDPTLNLE
                     LEKDTIKFNCIRNGVKKLYRYSKIQRYSFHMSGVFFCNTLELFYKIFGKDENSKGCVH
                     ETTNFRTKNSEFNKGYRDLIDMILLHNQMSRIYCKIENSLKFFEIKIILPLRALDEAF
                     SKISYYIQYRDKINVAYHELFIKYTELKEKTNDFTKSLTGSEEVSRIKIENNLISSKE
                     DLELANDKLRKQLSVLFGYCRSYFKTWFLLYYFTICRIYYDLQHFMRASSEFKKVFKV
                     IYNQQDKINSSGLAVPTSNSTEENNTYTINNNNYQQQFQSKENMYPEY"
     gene            <373768..>375510
                     /gene="TPHA0B01670"
                     /locus_tag="TPHA_0B01670"
                     /db_xref="GeneID:11535028"
     mRNA            <373768..>375510
                     /gene="TPHA0B01670"
                     /locus_tag="TPHA_0B01670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684226.1"
                     /db_xref="GeneID:11535028"
     CDS             373768..375510
                     /gene="TPHA0B01670"
                     /locus_tag="TPHA_0B01670"
                     /inference="similar to DNA sequence:INSDC:YML070W"
                     /note="similar to Saccharomyces cerevisiae DAK1 (YML070W);
                     ancestral locus Anc_4.334"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684274.1"
                     /db_xref="GeneID:11535028"
                     /db_xref="GOA:G8BPA9"
                     /db_xref="InterPro:IPR004006"
                     /db_xref="InterPro:IPR004007"
                     /db_xref="InterPro:IPR012734"
                     /db_xref="UniProtKB/TrEMBL:G8BPA9"
                     /translation="MVKSFEVADPIDSSLEGFALVNPSITLIPAEKILFRKTEKSQIA
                     LISGGGSGHEPTHAGFIGDGMLSAAVCGDIFASPSTKQILNAIRLVSENSKGVLLIVK
                     NYTGDVLHFGLAAERARAQGIDCHVFVVGDDVAVGRAKGGMVGRRALAGTVLVHKIAG
                     AFAKGYSEKYGLQGTIDAATIINDNLVTIGSSLEHCKVPGRKYETSLKGSQLELGMGI
                     HNEPGVQILEPIPSTEELISKYMLPALLDSSDSDRYFVNFDEGDDVVLLVNNLGGVSN
                     FIISSIVSIVNKALKSEYNIVPVQSISGTLMTAFNGNGFSITLLNATKATKALNSKFP
                     EIKSVLDLLNYNTTAPGWAVVSHNSKPAVNEDILKVDVKVKNAGTYDFETFSNWMKAA
                     AKAIKEAEPHITSLDTQVGDGDCGYTLVAGTEGITDDLDKISKKSLSEATAQISDIIE
                     SSMGGTSGGLYSILLSAFSNGIIQTCGENTPVTAKEVAKSLDFALSTLYKYTKARVGS
                     STMIDALEPFIEEFKKSQDFKKAVAAAAKGAESTGNVEAKFGRASYVGDSSSVEDPGA
                     VGLVAFLKGIESTF"
     gene            <375904..>377607
                     /gene="TPHA0B01680"
                     /locus_tag="TPHA_0B01680"
                     /db_xref="GeneID:11535053"
     mRNA            <375904..>377607
                     /gene="TPHA0B01680"
                     /locus_tag="TPHA_0B01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684227.1"
                     /db_xref="GeneID:11535053"
     CDS             375904..377607
                     /gene="TPHA0B01680"
                     /locus_tag="TPHA_0B01680"
                     /inference="similar to DNA sequence:INSDC:YML069W"
                     /note="similar to Saccharomyces cerevisiae POB3 (YML069W);
                     ancestral locus Anc_4.333"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684275.1"
                     /db_xref="GeneID:11535053"
                     /db_xref="GOA:G8BPB0"
                     /db_xref="InterPro:IPR000969"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013719"
                     /db_xref="InterPro:IPR024954"
                     /db_xref="UniProtKB/TrEMBL:G8BPB0"
                     /translation="MSTDFDRIYLNQSKVNGRFRVADSGLGWKASSSGGSAANKAKAP
                     FLLPATELSTIQWSRGCRGYELKINTKNQGVLQLDGFSEDDFDAIKSDFHRRFNIQLE
                     HKEHSLRGWNWGKTDLARNEMIFSLNGKPTFEIPYSRINNTNLTNKNEVAIEFDIQDE
                     EYQPAGDELVEMRFYIPDAIKEEESENEQIKSESAEGAVKAEGAVKTENEEDVEMSEN
                     EREEFEEKSMAETFYEELKEKADIGETAGDVIVSFPDIFFTTPRGRYDIDIYKNSIRL
                     RGKTYEYKLQHRQIQKIISLPKVDDIHHLIVLSIEPPLRQGQTSYPYVVLQFQKDEET
                     EVQLNLDDADYEENFKDTLKKQYDAKTHIVISHVLKGLTGRRVIVPGSYKSKYDNCAV
                     SCSYKANEGYLYPLDNAFLFLTKPTLYIPFSDVSSVNISRAGQSTTSRTFDLEIVLRF
                     NRGSVTFGNISKEEQQLLELFLTSKSLKVRNEEKESEQRLQTALGSDSDDGDINMGSA
                     GEDDESADEEFQASSDDDDDVAEEFDSDANAGSDSEGDNDGDDDVVSDSDRPVKKPKV
                     E"
     gene            <378052..>379449
                     /gene="TPHA0B01690"
                     /locus_tag="TPHA_0B01690"
                     /db_xref="GeneID:11535169"
     mRNA            <378052..>379449
                     /gene="TPHA0B01690"
                     /locus_tag="TPHA_0B01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684228.1"
                     /db_xref="GeneID:11535169"
     CDS             378052..379449
                     /gene="TPHA0B01690"
                     /locus_tag="TPHA_0B01690"
                     /inference="similar to DNA sequence:INSDC:YML068W"
                     /note="similar to Saccharomyces cerevisiae ITT1 (YML068W);
                     ancestral locus Anc_4.332"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684276.1"
                     /db_xref="GeneID:11535169"
                     /db_xref="GOA:G8BPB1"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002867"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G8BPB1"
                     /translation="MEDRVNLKDDLAILRDMYPELVLDQDEKSINTNIQNVVSGYLPF
                     KVSLHNNLSVSYEKELLTFSSFLLGVLQFKIDVAKYPSLKDSLELNFISEWMTKEDKN
                     IIISSLDEQFGDLTDPTSDIYDPFTPILMLLFSYLTDETASVLFPDNVKKCLTLEEYQ
                     IFKIMKSTIQKEEASKKNFTCCICIDTKKGTNIIELPCKEETKHYLCEPCVKSYYSEM
                     IKEGNMDAVRCPECKYEEIVLDSFKDYTLLKETLFTPAIPFEFFDRVLSEELCTKYRE
                     LFHSYCATKLSKHSTSACIPCRRCNTWCVKDNLDDAMISCKTCSFVFCFNCLHSWHGY
                     NNLCGAKVTIPREVIEAYIDEDGILSDDAKKEMEVKYGKKQLATDVSDYLADQLLDLA
                     IAEKDSNLQRCPHCRIVVQRSEGCNKMRCAVCNCLFCFICGTLLYPEDPYEHFREVWS
                     ECYGRLFEGMEGVDS"
     gene            complement(<379571..>380644)
                     /gene="TPHA0B01700"
                     /locus_tag="TPHA_0B01700"
                     /db_xref="GeneID:11535159"
     mRNA            complement(<379571..>380644)
                     /gene="TPHA0B01700"
                     /locus_tag="TPHA_0B01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684229.1"
                     /db_xref="GeneID:11535159"
     CDS             complement(379571..380644)
                     /gene="TPHA0B01700"
                     /locus_tag="TPHA_0B01700"
                     /inference="similar to DNA sequence:INSDC:YML066C"
                     /note="similar to Saccharomyces cerevisiae SMA2 (YML066C);
                     ancestral locus Anc_4.329"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684277.1"
                     /db_xref="GeneID:11535159"
                     /db_xref="UniProtKB/TrEMBL:G8BPB2"
                     /translation="MFFIKRFIIWGLILGVSVTQILLYIPIFTCRSSGKNVLCSPIYK
                     VQLIEDSKLTHDFIATLNELLRLLSYLTIDMGWDGEITTPTIYDNGYLDKAMKENNIF
                     KVNYFGYCKFQDSKNDYCSRLTSSCLDLFGTIAKDMGVYLSRYTSNYKTNPDVIGSSL
                     QQFYYLTLLSIYKFLKMDHKNDNNFLQILYGIHNVKVSDTIHVYSDSYKSAVITLYIS
                     MISNNVLKDLLLLEFTAVILLFLAISGFGALLFIWKKQTILPLIIMIISIISFMLSFF
                     SFASTLTNILSLKRLERNEDIIENGWEMLQVTYGSGFIFACIRHSLQWVILILGIVVK
                     KYYSVVPKPQPVIQNEIKEEEDK"
     gene            <381484..>384288
                     /gene="TPHA0B01710"
                     /locus_tag="TPHA_0B01710"
                     /db_xref="GeneID:11535167"
     mRNA            <381484..>384288
                     /gene="TPHA0B01710"
                     /locus_tag="TPHA_0B01710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684230.1"
                     /db_xref="GeneID:11535167"
     CDS             381484..384288
                     /gene="TPHA0B01710"
                     /locus_tag="TPHA_0B01710"
                     /inference="similar to DNA sequence:INSDC:YLR442C,YML065W"
                     /note="similar to Saccharomyces cerevisiae SIR3 (YLR442C)
                     and ORC1 (YML065W); ancestral locus Anc_4.327"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684278.1"
                     /db_xref="GeneID:11535167"
                     /db_xref="GOA:G8BPB3"
                     /db_xref="InterPro:IPR001025"
                     /db_xref="InterPro:IPR011579"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPB3"
                     /translation="MNEIIRNSLKGWQVIVTDSSGNIIDENSRRRSRRGGSERIFLQR
                     ISDGVSFTRGDSILVNDKTTKTYSIYCINEIRLNTLNNPVELIGFTYLRWFEVAPLNY
                     YKELSPSIYDNASKSMDYYKDKFLKEVNKNEIFLTAELSEISIKDFINVANVVIPEKW
                     NNESMKLDQDFILKYICEPDSSNFTEVNFESMKKTLVEYDPKSSENYLKRLSTRAKNR
                     LNTITKPKTVCKVEVKVEPPSLNFEGESKLSSKPQPNAVIKATSVKATSLTTPSETNT
                     KSSKISSSASTLANENTSLSLQPYTNDKLQTNVTDINQIPPVHDASKESFAQNSISKT
                     PNQNNNTIKKKLKPEYTKSESNVVSVTETGIDTNLSSNTSQSSIGDSSLSNFTKTSIS
                     NSTKSNRDELNSNSDEPAIPLNGNNNINDIQSNVMKNKALMEGKVVKIKSRTMVEQIK
                     GMQHKYRKYINVLRTLETTSDEVVKDTKKNSVEVENYPANNSFDDLYLKPLVGFCEKV
                     CNDNKKDIIKKSEYSRIFCTIVSFLNTESSGYILVKGILSTGKTFTIQKILQGLLDYS
                     HSKSILQIANISLSDSIEDEDQFYSDLWNQLTDETLNKHQSKDALNSYFLHVSKRKKR
                     HTLIIMDNFNPDKVVQTSFLKSVINWSASQESKLIVVSISRDFNISTLGLSSDIFNNL
                     NLTNVLFEKMSKAELFTLVQMNLQALSERLYHKNGKQLSINNHASTHGGLVQIMLPEK
                     EELNHMCSVIANISTGVNDALDICINLVKDAIQYSLMNQSRNNFHSRIKLLISFSTLK
                     SVMAKRESSNILKSIMELPFLLQLALVSVYKVSIGALTNNGEDNFKIISRELLKFLHD
                     KKYKNVAETFNNCILCSLGDITDKQMFSVEEAVTFISWGNIFMNLKRLNMVKLGVCPR
                     NVSLAIDGKYVEEFLENWLT"
     gene            complement(<384530..>385420)
                     /gene="TPHA0B01720"
                     /locus_tag="TPHA_0B01720"
                     /db_xref="GeneID:11534762"
     mRNA            complement(<384530..>385420)
                     /gene="TPHA0B01720"
                     /locus_tag="TPHA_0B01720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684231.1"
                     /db_xref="GeneID:11534762"
     CDS             complement(384530..385420)
                     /gene="TPHA0B01720"
                     /locus_tag="TPHA_0B01720"
                     /inference="similar to DNA sequence:INSDC:YML064C"
                     /note="similar to Saccharomyces cerevisiae TEM1 (YML064C);
                     ancestral locus Anc_4.326"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684279.1"
                     /db_xref="GeneID:11534762"
                     /db_xref="GOA:G8BPB4"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPB4"
                     /translation="MPYRENRNASSAGGMMRSVPKSRNQVEIQVGLIGDAQVGKTSLM
                     VKYVQNIFNEEYTQTLGVNFLKRTVSVRSTDIVFSLLDLGGQKEFINMLPIATVGSAA
                     IVFLFDLTRPETLNSIKNWYRQANGLNEMAIPILVGTKYDLFINLDKEHQDSISRLSM
                     EIAQVMDSPLVFCSTSKSINVQKIFKIALSKIFNLTLTIPEINEIGDPLLIYKTLGNN
                     FNNNRSHNSSPIRTNNNNNSNNDTNSNNDGNSNTVNNNNYSALDNSNYPNPTASEHLN
                     RIKNLHQCLRHAQLRCLRVV"
     gene            complement(<385899..>387152)
                     /gene="TPHA0B01730"
                     /locus_tag="TPHA_0B01730"
                     /db_xref="GeneID:11534880"
     mRNA            complement(<385899..>387152)
                     /gene="TPHA0B01730"
                     /locus_tag="TPHA_0B01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684232.1"
                     /db_xref="GeneID:11534880"
     CDS             complement(385899..387152)
                     /gene="TPHA0B01730"
                     /locus_tag="TPHA_0B01730"
                     /inference="similar to DNA sequence:INSDC:YML062C"
                     /note="similar to Saccharomyces cerevisiae MFT1 (YML062C);
                     ancestral locus Anc_4.324"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684280.1"
                     /db_xref="GeneID:11534880"
                     /db_xref="UniProtKB/TrEMBL:G8BPB5"
                     /translation="MATNELLTAEQYKHAVTKVRYNDVDPSFYNYMELINKITKLSKS
                     VLTGVLPEENNDDSGENVNKEISENKFNLDTILNLEQSLDLKYLTLTNELDIKKVTFE
                     NNIQKTDRNLAALQSHVQKTLPEMKYYRTTMQNRTRRLRDMYSSILNINEELYALAAG
                     KTSLAASLSEWEEKLGKELTSKLIQQNYMKSTGSESDGKDQLYKISDNLNKSPGELRF
                     VNASIRKDIQKLVKELELSKNKWSKDADIFDKISEVLKVELVNRNVELGSSKNDDDED
                     MEDVNDTIRKRHSRVQPTLNESEEFGGEHVNESVSEDESADEVEGADDIDEGMESDVD
                     IELDPEIEEDQRGESREYSEMGHEFADVEQDKEEDLEDKEEDLEDKNNDSASDANIIE
                     RNVDAEDIKMAEDGEEKTLKDDMKD"
     gene            <387569..>389677
                     /gene="TPHA0B01740"
                     /locus_tag="TPHA_0B01740"
                     /db_xref="GeneID:11535087"
     mRNA            <387569..>389677
                     /gene="TPHA0B01740"
                     /locus_tag="TPHA_0B01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684233.1"
                     /db_xref="GeneID:11535087"
     CDS             387569..389677
                     /gene="TPHA0B01740"
                     /locus_tag="TPHA_0B01740"
                     /inference="similar to DNA sequence:INSDC:YLR440C"
                     /note="similar to Saccharomyces cerevisiae SEC39
                     (YLR440C); ancestral locus Anc_4.323"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684281.1"
                     /db_xref="GeneID:11535087"
                     /db_xref="InterPro:IPR013244"
                     /db_xref="UniProtKB/TrEMBL:G8BPB6"
                     /translation="MLENQLYLLATIFASTADVEKLTILKNSFTNSSELLDIICVLWP
                     ELDDPILLRNFLTNLELNDLNADENPIDEDNILVSLLETGEDLVPIIEMDVETVSERV
                     STVKEYINRRLVEVTLDEITSFDDTVSSWLRKRILLCDELNPFNVLFNKKLWKEIKPI
                     DPEFMGWVNGILEPLDFINNSSDIRVQFRIIDFEALTPNNVIELLTKNLLENEYSFNN
                     KNVQQIDCLISYLNYTNSFTLFLEQKFNTNSFLFKKKQNYLVFDAIFTKFNESNVMAD
                     KENFQKAALSIIFENSKELMNIISMDELKQLLDAFDQNIETANGINSKILLSYIHLIS
                     IFLQDYSLKEVHLISKENEASQLLHYTSMIKAKIMSKGFKTSSSTAVNEILSVITGSA
                     SNSEQIVFTHIPPKRQISVLIDLLLELGEFDLLQDLMEEQNSQLEEAGLEKYFWHFFN
                     NASNGLKSRPEMKKAQKTVKLLLEQNEPKFKHLEILLHIADLLSYYSINLGKGVIFKP
                     SNIFDFKNHPSQIISKLLELNDGLYKDKNTTSLMLKELFEGMNLDITGDFFVQEQIRV
                     SEFHIDNALANLDFYFAYHESKELLTKSENKTPWATVFQVCKFSDPNWLDNETPTEIL
                     VLQFELSSDLLQSCPTEEMEIVISQWSSLELELLTRDIINDQYSIGNSGDSKREFSQA
                     TNLLDGVSNSVTKFISSNLS"
     gene            complement(<390107..>391759)
                     /gene="TPHA0B01750"
                     /locus_tag="TPHA_0B01750"
                     /db_xref="GeneID:11534760"
     mRNA            complement(<390107..>391759)
                     /gene="TPHA0B01750"
                     /locus_tag="TPHA_0B01750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684234.1"
                     /db_xref="GeneID:11534760"
     CDS             complement(390107..391759)
                     /gene="TPHA0B01750"
                     /locus_tag="TPHA_0B01750"
                     /inference="similar to DNA sequence:INSDC:YML061C"
                     /note="similar to Saccharomyces cerevisiae PIF1 (YML061C);
                     ancestral locus Anc_4.322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684282.1"
                     /db_xref="GeneID:11534760"
                     /db_xref="GOA:G8BPB7"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010285"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPB7"
                     /translation="MKKNTLFITEESELLEEHTNEQINLESDENILESKETTEFTSPT
                     TSQTPSQTITTESGITLSEEQKTIIKLAKDGHNIFYTGSAGTGKSVLLRELIKVLKSQ
                     HGSDSVAVTASTGLAACNIGGTTVHSFAGIGLGKEDAERLVSKVYKSIRHRERWKNIK
                     ILVIDEISMIDSSLLDKLDYIAKKLRKNNFPFGGIQLIFCGDFFQLPPVKKTNDPTVK
                     KAFESDLWNNAFNITVKLENVFRQKGDLEFISMLEKARLGKIDDETEKQFKQLDRMLD
                     NDDIAPAQLFPTRKEVEIANISQLRILKGDIYAYTSIDGGSIKDPKMRQNLLENFMAP
                     KVLPLKVGAQVMMIKNVDSTLVNGSLGKIVAFINQDVYAYFLKVILSEDSSIVSFLQK
                     YQDNMDLLKLKVLSDPSDSDEATVRQKISKEMFCKPDSGAPQMDVDELFGSLFSTAKN
                     LFPEYTLSQENLELVKKVFSNLCENTKHNKKFPLVLFKTSDLKDRLVLVSPEDWSIDD
                     EKEKVLVSRVQLPLILAWALSIHKSQGQTIPKLQIDLKKYLK"
     gene            complement(<392156..>393463)
                     /gene="TPHA0B01760"
                     /locus_tag="TPHA_0B01760"
                     /db_xref="GeneID:11535142"
     mRNA            complement(<392156..>393463)
                     /gene="TPHA0B01760"
                     /locus_tag="TPHA_0B01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684235.1"
                     /db_xref="GeneID:11535142"
     CDS             complement(392156..393463)
                     /gene="TPHA0B01760"
                     /locus_tag="TPHA_0B01760"
                     /inference="similar to DNA sequence:INSDC:YLR438W"
                     /note="similar to Saccharomyces cerevisiae CAR2 (YLR438W);
                     ancestral locus Anc_4.317"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684283.1"
                     /db_xref="GeneID:11535142"
                     /db_xref="GOA:G8BPB8"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR010164"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8BPB8"
                     /translation="MSLGFLSSEETVKLEHEYSAHNYHPLPVVFHKASGAKVWDPEGN
                     EYLDFLSAYSAVNQGHCHPKIVRALIEQAQVLTLSSRAFSNDVFAHFAEYVTNYFNYE
                     MVLPMNTGAEAVETALKLARRWGYEKKGIPADQAIIFGVEGNFHGRTFGAISLSTDEQ
                     DSRKHFGPFLKNTMANLPDDFNHKLRYGNIEDIQLVFEKYGPLVAAIIVEPIQGEAGI
                     VVPPNDYLPKIQQLCRKYNVLFICDEIQTGIGRTGKMLCFEHFEGVKPDMVLLGKAIS
                     GGVLPVSCVLSSKDIMLTLPPGSHGSTYGGNPLSSRVAIAALEVIKEEKLVQRAETLG
                     NLLLSKLNDLKNSDSAKGMISEVRGKGLLTAIVIDSQRANGRTAWDLCLLMKSHGVLA
                     KPTHDHIIRLAPPLVISEEDLMKGIRAIEMSLSELPNAPVSGH"
     gene            <394496..>394858
                     /gene="TPHA0B01770"
                     /locus_tag="TPHA_0B01770"
                     /db_xref="GeneID:11534731"
     mRNA            <394496..>394858
                     /gene="TPHA0B01770"
                     /locus_tag="TPHA_0B01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684236.1"
                     /db_xref="GeneID:11534731"
     CDS             394496..394858
                     /gene="TPHA0B01770"
                     /locus_tag="TPHA_0B01770"
                     /inference="similar to DNA sequence:INSDC:YLR437C,YML058W"
                     /note="similar to Saccharomyces cerevisiae YLR437C and
                     SML1 (YML058W); ancestral locus Anc_4.316"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684284.1"
                     /db_xref="GeneID:11534731"
                     /db_xref="InterPro:IPR013900"
                     /db_xref="UniProtKB/TrEMBL:G8BPB9"
                     /translation="MDNLQTPPKKVQTSPATESSAQFSQYHNQLSSIGMRIRQSMDLN
                     NTTQKYLNNPLSTANYSSMVVPGYKRQDVPSNVTVPMLVNEATMSSSNLDSMFTQQPQ
                     PQMVPSNEMNSTKRKRDF"
     gene            <395221..>396279
                     /gene="TPHA0B01780"
                     /locus_tag="TPHA_0B01780"
                     /db_xref="GeneID:11535014"
     mRNA            <395221..>396279
                     /gene="TPHA0B01780"
                     /locus_tag="TPHA_0B01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684237.1"
                     /db_xref="GeneID:11535014"
     CDS             395221..396279
                     /gene="TPHA0B01780"
                     /locus_tag="TPHA_0B01780"
                     /inference="similar to DNA sequence:INSDC:YLR431C"
                     /note="similar to Saccharomyces cerevisiae ATG23
                     (YLR431C); ancestral locus Anc_4.311"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684285.1"
                     /db_xref="GeneID:11535014"
                     /db_xref="UniProtKB/TrEMBL:G8BPC0"
                     /translation="MDDDLEVKLDDVLKKNVEIKDFLDSLTALHRRALSRGESEGNAI
                     DSNVYDVNMIRNDILIAFNDLVSLNERLIHFNGKINSEIVSVKNTRVKYLNLIELENQ
                     LLVERSKWEPQMSKSEGENTYEQQENNTITINLNHRDPMNKYIELIGIDNTALNNTDN
                     DIDNDVEDRETILNSLNLLNDCETRLSKNINNLQMILNTMKKDMNFVNKEKTIINRKK
                     VFEIDKLNEKLAKLKSKKIRLLSKIGLNLPEQHRQQSQFPSLTYFNNDLHYSNILMST
                     FSINQSKDSNNDDIEHNILNHAIDFMDLKIKDLQEHLSYKKENTNSLSQQRNIWESVI
                     NIINELELKTKNIFQIHS"
     gene            complement(<396879..>403103)
                     /gene="TPHA0B01790"
                     /locus_tag="TPHA_0B01790"
                     /db_xref="GeneID:11535006"
     mRNA            complement(<396879..>403103)
                     /gene="TPHA0B01790"
                     /locus_tag="TPHA_0B01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684238.1"
                     /db_xref="GeneID:11535006"
     CDS             complement(396879..403103)
                     /gene="TPHA0B01790"
                     /locus_tag="TPHA_0B01790"
                     /inference="similar to DNA sequence:INSDC:YLR430W"
                     /note="similar to Saccharomyces cerevisiae SEN1 (YLR430W);
                     ancestral locus Anc_4.310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684286.1"
                     /db_xref="GeneID:11535006"
                     /db_xref="InterPro:IPR024481"
                     /db_xref="InterPro:IPR026852"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPC1"
                     /translation="MNSSNRIISSTDNLYKYKEIAKQLAPKIELVYSGKAPNSEETII
                     LKEVISFLVSLPEGTHLFCDEAFREITIFSIVIFSFKQQTTIDYVTHYLVKSINTCEK
                     CILQFIRGKNKILKHFAIQRLVAYQHVTEFSDMVDKWRIPIVLKRLQDITTVPSLAAA
                     LSNSSGNNDEVDKKHLEIPRDIQLAFFECLCNPKMLRLDKSLKGTFNAIFTFFLSLSL
                     PLLNSYNSLINSENLITNENNNSETIVIPEFIAGIIYCWYEGKPDQSNWAKGVLVYLQ
                     SKQFKFKVDTITFDIIEEINFHNVYLQDPSNWNHINISRFWLKFSAILTFMELPVIKE
                     YFELPKNIQSLRQTYKNFTIESIFKLWYNHLASPYQMKPTSILLRAFNMFLEIYKHDF
                     WGKVDPYTFHSVLDTIFAKDSYVIDLIQVENNADDDDDTIFLDYGTLSDMVTWTISFY
                     HSVSDSKKIQMIKKVSTIFLNFIAKKTSSNGLTNACFFNSSAALLSYVLVIKENERGL
                     LYEKDDFETILFTKIDFRIFLNNPLIQDVFIRTITNPADLYLNLDSYLSTLSSSAMEV
                     ISKCISLEILLLCHYSFKLYSGKNITDSSSSFILLKNLTDNLSLTSFQDGPALAKQVL
                     ISFRDINGLLEVSVKTQMVQNHNTKVSNFLKLSTKLLEKCTDVSPQHMSEILKDNGVA
                     QGFWSCVFSPNDDLYQAATNILYDTFDVEGRLEGIQEILQTNLTGHIRAINLVLTHLI
                     KCEFFESCPRAVRVLMDIVNTCTDPTSGIISNFLTLKDDMTIIEFRKLWNLVWIFLDT
                     IYKCTLRWASKYEYSELENFTKDTLELSRSLIDSYGEFSTVLNQDDDVMFNSVLSAIK
                     NMLYWLRLSDDQLLESCVHLISSTSDLANKKGIKFNDTLVEMMTRYALKAKKYSNKLT
                     EQQSNEILTKAKLFNDKLTASVKESVESYRKEKDLSRQTLLQKSKQPIELTPTSSSPE
                     SRADFLQRKAMASSITGRPKGSQSKLTSFGSFQSTHSPTLQGIKTTSAPPLSKMEIAR
                     RQLLNNRVVHPPSDSVFRSKHISVKRNDSSSDESELDIESARELFATAKSKKGIQTLD
                     INGKQIKRQTEAERVKMEEEYMRKRLNIDINPFYNSILKWDYNRKDEFPDEKQLNEYS
                     PVKDVYNSVEEYQSIMRSLLLLETWQGLCSARDREEYTPFPIIVGNRVAVSDFYEIYA
                     SVKKSKLTEANISESDMVVLAYLSDVQYGEKLKKAHFQRAQHTCLAKIKTLKNAKNDN
                     VDVTLRIHRSQTFTKYLTLRSEIQAMKVMQMTTVEREYTSLEGLQYYDLVPQILAANP
                     ASPPDVSTGEIEEVKRNYSLNDSQAMAVVNTVAADGFSLIQGPPGTGKTKTILGIVGH
                     ILTTQDALPKNIIKVPGEQNSSPALEQTLKRKKVLICAPSNAAVDEICLRLRNGIATN
                     NGNPFLLSVVRIGRSDAVNAAIKDLTLEELVEKKVSEKNYNMTSNPDLERKFSSCVTK
                     RRAARAKLDSENGAIDSTMSTEEITNLQLEIRELSKQINQLGKERDEIREQNSINYRN
                     RELDRRNAQARVLANSNIICSTLSGSAHDVLSTLGVKFDTVIIDEACQCTELSAIIPL
                     RYGAKRCIMVGDPNQLPPTVLSSKASSLNYDQSLFVRMEKKCSPYLLNVQYRMHPSIS
                     AFPSLEFYDGKLKDGPDMANITKRPWHSIDSLGPYKFFDIISGRHEQNSRTMSYNNPE
                     EARVAVELVDFLLKRFENKYDFTGKIGVISPYKEQVFKLRREFRNHFGLLIEKYVDFN
                     TIDGFQGQEKEIIILSCVRANDSDHASGVGFLKDFRRMNVAFTRAKSSLWILGHHRSL
                     KRDKLWNHLITNAKQRNKLELACSGFLDINNTRVIKILEHYKDSHNYIGGDDDYSPVS
                     RYDNESNNSKRKLKEIKNSTPMNENVKKQKHSREIVAPNPLRPAAKKKSSIFNKSKLD
                     EVKSQRSSKKKSSIFGGPTIGETISKTVVPYIKDKTIKNDVNKKNKKDNRTVRISDDI
                     TIIEDKHHYDDDDDEAEDEYDPLASEKYNLPTVNHIKRLHSPPLPKPSEDEDPYVPHT
                     "
     gene            <404439..>404969
                     /gene="TPHA0B01800"
                     /locus_tag="TPHA_0B01800"
                     /db_xref="GeneID:11535005"
     mRNA            <404439..>404969
                     /gene="TPHA0B01800"
                     /locus_tag="TPHA_0B01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684239.1"
                     /db_xref="GeneID:11535005"
     CDS             404439..404969
                     /gene="TPHA0B01800"
                     /locus_tag="TPHA_0B01800"
                     /inference="similar to DNA sequence:INSDC:YML055W"
                     /note="similar to Saccharomyces cerevisiae SPC2 (YML055W);
                     ancestral locus Anc_4.307"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684287.1"
                     /db_xref="GeneID:11535005"
                     /db_xref="GOA:G8BPC2"
                     /db_xref="InterPro:IPR009582"
                     /db_xref="UniProtKB/TrEMBL:G8BPC2"
                     /translation="MSVTPINVYSIPELRQTLDADISSELNRLNFKEVFTYVDMKLVI
                     GYSIGMVAGTSFIIDKNFDYKETINYQKLLVLFYVILSGAFWWLTNIFQKNVIYTGEN
                     VKEECKVVIRSHFENNNPIYILVIEKTNTKTGKVETINANLPVNKVFNEAGYLQKSLY
                     FEWLKDQLEMSAKKDL"
     gene            complement(<405110..>406162)
                     /gene="TPHA0B01810"
                     /locus_tag="TPHA_0B01810"
                     /db_xref="GeneID:11535154"
     mRNA            complement(<405110..>406162)
                     /gene="TPHA0B01810"
                     /locus_tag="TPHA_0B01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684240.1"
                     /db_xref="GeneID:11535154"
     CDS             complement(405110..406162)
                     /gene="TPHA0B01810"
                     /locus_tag="TPHA_0B01810"
                     /inference="similar to DNA sequence:INSDC:YLR426W"
                     /note="similar to Saccharomyces cerevisiae YLR426W;
                     ancestral locus Anc_4.306"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684288.1"
                     /db_xref="GeneID:11535154"
                     /db_xref="GOA:G8BPC3"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8BPC3"
                     /translation="MVLKLDIDFFINWFGLTILKYPILLYLPFLNSEHFQLPLQVYYD
                     LILYSALLRAFLLLNSWFKCTYSTSEWSPLSEIDDLNVLVTGGSNGLGKALIETILTE
                     LGEKKKVNIINIDISNYSGNDERVHTYLCDLTIPSMLNKIIDTIYENVLIGGTKQFHL
                     IINNAGMRSKFKKFEAFTEKEIRDLMQINSITPVTIIQRLSPLRNCKQIDSKHKQCYI
                     VNIASSLGILAASKVSIYAASKAALISFHNSLKFEILADPTNKRNIKTLLVIAGQLNT
                     EMFSGFTPPRQFFAPIVDVKDLSRKIINKCNIGEFCQLNEPFYANFAYLLMSLPLVIQ
                     WIARKLSGMDNCLPDE"
     gene            complement(<406416..>408146)
                     /gene="TPHA0B01820"
                     /locus_tag="TPHA_0B01820"
                     /db_xref="GeneID:11534869"
     mRNA            complement(<406416..>408146)
                     /gene="TPHA0B01820"
                     /locus_tag="TPHA_0B01820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684241.1"
                     /db_xref="GeneID:11534869"
     CDS             complement(406416..408146)
                     /gene="TPHA0B01820"
                     /locus_tag="TPHA_0B01820"
                     /inference="similar to DNA sequence:INSDC:YML054C"
                     /note="similar to Saccharomyces cerevisiae CYB2 (YML054C);
                     ancestral locus Anc_4.304"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684289.1"
                     /db_xref="GeneID:11534869"
                     /db_xref="GOA:G8BPC4"
                     /db_xref="InterPro:IPR000262"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR008259"
                     /db_xref="InterPro:IPR012133"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:G8BPC4"
                     /translation="MYNKRFVLNYARFRTFPHRSYSRQYTVNNTKVKLPGNYFYYGIL
                     GLFLISASNFACDRYYRNDSMLLKNSKVITPEEVARHNKRDDCWVVINDSVYNLTDFI
                     DSHPGGKNVIVANSGKDVTKLFEPIHAPNVLEKYLQPKMRLGTLSKPMPPELVCDVYA
                     PGETAEELNSKIKLRASLPALNEISNIYDFEYLASKILSKQAWAYYSSGSDDEISLRE
                     NHNAYHRIFFNPRVLVDVSEIDTSTTIFGKKQDVPFYASATALCKLGNPLEGEKDITR
                     GCGQGPTKIPQMVSTLASCSPSEISSSKIDNNQSLWFQLYLNHDRNLTNLLVKEVEKL
                     GYTAIFVTVDAPTFGKREKDAKLKFLKDQEGSAKIMKDKPSSDEEAGASRALSKFIDP
                     SVTWNDIAELKKLTTLPIIIKGVQRKEDILKAAEIGCQGVVISNHGGRQLDFAKAPIE
                     VLAESMDILKERKLDKTFNVFIDGGIRRGTDILKALCLGAKGIGLGRPFLYANSCYGK
                     DGVQKTIDILKYELEMSMRLLGVTSIDELDESFLDLSSIKNRTVLVPKDTLSEMVYNP
                     SKLIEILPKE"
     gap             409563..410172
                     /estimated_length=610
     gene            412620..412693
                     /gene="TPHA0Btrna8N"
                     /locus_tag="TPHA_0Btrna8N"
                     /db_xref="GeneID:11535121"
     tRNA            412620..412693
                     /gene="TPHA0Btrna8N"
                     /locus_tag="TPHA_0Btrna8N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:11535121"
     gene            complement(<412955..>413563)
                     /gene="TPHA0B01840"
                     /locus_tag="TPHA_0B01840"
                     /db_xref="GeneID:11535068"
     mRNA            complement(<412955..>413563)
                     /gene="TPHA0B01840"
                     /locus_tag="TPHA_0B01840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684242.1"
                     /db_xref="GeneID:11535068"
     CDS             complement(412955..413563)
                     /gene="TPHA0B01840"
                     /locus_tag="TPHA_0B01840"
                     /inference="similar to DNA sequence:INSDC:YKL196C"
                     /note="similar to Saccharomyces cerevisiae YKT6 (YKL196C);
                     ancestral locus Anc_4.303"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684290.1"
                     /db_xref="GeneID:11535068"
                     /db_xref="GOA:G8BPC5"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR010908"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:G8BPC5"
                     /translation="MKINYIGIFRNGEGDGKALELSEVKDLSQFGFFERSSVGQFMTF
                     FAETVASRTSAGQRQSVEEGNYVGHVYARSEGVCGVLITDKEYPVRPAYTLLNKILDE
                     YLVAHQPSEWENITETNENLKFKELEIYINKYQDPSQADAIMKVQQELDETKIVLHKT
                     IENVLQRGEKLDNLVDKSESLTASSKMFYKQAKKTNSCCVIV"
     gene            <414079..>415077
                     /gene="TPHA0B01850"
                     /locus_tag="TPHA_0B01850"
                     /db_xref="GeneID:11535033"
     mRNA            <414079..>415077
                     /gene="TPHA0B01850"
                     /locus_tag="TPHA_0B01850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684243.1"
                     /db_xref="GeneID:11535033"
     CDS             414079..415077
                     /gene="TPHA0B01850"
                     /locus_tag="TPHA_0B01850"
                     /inference="similar to DNA sequence:INSDC:YKL195W"
                     /note="similar to Saccharomyces cerevisiae MIA40
                     (YKL195W); ancestral locus Anc_4.302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684291.1"
                     /db_xref="GeneID:11535033"
                     /db_xref="InterPro:IPR010625"
                     /db_xref="UniProtKB/TrEMBL:G8BPC6"
                     /translation="MFLARLRIASRCSSNGVLRSTYRSTLKSNIRLSGLNARYSTNPA
                     NFNDNNSYERLNKRRNELMGITVAAVITLGAVLYILPSKKNNKKASDEVIIQVTEVTN
                     SDDGSNSPLIETPAVAEIEVDEPLAVPELEVAQNISSDDLDKDLIDIGESVVAEIVSD
                     SVTGGQLETVTKITSPDHGSAVATIVEEAVDTENVNVDNDKSALELQAFEEEKLGETE
                     EEAQHEGAVNPDTGEINWDCACLGGMAYGPCGEEFKEAFACFVYSEAEPKGIDCVEKF
                     QAMQTCFRRYPDYYAEQLKDEDDATAEETDKTKTDASAPPAQSAQPENSSSESSEA"
     gene            complement(<415476..>417269)
                     /gene="TPHA0B01860"
                     /locus_tag="TPHA_0B01860"
                     /db_xref="GeneID:11534976"
     mRNA            complement(<415476..>417269)
                     /gene="TPHA0B01860"
                     /locus_tag="TPHA_0B01860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684244.1"
                     /db_xref="GeneID:11534976"
     CDS             complement(415476..417269)
                     /gene="TPHA0B01860"
                     /locus_tag="TPHA_0B01860"
                     /inference="similar to DNA sequence:INSDC:YLR424W"
                     /note="similar to Saccharomyces cerevisiae SPP382
                     (YLR424W); ancestral locus Anc_4.301"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684292.1"
                     /db_xref="GeneID:11534976"
                     /db_xref="GOA:G8BPC7"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="UniProtKB/TrEMBL:G8BPC7"
                     /translation="MQNLGHYDPYGYSENESDNASDGISVSSELDGREVNREDSKQVH
                     KDDKLTKKYGIGARLLSKMGFVEGQGLGRDGKGIAQPIHAEQRPQGHVGLGSFIGDNR
                     KVEEAENLRDTYSSSSDEFVSHSQVKFNASKTFQLNNNINLKFNNEEFNLKFLKYKDK
                     LPSEIVQKYETNKLQSNQKTKLWGSLSDLSNLYAEVDTINSKLESLNVSISSYEQNSL
                     KIAALLSEYHQDLKLLPAILCNNNDYDRNEISFKNYLRTILESVDSDELTDEIVSRLI
                     MERYSTIPNEIFLQVTEEKNLIFTELQYIIMTFPSIFQNISKTLNYSQSSLYNVIVPS
                     MRNLWQSLKDADIKTVDLFLFLLGTYATVFESIKIKDYIENNIIYQSLYSIVSDWDLN
                     DSYTKYPILKLSKSYWNEDLQQLLLENYRSHCESFNAETNSFLSKDNRSILANLIPRQ
                     DMYKATSIYIVPKLKQSWNLNVDILKEFETWNDNFFDNTVGTFSFVSLLVNFQNALPK
                     EYISSWLLCILNELNKLLFEFCQYSNLEEREHIKAFAAWFLDKLNADYFDLETYIPAE
                     FDMCFEFIESLSESDLKAIHNKSLELPTNIL"
     gene            <417669..>418922
                     /gene="TPHA0B01870"
                     /locus_tag="TPHA_0B01870"
                     /db_xref="GeneID:11534915"
     mRNA            <417669..>418922
                     /gene="TPHA0B01870"
                     /locus_tag="TPHA_0B01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684245.1"
                     /db_xref="GeneID:11534915"
     CDS             417669..418922
                     /gene="TPHA0B01870"
                     /locus_tag="TPHA_0B01870"
                     /inference="similar to DNA sequence:INSDC:YLR423C"
                     /note="similar to Saccharomyces cerevisiae ATG17
                     (YLR423C); ancestral locus Anc_4.300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684293.1"
                     /db_xref="GeneID:11534915"
                     /db_xref="GOA:G8BPC8"
                     /db_xref="InterPro:IPR007240"
                     /db_xref="UniProtKB/TrEMBL:G8BPC8"
                     /translation="MSSQDYLNNARKSLVEAQVVSQETNINIKNIKDRLTELEKSIGK
                     GKFIRKSLEKQVQFLRNNILRDFIERRLINKEWSQVILIDMVRDLHHWNALIRNQAEV
                     LENTKNVLNDPSKKTFDNEFQTLGSFISQDNLNILEARLNEIPNIELHIDTIKHQYQI
                     MVNKIDTELIKKDMQDLFLKFEKTFDQDSDEMQKLLLKYPTELKELECDIVNYLSSLT
                     HHYEQCQLLCDIDEFSPDFKELSEIIKADNNELHIISESLEETVKNINGRINSVSKLL
                     ANKEKESLEYKKLFKDLLKKFKTNHEYLLIFKEIAEIIEKFKNTCIQDMSYIEDLYHF
                     YQNFESSYQNMLQEINRRKQVAKEMQKILDDCESQLKALSLKDKVCREQFLNENGKYL
                     PENILPAEMQSSKPLYSLEYSINKY"
     gene            complement(<418994..>420391)
                     /gene="TPHA0B01880"
                     /locus_tag="TPHA_0B01880"
                     /db_xref="GeneID:11534986"
     mRNA            complement(<418994..>420391)
                     /gene="TPHA0B01880"
                     /locus_tag="TPHA_0B01880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684246.1"
                     /db_xref="GeneID:11534986"
     CDS             complement(418994..420391)
                     /gene="TPHA0B01880"
                     /locus_tag="TPHA_0B01880"
                     /inference="similar to DNA sequence:INSDC:YKL194C"
                     /note="similar to Saccharomyces cerevisiae MST1 (YKL194C);
                     ancestral locus Anc_4.299"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684294.1"
                     /db_xref="GeneID:11534986"
                     /db_xref="GOA:G8BPC9"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002320"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:G8BPC9"
                     /translation="MLRARTVVSKYAPKHISYSTKATVVNDSKNSLNISEKKVDNILN
                     EVNKDQKLYMNDPVSPGSIFFLPDGTKIFNKLVEFMKLQQEYKFGFKEVITPLIYKKS
                     LWEQSGHWINYKDDMFRVESQDKSKEEYGLKPMNCPGHCMIFQHADRSYSELPMRLSD
                     YSPLHRNEASGALSGLTRVRKFHQDDGHIFCTPEQVGEEIAKCIKLIDLCYKRVFTLN
                     RNSGPSYTLEVSTRPEKYIGELKTWDHAEDMLKNALESLKKDYSINEGDGAFYGPKID
                     IKVTDHKNKSHQVATIQLDFQLPERFKLRYKDKDNTYKRPIMIHRAVFGSLERFIAML
                     VETNEGSWPFWLNPRQAMIIPVNTKSAEQVKMAKEVHLKLKGEDIGSKNDFSIPVPNN
                     GYHFNVDIDLRSEPIGRRIKDAINKKYSYIITVGDNEVKSNIYSIRNRQTFEIEALSY
                     EKIFEQFKTLQTNYS"
     gene            complement(<421041..>421406)
                     /gene="TPHA0B01890"
                     /locus_tag="TPHA_0B01890"
                     /db_xref="GeneID:11535107"
     mRNA            complement(<421041..>421406)
                     /gene="TPHA0B01890"
                     /locus_tag="TPHA_0B01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684247.1"
                     /db_xref="GeneID:11535107"
     CDS             complement(421041..421406)
                     /gene="TPHA0B01890"
                     /locus_tag="TPHA_0B01890"
                     /inference="similar to DNA sequence:INSDC:YKL192C"
                     /note="similar to Saccharomyces cerevisiae ACP1 (YKL192C);
                     ancestral locus Anc_4.297"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684295.1"
                     /db_xref="GeneID:11535107"
                     /db_xref="GOA:G8BPD0"
                     /db_xref="InterPro:IPR003231"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="UniProtKB/TrEMBL:G8BPD0"
                     /translation="MFKNIFRTTASLATRSVVITTRPTYVAPSFIRLYSASALNKEDV
                     TKRVVDVIRKFDKSLANSQIEPKSLFHKDLGLDSLDTVELLVAIEEEFDLQLPDKVAD
                     ELKSVGETVDYIISNPEAN"
     gene            complement(<421833..>427454)
                     /gene="TPHA0B01900"
                     /locus_tag="TPHA_0B01900"
                     /db_xref="GeneID:11534966"
     mRNA            complement(<421833..>427454)
                     /gene="TPHA0B01900"
                     /locus_tag="TPHA_0B01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684248.1"
                     /db_xref="GeneID:11534966"
     CDS             complement(421833..427454)
                     /gene="TPHA0B01900"
                     /locus_tag="TPHA_0B01900"
                     /inference="similar to DNA sequence:INSDC:YLR422W"
                     /note="similar to Saccharomyces cerevisiae YLR422W;
                     ancestral locus Anc_4.296"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684296.1"
                     /db_xref="GeneID:11534966"
                     /db_xref="GOA:G8BPD1"
                     /db_xref="InterPro:IPR010703"
                     /db_xref="InterPro:IPR026791"
                     /db_xref="InterPro:IPR027357"
                     /db_xref="UniProtKB/TrEMBL:G8BPD1"
                     /translation="MAPGNYKVAKQSNVNDDTWIPMDNFIHAIMVKPFLPLSKLSSLK
                     DYSNNYQDLYPGSELYIFEQTKIKNRSRAYLCWDPLPQDYVARANSLGSKLPDVSTKT
                     TIFPTKYATLNPTRYTGDVPSLKIHHSKVQSLNESKISMPDNFMNQLKNSDKLENTIL
                     VEYLKLDKKPRIPDFPIFRFDERPVRDEFGPILSLLGSYIMVSYTNNEMNAYEQLTKL
                     YCQLEKIHIKLRFNLYTNDNKSFLIRHATSIHSKACKHLTQDIKKELRNSKLNDKRNL
                     SNKIDSSGFNGIFARDVNTGELLALGNSDISTFMTSSIFFGFLNDFPLTNLEAIHSLN
                     INKNKEFFEFTPVGMLIEVLDINNDANGLDPKFSNVSASMYLRTKDIILTDSFTVNIK
                     TDNILSLDNISTALFSNIDEEKAENETIYLVVVLYEDIPIKISSKTKSTYDFTGATSS
                     PEFNFLDSVKRGISVGVADITRVFSNKKGALNTGVAYKFKVNLFGSYFEPASSISNTR
                     EYSSTGGWGELIENIVKSSTKGVVVNPRAIYLWISIKEFRGKLELNRIIDSNNFAIKN
                     IPQYGYDASLNPEERVMLKIGRVSILTDDNIRSNVRLISVRIVSKNANLLFSTSSTDE
                     KTNDWSFISAIPGEILGDEIRVTGIEQLMDNESISVYVYFNGFLSGTGEIDIFKDNKL
                     CLTQGFEELILPSFNHNCKIIIELSKVYFGNKFCVPDDVSNFLNYDNICNHQITNEQT
                     GLEKVLYLERVVRKLNSVDIKIIQKYTTEIFTKYIMLFCEINEIDVDYDLKKEAIMAI
                     TGSGSELHLKSLIDNKTFKRKIFDFSLSYSVDNNDVLPDKTKYGTYLFRAIEELLANK
                     DKKFRHFRFACLQLYVYVVTFITINGKVEDPTGLIKKSISFYCENVLTLASGSDNFSA
                     EEQCLIIKDMDSVIELIHNWFPPNELLYFIEQMLLSSEDKLIYETYISGLSDANEQQY
                     VYEKLSLILKVLRLQKLKDIMYDTNDDKLDNARFISAVMDFTLNIYQASLNGQFNILV
                     MRICNSVILEILLNVKKDIIQKNLFRLLPEFCRIFLVVEKYCQNEHHFRPKRLFSNLF
                     PDAAPPDIYTVGSSMGSVVLVEILLELATIISKLVFLTENLYGNSLSIITIMKDINGH
                     ILSKHFRSKYYSSFINIDSLVLIINIVKRFVKGTFYPSDLLLSITAMFLKISNLMLLM
                     YKDFLISTIETDDNDTLEHFNSKLWIEYLKLTLKIFNHRLSFNRNLAIIPRKAIHKIC
                     GDVNELSKTIFIECWDSLESRDDKTENIKNYGVNILSFRQRYLVFDSPSLLRHILSLA
                     LRIDEESMLIGSRIILQMLLTSWKIKKALSDVKILIVLAFYNLSMLNPIIFENLDHVK
                     FIRANFSIMNIRKYDGKLIECLLLFYNEISQFLLLLIHTQSTPDIEEYANSRTMLQLD
                     VLSYLLDAKRPLQFYKLLSELFNQYIERKDFVQAALCLEHVANTYDWNPTDYLDELTF
                     FSLPSQSSFERKESLYIKSAEYFVKGSKLEKALTIYKDLATAYENINYNLNGLSFVYL
                     QISKIYKDLQTLDRLDPSYFCVMFLGYGFPASKRNKMFIYEGMPFEHISSMHARLLRY
                     HQGSTIVNSLNNAMELKNAPTVGKFLYVTTVEPQLNISDEYYSSETNYDLANKVRTYV
                     ENRDLKTFVSLRRLPGSTSVVDLWVEEDKYVTAATFPTLMNYSEIVSIVIKKLSPIEN
                     ATRMLQLKIQELCSFENICCKTITEKGPSSIIYLEMSRCVTGTISAPINGGIIQYKEF
                     FEMSQLANKPTEEEFIILTKLFDELAMVLGRCLVLLRKIIPSDELEKSHAALVSQFKK
                     NFKNEILKNNILIEDMPIEKLTKLKSKHSTK"
     gene            <428811..>429290
                     /gene="TPHA0B01910"
                     /locus_tag="TPHA_0B01910"
                     /db_xref="GeneID:11535094"
     mRNA            <428811..>429290
                     /gene="TPHA0B01910"
                     /locus_tag="TPHA_0B01910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684249.1"
                     /db_xref="GeneID:11535094"
     CDS             428811..429290
                     /gene="TPHA0B01910"
                     /locus_tag="TPHA_0B01910"
                     /inference="similar to DNA sequence:INSDC:YLR421C"
                     /note="similar to Saccharomyces cerevisiae RPN13
                     (YLR421C); ancestral locus Anc_4.295"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684297.1"
                     /db_xref="GeneID:11535094"
                     /db_xref="GOA:G8BPD2"
                     /db_xref="InterPro:IPR006773"
                     /db_xref="UniProtKB/TrEMBL:G8BPD2"
                     /translation="MSTVKSIPKKIKFRAGIAKFDEVTKECIPLAVQGEIHLDASEEE
                     SELGFYDFEWKPTEDVNNPNNTPINLILIPGETVFVPIKSCTTGRVFAIIFSSNEKYF
                     FWLQEKNPSNLRVNELSSNDKEIYQRITAILTAFEDDEDNEEGKALLNEKEKDVEME"
     gene            <429880..>431592
                     /gene="TPHA0B01920"
                     /locus_tag="TPHA_0B01920"
                     /db_xref="GeneID:11535179"
     mRNA            <429880..>431592
                     /gene="TPHA0B01920"
                     /locus_tag="TPHA_0B01920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684250.1"
                     /db_xref="GeneID:11535179"
     CDS             429880..431592
                     /gene="TPHA0B01920"
                     /locus_tag="TPHA_0B01920"
                     /inference="similar to DNA sequence:INSDC:YKL191W"
                     /note="similar to Saccharomyces cerevisiae DPH2 (YKL191W);
                     ancestral locus Anc_4.293"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684298.1"
                     /db_xref="GeneID:11535179"
                     /db_xref="GOA:G8BPD3"
                     /db_xref="InterPro:IPR002728"
                     /db_xref="InterPro:IPR010014"
                     /db_xref="UniProtKB/TrEMBL:G8BPD3"
                     /translation="MSDSGIESNDFVPPVLSTDQDENTFSFQKYSTTEKEREFYLGKY
                     TEDELKEKIFDYYNLKGLIQYFKNHPEYYKVTLQFPDSLIHDSTIVVGILQEVLNNEV
                     PILGLEKDMNENSTTPDMSTRKFWVLADTAYSACCVDEVASEHVQSQIVVHFGDACLN
                     AIQKLPVVYSFGNSYLDTSKVIEKFKDQFDDHDAKICLMADFPNSHNITSIYKALLEE
                     NYKNLYLSSINPELANDKVTILGNSELEPSLKMVHTFGNRALYTIDTNFKNFNDDQLR
                     EEFQLFHISKPMDPHLLYLTTMFQSVSIYDIKDDTIMNGPFPSLMKRYKYMHVARTAG
                     CIGILVNTLSLRNTKETISRLSKLIKDNGKKHYLFVVGKPNVAKLANFEAVDIWCVLG
                     CGQSGIILDQYNEFYKPIITPYELTMALNDKVTWTGKWLVDFKQVLNEIEKGEEEKEE
                     DNINGVSYNNEVNEDSLVPEFDAVTGRYISTSRPLRNITHLSIDNPNDNSSSSTSLIK
                     NVSGGVLIKGTVSTSAEALQNREWSGLGSDFAQQDGYEEEGATLEQGIGGVARGYGFD
                     RNRN"
     gene            <432107..>432634
                     /gene="TPHA0B01930"
                     /locus_tag="TPHA_0B01930"
                     /db_xref="GeneID:11535119"
     mRNA            <432107..>432634
                     /gene="TPHA0B01930"
                     /locus_tag="TPHA_0B01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684251.1"
                     /db_xref="GeneID:11535119"
     CDS             432107..432634
                     /gene="TPHA0B01930"
                     /locus_tag="TPHA_0B01930"
                     /inference="similar to DNA sequence:INSDC:YKL190W"
                     /note="similar to Saccharomyces cerevisiae CNB1 (YKL190W);
                     ancestral locus Anc_4.292"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684299.1"
                     /db_xref="GeneID:11535119"
                     /db_xref="GOA:G8BPD4"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:G8BPD4"
                     /translation="MGATSSKLIENLLEDTNFDRDEIERLRKRFMKLDSDSSGSIDKS
                     EFMSIPGVSSNPLAARIMEVFDSDNSGDIDFQEFITGLSIFSGRGSKDEKLRFAFKIY
                     DIDKDGYISNGELFIVLKIMVGNNLDDEQLQQVVDRTIMENDLDGDNHLSFEEFKSAI
                     ETTEVAKSLTLSYGV"
     gene            434387..434460
                     /gene="TPHA0Btrna13V"
                     /locus_tag="TPHA_0Btrna13V"
                     /db_xref="GeneID:11534795"
     tRNA            434387..434460
                     /gene="TPHA0Btrna13V"
                     /locus_tag="TPHA_0Btrna13V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:11534795"
     gene            <434881..>437436
                     /gene="TPHA0B01940"
                     /locus_tag="TPHA_0B01940"
                     /db_xref="GeneID:11534914"
     mRNA            <434881..>437436
                     /gene="TPHA0B01940"
                     /locus_tag="TPHA_0B01940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684252.1"
                     /db_xref="GeneID:11534914"
     CDS             434881..437436
                     /gene="TPHA0B01940"
                     /locus_tag="TPHA_0B01940"
                     /inference="similar to DNA sequence:INSDC:YKL188C"
                     /note="similar to Saccharomyces cerevisiae PXA2 (YKL188C);
                     ancestral locus Anc_4.287"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684300.1"
                     /db_xref="GeneID:11534914"
                     /db_xref="GOA:G8BPD5"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010509"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPD5"
                     /translation="MISSNFLDIYKRNRVAILRASTVVLLYSTFKNSMANDNYKRTRS
                     DKRERKRRKSNIEDQNPQEIQLIDIEDEENNEVRNSTSNEENQRLSNNFLFRLILKDK
                     KCLLLFLVQSVLLVLRTVLTLHVATLDGKLVSALVKARYLDFLKILLGQWMTLGIPAS
                     FINASIQYVTKLCAITINKQLSNHLLDKYLKNYKVFYSVVTNSNGPPEPLNNSEVSDN
                     HNVDNDNDHKEGVKKVSLKTPEIQDHLTRDIYQFSTNSSMLLNQLLKPTLDLLLCSFK
                     LLTGNTTMMGESTLVLGLIVNFSNSFLRLIQPNFTQLTMLRSSLESWFRTLHSNIRSN
                     NEEIAILRGQDKELTNLDYSFYQLVLFLNREIKERALYDFATTFVIKYTWGVAGLILC
                     SIPIFFGEKDSKGKMMNRDVIAEFITNRRLLLTASGSVGRFVELKRNVQQLRGIWMRL
                     NSFNNSLEYNTAIDSKIDNALEDQLISYDNSKIEFINVPLITPAGQVLVPELNFRLEH
                     GNHLLIIGPNGCGKSSLFRILGGLWPVRQTLVEGHETKLIMPSRNSENECTVYYLPQR
                     PYMGNRSTFREQIIYPDSIEQFEKRFQGNYMKGDEFLMEILKILDLDDLISENMSLVL
                     AKRSKIDFVNETNNTVEIKDSFDLIRNWSDELSIGIQQRLAMARMYYHKPKFAVLDEC
                     TSAVSPLMEQRMYENAQRFNISLISVCHRTSLWHFHNYLLKFDGLGGYKFGEFNPVER
                     LSNEEKLTELNVILNQQTPIWEKRLQELTEARKSNIIRKSQTDLKAMEDLQKDFNYRP
                     RSPVKLLMMNEKARNSSTSLPSSGRTALKNNISSKKNSKLRKESLKSTEKQKK"
     gene            <437768..>439381
                     /gene="TPHA0B01950"
                     /locus_tag="TPHA_0B01950"
                     /db_xref="GeneID:11535150"
     mRNA            <437768..>439381
                     /gene="TPHA0B01950"
                     /locus_tag="TPHA_0B01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684253.1"
                     /db_xref="GeneID:11535150"
     CDS             437768..439381
                     /gene="TPHA0B01950"
                     /locus_tag="TPHA_0B01950"
                     /inference="similar to DNA sequence:INSDC:YLR417W"
                     /note="similar to Saccharomyces cerevisiae VPS36
                     (YLR417W); ancestral locus Anc_4.288"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684301.1"
                     /db_xref="GeneID:11535150"
                     /db_xref="GOA:G8BPD6"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR007286"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR021648"
                     /db_xref="UniProtKB/TrEMBL:G8BPD6"
                     /translation="MECWHYVEVTKSGQPILRENEKDILIEDKIGLYHGKNRIKNRQS
                     GRLFLTTQRLIYVDDVNPVKYSVCLELDDIDHLEYSSRFLKRSAKVILFLLDMGNLKS
                     GGQSTSKAEGPINEVSTWVCPICMFTNETEGVLTENTFPSPICENCGVPLVYEMTMNT
                     INIIDNKLGNSDSNLEGSGEKNLNACPACTFINHALIKNCEICGARLPNAKIRSHNVN
                     HEDSRVLIELDCKLLRDKSNKNSNLEADFVQFSFRKGDGLLFSQALEKSLEDIKNLRQ
                     KNSFNEGIVSINGISIGIKETVELPYLEKRLNKFGITSLENSRETQLANNDILLSNAL
                     TDLNQLMSLANDIEKVFKTHMKNETDNLQNKPSFLIDREKFYNKSMFLNEIAREIFQF
                     VITEFKSEKNDDIIMVTLVDLYALYNKTMRIGMGYISPSEMREACGRFEVLGLTSLKL
                     KKLNGRVLCLSSENSFDYINNQIIKLLEDEPGCDILQITQTMNKHSTGTSWTIGIITE
                     VLENCINKGEIVIDEQLSGLTYYKNDIWI"
     gene            complement(<439468..>440562)
                     /gene="TPHA0B01960"
                     /locus_tag="TPHA_0B01960"
                     /db_xref="GeneID:11535112"
     mRNA            complement(<439468..>440562)
                     /gene="TPHA0B01960"
                     /locus_tag="TPHA_0B01960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684254.1"
                     /db_xref="GeneID:11535112"
     CDS             complement(439468..440562)
                     /gene="TPHA0B01960"
                     /locus_tag="TPHA_0B01960"
                     /inference="similar to DNA sequence:INSDC:YKL189W"
                     /note="similar to Saccharomyces cerevisiae HYM1 (YKL189W);
                     ancestral locus Anc_4.289"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684302.1"
                     /db_xref="GeneID:11535112"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013878"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR028637"
                     /db_xref="UniProtKB/TrEMBL:G8BPD7"
                     /translation="MFKRYRNQEFDMTFWWKKHPKEPTEYAKYITEQLHNLLVSDSIE
                     TKKFVNQEIKKYLIIMKSIMLHEVEPKISDEIETKFYNEIINCDLFLKLIRHLPDLEF
                     ETRKDIIFLYSLSLRYFNETNSSQTQHFFINPVMISTMLRSTELVIVGNSSRDIFLTL
                     TNMIIESSKYERMCELLLNDEFIWRIFEYCNLPDFEISTEALHIITTVFSIHSEVVSE
                     FFLKGNKTSTCHELTGVNNNATRFIRNVNNLLVNGSYVCKRQITKLLGSLLILRANNK
                     LMMVYINNPENLRLIMTLLGNKSKSLQFEAFNIFKIIVANPEKPLTILQILANNREKL
                     LAHLPKIGMENKDSTFSDEIDYIMQEINSF"
     gene            complement(<441193..>442422)
                     /gene="TPHA0B01970"
                     /locus_tag="TPHA_0B01970"
                     /db_xref="GeneID:11534763"
     mRNA            complement(<441193..>442422)
                     /gene="TPHA0B01970"
                     /locus_tag="TPHA_0B01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684255.1"
                     /db_xref="GeneID:11534763"
     CDS             complement(441193..442422)
                     /gene="TPHA0B01970"
                     /locus_tag="TPHA_0B01970"
                     /inference="similar to DNA sequence:INSDC:YLR418C"
                     /note="similar to Saccharomyces cerevisiae CDC73
                     (YLR418C); ancestral locus Anc_4.290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684303.1"
                     /db_xref="GeneID:11534763"
                     /db_xref="InterPro:IPR007852"
                     /db_xref="UniProtKB/TrEMBL:G8BPD8"
                     /translation="MSILNQIRDLFINQKTFKLFDKDNNETNDIAIADIIKFDDNENK
                     AFKLDTLTEFSVDGNILPLRLIVHCWLNKDSTAAEYLSDCQAKQLTNVSFLHRTDLIN
                     WLSGQLEKSSYVNTGSTEATQDDNTNNTSKSQTENENLQSETYSSTSVTSNNIIPSKG
                     SVNAETLNVTNNIELLKSSDAVLAKTLENTRELLNHNTELRGSKPIDFGYLIKDAELK
                     IVQSIKSSLRSSKGKSSSTGISKNREKKVVLQKDPIILIPSATSSIFTLTNIKQFLED
                     SKYVSPRDLSVNLQQDLVTVEKKLDGLSRPIRFLIVNNTRMFTKPEYWERVVAVFTTG
                     HEWQFNNYQWSKPQDLFQHTKGYYFHFTGDTVPPNVQKWNVQKVEIDRNKRFKDVEVV
                     RFFWYNLEKELLARGYR"
     gene            <442882..>447234
                     /gene="TPHA0B01980"
                     /locus_tag="TPHA_0B01980"
                     /db_xref="GeneID:11534779"
     mRNA            <442882..>447234
                     /gene="TPHA0B01980"
                     /locus_tag="TPHA_0B01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684256.1"
                     /db_xref="GeneID:11534779"
     CDS             442882..447234
                     /gene="TPHA0B01980"
                     /locus_tag="TPHA_0B01980"
                     /inference="similar to DNA sequence:INSDC:YLR419W"
                     /note="similar to Saccharomyces cerevisiae YLR419W;
                     ancestral locus Anc_4.291"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684304.1"
                     /db_xref="GeneID:11534779"
                     /db_xref="GOA:G8BPD9"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPD9"
                     /translation="MAKKGKSSSKVSTPVIEKVDTKKSGKKGKKGKSEEPAEYIDPKE
                     ANRAKQQQNRAKVTSTASWTGKLPHTILHENCQKRKWNKVEYDMKRIGDKGLVATAVI
                     SYTDPKTKEVITIKMHDPTYDKTTGKGLSLPQETPMEARHIAATIALYRIAYNTNMQM
                     MLPPNHKNLWYDLSDYRKDLLESNPKKAATLFDVDPFKSTLEERKKKEQQEKERDARF
                     QQSQKENKRTIVISINSSSEDREKNNNKSSSKSKNFKSLNQDKINSIKNSNLVSFPRK
                     VWDNATFIDLSETTRQLIEVSLKHYINWNYQLYNDKYSTPQSKEARKALENKLLSLNF
                     RKPHVTEAMQYQDPLSFLLFNLPEDDLPPFFHKRKEDSDNVIEIAKLPLATRNIIDRL
                     GESGLSKDVILLCLEQCNFNEAEAAGMLTLNSLPSLKIDKSQYVSEEGSRNMWDEELE
                     SLKSIYGDSIEINNKEDSLTMVLLEKFHLKVKFYKTKYYPSTLPGIIVSTLEKSVTLP
                     NYIKQQIILKLLHYIQTMELLNDMMLYNIYEWLVDNVPKIIENPGSLLSDGDLEKSLL
                     NNSKEIKSSTSNKIKKKNRSQQNLLTDSDIANLKLEYQLRMKSTDYQLMKNNRMNLPA
                     WKEQQVITDLCFQNDVILITGETGSGKSTQVVQFILDHLVQKGRFQTKIICTQPRRIS
                     AIGLAERVSEERCTSCGDEVGYVIRGINKTNDKTRIKFMTTGVLVRILQTDINYLRDS
                     IIVIDEVHERSIDTDLVVILLKNLLEKVKGLKIILMSATVNVDVFKTYFKNLGQCHIE
                     GRTYPIKDYFLEDILTSTNFTIEKAKGKYEYDDDVNEAPQNIAPSAESNFFKSGNINY
                     DLISELIVYIDQQLKKEQNDGSVIVFLPGVAEINKCCRMLESNNKSNEFVVLPLHSAL
                     TPEEQKRVFKKFGSKRKIVVSTNIAETSITIDDCVATVDSGRAKTMLYNSRDNTTRLV
                     EAFISKAEAKQRRGRAGRVREGLSFRLYSKRLYEEDMVEMPTPEIRRTSLESLYLSVK
                     SMGVKDVKMFLSGGLDPPPTASLKKAEDMLTTVGLLKNEDNSLTQLGQFISLMPVMDS
                     KHGKLLIYSIIFGCADLGVLIVSTLSGNSLPFLAGVENRDKVRAILSKNESLGDVLST
                     VLLLKKYISLNDSTSKRNFMKENFLSFNKVSDIMSSRTQFYSILKDVGFLPMNYRPGS
                     SDELNVNENNLPLIKSILAGAFYPNITRVELPDAKFASTSVGAIEKNADAKLIKYWIR
                     NENYIQKLNEVREKLKSNPDFHIERDQLPLPATKSFIHPSSVLFSTKSLNEEEMESLS
                     LDYAPVLKNKNTEITKYPFLVFTGSFVTSKLFLKDITPTSTLAVLLFGGPINYETNGA
                     THSQGIVVDDWLPIRTWCKNGVLMKELRNLLDTAIKEKLINPQYTSGQTETSSSADVI
                     LKTVQKIITIEQSK"
     gene            <448264..>449067
                     /gene="TPHA0B01990"
                     /locus_tag="TPHA_0B01990"
                     /db_xref="GeneID:11535036"
     mRNA            <448264..>449067
                     /gene="TPHA0B01990"
                     /locus_tag="TPHA_0B01990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684257.1"
                     /db_xref="GeneID:11535036"
     CDS             448264..449067
                     /gene="TPHA0B01990"
                     /locus_tag="TPHA_0B01990"
                     /inference="similar to DNA sequence:INSDC:YLR414C"
                     /note="similar to Saccharomyces cerevisiae YLR414C;
                     ancestral locus Anc_4.286"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684305.1"
                     /db_xref="GeneID:11535036"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:G8BPE0"
                     /translation="MANGAKLFLAGIITFVSFIIAIVSFAGSTSNYKPINEIYVAHLN
                     LKNIKNDAVFTNLTQALDSNSLPNYINIGLWSYCISGTNSDKIEKCTSPKGIQEFDLK
                     TLLYDNVANNESEDLLDSIDDILLPDSIANKKGYYNGLSRCMWITLIIGIIVLFLDLI
                     FIILRMLFALRALKIIGLFLACVAFASLIISGSTSVATYVYIKVHLNKNYDEYGIKLD
                     LGRNFFCILWGSILGSLLNLLLWVSVRDDVRRTYVTQAGPSQSGKRIIL"
     gene            complement(<449543..>451609)
                     /gene="TPHA0B02000"
                     /locus_tag="TPHA_0B02000"
                     /db_xref="GeneID:11535041"
     mRNA            complement(<449543..>451609)
                     /gene="TPHA0B02000"
                     /locus_tag="TPHA_0B02000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684258.1"
                     /db_xref="GeneID:11535041"
     CDS             complement(449543..451609)
                     /gene="TPHA0B02000"
                     /locus_tag="TPHA_0B02000"
                     /inference="similar to DNA sequence:INSDC:YKL187C,YLR413W"
                     /note="similar to Saccharomyces cerevisiae YKL187C and
                     YLR413W; ancestral locus Anc_4.285"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684306.1"
                     /db_xref="GeneID:11535041"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:G8BPE1"
                     /translation="MRMNFGKRTWLAIAILFLFTTFIMMIISIAGCSSNYSPINNVYI
                     FNADIKKLNVTKVLPQLSPLLSFIGTALTAENATVESVFGVFDSLTNTTVFSPLLNIL
                     ADTNNATATINSLNVLSPLALSNTTSALVGTAVTPIETLFNLTSNATQTILGLEELIN
                     AVTSTNSTTNAKDQALLLSLLADSSNVTGSTAAVMTLNNLTLIQKVSIAPLLTLISNS
                     SDVASTLDHLAVVANATLPTALVSTLFSTLGNITDVSALNTTLTALAGLVPSSLESSF
                     ESITDIITTSSDPLSAIDTLYSLFSQNITSSDWAASSLTALTKLVEYGNNDTEVLSTV
                     TELAANTDTATTTAELTGLYNIFSSSTNATETLEIVSSLSSLLTVSSPLTTYIPYLFT
                     LLGVSTAPLNTISNLIAIIEWAGPNASLFTPIVEILESVTTLAPVTEAQLEAMVPSLL
                     AYLEVPTDYRLALMSICHQMSDGEIVSCTRHHPVQGLDFRTIIYDALDESKLQPYLDG
                     LSIGADDLYLQGKLLEKEHEYVPAMKAVLAMSILSFISCLCGITIAVLLIRKPVSSVK
                     CWFSIVAFITFICVFTGLAAAITAAIVGIVKSGTKEDNFGVIITNGPAYYGLVWTSFS
                     LTFLTVFIYFFDGLYSTGYIHTYRNKARVDEESNDDKENAEVNVKELSNSNGEDSDST
                     ESVPHV"
     gene            <456137..>457930
                     /gene="TPHA0B02010"
                     /locus_tag="TPHA_0B02010"
                     /db_xref="GeneID:11535047"
     mRNA            <456137..>457930
                     /gene="TPHA0B02010"
                     /locus_tag="TPHA_0B02010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684259.1"
                     /db_xref="GeneID:11535047"
     CDS             456137..457930
                     /gene="TPHA0B02010"
                     /locus_tag="TPHA_0B02010"
                     /inference="similar to DNA sequence:INSDC:YKL185W"
                     /note="similar to Saccharomyces cerevisiae ASH1 (YKL185W);
                     ancestral locus Anc_4.283"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684307.1"
                     /db_xref="GeneID:11535047"
                     /db_xref="GOA:G8BPE2"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:G8BPE2"
                     /translation="MSTLMNQYSMSKLNPAGPGFNERGANASIASSPGGSTSADRKHS
                     FGFDDLLTAGNIGLNNLTTSPQAKSHSAPASIYSLSNSFLNNHKCDNGYSLNVNFSAL
                     ENFKNNLELPPLRHLRLLPDPRIQEYAYNYPDTSENTPTWKKNLVAWCKQKNYQDYVK
                     IVNETSFARFSSTQTIPSVLKPFDAFQNLTNNPNTYADLGPVTPPMSPNIKKLDVPTH
                     RKRRQSITKPTDTETEVTGNVFNPVISPKLIQLVKTQYLEMSDNKKNVNTGNNKIERN
                     LAADYNKHSQRHKKTNSFKAKQLKQLLDNRDLLNNTGATVTKLTGIDFDKARRRSNNL
                     DRVEKPILKETASNHSLNKPRSRSLSLSRKARPTISPTRNLVMKVDNYQNRGSRGSSG
                     TVTPRSSSPIRTSPITPPQNILKYRKFNMDSPPKVSGYNETYTLGDVVLTDKRGNETA
                     AATTITTTTSSLNVKHKSKSVTPRKRSNGSPQHMHIRKCLSCNSSDSPCWRPSWSSKK
                     HDQLCNSCGLRLQKTRTRCLTDSCKKIPTKSELTIMKTNGMIKETLNNGEVVEGYRCL
                     FCNGVAETVTALQSPTFPKKIWIPVNRSLLK"
     gene            <459458..>460834
                     /gene="TPHA0B02020"
                     /locus_tag="TPHA_0B02020"
                     /db_xref="GeneID:11535134"
     mRNA            <459458..>460834
                     /gene="TPHA0B02020"
                     /locus_tag="TPHA_0B02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684260.1"
                     /db_xref="GeneID:11535134"
     CDS             459458..460834
                     /gene="TPHA0B02020"
                     /locus_tag="TPHA_0B02020"
                     /inference="similar to DNA sequence:INSDC:YKL184W"
                     /note="similar to Saccharomyces cerevisiae SPE1 (YKL184W);
                     ancestral locus Anc_4.282"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684308.1"
                     /db_xref="GeneID:11535134"
                     /db_xref="GOA:G8BPE3"
                     /db_xref="InterPro:IPR000183"
                     /db_xref="InterPro:IPR002433"
                     /db_xref="InterPro:IPR009006"
                     /db_xref="InterPro:IPR022643"
                     /db_xref="InterPro:IPR022644"
                     /db_xref="InterPro:IPR022653"
                     /db_xref="InterPro:IPR029066"
                     /db_xref="UniProtKB/TrEMBL:G8BPE3"
                     /translation="MNVEFGQVLSSSSTLVELGKVSNVKVVEDVTSTNISNGNNGLPH
                     EPAHDLIFKALKTRIESINQETCEPGEENSFFICDLGELEKLYINWQKELPMVKPYYA
                     VKCNPNPKILLKLKELGLNFDCASKSEIETILSMGVDPSRIIYANPCKASSFVRYAQD
                     KKVMKSTFDNVDELYKIKKFHPDSELLIRISTDDSTAQCRLSTKYGCDLADVESLLEK
                     VKELQLNLVGVAFHVGSGACDFTSIHTAVKDSKFVFNKAKEMNLPELKYLDIGGGFQF
                     ETFSESTKTVRVALDEFFKEEIKTKKIEVLAEPGRYFASTALTLASHVIAKRTIADNE
                     SMLYTNDGVYGNMNCILFDHQEPVPRILYHNNDFKYYEFDSTSKSLPVIGGQKKYPQK
                     VSIWGPTCDGLDCITKEYYLKYNLEVGDWLYFPNLGAYSSTAATTFNGFQQHSDFIYI
                     NSIEDKLL"
     gene            <461287..>462189
                     /gene="TPHA0B02030"
                     /locus_tag="TPHA_0B02030"
                     /db_xref="GeneID:11534783"
     mRNA            <461287..>462189
                     /gene="TPHA0B02030"
                     /locus_tag="TPHA_0B02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684261.1"
                     /db_xref="GeneID:11534783"
     CDS             461287..462189
                     /gene="TPHA0B02030"
                     /locus_tag="TPHA_0B02030"
                     /inference="similar to DNA sequence:INSDC:YKL183W"
                     /note="similar to Saccharomyces cerevisiae LOT5 (YKL183W);
                     ancestral locus Anc_4.281"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684309.1"
                     /db_xref="GeneID:11534783"
                     /db_xref="UniProtKB/TrEMBL:G8BPE4"
                     /translation="MLSNKIKAASEAVIRPSAENVLPLNQYINTQPRLLGENQQLKIS
                     DDMIILFGGGRDFKLSVWGYKGAEATEKVIDNVELFILNKCIIIWLKNLDKGIEIKYT
                     GVIYHGANKINDNTSREGHKLELLITVIRDDLLNSYFPTNDTEEDLENSVNDFTMDSI
                     EFKLTPKHSTYDRFYSDEVETLFTFNNFGSNRGDDMVINCNKALEKCLELSGNEFNRF
                     GNPIAEDSEEELDQEEVEQANPNTAVMGFNETINTYYSSGNADDLDNDYILKSTVVEN
                     DTDAGMSMQFYNSSSLVTQKRSFQ"
     gene            <464358..>470600
                     /gene="TPHA0B02040"
                     /locus_tag="TPHA_0B02040"
                     /db_xref="GeneID:11534907"
     mRNA            <464358..>470600
                     /gene="TPHA0B02040"
                     /locus_tag="TPHA_0B02040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684262.1"
                     /db_xref="GeneID:11534907"
     CDS             464358..470600
                     /gene="TPHA0B02040"
                     /locus_tag="TPHA_0B02040"
                     /inference="similar to DNA sequence:INSDC:YKL182W"
                     /note="similar to Saccharomyces cerevisiae FAS1 (YKL182W);
                     ancestral locus Anc_4.280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684310.1"
                     /db_xref="GeneID:11534907"
                     /db_xref="GOA:G8BPE5"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="InterPro:IPR003965"
                     /db_xref="InterPro:IPR013565"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR016452"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:G8BPE5"
                     /translation="MSVSTRPLTLSHGSIEHILSIPTDIYFVASQLQDQFQKYLPQPT
                     ETFDLDDEPSSNVELLAKFLGYISNFIDIENEHNLENIPKPNNEIQVEQFKIVLSVCL
                     TEFENTFLHGNDIHALAAKLLINNNINAFDVNDSMDKNIEQKNEESATQTTHAKINEL
                     IKNYINARIVTNKPFTKSNSLLFKSAKENIAQITAIFGGQGNTDDYFEELRELYETYN
                     VLIVDVIEFAADTLGELTKSTTETEKVYTQGFNILDWLKNPSQTPDVDYLLYIPVSCP
                     LIGVIQLVHFALTARLLGFTPGEMKSYFKGATGHSQGLVTAVAIAEADSWESFFESAR
                     KAISLLFFIGVRCHLTYPNTSLPPSILEDSVETGEGTPSPMLAVSNLTKEQVQEFIDK
                     TNLHLPEEKHINISLINGARNLVVSGPPQSLYGLNLTLRKAKAPAGLDQSRIPYSERK
                     LKISNRFLPVSSPFHSKLLSSAGSLIAQDLARNKIEFNSANLSIPVFDTYDGADLRNF
                     NGSITSRITECIITLPVNWEEATKAHATHILDFGPGGASGLGVLTHRNKDGTGVRVII
                     AGSLNNNIDDEYGFKQEIFDISETGFKMNPNWLKEYHPTLVKNKNGKIYVKTKYSSLL
                     GRAPLLVPGMTPTTVSPELVAATINAGYTIELAGGGYFSPEHMTAAIDSVISQIKDGY
                     SLGINLIYVNPRMLQWGIPLIKDLREKGYPIQYVAIGAGVPSLEVASEYIETLNLTHL
                     DLKPGSIDAISQVINIANAYPNFPIVLQWTGGRGGGHHSYEDFHAPMLQMYSKLRRYK
                     NIILVVGSGFGSAEDTYPYLTGEWSTKFDYPPMPFDGFLFGSRVMIAKEAKTSPAAKK
                     LITECPGVDDSNWQNTYKKPTGGIITVRSEMGEPIHKIATRCVIFWKEMDDTIFNLPK
                     NKLQAALDAKKDYIISKLNADTQKPWFATVNNEVKDLTTMTYLEVANRLVELMYIKST
                     KSWIDPTLRKFAGDFLRRIEERFTKVKTLSMIQSYTVLEEPDKIVGEVFQKYPAAKSQ
                     FLHAEDIDHFLNMCQNPVQKPVPFVPILDHRFEFFFKKDSLWQSEHLEAVVDEDVERT
                     CILHGPVAAKSTKIVDEPIKDILDNIHNGHIEKLLKDYYSNDVSKIPAVEYFGGDDLV
                     AEPCTENSLEMSSSKLTNVDNWFSTLAGSENNWRSAFFSVVNFTQGSVFVPNPARKVF
                     MPSKHMKVEIENINNSEKTVVKLWEKVQGEMKLTATLKLVEESLIQFDLIENRTMDGN
                     PVSLSLLYNYNPDNGFTPISEVMDDRNTRIKEFYWKLWLDEPFNLDFDPRSVIEGKEF
                     TITKEAVSSFTHAIGNNCEDFVARSGRKVLAPMDFAIVIGWRAIIKAIFPKNVDGDLL
                     KLVHLSNAYKMVPGAKALQEGDVISTSAIIKSIVNQPTGKVVEVVGTLSRQGSPVMEV
                     TSSFFYRGNYTDFENTFKNTTEPVYKVNILSAKDIAVLRSKEWFQLDDEDLDLNNKVL
                     TFKVSTEVNFKTATVYSSIKCHGSISMELPTREKIEIGQVDYEASESYGNPVIDYLKR
                     NGTTLEHKVSLENAIPIAVLDSQSPSTNEPYGRVSGDLNPIHVSRHFASYANLPGTIT
                     HGMYSSAAVRALIENWAADSISSRVRGYSCDFVAMVLPNTPLKTHIQHVGMINGRKLI
                     KFETKNDNDVVVLSGEAEIEQPVSTFVFTGQGSQEQGMGMDLYNKSEIAKDVWNRADV
                     HFKKTYGFSILDIVKNNPKELTVYFGGEEGRKIRKNYTEMIFETIVDDTVKTEKIFKE
                     IDEKTNSFTFKSPTGLLSATQFTQPALTLMEKASYEDLRSKGLIPTNAAFAGHSLGEY
                     AALASLADIMSIESLVDVVFYRGMTMQVAVPRDEAGRSNYGMIAVNPSRVSPTFSQDA
                     LQFVVEKVGKRTDWLVEIVNYNVETQQYVAAGDLRALDTLTNVLNFIKIQKIEIDKLQ
                     ESMSLEEVEANLFEIVDNISKKSLAKPQPIELERGFACIPLRGISVPFHSSYLRNGVK
                     PFKNFLEKNILKENVKTDRLIGKYIPNLTAKPFQITKEYFQDVYDLTGSERIKAIIDN
                     WEQYEK"
     gene            complement(<470747..>471568)
                     /gene="TPHA0B02050"
                     /locus_tag="TPHA_0B02050"
                     /db_xref="GeneID:11534743"
     mRNA            complement(<470747..>471568)
                     /gene="TPHA0B02050"
                     /locus_tag="TPHA_0B02050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684263.1"
                     /db_xref="GeneID:11534743"
     CDS             complement(470747..471568)
                     /gene="TPHA0B02050"
                     /locus_tag="TPHA_0B02050"
                     /inference="similar to DNA sequence:INSDC:YLR412W"
                     /note="similar to Saccharomyces cerevisiae YLR412W;
                     ancestral locus Anc_4.279"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684311.1"
                     /db_xref="GeneID:11534743"
                     /db_xref="InterPro:IPR012942"
                     /db_xref="UniProtKB/TrEMBL:G8BPE6"
                     /translation="MSQDDFKKVGKKIKNRLDTFNGDLIKFRQIIRESEFFTELVDIL
                     CEKYKGIDRIRCLALGSFHEEIPARYQFALLLEIIEKIEHENGKQLKVSIYDPVFTND
                     DIEYIGKNGINWTIDENPPQWSNFTDSTIYYLPHAPLDLTENVIKNEHPKIWLANNLI
                     EHSDRYTKAQLYDKYPVIAKLVYILTSNSSVSGNSGVIQDKKIQEDGFTRFESSKKKR
                     GRKKKLAVSQCSFDYSLIESYFNNCRFESKFNDGLLLNNKPWINSFSDLTLHIID"
     gene            <472237..>473514
                     /gene="TPHA0B02060"
                     /locus_tag="TPHA_0B02060"
                     /db_xref="GeneID:11534733"
     mRNA            <472237..>473514
                     /gene="TPHA0B02060"
                     /locus_tag="TPHA_0B02060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684264.1"
                     /db_xref="GeneID:11534733"
     CDS             472237..473514
                     /gene="TPHA0B02060"
                     /locus_tag="TPHA_0B02060"
                     /inference="similar to DNA sequence:INSDC:YKL181W"
                     /note="similar to Saccharomyces cerevisiae PRS1 (YKL181W);
                     ancestral locus Anc_4.278"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684312.1"
                     /db_xref="GeneID:11534733"
                     /db_xref="GOA:G8BPE7"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:G8BPE7"
                     /translation="MRKCKVFVGNSHPKLGKLVCERLGIEPAPCTLKNYVNGETSVQI
                     GTSVRDEDVYVIQSGSATVNDHIMELLILVSACRGGSARKITAVIPQFPYSKQCKMKK
                     HRGAITARMLANLLIMAGADHVVSMDLHASQMQGFFTKPVDNLYGGPSLAKWIRENVE
                     DYQEAVVVSKNPGGTKRVTALADALKINFAMIHTDRRRSKDLYSQNRDLQQLKQRKQS
                     MLRKNKPIVKQGETPNEEENIILTNGIQTARIRNGHVIGDEEEEEESVIEDFDSDVIS
                     IDGINSTALGETYDAIDSDDDEESEFVQKEKLITLVGNVRGRSAVILDDMIDRPSSII
                     EAAEHLIQNCGAKKVYVVATHGVFTGDSLELLEQSEAIHQIVVTNTYPIAEARINKSK
                     KLTIIDVSAIFAECIRRDHYGESISVLFDSLAT"
     gene            complement(<473846..>477313)
                     /gene="TPHA0B02070"
                     /locus_tag="TPHA_0B02070"
                     /db_xref="GeneID:11534746"
     mRNA            complement(<473846..>477313)
                     /gene="TPHA0B02070"
                     /locus_tag="TPHA_0B02070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684265.1"
                     /db_xref="GeneID:11534746"
     CDS             complement(473846..477313)
                     /gene="TPHA0B02070"
                     /locus_tag="TPHA_0B02070"
                     /inference="similar to DNA sequence:INSDC:YLR410W"
                     /note="similar to Saccharomyces cerevisiae VIP1 (YLR410W);
                     ancestral locus Anc_4.276"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684313.1"
                     /db_xref="GeneID:11534746"
                     /db_xref="GOA:G8BPE8"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR013651"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G8BPE8"
                     /translation="MSEQEKDSRHNEGLSTSPNKSELDSKTKKAMESMAPFLMDFVPK
                     TSSSENTSLKLLPVSPKEGSDEEDEDVGATLQRTLSHNSQHGNSTTIKAASSPSVNIA
                     AKEYVLNPIKFNDNSFNSNPNPVSMDPPSPSASNSEASSNNSSAPNSTASSKRPSISH
                     VKLQLPKIGKIGVCAMDNKVLSKPCRRILNTLIENGEFETIIFGDKVILDESVENWPT
                     CDFLISFFSNGFPLEKAIQYVNLRKPFFINDLVMQKALWDRRLCLRLLKSAGVPTPPK
                     LEISRDGGPVYDDQLKSMLIERGVSIDPIPEPKWRMIDEDTLEVNGETMTKPFVEKPV
                     DGENHNIYIYYHSKDGGGGRRLFRKVDNKSSEFDPTLLMPRTEGSYIYEMFIETDNSE
                     DVKAYTVGENFCHAETRKSPVVDGIVRRNTHGKEVRYLTELSTEEKQMASRVCKVFSQ
                     MICGFDILRVKGKSYVIDVNGFSFVKDNAAYYDHCVRILRETFIEAKKRIDLRKKNLP
                     VIQEEKSQKWVFKGLVTVIRHADRTPKQKFKHSFTSPIFISLLKGHKEEVVIRKTDDL
                     KIALKALQLAIDENAEDPTKLYVLFKALKKKLDFPGTKIQLKPLLNSDKEVEKVQFIL
                     KWGGEPTHSARYQARELGEQMRQDFDLLNKSILQNIKIFSSSERRVLLSAQVWASALF
                     SENEVGSDEINIRKDLLDDSNAAKDLMDKVKKKLKPLLRVGNEIPSQFAWPAKMPGPY
                     TVTKRVVDLMNYHHEVLNLNYQTKDVDTFQKRWCCGEDPFLFKERWEKLFKEFVSVEK
                     LDPSKISELYDTIKYDSLHNREFLEHAFDPSGFDHQIIDEVSSHFLVNNYPVNVLAKN
                     NFKITDTVPKHSSSSTASRSSSLLGSSGWVIESKKPVDFEKTQQSSCFEKRRFILFQE
                     LFKLTKVLFDFICPKEYGIKDSEKLDIGLLTSLPLARQILDDIDAMKTRQDPECIAYF
                     TKESHIYTLLNIIYESGIPMRIPRNALPEFDYLSQINFELYESTDGNGEKMHSIRLKM
                     SPGCHTQHPLDVQLDDKHYISCIHKISLTKHLDIDYVQEKIRNKFTRVNLPKKFTPVN
                     ITSPNLTFQPGMRDFNKISDVSLESRETDNTNSTDNTESTLNLTKASELTVSSIDGVL
                     NATSDTINK"
     gene            <477775..>480600
                     /gene="TPHA0B02080"
                     /locus_tag="TPHA_0B02080"
                     /db_xref="GeneID:11534918"
     mRNA            <477775..>480600
                     /gene="TPHA0B02080"
                     /locus_tag="TPHA_0B02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684266.1"
                     /db_xref="GeneID:11534918"
     CDS             477775..480600
                     /gene="TPHA0B02080"
                     /locus_tag="TPHA_0B02080"
                     /inference="similar to DNA sequence:INSDC:YLR409C"
                     /note="similar to Saccharomyces cerevisiae UTP21
                     (YLR409C); ancestral locus Anc_4.275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684314.1"
                     /db_xref="GeneID:11534918"
                     /db_xref="GOA:G8BPE9"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007319"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8BPE9"
                     /translation="MSTMIEQKKRKLSSAIVAARRDPSKIFSPYRVIGNVSNYVPFSV
                     GTLGSTFYIVTSVGKSFQIYDANNLHLLFVSEKELDNPITAFATHFHYVYVGSGNKVF
                     VFKRGIQEYEIELKANARVKSVCVFGDFLCASAEDGILYIYKKKNASAKYPTEYYSQF
                     QVTELLGGDIVSIIHLPTYLNKIVIITKSNLLLINVRTGKLLFQSQEFPNNITTACDA
                     PALDIIALGTNAGQLMMYNIKKGKVIRNINIPKSHISSISFRTDGAPHMSVGCTNGDL
                     IFYDLDRRSRIHVIKNAHKESLGGVMKAMFLNGQPIIVTSGGDNSLKEFVFDPSLSQA
                     DGETVVQPPRLLRSRGGHSQPPSCIQFADSSAHMLLSSSRDRSLWSFSLRKDAQSQEL
                     SQRLHKNSNGDRLAGGSVREKFPEILSMAIENSRLGEWENVITAHKDEKSARTWDMRN
                     KRVGRWTFNTTDDGFAKSVALSQCGNFGLVGSSNGSIVVYNMQSGLIRRKYKLHKKAV
                     TGIAIDGMNRKMVSCGLDGIVGFYDFNKATLLGKLVLDSSISSMVYHRSSDLIALVLD
                     DLSIVVIDTITQKIVRQLWGHSNRITSLDFSPDGRWIVSTSLDSTLRTWDLPTGNCID
                     GVKLENVATNIQFSANGEFIATSHVVGNGICLWTNKSQFKSISTRAISEDEFRNIMLP
                     NNSASGNSNIIEGALDVSNDDELDIDFTNYESLSQINEDLITLSVGPRNKLNTLLNLD
                     IIKQRSKPTEAPKKPEKASFFLQLTGDKIGDEASTREGVVDTSALESAESESKLNEAG
                     AAEQELQKFKPRGHVELESQFTKLLRECSKQNNYSKFLEYLIKLSPSLIDIEIRGLDS
                     FEPFNEIIFFINALTSGLKSKRNFELYEAFMSILFKVHGDVLHSNNTNANISEALEKW
                     DIVHSECNKLDDLLKYCSGVLNFISSN"
     gene            complement(<480717..>483869)
                     /gene="TPHA0B02090"
                     /locus_tag="TPHA_0B02090"
                     /db_xref="GeneID:11534890"
     mRNA            complement(<480717..>483869)
                     /gene="TPHA0B02090"
                     /locus_tag="TPHA_0B02090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684267.1"
                     /db_xref="GeneID:11534890"
     CDS             complement(480717..483869)
                     /gene="TPHA0B02090"
                     /locus_tag="TPHA_0B02090"
                     /inference="similar to DNA sequence:INSDC:YDL077C"
                     /note="similar to Saccharomyces cerevisiae VAM6 (YDL077C);
                     ancestral locus Anc_4.274"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684315.1"
                     /db_xref="GeneID:11534890"
                     /db_xref="InterPro:IPR019452"
                     /db_xref="InterPro:IPR019453"
                     /db_xref="UniProtKB/TrEMBL:G8BPF0"
                     /translation="MLTAKRIDTFNIKSIYASLSLPEVSKLIIVNSHNDVLVYHKNQD
                     IFKHLQTYPNLIKHLHTDESRIYDLKYSHSISTIFAQCDKTIILLNSSNLSQYDYIFE
                     KRGIEQTWVFNIRHTHTTDDYKTILLYSTKTKPTLRALIWEGTTYKKMIDVPLFHKSE
                     KALSALAIQEGILISTKHGIYLWKHDVDKLIKIDKITKRTAPDDMMVALNNFKNICEK
                     ESQGNNPRDIVSNKSISSKASEYTFNKSRPSSQTFRKVSGYFWQQQKFRHDHSNDNIR
                     YIFKPSEKENPIIFDFISRNILELHTGDDNQHFLVFSDCNCFNSLNEDYFSVKHIDLN
                     VVLLYNEHSVKFIEYEQGFPFLNMTVDDEIKDILLLEGPYFVMITKSDDVHLYHYQVD
                     DSFEQHILVKEFDFNTNKDKELNQLWRNVLFYKYFLSSTYSLDICVSSDPEHSLDLCA
                     MKLRDLTVVLCLRVFERYQYYLKSIEYNEDVIEKSYNIQRIIVENIFKLFITYWAPPH
                     LVLLKTLPNVILAYVMDHLKHYDDDIDAEYYSLPDAYTNMVLPKLILHCYVPYLIEIR
                     RHIKNIKISKFEGNVTWKIFGRKINQTIDFFLVDDDEDTSIVDLLTLLDTSLFEIYFN
                     YNKALIGPFLRVENYAKENVVISQLKKNNMFQELIDCYFQSGKHKEALNFLKTLYLSL
                     SSTDEQEIKDGILLLIIGYLRNVPNDFIELIFDYTKWVLDIYHDKESVIILVFMQDTL
                     VSKGRDYQKVYNFIKSFDAELAVSYLEFTISSFQLTNATLQSILIKAYIANLSDAHIR
                     KKFNSLLKSSMIYEPKFVLKILDDSIREGQNMDIDNLNYLQFLKIYPLYKLREDNLSV
                     SIVYNKLHNYAEASKYCLRIYREDMERGQSVILYFLQQILKLPASDINENEDVLYFLK
                     EFGSKLNTKTILKLMPPNTNIKIICDYLLNTIETTSLKVGDSNLERSLLQLELINTTN
                     TLNVIFSENYLIKETDICSVCDKKFPLSSNDSVSLVNIYGKSKIVHTTCAKVIETHNS
                     KSKVNIPKLITVGDYKDGQN"
     gene            <484475..>484843
                     /gene="TPHA0B02100"
                     /locus_tag="TPHA_0B02100"
                     /db_xref="GeneID:11535097"
     mRNA            <484475..>484843
                     /gene="TPHA0B02100"
                     /locus_tag="TPHA_0B02100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684268.1"
                     /db_xref="GeneID:11535097"
     CDS             484475..484843
                     /gene="TPHA0B02100"
                     /locus_tag="TPHA_0B02100"
                     /inference="similar to DNA sequence:INSDC:YLR408C"
                     /note="similar to Saccharomyces cerevisiae YLR408C;
                     ancestral locus Anc_4.273"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684316.1"
                     /db_xref="GeneID:11535097"
                     /db_xref="UniProtKB/TrEMBL:G8BPF1"
                     /translation="MANKVQLETLFNKLLKLPDDTEISKILKEIEDNDNYITSIQLQT
                     LMNIHDKSFKEKYHNQLEQLYNKYKNKNYTSDAGLHNDAAIIDRDIRILEETMKLLKE
                     NSSEHKKHIRSITKNGIASD"
     gene            complement(<485001..>485996)
                     /gene="TPHA0B02110"
                     /locus_tag="TPHA_0B02110"
                     /db_xref="GeneID:11534805"
     mRNA            complement(<485001..>485996)
                     /gene="TPHA0B02110"
                     /locus_tag="TPHA_0B02110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684269.1"
                     /db_xref="GeneID:11534805"
     CDS             complement(485001..485996)
                     /gene="TPHA0B02110"
                     /locus_tag="TPHA_0B02110"
                     /inference="similar to DNA sequence:INSDC:YDL076C"
                     /note="similar to Saccharomyces cerevisiae RXT3 (YDL076C);
                     ancestral locus Anc_4.271"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684317.1"
                     /db_xref="GeneID:11534805"
                     /db_xref="InterPro:IPR013951"
                     /db_xref="UniProtKB/TrEMBL:G8BPF2"
                     /translation="MDTNDEYKRNQFQIYNLQETILNSTKSAKHQLSSNSTNKENVLL
                     DEIDEQNDDIVVDSTSVLKFVAEKYPRQENVICSMYYHPFRTGVLNEKRYFDNQLLFP
                     YNIDQLGTPAPFLPPLGDAKINSLITIHILYEDLTNKFNMNPRLDNNELWGCQIYTDD
                     SDPILVLKHSGVLRDTTKTTDSHRDPALLNRTPGNLRNTDDVTDSHSLLNNKDDIPYD
                     IEMTILILPCLRVYSSVKRFGLTSRQWGEDLSSLSNTSEYENEGSPSLPELEYSTAAQ
                     QPLSMTATHDGLSYSIYSIKVVPRKTNEETTKSATINEKELPIVSKIGSNWFNQN"
     gene            complement(<487784..>488836)
                     /gene="TPHA0B02120"
                     /locus_tag="TPHA_0B02120"
                     /db_xref="GeneID:11535046"
     mRNA            complement(<487784..>488836)
                     /gene="TPHA0B02120"
                     /locus_tag="TPHA_0B02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684270.1"
                     /db_xref="GeneID:11535046"
     CDS             complement(487784..488836)
                     /gene="TPHA0B02120"
                     /locus_tag="TPHA_0B02120"
                     /inference="similar to DNA sequence:INSDC:YLR405W"
                     /note="similar to Saccharomyces cerevisiae DUS4 (YLR405W);
                     ancestral locus Anc_4.269"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684318.1"
                     /db_xref="GeneID:11535046"
                     /db_xref="GOA:G8BPF3"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:G8BPF3"
                     /translation="METKKKVVIPRPKPLTSENDPLHIIKTRMVTHNRPATIAGPMVR
                     YSKLPFRQICRDYNADIVYSPMILAREFVRNEHARQADFSRNSSDTPLIVQVGVNNVT
                     DLLKFCEMVAPYCDGIGINCGCPIKEQIREGIGCALIYNPDLLSSMVRTVKEKYKDTL
                     RLETKIRIHDDLDTTVELCRRVCDAGADWITIHGRTRRTRSSQPVNLDAIKYIISKIK
                     DKNIPVVANGDCFQLSDVTRIADYTGANAVMAVRGLLENPALFSGYGRCPWGCIERFW
                     YRTIEYTCLPFQLTQHHLFCMLENMQLSKSLLKELMSTKSLPEMLDWFEDNFELKRYG
                     EKGFGERVEIPYIKIE"
     gene            complement(<489226..>491211)
                     /gene="TPHA0B02130"
                     /locus_tag="TPHA_0B02130"
                     /db_xref="GeneID:11535137"
     mRNA            complement(<489226..>491211)
                     /gene="TPHA0B02130"
                     /locus_tag="TPHA_0B02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684271.1"
                     /db_xref="GeneID:11535137"
     CDS             complement(489226..491211)
                     /gene="TPHA0B02130"
                     /locus_tag="TPHA_0B02130"
                     /inference="similar to DNA sequence:INSDC:YDL074C"
                     /note="similar to Saccharomyces cerevisiae BRE1 (YDL074C);
                     ancestral locus Anc_4.268"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684319.1"
                     /db_xref="GeneID:11535137"
                     /db_xref="GOA:G8BPF4"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013956"
                     /db_xref="InterPro:IPR018957"
                     /db_xref="UniProtKB/TrEMBL:G8BPF4"
                     /translation="MPTEPPSKKVKLDLSDPDEPLTRRDVIAFQKEALYRCMNQYKQQ
                     LGCLREQYDLAKLENSNISTRLAESLSILSTIALSLKDNCDSVSEKELFDKLFSNDIL
                     GIFESSDALSKLFIKYYGTAKNSDQATIDIKLEIKNLNKIKNELLVKNENLTKEINAV
                     KKYYQNEIRKYDREDSLTVKRVFQKEVDESENSIKETTSDNNVEQNETPLKDQTLTKT
                     EKDLEGASNEKLINEIKIENYDQEILSLKKVIENLENTKKQNEQELVTLRIQLSQKNQ
                     GTNQLQDENLIQRLDKLTSENIKLSKINDEFLKKFQSLNESMEIYNGTLTKEFESAQD
                     TLKKHNASLEKDLVRIRSARDDLLSKNMILEAQTSKSAMITNLESTLSILKTQWDKIE
                     IRNSNSTGLPQDALLNELQDLETAFKEISNTINIKYTEYLNTENVISKLTVEKTKADQ
                     KYFAVMRSKDSILIENKNLSKSLQKSYELISQLKEADKLYQQKIENLNKQLELSQNNE
                     KSLLNNMKDEVMKQNNLSSEISQQKKINLNLQEENSKHISLYTTLQGELDAEVTAKNN
                     LASKIKHLEDQNLKLQKSLLSNGSGDSSGLAEELDNFRSLVYCTLCSKNWKSTAIKTC
                     GHVFCDDCCKERLSSRMRKCPTCNKAFSSNDLLSIHL"
     gene            complement(<491794..>493050)
                     /gene="TPHA0B02140"
                     /locus_tag="TPHA_0B02140"
                     /db_xref="GeneID:11534885"
     mRNA            complement(<491794..>493050)
                     /gene="TPHA0B02140"
                     /locus_tag="TPHA_0B02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684272.1"
                     /db_xref="GeneID:11534885"
     CDS             complement(491794..493050)
                     /gene="TPHA0B02140"
                     /locus_tag="TPHA_0B02140"
                     /inference="similar to DNA sequence:INSDC:YLR403W"
                     /note="similar to Saccharomyces cerevisiae SFP1 (YLR403W);
                     ancestral locus Anc_4.265"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684320.1"
                     /db_xref="GeneID:11534885"
                     /db_xref="GOA:G8BPF5"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BPF5"
                     /translation="MNSQFEISQDVIPHNINIDKIRRDSIIHSAGVGGVSWGTRRIST
                     WLRNESVFHATLNEAVLKNNQHKSISLNKRNSLIDINGNRVSLHDYNDTNLEFEKQFC
                     KDYSCCGLSLPNLHDLLSHYKENHINLDDEAYYNKNSQNQKYSSHDQSLSFNQIPLNY
                     YDHTNVIDSISTNEIFLDMDTKNGEGPHSIAPLTPDSLKTDNTQLNGSNDTIQFNNPF
                     AKKMEFNSEGEQVALGDIDTKCHDNENEEGEYGEELEEEDDDDEDDFEQENIASPVDK
                     INDDPSLNLNSSINLPDLNHNLNELHINTYNLHASNNFLDDPARYLHATDSQKDTPFK
                     CPVIGCNKCYKNQNGLKYHKIHGHKHQKLQNNPDGTITVLDPITNQPLYHNSDFEKDK
                     PYHCEVCGKRYKNLNGLKYHRGHTTH"
     gene            complement(<497230..>497820)
                     /gene="TPHA0B02150"
                     /locus_tag="TPHA_0B02150"
                     /db_xref="GeneID:11534983"
     mRNA            complement(<497230..>497820)
                     /gene="TPHA0B02150"
                     /locus_tag="TPHA_0B02150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684273.1"
                     /db_xref="GeneID:11534983"
     CDS             complement(497230..497820)
                     /gene="TPHA0B02150"
                     /locus_tag="TPHA_0B02150"
                     /inference="similar to DNA sequence:INSDC:YDL072C"
                     /note="similar to Saccharomyces cerevisiae YET3 (YDL072C);
                     ancestral locus Anc_4.263"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684321.1"
                     /db_xref="GeneID:11534983"
                     /db_xref="GOA:G8BPF6"
                     /db_xref="InterPro:IPR008417"
                     /db_xref="UniProtKB/TrEMBL:G8BPF6"
                     /translation="MSLYNNLVFIILLSEIVAFTILSLPLPSKVRRPLTLTIIKPFQN
                     QKVQTIIKCVIVFILILFVDSINKVYKVELELKAHSITGSVVQTSTSTDRVEIHSRKF
                     LAQRNMYLTGITLFLSFAVVRAFNLVTELLKLKEKYQKSEDKASLEHLKGDEKEFLTK
                     KGDEKDVEEIKLLIEKKNNEIKRLKEKALALQAEIK"
     gene            <500156..>502228
                     /gene="TPHA0B02160"
                     /locus_tag="TPHA_0B02160"
                     /db_xref="GeneID:11534723"
     mRNA            <500156..>502228
                     /gene="TPHA0B02160"
                     /locus_tag="TPHA_0B02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684274.1"
                     /db_xref="GeneID:11534723"
     CDS             500156..502228
                     /gene="TPHA0B02160"
                     /locus_tag="TPHA_0B02160"
                     /inference="similar to DNA sequence:INSDC:YDL070W,YLR399C"
                     /note="similar to Saccharomyces cerevisiae BDF2 (YDL070W)
                     and BDF1 (YLR399C); ancestral locus Anc_4.262"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684322.1"
                     /db_xref="GeneID:11534723"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="InterPro:IPR027353"
                     /db_xref="UniProtKB/TrEMBL:G8BPF7"
                     /translation="MTEEIQPALNDVSSSVTMNDNLETLDTNTNSDLSAHLDEPGKKM
                     KMENGNIVVAVSASVASPTPSNTAENDMVLESEVSNVDVENSKNLPASPVSEAPKPLD
                     NQNEDDNQSNTTSLEASGAIDDGDAAASAIDYTNIPPAPAPPAEPDMNNLPANPIPKH
                     QQKHALMSIKAVKRLKDAKPFLLPVDPVALNIPHYYNKIQRPMDLMTIEKKLTVDAYD
                     SPEKITEDFNLMVQNCIVFNGPTSGIAQMARNIQAAYEKHMLNMPSKDSEPLKQTRKR
                     KQDEDAPVIIRRAQTHNGRPKREIHPPKSKDIYPVENEKPKSKKLQQAMRFCQGIVKE
                     LTSKKYASFNYPFLEPVDPVAMNIPTYFDYVKDPMDLSTVTKKLNNWEYKSLEEFESD
                     VKLVFHNCYAFNPDGTIVNMMGHRLEEIFNAKWVDRPIFEDYDTDEEIEREEYSASDV
                     EDSEESESEIDESSITNPAIQYIEEQLARMKVELQQLKKQELDKIRKERRLARGTKKP
                     RGKRGRNKSRGSSGSRSGKKKFKTVVTYEMKKIITEKINDLSPSKLEKAVNIIKKSMP
                     DLGEDDEVELDLDTLSNSTLLTLYNTFFRVYDTTNNGSARNAVGSPMSPSNGLGGHSK
                     KKRSKALSEEQQSKQIEKIKSKLAILDGASPLSQQNSPLSNGNVQTAYLSGSSSSGDD
                     ESSESEEE"
     gene            <503118..>506930
                     /gene="TPHA0B02170"
                     /locus_tag="TPHA_0B02170"
                     /db_xref="GeneID:11534816"
     mRNA            <503118..>506930
                     /gene="TPHA0B02170"
                     /locus_tag="TPHA_0B02170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684275.1"
                     /db_xref="GeneID:11534816"
     CDS             503118..506930
                     /gene="TPHA0B02170"
                     /locus_tag="TPHA_0B02170"
                     /inference="similar to DNA sequence:INSDC:YLR398C"
                     /note="similar to Saccharomyces cerevisiae SKI2 (YLR398C);
                     ancestral locus Anc_4.261"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684323.1"
                     /db_xref="GeneID:11534816"
                     /db_xref="GOA:G8BPF8"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012961"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016438"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPF8"
                     /translation="MKLNPDSLEELYSSLRNITGDDVELFEDKISKFSTNVNTDEAVN
                     KEIKDTFLGLSNELSWGLLDVVQSVPNINFLDDINNEKSDYDYKQFLNVPSVLNRTSY
                     RFKRKGIDGKINSYKEEVNLAELENANASNSLSLKRSINTHGNLVRGSTAQLPFTPGG
                     LVMDEMEKVDTEVSALSNSVKLLHKDADGLFDVPQGFQRGIICSENNSNTEENLFTNF
                     KKIDMIDNEVVNRKELEEKQQKIDDEINEKTELEVYRKPTELANTDIDDILPMGIAFG
                     RIKNRNNNLLQKKEWAHVIDLNHRLDNFSELVPNPARIWPFELDVFQKEAIYHLEQGD
                     SVFVAAHTSAGKTVVAEYAIAMSKRNMTKTIYTSPIKALSNQKFRDFKETFDDVEIGL
                     ITGDVQINPDANCLIMTTEILRSMLYRGADLIRDVEFVIFDEVHYVNDQDRGVVWEEV
                     IIMLPQHVKFILLSATVPNTYEFANWIGRTKQKNIYVISTPKRPVPLEISIWTKNVLV
                     PVINPKREFLESNFKKHKNLIEGTTSDKVQKTLSHSKENSTRGGARGGARGVSRGGTR
                     GSMRGGSRGAGAIGSNKSQFFKRSGPNKKTWSGIIDYLRGKDLLPAVIFVFSKKRCEE
                     YADWLDAVSFCSNKEKSQIHMFIEKSITRLKKEDRELPQILKIRSLLERGIAVHHGGL
                     LPIVKELIEILFSKGLIKVLFATETFAMGLNLPTRTVIFSELQKHDVNGLRSLTPGEF
                     TQMAGRAGRRGLDKIGTVIVMAYTEPLNQSVFKEVTLGIPTKLQSQFKLTYNMILNLL
                     RIEAFKVEEMIKYSFGENLKQTLQPEHEKQIKQLTSELQDIKQSSCNTCAEDIDKFLD
                     LSISLKTVTSNLFEELGKSEKSYTVFRVGRLIVYRDGDDNAKLGFLYRTSKDNGVVVL
                     TFTNPQTSPDGSANHLPYLEGNKEFNSSHIGRFTYSPYILENIAFSQIELVTKYILRI
                     SFTDIFNEEKEALELLDNEIRTILRISTKLMISSNQSSGSVKVHQLLLEQSNITKQIL
                     TCKCIKCANFASHYKPKYDKYLIDSKIKNLYHLMSNQNLTLLPEYENRLKVLHRTGFI
                     DQNQNVTLKGRVACEINTGFELVITELILDNFLGDFEPEEIVSLLSAFIYEGRSRDEP
                     PPIVTPRLIKGKQKIEEIYGRMLDIFAEEQITMTKEESEFLEMKRFGLINVIYEWARG
                     LSFKEIMEISIEQEGTVVRVITRLDEICRQVKTAAIIIGNSGLHSKMSQAQELIKRDI
                     VFAASLYL"
     gene            complement(<506998..>507570)
                     /gene="TPHA0B02180"
                     /locus_tag="TPHA_0B02180"
                     /db_xref="GeneID:11535105"
     mRNA            complement(<506998..>507570)
                     /gene="TPHA0B02180"
                     /locus_tag="TPHA_0B02180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684276.1"
                     /db_xref="GeneID:11535105"
     CDS             complement(506998..507570)
                     /gene="TPHA0B02180"
                     /locus_tag="TPHA_0B02180"
                     /inference="similar to DNA sequence:INSDC:YDL069C"
                     /note="similar to Saccharomyces cerevisiae CBS1 (YDL069C);
                     ancestral locus Anc_4.260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684324.1"
                     /db_xref="GeneID:11535105"
                     /db_xref="UniProtKB/TrEMBL:G8BPF9"
                     /translation="MVSPSFSPISMIQRIPTKININSLIIDSRLKFQQNVQLPKNSNN
                     KYKLMRNKASDLVKIESIKLRLNFLNNLITFNEASLINCLYVSDNSKGNNNYEELGYR
                     LINIHLNIIKKVSSLDQKKMLLKFLDSRKLNNISNLPLPDNRIPLRIKRIHDLKTLYK
                     IIGYLSLQNDTTIMAKFVRTEILSKIYRLY"
     gene            complement(<508228..>508398)
                     /gene="TPHA0B02190"
                     /locus_tag="TPHA_0B02190"
                     /db_xref="GeneID:11534700"
     mRNA            complement(<508228..>508398)
                     /gene="TPHA0B02190"
                     /locus_tag="TPHA_0B02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684277.1"
                     /db_xref="GeneID:11534700"
     CDS             complement(508228..508398)
                     /gene="TPHA0B02190"
                     /locus_tag="TPHA_0B02190"
                     /inference="similar to DNA sequence:INSDC:YDL067C"
                     /note="similar to Saccharomyces cerevisiae COX9 (YDL067C);
                     ancestral locus Anc_4.257"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684325.1"
                     /db_xref="GeneID:11534700"
                     /db_xref="GOA:G8BPG0"
                     /db_xref="InterPro:IPR014368"
                     /db_xref="UniProtKB/TrEMBL:G8BPG0"
                     /translation="MAISAITGTLKRRIILDITIGFSLGGLMASYWWWGYHKVLINKR
                     EAYYAKLAAAKE"
     gene            <509286..>509504
                     /gene="TPHA0B02200"
                     /locus_tag="TPHA_0B02200"
                     /db_xref="GeneID:11534899"
     mRNA            <509286..>509504
                     /gene="TPHA0B02200"
                     /locus_tag="TPHA_0B02200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684278.1"
                     /db_xref="GeneID:11534899"
     CDS             509286..509504
                     /gene="TPHA0B02200"
                     /locus_tag="TPHA_0B02200"
                     /inference="similar to DNA sequence:INSDC:YLR395C"
                     /note="similar to Saccharomyces cerevisiae COX8 (YLR395C);
                     ancestral locus Anc_4.256"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684326.1"
                     /db_xref="GeneID:11534899"
                     /db_xref="GOA:G8BPG1"
                     /db_xref="InterPro:IPR004202"
                     /db_xref="UniProtKB/TrEMBL:G8BPG1"
                     /translation="MINQLVRLNGRRYFSQSLKSNVHFKDGVYTNLPFKVKDRKTPYA
                     LTHFAFFGLGFAVPFLITYAQLKKSGTI"
     gene            <509945..>511246
                     /gene="TPHA0B02210"
                     /locus_tag="TPHA_0B02210"
                     /db_xref="GeneID:11534804"
     mRNA            <509945..>511246
                     /gene="TPHA0B02210"
                     /locus_tag="TPHA_0B02210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684279.1"
                     /db_xref="GeneID:11534804"
     CDS             509945..511246
                     /gene="TPHA0B02210"
                     /locus_tag="TPHA_0B02210"
                     /inference="similar to DNA sequence:INSDC:YDL066W"
                     /note="similar to Saccharomyces cerevisiae IDP1 (YDL066W);
                     ancestral locus Anc_4.254"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684327.1"
                     /db_xref="GeneID:11534804"
                     /db_xref="GOA:G8BPG2"
                     /db_xref="InterPro:IPR004790"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:G8BPG2"
                     /translation="MFHSQSSKRLFSTSRQVLQAVQKKINVKTPVVELDGDEMTRIIW
                     DKIKQKLILPYLNVDLKYYDLSVTNRDATNDQITIDSAEAIKKYGVGIKCATITPDEG
                     RVKEFNLKKMWKSPNGTIRNILGGTVFREPIVIPRIPRLVKNWEKPIIIGRHAHADQY
                     KATDTLIPGPGTLELVYKSKDNDPSKTQVLNVYDYKSSGVALAMYNTDESITGFAHSS
                     FKLAIDKKLDLFLSTKNTILKKYDGRFKDVFQEVFDSTYKDKFEALNIKYEHRLIDDM
                     VAQMIKSKGGYIMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTV
                     TRHYRQHQQGKQTSTNSIASIFAWSRGLAKRGELDNTPDVMKFAQTLEKATLDTVQED
                     GIMTKDLALACGNLNPDAYVNTAEFLNAVDKRLQETMKSVD"
     gene            complement(<511433..>512305)
                     /gene="TPHA0B02220"
                     /locus_tag="TPHA_0B02220"
                     /db_xref="GeneID:11534846"
     mRNA            complement(<511433..>512305)
                     /gene="TPHA0B02220"
                     /locus_tag="TPHA_0B02220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684280.1"
                     /db_xref="GeneID:11534846"
     CDS             complement(511433..512305)
                     /gene="TPHA0B02220"
                     /locus_tag="TPHA_0B02220"
                     /inference="similar to DNA sequence:INSDC:YLR393W"
                     /note="similar to Saccharomyces cerevisiae ATP10
                     (YLR393W); ancestral locus Anc_4.253"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684328.1"
                     /db_xref="GeneID:11534846"
                     /db_xref="GOA:G8BPG3"
                     /db_xref="InterPro:IPR007849"
                     /db_xref="UniProtKB/TrEMBL:G8BPG3"
                     /translation="MNYFSVFKRTLTQSQRLSVGKFTKFVLNATPEPHAVKPLVRPVG
                     LTTPPTSDTKYSAGNSFKDLFDKEKTDKRSGELGIEFNKTSMHHMSVFRKTNGRLFEP
                     PKSYWRADKALYFPHLKGEPLSGRGSKEINIEDKLKDKISIVNLFSNKTANELADTSL
                     KNERRNIDYLNKDFESLPKDVQIVQINLIDSKAKMLIFKLFAMRSLRSLIPSFLKDTY
                     FICNRDQLPFILRENLHINNPYTGYSLLVDQNLKIRWMGSGALTVEDFDVLWKAVKGV
                     KKEANKGNEGSSTW"
     gene            <512703..>514361
                     /gene="TPHA0B02230"
                     /locus_tag="TPHA_0B02230"
                     /db_xref="GeneID:11535092"
     mRNA            <512703..>514361
                     /gene="TPHA0B02230"
                     /locus_tag="TPHA_0B02230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684281.1"
                     /db_xref="GeneID:11535092"
     CDS             512703..514361
                     /gene="TPHA0B02230"
                     /locus_tag="TPHA_0B02230"
                     /inference="similar to DNA sequence:INSDC:YLR392C"
                     /note="similar to Saccharomyces cerevisiae YLR392C;
                     ancestral locus Anc_4.252"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684329.1"
                     /db_xref="GeneID:11535092"
                     /db_xref="UniProtKB/TrEMBL:G8BPG4"
                     /translation="MADIKLIIDPPINNEYFSNEDLISGTIILDIKKSLSIKKINVKL
                     KGYVETLTKMSGDYFHGQGGLMTPVQDNRSIHGIIDIDQRVFPPDNVWDALDGNVKPF
                     KVKPGSYDYRFQFPKLPKRPSCIQHHIYDINCFVKKSETRLPPSFNYEWQDPTKIDNL
                     DIYFYSFGKVLYYIQVQLELGKSKAWYKPFNRYFTETEYINFIPDPKETMYKVDYDKI
                     AEVGEVEYTEQNLNNSIVTGDGVNRRRLLREKDKFTIPHNVNDNDNENELTNMMSNTM
                     LNAPAVTTDQNELPTFSSLEVDALSDTNNNTIDIIQGNSRSNLTSRHLIYKSTYSVHI
                     GDDATIMCVEVRSRGLKYTYRRDFLFRHGSNKFDHIFLVFKGNKDTIRNTKVTPLKMQ
                     LNLLEYASYLSHGVANENVSSLRLIEVTDLNSPENKNIVNFEECRTLMTPDLGYGKCK
                     MECELKLKDHEILKKLRFNKENYLHRGNRLFSFKCCTIKRIFRFQLVISWQIGGKVIQ
                     TENIINNAQIFSHLREKANKVEHLPRYVEPPKYTEVRNVDNDNA"
     gene            complement(<514557..>515234)
                     /gene="TPHA0B02240"
                     /locus_tag="TPHA_0B02240"
                     /db_xref="GeneID:11534843"
     mRNA            complement(<514557..>515234)
                     /gene="TPHA0B02240"
                     /locus_tag="TPHA_0B02240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684282.1"
                     /db_xref="GeneID:11534843"
     CDS             complement(514557..515234)
                     /gene="TPHA0B02240"
                     /locus_tag="TPHA_0B02240"
                     /inference="similar to DNA sequence:INSDC:YLR390W-A"
                     /note="similar to Saccharomyces cerevisiae CCW14
                     (YLR390W-A); ancestral locus Anc_4.251"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684330.1"
                     /db_xref="GeneID:11534843"
                     /db_xref="InterPro:IPR008427"
                     /db_xref="UniProtKB/TrEMBL:G8BPG5"
                     /translation="MRTSAVLSAIASVALLSTQVVAAPPACMLACVAQVSKASSTCSG
                     LNDISCLCGTEGAAIQECINSICDSSVVDSALSSLKAQCSAQNAVLASASVSASSKSS
                     SSSSAVSTSSSSSSAVSSSAVSTSSSSSSAVSSSAVSSSAVSSSTIISSSSASSVAAS
                     SSSSTPVTTSTTPVTTSTTPTSTSTTSIVASSSSSAFTVSEAPNAANVVHAAGSVLVA
                     AAAAFLL"
     gene            complement(<516247..>516525)
                     /gene="TPHA0B02250"
                     /locus_tag="TPHA_0B02250"
                     /db_xref="GeneID:11534850"
     mRNA            complement(<516247..>516525)
                     /gene="TPHA0B02250"
                     /locus_tag="TPHA_0B02250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684283.1"
                     /db_xref="GeneID:11534850"
     CDS             complement(516247..516525)
                     /gene="TPHA0B02250"
                     /locus_tag="TPHA_0B02250"
                     /inference="similar to DNA sequence:INSDC:YLR390W"
                     /note="similar to Saccharomyces cerevisiae ECM19
                     (YLR390W); ancestral locus Anc_4.247"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684331.1"
                     /db_xref="GeneID:11534850"
                     /db_xref="UniProtKB/TrEMBL:G8BPG6"
                     /translation="MSRINGYNMMGVVLAVVVGVYSGTRFFEPLVVDQLKRDGNLRSD
                     IAIPEYDSEGNPVEPKSIRDLRKHIEEASADGKKMSDILQDLDSSKND"
     gene            <517138..>520263
                     /gene="TPHA0B02260"
                     /locus_tag="TPHA_0B02260"
                     /db_xref="GeneID:11534774"
     mRNA            <517138..>520263
                     /gene="TPHA0B02260"
                     /locus_tag="TPHA_0B02260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684284.1"
                     /db_xref="GeneID:11534774"
     CDS             517138..520263
                     /gene="TPHA0B02260"
                     /locus_tag="TPHA_0B02260"
                     /inference="similar to DNA sequence:INSDC:YLR389C"
                     /note="similar to Saccharomyces cerevisiae STE23
                     (YLR389C); ancestral locus Anc_4.246"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684332.1"
                     /db_xref="GeneID:11534774"
                     /db_xref="GOA:G8BPG7"
                     /db_xref="InterPro:IPR001431"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:G8BPG7"
                     /translation="MTTNLIQISTRFLPYSSACLPKLLALRSARLLPFFLDTKRKYTT
                     FGINTSSTRQSKFNQFKFQQKNYYHQKMSNSYKTLNSDFLKPDLDDRSYRYIQLPNSL
                     KALLISDPQTDKAAASIDVNVGAFEDPENLPGLAHFCEHLLFMGSEKFPDQNEYSSYL
                     SKHGGHSNAYTAALNTNYFFEVNHEHLHGALDRFSGFFTGPLMNADSTEKEINAVDSE
                     NKKNLQNDDWRRYQMDKTISNYNHPYHKFSTGNIKTLMEEPTKLGLNTRNELLKFYNS
                     SYSANIMKLCILGRQDLDTLSNWATEFFKDVKNLNKALPQYNENILEEEHLKKIIKII
                     PVKDLKKLEINFVVPDMDLHWESRPHHVLSHLIGHEGSGSILSYLKKLGWANDLSAGA
                     HTVSKDNAFFGINVDLTDKGLENYQEIALLIFQYIEMLKHSLPQEWIFSELQDVSKSS
                     FKFKQKSSPSGTVSELSKLLEKEYINPDLILSTTLLRKYEPEMIKQYVDSLTVDNSRI
                     TLISKTVETDSKEKWYGTEYQVVDYPKSFIDQLNQPGLNSEFKLPRRNEFVATNFEVK
                     KPTDELVPLDEPHLILDNDISKVWYKKDDRFWQPRGYIYVSMKLPSCQSGIVNSLLNG
                     LYVDQINDYMKDLQYDASCANLNLSFSSTNQGLDITISGFNDKLLVLLSRFIEGVKLY
                     QPSEERFNIFKNKAIQNLKNSLFEVPYSQMGTLYNTIMNESTWPIKEKLDVLEALTFD
                     QFVSFVPSIYNEFYFDALVHGNIRYEEAMEANDLLKSLASFKILNLHVRNSRLRSYIL
                     PEGESYRYEIDMEDKDNLNSCIQHVVQLGLYTEELSALSGLFAQMIREPCFDTLRTKE
                     QLGYVVFSSNLNNHGTANMRILVQSEHSTSYLEWRIDEFYKKFGESLNNMSEEDFEKH
                     KDALYKSLTQKYKNMREESSRYTVSIYLGDYNYTHRQKKAELVKKLTKQQMVDFYNDN
                     FVSNKKSQLVIHLKSVATKSLKDLEENELDNSVYPSGKLIDNIDSFKSKMFAAPIRQP
                     LKKFEVYNPKA"
     gene            <520720..>522054
                     /gene="TPHA0B02270"
                     /locus_tag="TPHA_0B02270"
                     /db_xref="GeneID:11534730"
     mRNA            <520720..>522054
                     /gene="TPHA0B02270"
                     /locus_tag="TPHA_0B02270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684285.1"
                     /db_xref="GeneID:11534730"
     CDS             520720..522054
                     /gene="TPHA0B02270"
                     /locus_tag="TPHA_0B02270"
                     /inference="similar to DNA sequence:INSDC:YLR387C"
                     /note="similar to Saccharomyces cerevisiae REH1 (YLR387C);
                     ancestral locus Anc_4.243"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684333.1"
                     /db_xref="GeneID:11534730"
                     /db_xref="GOA:G8BPG8"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BPG8"
                     /translation="MSAVQFTCNSCVIQFVSSDLQRYHMKTEWHRYNLKRRVAKLTPI
                     TADEFAQKLQISELEKGGHDYDEFGFEIISVNGNTDIKHNKRGKAKHRHHHHHHHHSH
                     GDRDSKNAINANEKAKDATPNDNDDAEPNTERRSSVSSKISKLSIDSEESNFDEDAGF
                     SDYAFTSDSNYTSTEDEYDSATDLSEYSYNENADGSVTITECIYCGVNNKEMERNIKH
                     MFSKHGLYLPERSYLVDVSGLLMFLIEVIVVNYQCLCCPFRGNSLEGIRAHMNSKRHC
                     RLPYETTQEKNMFKDFYDFSSLEERNREIIRKPTEGKQSIRFQESDDFDEFEQDISSI
                     IKEHNINSNFSASEFDDSHLRIKSPNGSIAGHRNSLRQNKQRKPIHEESSESKTAVTA
                     SDKRLVSGVTEKEFKKGLKKMQQTEKRAVDEHFRASVKRMNFQTHFRDELLQ"
     gene            complement(<522281..>525151)
                     /gene="TPHA0B02280"
                     /locus_tag="TPHA_0B02280"
                     /db_xref="GeneID:11534990"
     mRNA            complement(<522281..>525151)
                     /gene="TPHA0B02280"
                     /locus_tag="TPHA_0B02280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684286.1"
                     /db_xref="GeneID:11534990"
     CDS             complement(522281..525151)
                     /gene="TPHA0B02280"
                     /locus_tag="TPHA_0B02280"
                     /inference="similar to DNA sequence:INSDC:YLR386W"
                     /note="similar to Saccharomyces cerevisiae VAC14
                     (YLR386W); ancestral locus Anc_4.242"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684334.1"
                     /db_xref="GeneID:11534990"
                     /db_xref="GOA:G8BPG9"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR021841"
                     /db_xref="InterPro:IPR026825"
                     /db_xref="UniProtKB/TrEMBL:G8BPG9"
                     /translation="MEKSIVKGLSDKLYEKRKATALELQKQVSQYVNDNNYSQIDDII
                     NELCRDYAYALHQPMARTAGLMGLAAVSIALGTNNVTRYLSHILPPVLACFSDQNDQV
                     RFYACESLYNIAKIAKGEMLVYFNEIFDVLCKISADNENSVRGASELLDRLIKDIVAE
                     RASSYISVVNNDPQDLPPATKLDIVTGNVYQERYEQGSVDANISTGDTVNQNNKIVAF
                     SLPKFIPLLSERIYAINPDTRTFLVDWIKVLLNNPDLELITYLPAFLGGLFSFLDDSH
                     EDVKVVTHELLNQLLSEVVRISKIQKNIKQEEKILSMSERQAKPDNSSENNKISKSNT
                     VTSKKIDGSLIAEKKKSLLDAFGQLSVNKQSSSSILNNYSSNITTNSLDSNTIDNSKS
                     QQLPGDVSNISISTGISNDTINNNNHNNDDMNKDNIELLKANEQIPYYSQSKKPRFGE
                     EYIPGQDIHIDFSNIIEILINNLSSSEYEVRLVSLHWIDYLLNLAAREFIPYLSKILS
                     LLLKLLGDSDNNTSESANLVNSKFIALFNDEHFMKDSSLIAYSSLMNSLTLQFFDSKV
                     DTKIACLDWLLLIYKKSPDKILEQNENMIMILLKSLSDNDTRLTEKSLGILNTLCIDP
                     KDIYLKRFLHDLLDLLRKDSKLFKTRANYIIRQICTRLSSERIYKAISSILDTDDDIV
                     FSRMMIQILSANLVTSQEAADLRKKLRYGEDTYFFNILFKLWCHNPVSVLCLCFVAEN
                     YELAYNVLQCYVNYDLGMSDLVQLDMLVQLLESPVFTRLRLQLLEQQKFPYLYKCLYG
                     ILMILPQSKAFDILNRRLSSITNWVSQSSFNNTVYGSSRNGSHSTIGTDSSQRSVSKN
                     KYYNQELLDHFNKVLENERPSLKLDNTYDVNNETINEHDLNIGRVPSQTVIVKNAEKN
                     IEYDQLNYNSSYNEDNDNYNNNSQTSESTENDIPSVIQKPTI"
     gene            <525541..>525945
                     /gene="TPHA0B02290"
                     /locus_tag="TPHA_0B02290"
                     /db_xref="GeneID:11535108"
     mRNA            <525541..>525945
                     /gene="TPHA0B02290"
                     /locus_tag="TPHA_0B02290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684287.1"
                     /db_xref="GeneID:11535108"
     CDS             525541..525945
                     /gene="TPHA0B02290"
                     /locus_tag="TPHA_0B02290"
                     /inference="similar to DNA sequence:INSDC:YLR385C"
                     /note="similar to Saccharomyces cerevisiae SWC7 (YLR385C);
                     ancestral locus Anc_4.241"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684335.1"
                     /db_xref="GeneID:11535108"
                     /db_xref="InterPro:IPR020195"
                     /db_xref="UniProtKB/TrEMBL:G8BPH0"
                     /translation="MANYPDNVILLLLQIILERQQNLSHIFQNQKANKEKYEKLLERP
                     IIDQEILSRFVTDKLVIMYAPELCEMQLRSLKTLVLDIFNKGIEGEDKESILVNVITL
                     ANYYYYKRIKDIEETRLPELRSQMKIILEGKT"
     gene            complement(<526025..>526645)
                     /gene="TPHA0B02300"
                     /locus_tag="TPHA_0B02300"
                     /db_xref="GeneID:11535091"
     mRNA            complement(<526025..>526645)
                     /gene="TPHA0B02300"
                     /locus_tag="TPHA_0B02300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684288.1"
                     /db_xref="GeneID:11535091"
     CDS             complement(526025..526645)
                     /gene="TPHA0B02300"
                     /locus_tag="TPHA_0B02300"
                     /inference="similar to DNA sequence:INSDC:YDL059C"
                     /note="similar to Saccharomyces cerevisiae RAD59
                     (YDL059C); ancestral locus Anc_4.239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684336.1"
                     /db_xref="GeneID:11535091"
                     /db_xref="UniProtKB/TrEMBL:G8BPH1"
                     /translation="MISTCSETKSLTSISNAKKMMCNLQTDGVKFACLTQIHDFSKDQ
                     TVTRKNQDLAYTTVLKINSLECREKILEFKMLIDSYISTHIMKGCNKFGKHHLYKVIP
                     TKDLIESMAKVFGHHWNFEVVNEEVKYPIIRKKLNILVEVSIKINLLDNNSWSVLGGL
                     SNRIFDNYNIDKLHDYIGEVEEEAIDDGLRRAILNLLIENNNYVVS"
     gene            <527211..>529943
                     /gene="TPHA0B02310"
                     /locus_tag="TPHA_0B02310"
                     /db_xref="GeneID:11534773"
     mRNA            <527211..>529943
                     /gene="TPHA0B02310"
                     /locus_tag="TPHA_0B02310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684289.1"
                     /db_xref="GeneID:11534773"
     CDS             527211..529943
                     /gene="TPHA0B02310"
                     /locus_tag="TPHA_0B02310"
                     /inference="similar to DNA sequence:INSDC:YLR382C"
                     /note="similar to Saccharomyces cerevisiae NAM2 (YLR382C);
                     ancestral locus Anc_4.236"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684337.1"
                     /db_xref="GeneID:11534773"
                     /db_xref="GOA:G8BPH2"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002302"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR025709"
                     /db_xref="UniProtKB/TrEMBL:G8BPH2"
                     /translation="MLIPYIQASRYGLLKSVVYPTRTFHCLPVTLKDPLSDTVNRERL
                     VEINKKWAHEVTLNAMEGISNGKQMMKKKYILSMFPYPSGMLHLGHLRVYVISDVLNR
                     FYKQNKYDVLHPMGWDAFGLPAENAAIERGIRPSLWTETNIKKMKEQMNSMLANFDWT
                     KEVNTSDPNYYKFTQWIFVKLFKNGLAYQKESAINWDPVDETVLANEQVDANGKSWRS
                     GAKVEKRMLKQWFLGITKFAEQLNEDLVTLNDWPNKVKTMQKNWIGRSEGADVNFKIL
                     LSDETSLPNIIKNSGIDIFTTRIETIFAVQFLAISINHPVAQHYSKNNIELKTFIAKY
                     QNVNDHASDSKEGYQLPGIFVINPLTNAKVPVYVAPYVLDNYGHGAVMGVPSHDKRDK
                     EFWEENSAGVILPSVFDKVSDNVLKCIMNANVLKEYQSVTVTECREKIINHLEANNIG
                     KASIKYKLRDWLISRQRYWGTPIPIIHCHDCGAVPVPEADLPVLLPDVDSLTKRGNPL
                     SSISSFVEVNCPSCNKPAKRETDTMDTFIDSSWYYFRYTDSKNDSLPITKQNADKSMP
                     VDIYIGGVEHAILHLLYSRFISKFLKSIGQWDGTKAANAEPFKKLVTQGMVQGKTYVN
                     PRNGQFMKPNEIKFTNDSDNPVVTKDTEEPLNISYEKMSKSKYNGIDPMTFISQHGAD
                     ATRAHILFQAPIEKALNWDSDKIVGTERWLNKTLHICENISQNKTSDIDYVPSIQELN
                     KHEIKFNNDFSKLHMNINMSFKENLSLNTVVSDYMKMTNLIEIANENFNINKNLLIYN
                     LKKLITIMYPVTPTISAECANLIKKGQNWTDDEWDQYSWPNTDEPIIVKEQDYMVFVN
                     GKMRFKFAASTDFVKLEESCIVTELLKTNEGKKYLLGKTIKKIILKQKVISFIV"
     gene            complement(<530231..>531460)
                     /gene="TPHA0B02320"
                     /locus_tag="TPHA_0B02320"
                     /db_xref="GeneID:11534741"
     mRNA            complement(<530231..>531460)
                     /gene="TPHA0B02320"
                     /locus_tag="TPHA_0B02320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684290.1"
                     /db_xref="GeneID:11534741"
     CDS             complement(530231..531460)
                     /gene="TPHA0B02320"
                     /locus_tag="TPHA_0B02320"
                     /inference="similar to DNA sequence:INSDC:YLR380W"
                     /note="similar to Saccharomyces cerevisiae CSR1 (YLR380W);
                     ancestral locus Anc_4.234"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684338.1"
                     /db_xref="GeneID:11534741"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:G8BPH3"
                     /translation="MTQESTISGRIDSLDAKQELILKQVWTYLLQFWGIDIDGTKIFN
                     DPLVTSADKKKKKSLLGKLSGSSSTADSENTTAGTYTRGKIHDSLRSQDPKIIQDTFW
                     KTLRTDSPDNLLLRFIRARKWDSDKAMNMLVSSLNWRATKYDANDIVMKGEADMYKNN
                     EAGCIKNLELQKAVLNGFDKKGRPIVLVRPKLHHADDQTEEEIEKYSLLVIEQARLFL
                     NEPTEAASILFDLTDFTMSNMDYQPVKFLITCFEAHYPESLGHLFIHKAPWIFSPIWN
                     IIKKLLDPVVASKVVFTNKTKDLNKYIEMNNIPEHLGGTDTKDLDQFTPVDGSHDELL
                     EDTATRDALLEQRKELIETILKTTADWIHSSDANESRALLNEKIKLNSQLSELYRKLD
                     PYIRSRSSYDIDGTLTI"
     gene            complement(<532389..>533474)
                     /gene="TPHA0B02325"
                     /locus_tag="TPHA_0B02325"
                     /db_xref="GeneID:11535116"
     mRNA            complement(<532389..>533474)
                     /gene="TPHA0B02325"
                     /locus_tag="TPHA_0B02325"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684291.1"
                     /db_xref="GeneID:11535116"
     CDS             complement(532389..533474)
                     /gene="TPHA0B02325"
                     /locus_tag="TPHA_0B02325"
                     /inference="similar to DNA sequence:INSDC:YDL055C"
                     /note="similar to Saccharomyces cerevisiae PSA1 (YDL055C);
                     ancestral locus Anc_4.231"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684339.1"
                     /db_xref="GeneID:11535116"
                     /db_xref="GOA:G8BPH4"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BPH4"
                     /translation="MKGLILVGGYGTRLRPLTLTQPKPLVEFANRPMILHQIEALANA
                     GVTDIVLAVNYRPEVMVETLQKYEKEYGVSITFSVETEPLGTAGPLKLAEKILKKDNS
                     PFFVLNSDVICEYPFKELADFHNAHGGKGTIVATKVDEPSKYGVIVHDIQTPNLIDRF
                     VEKPVEFVGNRINAGLYILNPEVIDLIEMKPTSIEKETFPILVEQKSLYSFDLEGFWM
                     DVGQPKDFLAGTVLYLSSVAKKNEEKLAKGSNIVGNVIVDPTAKISPSAKIGPNVTIG
                     PNCVIGDGARIERSVILANSTVKEHSLVKSTIIGWNSTVGRWCRLEGVTVLGDDVEVK
                     DEIYINGGKVLPHKSISTNVPQEAIIM"
     gene            <535505..>536431
                     /gene="TPHA0B02330"
                     /locus_tag="TPHA_0B02330"
                     /db_xref="GeneID:11534970"
     mRNA            <535505..>536431
                     /gene="TPHA0B02330"
                     /locus_tag="TPHA_0B02330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684292.1"
                     /db_xref="GeneID:11534970"
     CDS             535505..536431
                     /gene="TPHA0B02330"
                     /locus_tag="TPHA_0B02330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684340.1"
                     /db_xref="GeneID:11534970"
                     /db_xref="GOA:G8BPH5"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:G8BPH5"
                     /translation="MTAIFANSTLVNLVKTDTFNGIVSNIETYQPQLNVIEKYWASWY
                     LFMDNDKLATGLLFFLLHEFMYFFRCLPWFIIDQIPYFRQWKIQPTKIPSMKEQWYCF
                     KSVLLSHFLVEAIPIWTFHPMCERLGITIQVPFPTIKRMALEIALFFVLEDMWHYWAH
                     RLFHYGIFYKYIHKQHHRYAAPFGLAAEYAHPAETMSLGFGTVGMPILYVMYTGNLHL
                     FTLCVWITLRLFQAIDSHSGYDFPWSLNKFLPFWAGAEHHDLHHHYFIGNYASSFRWW
                     DYCLDTESGPESKVSREEKMRRRAEKNVKKNI"
     gene            538416..538511
                     /gene="TPHA0Btrna15K"
                     /locus_tag="TPHA_0Btrna15K"
                     /db_xref="GeneID:11535067"
     tRNA            join(538416..538453,538475..538511)
                     /gene="TPHA0Btrna15K"
                     /locus_tag="TPHA_0Btrna15K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAA"
                     /db_xref="GeneID:11535067"
     gene            complement(<538839..>540275)
                     /gene="TPHA0B02340"
                     /locus_tag="TPHA_0B02340"
                     /db_xref="GeneID:11534736"
     mRNA            complement(<538839..>540275)
                     /gene="TPHA0B02340"
                     /locus_tag="TPHA_0B02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684293.1"
                     /db_xref="GeneID:11534736"
     CDS             complement(538839..540275)
                     /gene="TPHA0B02340"
                     /locus_tag="TPHA_0B02340"
                     /inference="similar to DNA sequence:INSDC:YLR378C"
                     /note="similar to Saccharomyces cerevisiae SEC61
                     (YLR378C); ancestral locus Anc_4.230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684341.1"
                     /db_xref="GeneID:11534736"
                     /db_xref="GOA:G8BPH6"
                     /db_xref="InterPro:IPR002208"
                     /db_xref="InterPro:IPR019561"
                     /db_xref="InterPro:IPR023201"
                     /db_xref="UniProtKB/TrEMBL:G8BPH6"
                     /translation="MSGRLLDLFKPFESFLPEVIAPERKVPYNQKLIWTGVSLLIFLV
                     LGQIPLYGIISSETADPLYWLRAMLASNRGTLMELGVTPIITSSMIFQFLQGTQLLQV
                     NMQNKEDRELFSTAQRVCAIILTLGQAVVVVASGNYGAPSDIGLAISLILIFQLIFAS
                     FIVLLLDELLSKGYGLGSGISIFTATNIAENIFWKAFAPTTVDTGRGTEFEGAIIALF
                     HLLAVRKDKKRALVEAFYRKNLPNMFQVLATIFVFLFVLYLQGFRYEIPVRSTRVRGH
                     LGSYPIKLFYTSNTPIMLQSALSSNIFLISQILYQRFPSNPFVNLLGVWGVKPGTQNQ
                     MALSGLAYYIQPPTSLMEIPLDPIKFVVYVSFVLGTCAIFSKTWIEISGSSPRDVAKQ
                     FKDDGLVINGKRESNVYRELKRIIPTAAALGGITIGALSIGSDFLGTLGSGTSILMAT
                     TTIYGYYEAAAREGGFSDKLVSGISELM"
     gene            complement(<541514..>542941)
                     /gene="TPHA0B02350"
                     /locus_tag="TPHA_0B02350"
                     /db_xref="GeneID:11534848"
     mRNA            complement(<541514..>542941)
                     /gene="TPHA0B02350"
                     /locus_tag="TPHA_0B02350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684294.1"
                     /db_xref="GeneID:11534848"
     CDS             complement(541514..542941)
                     /gene="TPHA0B02350"
                     /locus_tag="TPHA_0B02350"
                     /inference="similar to DNA sequence:INSDC:YDL054C"
                     /note="similar to Saccharomyces cerevisiae MCH1 (YDL054C);
                     ancestral locus Anc_4.229"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684342.1"
                     /db_xref="GeneID:11534848"
                     /db_xref="GOA:G8BPH7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G8BPH7"
                     /translation="MVRSNIEHYLSYHIRLSIPKILSNKSSCRVGYIFSLLAAVTSGF
                     VTLISLFTSSWQAQLHYTSKQINTIASVITLSMYLSPCILGVIADLHGPITLNFMAIL
                     GLAPSYLYLSYDYNSKMYQEEVNIPISSNFIPILVCFGTIGVATSAMYFSALLTCAKL
                     YPNRNLLSISLPTTFFGLSSLVGSQILRLRWFWNENEPLLNLSRVFKFLAASYVVVGL
                     LAWISTAVLSMLHNQKDEEYGELEALLSVDESYNHQTEIKNKQMQFLKDPNTYYFLIS
                     VFLVLGPLETFVANMYMVADLLTSKNSFYNESGAILSVYSFFSTGTRIIAGLITEALT
                     KRNKNLHSTLLIYIVLALFSQLYILRLTITSNGMNTETELYAMSSLSGICNGALFTMY
                     PTLLLNIYGKDLFGTVYGVMMIGPALGATYSFKRFGEIYDSKCSNTRSKASCISEFYG
                     YVNIEIILGFLLSLYVIHNWKKRSS"
     gene            complement(<543522..>543710)
                     /gene="TPHA0B02360"
                     /locus_tag="TPHA_0B02360"
                     /db_xref="GeneID:11535090"
     mRNA            complement(<543522..>543710)
                     /gene="TPHA0B02360"
                     /locus_tag="TPHA_0B02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684295.1"
                     /db_xref="GeneID:11535090"
     CDS             complement(543522..543710)
                     /gene="TPHA0B02360"
                     /locus_tag="TPHA_0B02360"
                     /inference="similar to DNA sequence:INSDC:YDL053C"
                     /note="similar to Saccharomyces cerevisiae PBP4 (YDL053C);
                     ancestral locus Anc_4.228"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684343.1"
                     /db_xref="GeneID:11535090"
                     /db_xref="UniProtKB/TrEMBL:G8BPH8"
                     /translation="MKKLFDSYNSQKNVALEEKGIQGLTNINENKAQESSNWDTVGSK
                     NKNKKFGCLTDVAKTLKA"
     gene            complement(<544512..>545495)
                     /gene="TPHA0B02370"
                     /locus_tag="TPHA_0B02370"
                     /db_xref="GeneID:11535027"
     mRNA            complement(<544512..>545495)
                     /gene="TPHA0B02370"
                     /locus_tag="TPHA_0B02370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684296.1"
                     /db_xref="GeneID:11535027"
     CDS             complement(544512..545495)
                     /gene="TPHA0B02370"
                     /locus_tag="TPHA_0B02370"
                     /inference="similar to DNA sequence:INSDC:YDL052C"
                     /note="similar to Saccharomyces cerevisiae SLC1 (YDL052C);
                     ancestral locus Anc_4.226"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684344.1"
                     /db_xref="GeneID:11535027"
                     /db_xref="GOA:G8BPH9"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="InterPro:IPR004552"
                     /db_xref="UniProtKB/TrEMBL:G8BPH9"
                     /translation="MGFINKIKFYYKSFLSFIVVSCSSVVGVFASIILSIVGKKYIAQ
                     WATARFFYYMYRTLLGIDVKVTSPQNLENLPCIFVSNHQSALDIMVIGKCFPRNCTVT
                     AKKSLKYVPFLGWYMSLSGTLFLDRKNGASSIVAMKNSLFNVLVQKRALWVFPEGTRC
                     SSEQLEMLPFKKGAFHMAQQGKIPIVPVVVSNTSNLFNKKHSIFNRGNIVVKVLDPIS
                     TQDLKSEEVADFANKVQEKMLKELKELGFCETSASIKRTDTTTTEAADDPPETDENEE
                     VEEVSTSNTSPEPPVSEGTEATVVEDKVSQLKSASENSFSTVGNDDSDDTK"
     gene            <546039..>546818
                     /gene="TPHA0B02380"
                     /locus_tag="TPHA_0B02380"
                     /db_xref="GeneID:11534917"
     mRNA            <546039..>546818
                     /gene="TPHA0B02380"
                     /locus_tag="TPHA_0B02380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684297.1"
                     /db_xref="GeneID:11534917"
     CDS             546039..546818
                     /gene="TPHA0B02380"
                     /locus_tag="TPHA_0B02380"
                     /inference="similar to DNA sequence:INSDC:YDL051W"
                     /note="similar to Saccharomyces cerevisiae LHP1 (YDL051W);
                     ancestral locus Anc_4.224"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684345.1"
                     /db_xref="GeneID:11534917"
                     /db_xref="GOA:G8BPI0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR002344"
                     /db_xref="InterPro:IPR006630"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BPI0"
                     /translation="MSEDNLVTPVSEQPRRNSFATIEFTPEVSKQCLKQLEFYFSEFN
                     FPYDKFLRTTAEKNDGWVPISTIATFNRMKKYRPVDKVIEALHASEILEVSEDGENTR
                     RRVPLDLSATRNARIEQSRRTLAIMNFPTDKEHEKITDAQEKIESFFHKLATVNQVRL
                     RRAQRKNFSGTVLVEFKTQEEADKFLTTYTGEGAEDLSYEGRKLDVLTKKQFELQREA
                     TNSKNFSGAGQRSRSFTGRRKNMPVVKSPKNGTESESAITE"
     gene            complement(<547109..>548149)
                     /gene="TPHA0B02390"
                     /locus_tag="TPHA_0B02390"
                     /db_xref="GeneID:11534877"
     mRNA            complement(<547109..>548149)
                     /gene="TPHA0B02390"
                     /locus_tag="TPHA_0B02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684298.1"
                     /db_xref="GeneID:11534877"
     CDS             complement(547109..548149)
                     /gene="TPHA0B02390"
                     /locus_tag="TPHA_0B02390"
                     /inference="similar to DNA sequence:INSDC:YDL048C,YLR375W"
                     /note="similar to Saccharomyces cerevisiae STP4 (YDL048C)
                     and STP3 (YLR375W); ancestral locus Anc_4.222"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684346.1"
                     /db_xref="GeneID:11534877"
                     /db_xref="GOA:G8BPI1"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BPI1"
                     /translation="MTNKGLFEYVSATTGAFIKKSKRKVRSNRKMEPSLLIPIPKLYD
                     SLVKIAETRDAPIMNVSSKSKVIDDTADEDETIGNSTYQKDTSKVSNDDNPTDDDVDS
                     NIDEELRKRKWDNNEEYSDNSTQDSSKAVEESGNSNVANVKKNEKRIRLPDPSDNRNP
                     GARKKKKCSVCNLSFANMTTHKRTHLSPEDKPFHCDICPKSFSRNFDFLRHKKEHVQK
                     ALIQDVNSQDAYSDLTNKSKLTQLHNIGNVFRCPYNEKVIDLDLSLHKYKVKPASSQV
                     ANCHHNGMFFRKDTLRNHLRSHHFDYDKKELSVKEKACASGRCRFCNEWHENAKIWAD
                     EHVGKKCGYSFH"
     gene            complement(<548651..>549739)
                     /gene="TPHA0B02400"
                     /locus_tag="TPHA_0B02400"
                     /db_xref="GeneID:11535010"
     mRNA            complement(<548651..>549739)
                     /gene="TPHA0B02400"
                     /locus_tag="TPHA_0B02400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684299.1"
                     /db_xref="GeneID:11535010"
     CDS             complement(548651..549739)
                     /gene="TPHA0B02400"
                     /locus_tag="TPHA_0B02400"
                     /inference="similar to DNA sequence:INSDC:YLR372W"
                     /note="similar to Saccharomyces cerevisiae SUR4 (YLR372W);
                     ancestral locus Anc_4.220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684347.1"
                     /db_xref="GeneID:11535010"
                     /db_xref="GOA:G8BPI2"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:G8BPI2"
                     /translation="MDTVVEKAAEEVIKQVAGEVGELAEEAIVAQSSNAIVDFLTSCP
                     YVILHTPSVDHPFGIELWPIFSKIFEMIAGYPAEEFQFIHNQTFLANGYHAMGIIAVY
                     YIIIFGGQALLRAANAGPTKLTFLFQLHNLFLTTVSFTLLMLLVEQLLPMIYYHGIFW
                     AICSKEAFAPKLVVLYYLNYLTKFWELFDTVFLILRRKNLLFLHVYHHGATALLCYTQ
                     IVGQTSVEWVVISLNLGVHVIMYWYYFLSSRGIRVWWKEWVTRFQIIQFLIDLCFVYF
                     ATYTFYANKYFTDILPHMGTCYGTQDAAAYGYLILTSYLFLFISFYIQSYRKSGKKKQ
                     EPAPAKSISTGSKASGAKKNKTKVSRRA"
     gene            complement(<550721..>554572)
                     /gene="TPHA0B02410"
                     /locus_tag="TPHA_0B02410"
                     /db_xref="GeneID:11535016"
     mRNA            complement(<550721..>554572)
                     /gene="TPHA0B02410"
                     /locus_tag="TPHA_0B02410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684300.1"
                     /db_xref="GeneID:11535016"
     CDS             complement(550721..554572)
                     /gene="TPHA0B02410"
                     /locus_tag="TPHA_0B02410"
                     /inference="similar to DNA sequence:INSDC:YGR070W,YLR371W"
                     /note="similar to Saccharomyces cerevisiae ROM1 (YGR070W)
                     and ROM2 (YLR371W); ancestral locus Anc_4.219"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684348.1"
                     /db_xref="GeneID:11535016"
                     /db_xref="GOA:G8BPI3"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:G8BPI3"
                     /translation="MNIFFKKNTHIRNVSDTKSLSSSDNTPTSSPRKIFQNYSNNSSS
                     QKIKDEQETIFVDAHKQKNQVPVTYHPKSLRATKSEHFSKRTPSLPQLSIGGVKNQAS
                     FSNGNQSPKLNSNSIPSSPSSAYKKSPLTGFNVFSKSNNNNNNNNNNNNNNNNNNNNN
                     NNDNFTIDESPSSSQDSIYNEHNSQNSRDAPSSSGTFRSMSITSNTFKSIKSSFGSRK
                     NSQRGETSNPFSSHDNHNNNPPNSNGKSNSNQKNLLSKSISDNNMGLGIKTRKSSTSL
                     MSKRYMSGSSTNLPYRQTSSTSTKTSSSNVYHGHHHHQHTSRKPQVYPALLSKVASKF
                     KSQIQLKEHKKNGLLYRDSFTGQQAVTLVSSIIRTSDRNLALLLGRSLDAQNFFHDVV
                     YEHRLRDSPNEIYEFTDNLRIIGSNSGSYAHMSRHEPLDLYSTGDNSISGINLTNSNT
                     NTLHYQPSISSMTTDRTVTTSSAHNMEAEIAQPQGSNNIMVRNVNGVFTLLAECYSPT
                     CSRDKLCYSISCPNRLEQQARLNLKPNGGLKRNISMNLDDDEEERQCWTSSVSEDIWK
                     NLSKNEIKRQEAIYEVFMTEKKFIKSLEITRDTFMKTLAETNIIPADIRKNFIKHVFA
                     HIEDIYSVNRRFFEALAERQRSQPLVRGIGDIMLRFLPFFEPFITYVASRPYAKYLIE
                     TQRSVNPYFARFDDDMMNSSLRHGIDSFLSQGVSRPGRYMLLVKEILKSTDPEKDTRD
                     HENLQKCMESLKAFMSRIDVASGAAQDRHDVKLLKQKILFKNEYVNLGLNDEKRKIKH
                     EGILFRKEISKTDNTFNGDIQFYLLDNLLLFLKAKSVNKWHQHKVFQRPIPLPLLFSI
                     PGEEVPNLRKYIGTVPDSSACVLKPELNQTSNLKNAISFVYYGAKQKYQVTLYAAQLA
                     GLQTLLEKIRVEQQRIISETSMINIIKISDKYFDYNNKINSVVSCDGGRKLLIATNLG
                     LYMSNIRRTPASENSKAHVLFSTPTQVIQRNSITQVGVLEEFKSILLLIDKKLYSCPL
                     ALLDVQGNATQYFKKHGKELINHVNFFAEGDCNGKRLVVTAHSHSVKYFEHEHPLLSR
                     KTNGSGDSGTNTTGAVNPTTTTKKNLKKSITEVTFDSEPVSISFLKANLCIGCKKGFQ
                     IVSIFRNQHESLLDSADTSLEFALQDTLKPMAIYRVGTMFLLCYTEFAFFVNNQGWKK
                     KDSHIINWEGEPQKFAIWHPYILAFDTNFIEIRKIETGELVRCILGEKIRLLQTSSQE
                     ILYVYEDSRGYDTVASLDFWG"
     gene            <556748..>557278
                     /gene="TPHA0B02420"
                     /locus_tag="TPHA_0B02420"
                     /db_xref="GeneID:11535168"
     mRNA            <556748..>557278
                     /gene="TPHA0B02420"
                     /locus_tag="TPHA_0B02420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684301.1"
                     /db_xref="GeneID:11535168"
     CDS             556748..557278
                     /gene="TPHA0B02420"
                     /locus_tag="TPHA_0B02420"
                     /inference="similar to DNA sequence:INSDC:YLR370C"
                     /note="similar to Saccharomyces cerevisiae ARC18
                     (YLR370C); ancestral locus Anc_4.218"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684349.1"
                     /db_xref="GeneID:11535168"
                     /db_xref="GOA:G8BPI4"
                     /db_xref="InterPro:IPR007204"
                     /db_xref="UniProtKB/TrEMBL:G8BPI4"
                     /translation="MPAYHSTFAVDQTNDRLVGNFVLLPLNSKYRGPAYPANSDYDII
                     DECIDLFRANSFFKNFEIKSPADRVLIYGILFINDCLSNLKSNTSQSEAIKILTNIAL
                     DNIKVPGSPGFQLNSVYNIPTNDHNQVELLTSYIQQFRQELAMRLLERIYTDSKDHPS
                     KFWLAFTRRRFMNKSL"
     gene            complement(<557582..>559537)
                     /gene="TPHA0B02430"
                     /locus_tag="TPHA_0B02430"
                     /db_xref="GeneID:11534838"
     mRNA            complement(<557582..>559537)
                     /gene="TPHA0B02430"
                     /locus_tag="TPHA_0B02430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684302.1"
                     /db_xref="GeneID:11534838"
     CDS             complement(557582..559537)
                     /gene="TPHA0B02430"
                     /locus_tag="TPHA_0B02430"
                     /inference="similar to DNA sequence:INSDC:YLR369W"
                     /note="similar to Saccharomyces cerevisiae SSQ1 (YLR369W);
                     ancestral locus Anc_4.217"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684350.1"
                     /db_xref="GeneID:11534838"
                     /db_xref="GOA:G8BPI5"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:G8BPI5"
                     /translation="MLRLRNVLRPTHGYNVARLVSARYSSTKVVGIDLGTTNSAIAYI
                     KDSNNKNSVEIIENNEGNRTTPSVVAFGKDKKWIVGEAAKRQASINPMNTFYATKRLI
                     GRHFDSSEVKLDIEIMPFKIVPSPDNGQAYLCTTDGNVKSPSEIGSYILDHLKKQAQD
                     YLNEKIDKAVITVPAYFNDSQRQATKDAGKLAGLKVLRVINEPTAAALSFGMDDKSNS
                     GIIAVYDLGGGTFDISILDIEDGVFEVRATNGDTHLGGEDFDNVVVNYIIDSFVKENP
                     EINKNNLLNNNEVIQRVKVAAEKAKIALSHVTETEISIPFITRNKHFLKTLKERELDD
                     MTLHLINRTINPVKKALKDADIDPEDIDDIILVGGMTRMPKIRKIVEQLFNKKPTTTV
                     NPDETVALGAAIQGGVLSGEIKNVLLLDVTPLSLGIETFGGAFSPLIPRNTTVPAKKT
                     EVFSTGVDGQTSVLFKVYQGERGLVRDNKLIGDFVLKGIPPMLKGKPQIFVTFDVDAD
                     GIINVTASEKSTGKEQSVTVISNSGLTQDEIKKMVEEGQKNKDMDNKLRSRIELINKA
                     DVMISDTERAFEQFREVISLEENYESILKELHTVRETINLYKNNENDFSLDVNNIKRA
                     TDTLQNKSLKLFQAASKRQAKLKDTKQ"
     gene            <560189..>561592
                     /gene="TPHA0B02440"
                     /locus_tag="TPHA_0B02440"
                     /db_xref="GeneID:11534896"
     mRNA            <560189..>561592
                     /gene="TPHA0B02440"
                     /locus_tag="TPHA_0B02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684303.1"
                     /db_xref="GeneID:11534896"
     CDS             560189..561592
                     /gene="TPHA0B02440"
                     /locus_tag="TPHA_0B02440"
                     /inference="similar to DNA sequence:INSDC:YHR030C,YKL161C"
                     /note="similar to Saccharomyces cerevisiae SLT2 (YHR030C)
                     and YKL161C; ancestral locus Anc_5.274"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684351.1"
                     /db_xref="GeneID:11534896"
                     /db_xref="GOA:G8BPI6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008352"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BPI6"
                     /translation="MNNIAIKRHTFKVFNQDFTVDKRFELIKEIGHGAYGVVCSARFI
                     EATEDTTVAIKKVTNIFSKTLLCKRSLRELKLLRHFRGHKNITCLYDLDIVFNSKTGE
                     FNGLYLYEELMECDLYQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGN
                     LLVNADCQLKICDFGLARGYSENPVENNQFLTEYVATRWYRAPEIMLSYQGYTRAIDV
                     WSTGCILAEFLGGKPIFKGKDYVNQLNRILQVLGTPPDETLRRIGSKNVQDYIHQLGH
                     IPKVPFSNLYPQANPDALDLLEKMLAFDPQDRITVNEALEHPYLSVWHDPSDEPICLE
                     KFEFSFETVNEMDMLREMVIQEVQDFREFVRKPLIEENENGLVNSPSQSQQSEQDIIS
                     NVQMQQQLDSASSNNMAGDFTSELQSNNLPKTRDNDFPPSPQENNRSAITSNNNQFNG
                     IFDLEKELEFGLDGKYL"
     gene            complement(<561824..>562483)
                     /gene="TPHA0B02450"
                     /locus_tag="TPHA_0B02450"
                     /db_xref="GeneID:11534854"
     mRNA            complement(<561824..>562483)
                     /gene="TPHA0B02450"
                     /locus_tag="TPHA_0B02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684304.1"
                     /db_xref="GeneID:11534854"
     CDS             complement(561824..562483)
                     /gene="TPHA0B02450"
                     /locus_tag="TPHA_0B02450"
                     /inference="similar to DNA sequence:INSDC:YHR026W"
                     /note="similar to Saccharomyces cerevisiae PPA1 (YHR026W);
                     ancestral locus Anc_5.270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684352.1"
                     /db_xref="GeneID:11534854"
                     /db_xref="GOA:G8BPI7"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="UniProtKB/TrEMBL:G8BPI7"
                     /translation="MSSTATYKENTKDDDDIFNYFSWSKFLYYIILTVIVVYVLYKLF
                     TGHGTDINIGKFLLKSSPYMWANLGIAACIGLSVVGAAWGIFITGSSIIGAGVRAPRI
                     TTKNLISIIFCEVVAIYGLIIAIVFSSKLTVASPETMFSKSNLYTGYSLFWAGLTVGM
                     SNLICGVAVGITGATAAISDAADSALFVKILVIEIFGSILGLLGLIVGLLMAGKAVDF
                     Q"
     gene            <563569..>565047
                     /gene="TPHA0B02460"
                     /locus_tag="TPHA_0B02460"
                     /db_xref="GeneID:11534829"
     mRNA            <563569..>565047
                     /gene="TPHA0B02460"
                     /locus_tag="TPHA_0B02460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684305.1"
                     /db_xref="GeneID:11534829"
     CDS             563569..565047
                     /gene="TPHA0B02460"
                     /locus_tag="TPHA_0B02460"
                     /inference="similar to DNA sequence:INSDC:YHR024C"
                     /note="similar to Saccharomyces cerevisiae MAS2 (YHR024C);
                     ancestral locus Anc_5.268"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684353.1"
                     /db_xref="GeneID:11534829"
                     /db_xref="GOA:G8BPI8"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:G8BPI8"
                     /translation="MFKTSGRRSVINTLSKRLYSQSSSDTFQFTTLKNGIRVASNSLP
                     SHFSALGLYLGAGSRFESDNSLKGCTHMMDRLSFKSTENIEGRTMAETLELLGGNYQC
                     TSSRETIMYQASVFNQDVDKMLHLMAETVRYPNITDSELNEQKAIVQYELEEIQLKPD
                     MILPELLHMAAYSNKTLGNPSLCPPELLPYLSKENLRNYRNKFYIPKNTVAAFVGVPH
                     EKAIEYVETHFGDWNSSTSITKQEPAHYTGGELSVPSGPVYGGLPELYHIQIGFEGLP
                     IDHPDICALATLQTLLGGGGSFSAGGPGKGMYSRLYTHVLNQYYFIENCISFNHSYSD
                     SGIFGISISCIPEAAEQAVEVIAQQFHNTFANDRLKLSQEEVDRAKNQLKSSLLMNLE
                     SKLVELEDMGRQIQAQGKKIPLTEIIRMIEALTPEDIRRVAETVFTGKVKNIGEGTGK
                     ATVVIKGKREAFGDVESVLRRYGLGNYPKLNQPSKESKRRFF"
     gene            <566374..>567389
                     /gene="TPHA0B02470"
                     /locus_tag="TPHA_0B02470"
                     /db_xref="GeneID:11532808"
     mRNA            join(<566374..566376,567144..>567389)
                     /gene="TPHA0B02470"
                     /locus_tag="TPHA_0B02470"
                     /product="40S ribosomal protein S27"
                     /transcript_id="XM_003684306.1"
                     /db_xref="GeneID:11532808"
     CDS             join(566374..566376,567144..567389)
                     /gene="TPHA0B02470"
                     /locus_tag="TPHA_0B02470"
                     /inference="similar to DNA sequence:INSDC:YHR021C,YKL156W"
                     /note="similar to Saccharomyces cerevisiae RPS27B
                     (YHR021C) and RPS27A (YKL156W); ancestral locus Anc_5.265"
                     /codon_start=1
                     /product="40S ribosomal protein S27"
                     /protein_id="XP_003684354.1"
                     /db_xref="GeneID:11532808"
                     /db_xref="GOA:G8BPI9"
                     /db_xref="InterPro:IPR000592"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR023407"
                     /db_xref="UniProtKB/TrEMBL:G8BPI9"
                     /translation="MVLVQDLLHPSATSEARKHKLKTLVQAPRSYFLDVKCPGCLNIT
                     TVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK"
     gene            complement(<567699..>569822)
                     /gene="TPHA0B02480"
                     /locus_tag="TPHA_0B02480"
                     /db_xref="GeneID:11534727"
     mRNA            complement(<567699..>569822)
                     /gene="TPHA0B02480"
                     /locus_tag="TPHA_0B02480"
                     /product="mitochondrial 37S ribosomal protein RSM22"
                     /transcript_id="XM_003684307.1"
                     /db_xref="GeneID:11534727"
     CDS             complement(567699..569822)
                     /gene="TPHA0B02480"
                     /locus_tag="TPHA_0B02480"
                     /inference="similar to DNA sequence:INSDC:YKL155C"
                     /note="similar to Saccharomyces cerevisiae RSM22
                     (YKL155C); ancestral locus Anc_5.264"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM22"
                     /protein_id="XP_003684355.1"
                     /db_xref="GeneID:11534727"
                     /db_xref="GOA:G8BPJ0"
                     /db_xref="InterPro:IPR015324"
                     /db_xref="InterPro:IPR016522"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BPJ0"
                     /translation="MFNITRYATSLGGLRQISTVRKEFLKRIVVDDELIIAKGIPSEQ
                     TFGKLVRDGDSENVTVITKEESMNGSIKSPYRNSSGTLISGSNAKEARLQPETLLGKA
                     FPEQIKLNSIIEKTIRDNILSLHIPANLRRVAANYFIELKKTSLHRPAKTILEVDAHI
                     ASIFVQNYASIYQCLTELQQRVGKKHFSPNRVLDVGFGPATGIVALNDLLGQDYRPEL
                     KEAVIIGEREMQNRAKIILSRQLNEVPITKEGSVSSSNKMDSVGKSDDISDEKDMVGE
                     VMTDKINIVTRIKDSIPGSKQYDLIILTHQLLKSEQHFPVQIDHNIEHYLNLLAPGGH
                     IIIVERGNPLGFESIARARQVIIRPENYLDEYGKIPRPWLRGSSNKINRINLLSVNRE
                     TEAALDEELQFEPEILDAIEKMNKKEVDLKDIDYHVSILAPYPHHRKCPLQTGKPTYY
                     SFKEGKRLKFLNFQKAIERPKFGIELKKGKILAAPWENPTAGIGLPGIAKGGSGRANG
                     RSFEVANYSYMIIERSLNDKETINKINQLREKHNTAEMKEKYQVGSTGNGTPNEWPRI
                     ISPPSKVKGHVTFDVFGPSGEIEKWTIPKSFSKEVYHDARKAMKGDLWALDAKTKIKS
                     MNTFNVSKFEALEKSRIKELKKEKKMRERELIETQNTISEPDEFSSDPHGLFINNDVN
                     TIRKLSEIYDHNFSKSNKEKRKKRY"
     gene            <570257..>571048
                     /gene="TPHA0B02490"
                     /locus_tag="TPHA_0B02490"
                     /db_xref="GeneID:11534745"
     mRNA            <570257..>571048
                     /gene="TPHA0B02490"
                     /locus_tag="TPHA_0B02490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684308.1"
                     /db_xref="GeneID:11534745"
     CDS             570257..571048
                     /gene="TPHA0B02490"
                     /locus_tag="TPHA_0B02490"
                     /inference="similar to DNA sequence:INSDC:YKL154W"
                     /note="similar to Saccharomyces cerevisiae SRP102
                     (YKL154W); ancestral locus Anc_5.263"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684356.1"
                     /db_xref="GeneID:11534745"
                     /db_xref="InterPro:IPR019009"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPJ1"
                     /translation="MENIKSIYITIVLLILSSAAFFIFNKNGKIAVSVNGHSGDKQYK
                     NKKPTLIIAGSSNSGKSTLFGLLTTDSIKTTVVSQVPNVCHHFVSEPENKAVKLIDFP
                     GNIKLTYKLIEALKSSNNIKGIIFVTDSTVDPRHITQTAELLYNILNIVEDRDHNGVN
                     ILIACNKSESFIARPPQKILNALENEIANIIKRKKKSLNSVSDTQANDADLYDEDLLN
                     DENPLDSINDFKFSLLESEITLAEGSVTKRKISKWQEWINDVVNQ"
     gene            complement(<571203..>571400)
                     /gene="TPHA0B02500"
                     /locus_tag="TPHA_0B02500"
                     /db_xref="GeneID:11534765"
     mRNA            complement(<571203..>571400)
                     /gene="TPHA0B02500"
                     /locus_tag="TPHA_0B02500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684309.1"
                     /db_xref="GeneID:11534765"
     CDS             complement(571203..571400)
                     /gene="TPHA0B02500"
                     /locus_tag="TPHA_0B02500"
                     /inference="similar to DNA sequence:INSDC:YIL102C-A"
                     /note="similar to Saccharomyces cerevisiae YIL102C-A;
                     ancestral locus Anc_5.262"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684357.1"
                     /db_xref="GeneID:11534765"
                     /db_xref="GOA:G8BPJ2"
                     /db_xref="InterPro:IPR009914"
                     /db_xref="UniProtKB/TrEMBL:G8BPJ2"
                     /translation="MNRFLVLTFAFIYYLIWLVLPIFELDRKLYLFPLPSVYAVYLPI
                     LLLLLGVILVGSYMGYLLLIN"
     gene            572766..572837
                     /gene="TPHA0Btrna12R"
                     /locus_tag="TPHA_0Btrna12R"
                     /db_xref="GeneID:11534823"
     tRNA            572766..572837
                     /gene="TPHA0Btrna12R"
                     /locus_tag="TPHA_0Btrna12R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGA"
                     /db_xref="GeneID:11534823"
     gene            complement(<573028..>577131)
                     /gene="TPHA0B02510"
                     /locus_tag="TPHA_0B02510"
                     /db_xref="GeneID:11534934"
     mRNA            complement(<573028..>577131)
                     /gene="TPHA0B02510"
                     /locus_tag="TPHA_0B02510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684310.1"
                     /db_xref="GeneID:11534934"
     CDS             complement(573028..577131)
                     /gene="TPHA0B02510"
                     /locus_tag="TPHA_0B02510"
                     /inference="similar to DNA sequence:INSDC:YJL042W"
                     /note="similar to Saccharomyces cerevisiae MHP1 (YJL042W);
                     ancestral locus Anc_5.259"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684358.1"
                     /db_xref="GeneID:11534934"
                     /db_xref="UniProtKB/TrEMBL:G8BPJ3"
                     /translation="MEINLGKESIKNDIEKVRLQPLDIDWFIRSGKIDKNYEATLKNK
                     QADPKSDEKDKATEPIRTNDHQINKNSSDKDKSNRRQSMNAHEENLNIHKIKSLNADN
                     VEQHKNTVVPDECLPIRRTRSLPSNKEQDDAKSISFTPVDNITTNKSPKPKGSFFKKL
                     FNRQRSSSSASLNSEKVEEQFKKKERRESTSSIGTKPALKELETIRPTDNNNINTSTY
                     NDYNRSSTADSHLNGKNKNKNNVINEVDLRTDNIKLREFLDYYKKNGYNVSSFKNKNG
                     KSIKNIRKKQPCFVIGDPTENRPSSKRNQTTKLEKERVDSRGRSLPDLPEKSKYKSCL
                     KNLTIADSSRGAESPICYSSESESDDESSASPGRFGNFLKKVTSHGTGSRNSRNNSIE
                     YKSIDHNISPDNLMSSNSSIDSKMDFDKFNVPGLEDIKQFKHVAFSPCTYFNDPPQQI
                     CSKSPRKGEVEVKEDGTIIIHRLSKEERLKTMENSSLGVVVGGTGYLKLLERNRNEYP
                     TPSDEETNFELSQTDESIESSRNVPEKLASVGDNEQDIAVSKSASFLKIDKPMISRRS
                     SASIRSQESSFIGDVLPLKDVRIPHDIIYTRCCHLREILPIPAIMKQLKKGSTDPIPL
                     LQLRNPRPSLVEVWCFSDFISSVPVLSVSLDGTSLSSEVFKIILSSLIRKKHFEKLSL
                     RNTSIDDDGWKFLSYFISKSTSLLCIDLTMVPSIKTNVQKPSKSSLKSTLKRMECNLD
                     NRSDRNWDLFSASVAAHGGLEEIIVSGANMSLSQFQNFLSVACQKTERLGLAYNNLTV
                     EQMDYLGTWVINSKITGLDLGFNDLHNKLSGFTEGVSNVIKRKGEKAQFKYFSLNSTN
                     LQVEENASSTTNEPLYLISTLCYCQNLRFLDLSNNPKMFPYCRRTLLNCLPVFVNLVR
                     LHLDFEKLDSTTVIMLAEMFPLCSKLNHLSMLGTSFGVAAVKALTDAVEKSNSLITLD
                     IDYSQFSEKAKEKLSLFTMRNLQNEASRIQLMNTNKSPNSDRLDSLSNLQSELSNILN
                     ANSDDRQLYNAMVIKFILRLMHARAKITKVVHDLFELRLNGQLNREGRDALIRLCFID
                     SCFEKGIRLLKERNPDVNIDSSKAEESNTEIALNLTCPVTEANTSSKVNQKQSGDLQT
                     SSNNSSVLRLSDELNKTGHSMLLPFGKAELVGYFPHAHDTIDLTTDGEIKSLELARQE
                     SEEGRLFKQSSHIMREVEDSIANEKIDKNALIGAAESLDSDQIKGFLLKNDISAAVSV
                     IDELHKRGYHLHHIFKKKEAINDDNYKSDCVFNETNDEHPTNNNNNVEDSDQFNIITP
                     CDSEVEVRDLNFSSNNAEEEETIDAEYDKVLDNLQKARIFANSETNR"
     gene            complement(<578421..>579647)
                     /gene="TPHA0B02520"
                     /locus_tag="TPHA_0B02520"
                     /db_xref="GeneID:11534864"
     mRNA            complement(<578421..>579647)
                     /gene="TPHA0B02520"
                     /locus_tag="TPHA_0B02520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684311.1"
                     /db_xref="GeneID:11534864"
     CDS             complement(578421..579647)
                     /gene="TPHA0B02520"
                     /locus_tag="TPHA_0B02520"
                     /inference="similar to DNA sequence:INSDC:YKL149C"
                     /note="similar to Saccharomyces cerevisiae DBR1 (YKL149C);
                     ancestral locus Anc_5.254"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684359.1"
                     /db_xref="GeneID:11534864"
                     /db_xref="GOA:G8BPJ4"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR007708"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8BPJ4"
                     /translation="MGKLRVAIQGCCHGELDKIFQELEQLHKRNPIDLLLILGDFQSL
                     RSENDFKSISIPPKYQKLGDFQNYYKDSNLKPCVPTIFIGGNHESMRHLMLLPFGGYV
                     SNDIYFMGYSNMIWFKGLRIGGLSGIYKHWDLNKNRPGYKFLEEGNNWEKNVRSLYHV
                     RKTDLLPLYMTACTRNEYNEKNGVNIMMSHDWPNGIVYHGNYKELLKVKPFFKRDVLY
                     NQSLGSELNWELLNLFKPEWWVSAHLHVRYTAEFTHEDKKRKMEDIKTTNQDEISLDL
                     DDLDSSSTEEEEKTTPVKTTHFLALDKCLPRRKHLEIIEIEGNENHFSSTSNDMYYDP
                     EFINNLSYIEKNKEHSKIKNTPLNKIDINELISDNKIMQLDEIDWNKYKIPNYETDVQ
                     KLETEQTNSFIEQFLK"
     gene            <580212..>582002
                     /gene="TPHA0B02530"
                     /locus_tag="TPHA_0B02530"
                     /db_xref="GeneID:11534862"
     mRNA            <580212..>582002
                     /gene="TPHA0B02530"
                     /locus_tag="TPHA_0B02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684312.1"
                     /db_xref="GeneID:11534862"
     CDS             580212..582002
                     /gene="TPHA0B02530"
                     /locus_tag="TPHA_0B02530"
                     /inference="similar to DNA sequence:INSDC:YKL146W"
                     /note="similar to Saccharomyces cerevisiae AVT3 (YKL146W);
                     ancestral locus Anc_5.252"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684360.1"
                     /db_xref="GeneID:11534862"
                     /db_xref="GOA:G8BPJ5"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:G8BPJ5"
                     /translation="MSENKTVDKSQLLINNPNSSSRTPNAPLNNDYGTINDTGNPLLN
                     DQMVSLPKNDITHTPVSRQRSMSFSQVSVQSSSNNVLEDAGLPMSHRDITAPGGFRRS
                     FIMRKHILENKKIPYLPNFMLTNFNDFLYLYGHYAGEDLSESDEDEEAIEDEEDYQDF
                     ARRPLLNNVSPSNNPLATGVSPTEIPHRIAKRKGDNNKKASTFKAILLLLKSFVGTGI
                     LFLPKGFSNGGYTFSTISLLVCSLLSYYCFILLISTKDQMKGINGYGDLGNHLYGKNM
                     KLAILLSIVLSQIGFSAAYTVFVATNLKTLCQNLFSNNQHFSIVLFIIFQTLLFIPLS
                     FTRNITKLTATALVADLFIFIGVIYIYYYPITYIIKNGIATETIVPFNNKNWSLFIGT
                     AIFTFEGIGLLIPIQESMAKPHQFFISLTLVMVIVTVIFISVGLLCYCAFGSSVETVV
                     LLNFPQDSPYTLTVQLLYCLAILLSTPLQLFPAIRILENWVFKKKGSGKYNPKIKWAK
                     NYFRSLIVIGTTCIAWSGANDLDKFVSLVGSFACIPLIYIYPPLLHYKACKINGSANL
                     VQNYLDIILILFGVILMSYTSFQTIQLWLS"
     gene            <582838..>583299
                     /gene="TPHA0B02540"
                     /locus_tag="TPHA_0B02540"
                     /db_xref="GeneID:11534924"
     mRNA            <582838..>583299
                     /gene="TPHA0B02540"
                     /locus_tag="TPHA_0B02540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684313.1"
                     /db_xref="GeneID:11534924"
     CDS             582838..583299
                     /gene="TPHA0B02540"
                     /locus_tag="TPHA_0B02540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684361.1"
                     /db_xref="GeneID:11534924"
                     /db_xref="UniProtKB/TrEMBL:G8BPJ6"
                     /translation="MYSQLDISFQSRENTCDDIDYKKFEKRQQDHILKSTLPSDKEYN
                     NVFKKYDCNIIRGSKIQQTETVKAYAYRDTNPENLKFFKLSNSKSENENQKLQILCKS
                     GKLMDRIYYWSPNAPSFEEVAMTFYFDSDRLRNSKPETIAWFFEQWQYRNN"
     gene            <583789..>585180
                     /gene="TPHA0B02550"
                     /locus_tag="TPHA_0B02550"
                     /db_xref="GeneID:11535171"
     mRNA            <583789..>585180
                     /gene="TPHA0B02550"
                     /locus_tag="TPHA_0B02550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684314.1"
                     /db_xref="GeneID:11535171"
     CDS             583789..585180
                     /gene="TPHA0B02550"
                     /locus_tag="TPHA_0B02550"
                     /inference="similar to DNA sequence:INSDC:YKL145W"
                     /note="similar to Saccharomyces cerevisiae RPT1 (YKL145W);
                     ancestral locus Anc_5.251"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684362.1"
                     /db_xref="GeneID:11535171"
                     /db_xref="GOA:G8BPJ7"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPJ7"
                     /translation="MAPKEDWEKYKAPVEGKDSKPNEDKIIPLSEGDIQVLKSYGAAP
                     YDSKIKETEKDLKVIEGKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARC
                     TKIIKKSSENGDESNSESTEGNGTANTNTAADDNEEAKYVINLKQIAKFVVGLGERVS
                     PTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLR
                     EVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELV
                     QKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELIT
                     QLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSM
                     SVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGY
                     KKFSSTSRYMQYN"
     gene            complement(<585440..>586510)
                     /gene="TPHA0B02560"
                     /locus_tag="TPHA_0B02560"
                     /db_xref="GeneID:11534780"
     mRNA            complement(<585440..>586510)
                     /gene="TPHA0B02560"
                     /locus_tag="TPHA_0B02560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684315.1"
                     /db_xref="GeneID:11534780"
     CDS             complement(585440..586510)
                     /gene="TPHA0B02560"
                     /locus_tag="TPHA_0B02560"
                     /inference="similar to DNA sequence:INSDC:YBR249C"
                     /note="similar to Saccharomyces cerevisiae ARO4 (YBR249C);
                     ancestral locus Anc_6.168"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684363.1"
                     /db_xref="GeneID:11534780"
                     /db_xref="GOA:G8BPJ8"
                     /db_xref="InterPro:IPR006218"
                     /db_xref="InterPro:IPR006219"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G8BPJ8"
                     /translation="MSENNNHQEDVRILGYDPLVSPALLQVQVPATEKCLETARKGRE
                     ESIEIISGRDDRVLVVVGPCSIHDLDAAQEYAIRLKKLSEELQQDLLIVMRAYLEKPR
                     TTVGWKGLINDPDVNNTFNINKGIQAARQLFVNLTDLGLPIGSEMLDTISPQYLADLL
                     SFGAIGARTTESQLHRELASGLSFPIGFKNGTDGTLGVAVDACKAASFSHHFMGVTKH
                     GLAAITTTKGNEHCFVILRGGKKGTNFDAKSVAEAKAQLDEGSNGLMIDYSHGNSNKD
                     FRNQPKVNDVVCEQIANGEKSIIGVMIESNIKEGNQKIPPEGKAGLEYGVSITDACIS
                     WETTVDVLRKLAGAVRQRREKK"
     gene            <588000..>589607
                     /gene="TPHA0B02570"
                     /locus_tag="TPHA_0B02570"
                     /db_xref="GeneID:11535070"
     mRNA            <588000..>589607
                     /gene="TPHA0B02570"
                     /locus_tag="TPHA_0B02570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684316.1"
                     /db_xref="GeneID:11535070"
     CDS             588000..589607
                     /gene="TPHA0B02570"
                     /locus_tag="TPHA_0B02570"
                     /inference="similar to DNA sequence:INSDC:YBR250W"
                     /note="similar to Saccharomyces cerevisiae SPO23
                     (YBR250W); ancestral locus Anc_6.169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684364.1"
                     /db_xref="GeneID:11535070"
                     /db_xref="UniProtKB/TrEMBL:G8BPJ9"
                     /translation="MKITKLGDPISMIVSDEYYELFPYKNYETNNGADNQLNEPKVLS
                     KYLLFLKKQNTINKEPVPKVLKLRKLKFGGTTIINDSGRKKYFYYPLKTVDNPCVTIC
                     NNIKKGYNIELIINPGSSKVYLPDLPINKDHVTENVFDPDANHLKGYTSSDPDYYDKF
                     PAVVSGKLKFTVYQDNFELPLFLTNLDINLKCFSNEYINITHIDSHHNLSRKNENSEE
                     FDKKLNVFKSNPRVNLDFLNYKNINKNMPKGVYEFPFDFILNCKESPATNCYYGSIQY
                     RIEAISKIFYEKTGYFDTVILTDLIEVKKVLPIDSEYLINNQLIAKSIWSRIGCKEES
                     LVLKSYDNLLISEEFDDSLFAEVNIPSRILDSSILGKFSAILNVDKSFENLKITKISL
                     NLSQAVSLPSIDNISFEPTKNSEHIQHSNEFRLLKKIITDDKPDDKIVKVEFDLNNIS
                     ELLSLKRTIMPYYCERSSMYKNMASLKVTHKLLFRIYLFPIKTTLQKSNISEYCIRIA
                     VPILLLDDSMLNNLVLPSYEFENSTHL"
     gene            <592073..>592867
                     /gene="TPHA0B02580"
                     /locus_tag="TPHA_0B02580"
                     /db_xref="GeneID:11534712"
     mRNA            <592073..>592867
                     /gene="TPHA0B02580"
                     /locus_tag="TPHA_0B02580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684317.1"
                     /db_xref="GeneID:11534712"
     CDS             592073..592867
                     /gene="TPHA0B02580"
                     /locus_tag="TPHA_0B02580"
                     /inference="similar to DNA sequence:INSDC:YGL096W,YPL177C"
                     /note="similar to Saccharomyces cerevisiae TOS8 (YGL096W)
                     and CUP9 (YPL177C); ancestral locus Anc_6.170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684365.1"
                     /db_xref="GeneID:11534712"
                     /db_xref="GOA:G8BPK0"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR008422"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:G8BPK0"
                     /translation="MLHPSRQQQNVILPPIKSLIDSLDTQVNPQSYDINSINNARLSA
                     VTPLNATYKTYVPEKAYLSIPYSNNIRSIPTPIPSPHASPLSYPISEDDNQILNAAVA
                     INSINQSLNNVVTSTVPQTKVATKTSRTKAQKKVRSKSFSTINTQTTSKTSIGKRSNL
                     PKQSVDVLNKWLLNHLGNPYPTPKEKEELLELTGLSKIQLSNWFINVRRRKIFNDYYN
                     LINKHNGADSASSSSDEESSQNLTLPVTRRKKLSDRLEELKKLNEL"
     gene            <594210..>596540
                     /gene="TPHA0B02590"
                     /locus_tag="TPHA_0B02590"
                     /db_xref="GeneID:11535075"
     mRNA            <594210..>596540
                     /gene="TPHA0B02590"
                     /locus_tag="TPHA_0B02590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684318.1"
                     /db_xref="GeneID:11535075"
     CDS             594210..596540
                     /gene="TPHA0B02590"
                     /locus_tag="TPHA_0B02590"
                     /inference="similar to DNA sequence:INSDC:YGL120C"
                     /note="similar to Saccharomyces cerevisiae PRP43
                     (YGL120C); ancestral locus Anc_6.132"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684366.1"
                     /db_xref="GeneID:11535075"
                     /db_xref="GOA:G8BPK1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPK1"
                     /translation="MTEAIGTKRRLSNTSGHPDPVATSIPEHAAEAAEEYSKTHPAPP
                     KEPLIHHDAGEFNGLTRHNTTAAQAEVLEDSKVNPFTGNEFSSKYFGILKTRRDLPVH
                     AQRDEFLKIYQQNQIMVFVGETGSGKTTQIPQFVLFDEMPHLLNTQVACTQPRRVAAM
                     SVAQRVAEEMDVKLGEEVGYSIRFENKTTNKTILKYMTDGMLLREAMEDHDLKRYSCI
                     ILDEAHERTLATDILMGLLKEVIKRRSDLKIIIMSATLDAEKFQRYFNDAPLLAVPGR
                     TYPVEIYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGD
                     QLIREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVIISTNIAETSLTID
                     GIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASSQQRAGRAGRTRPGKCFRLYTEEA
                     FKKELIEQSYPEILRSNLSSTVLELKKLGVDDLVHFDFMDPPAPETMMRALEELNYLA
                     CLDDEGNLTPLGRLASQFPLDPMLAVMLIGSSEFNCSQEILTIVAMLSVPNVFMRPPK
                     DRKRADDAKNAFAHPDGDHITLLNVYHAFKSDEAYEAGIKKWCRDNFLNFRALSAADN
                     IRAQLERLMIRHNLDLNTTDYESSKYFDNIRKALASGFFMQVAKKRSGGRGYITVKDN
                     QDVLIHPSTVLGHDAEWVLYNEFVLTSKNYIRTVTSVRPEWLVKLAPAYFELDNFQNG
                     DVKLSLERVQEKVQRMDELNSEKSSKHSKKSKKEKH"
     gene            <596909..>598444
                     /gene="TPHA0B02600"
                     /locus_tag="TPHA_0B02600"
                     /db_xref="GeneID:11535007"
     mRNA            <596909..>598444
                     /gene="TPHA0B02600"
                     /locus_tag="TPHA_0B02600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684319.1"
                     /db_xref="GeneID:11535007"
     CDS             596909..598444
                     /gene="TPHA0B02600"
                     /locus_tag="TPHA_0B02600"
                     /inference="similar to DNA sequence:INSDC:YGL122C"
                     /note="similar to Saccharomyces cerevisiae NAB2 (YGL122C);
                     ancestral locus Anc_6.130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684367.1"
                     /db_xref="GeneID:11535007"
                     /db_xref="InterPro:IPR021083"
                     /db_xref="UniProtKB/TrEMBL:G8BPK2"
                     /translation="MSDDKIIENMKVIVAEKLNTLQNFNEDINYVAEYIVLLMSNGGS
                     VESIVQELTTLFDSVSTEVLTDVVQTAFFALEAIQQGEPVANIVEKIRGVAQATQPTT
                     QEQPQQPQQPQQPQQPEQPLFPQQPASNIPQQPAVSQTAGNQESVTPEVKSAFSDIVS
                     SIPSASDDMEIVSTGFESRFNKYDNGVNKRGRGGRNTRGGRGASRNARGGPNTRFNPL
                     AKALGMEGDGSATVIHQKKEGRCKLFPHCPLGRSCPHAHPTKPCQEYPNCPKLPGTCE
                     YLHPNEDVELMKEIEKTREEFQKRKEAMIAARTKPVQTGIVLCKFGTICSNPMCPFGH
                     PTPANDENKVLELMWCPNNLKCEDTACTKAHSSLSKIKNITPMGVPKSAPPPVEKSLE
                     QCKFGAKCTNKRCKYRHARSPVMCRDGSNCTRIDCLFSHPINEDCRFGMECKNPRCLF
                     RHPEGFVPPQASANGATPFGTQPATSARQFALPEGSDIKPAPAQEGLVSMHATNDLDA
                     DMN"
     gene            complement(<598985..>599749)
                     /gene="TPHA0B02610"
                     /locus_tag="TPHA_0B02610"
                     /db_xref="GeneID:11535085"
     mRNA            complement(<598985..>599749)
                     /gene="TPHA0B02610"
                     /locus_tag="TPHA_0B02610"
                     /product="40S ribosomal protein S2"
                     /transcript_id="XM_003684320.1"
                     /db_xref="GeneID:11535085"
     CDS             complement(598985..599749)
                     /gene="TPHA0B02610"
                     /locus_tag="TPHA_0B02610"
                     /inference="similar to DNA sequence:INSDC:YGL123W"
                     /note="similar to Saccharomyces cerevisiae RPS2 (YGL123W);
                     ancestral locus Anc_6.129"
                     /codon_start=1
                     /product="40S ribosomal protein S2"
                     /protein_id="XP_003684368.1"
                     /db_xref="GeneID:11535085"
                     /db_xref="GOA:G8BPK3"
                     /db_xref="InterPro:IPR000851"
                     /db_xref="InterPro:IPR005324"
                     /db_xref="InterPro:IPR005711"
                     /db_xref="InterPro:IPR013810"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018192"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:G8BPK3"
                     /translation="MSAAPEGQQRRGGFGGRNKGRQQRRGGRNVEEKGWVPVTKLGRL
                     VKAGKVTSMEEIFLHSLPVKEFQIIDTLLPNLQDEVMNIKPVQKQTRAGQRTRFKAVV
                     VVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGSNLGQPHSLANKTSG
                     KCGSVTVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTQSTGSTRTLENTLKAAFVAI
                     GNTYGFLTPDLWAEQPLPLSPLDVFADDAVASKKRY"
     gene            <601046..>603835
                     /gene="TPHA0B02620"
                     /locus_tag="TPHA_0B02620"
                     /db_xref="GeneID:11535079"
     mRNA            <601046..>603835
                     /gene="TPHA0B02620"
                     /locus_tag="TPHA_0B02620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684321.1"
                     /db_xref="GeneID:11535079"
     CDS             601046..603835
                     /gene="TPHA0B02620"
                     /locus_tag="TPHA_0B02620"
                     /inference="similar to DNA sequence:INSDC:YBR229C"
                     /note="similar to Saccharomyces cerevisiae ROT2 (YBR229C);
                     ancestral locus Anc_6.126"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684369.1"
                     /db_xref="GeneID:11535079"
                     /db_xref="GOA:G8BPK4"
                     /db_xref="InterPro:IPR000322"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR025887"
                     /db_xref="UniProtKB/TrEMBL:G8BPK4"
                     /translation="MHIHLLPLWFFIIQIIPVLGFTDYLLKTCAQSGFCNRHRFYEAN
                     IKESKNRYYSVDKSSIEYYKEENTHKYVFKASIIKTIPRPDVNDIKVELPFTLSFFED
                     LTSLRFTIDEIRTNRLTELLPDFLNTYRYNETWKWAFDSEFNLYNSELTYKESNWLSN
                     DIITIFNEDESLKVELYTNSFLLKVYYDNKLSIVINEEQLLNIEHLRSKEENFQQLLP
                     EESSFNMFGDNFEYSKADSLRFGPESVGLDFSFIGYKNVFGIPEHADSLRLKDTSKTE
                     PYRLFNVDVFEYNVDSKMPTYGTIPLMIAANPTSSIGVFWVNAADTWVDINYKEDKIS
                     SHWISENGIVDVVLLFSKSVAGITEQFTTLTGKPQLPLLSAIGYHQCRWNYNDEADVL
                     NVDSEMDKAHIPYDFIWLDIEYADSRQYFTWKPNSFATPKKMLKKLENLGRQLVVLLD
                     PHLKVDYFASDKCIENGVAINDKNNKPYIGHCWPGKAIWIDALNPLGKKIWDGLVTVF
                     VDKVKNLHMWNDMNEPSIFDGPETTAPKDLIHFGGWEHRSVHNIYGLSVHESTYESLK
                     SLKSDRDQRPFLLTRAYYAGSQRSAAVWTGDNVANWDYLRISIPMVLTNNIVGFPFIG
                     ADVAGFSGNPEPELLVRWYQAGIWYPFFRAHAHIDSKRREPYLFDEPIKSIVRDLIVL
                     RYALLPTLYTSFYNSYISGSPIMKPMFYEKPEFEEFYDVDDQFYIGDSGLLTKPVVAP
                     EQTTVDMKFAPGIYYDYFTLDHFVIKGNSVIEKTIETPLEKSAVFIEGGHILTRKDRY
                     RRSSQLTKYDAYTLLISPNLNGFANGILYVDDGISFEYQNGQYVVSNFTFQDNKITNK
                     VIHSPDELAYDGNMSISKIIIPIGSGKVKYSNVATVKMNSNKIVVNVSISDDKKSIII
                     NNPSLSIDTDWELIL"
     gene            <604494..>606110
                     /gene="TPHA0B02630"
                     /locus_tag="TPHA_0B02630"
                     /db_xref="GeneID:11534705"
     mRNA            <604494..>606110
                     /gene="TPHA0B02630"
                     /locus_tag="TPHA_0B02630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684322.1"
                     /db_xref="GeneID:11534705"
     CDS             604494..606110
                     /gene="TPHA0B02630"
                     /locus_tag="TPHA_0B02630"
                     /inference="similar to DNA sequence:INSDC:YBR222C"
                     /note="similar to Saccharomyces cerevisiae PCS60
                     (YBR222C); ancestral locus Anc_6.120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684370.1"
                     /db_xref="GeneID:11534705"
                     /db_xref="GOA:G8BPK5"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:G8BPK5"
                     /translation="MTTITASFNDTFKVSDNVAVIVPETGVLVTYRDLSHMVGQFQTL
                     FHDPQSPLTGLVTRQETVAISMKNSLEFIVAFLGSTMDGKIAAPLNSNYKFDEFNFYL
                     NDLKSKAICVPKGVVIQSEKAEIMRSAKQFSCYVIELEFNTERFRVEYDVYSPKDNYK
                     GIVFSSRNNPKFINNDDTKFPGFARSSDVALILHTSGTTSKPKTVPLLHLNIVRSTLN
                     ISNTYKLNQDDRSYTVMPLFHVHGLIGVLLSTFRTQGSVVVPEKFSAKRFWDDFIKYK
                     CNWFSCVPTISMIMLNMPKPSKLPYIRFIRSCSSPLAPVTFSKLEKEFNAPVLEAYAM
                     TEASHQMTSNNLPPGKRKPGTVGQPQGVELYILDEKDNKLEQGQIGEVCIRGENVTPG
                     YANNPKANKENFTWEYNYFRTGDQGYIDAEGFLVLTGRIKELINRGGEKISPAELDNI
                     MLSNPKVREAVCFAVPDLKYGQIVNAAIVLKDNETMSYEELIKFMSNKVASFKLPSKV
                     YFVKQLPKTATGKIQRRIIAEKLTKPESKF"
     gene            <607359..>608438
                     /gene="TPHA0B02640"
                     /locus_tag="TPHA_0B02640"
                     /db_xref="GeneID:11535056"
     mRNA            <607359..>608438
                     /gene="TPHA0B02640"
                     /locus_tag="TPHA_0B02640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684323.1"
                     /db_xref="GeneID:11535056"
     CDS             607359..608438
                     /gene="TPHA0B02640"
                     /locus_tag="TPHA_0B02640"
                     /inference="similar to DNA sequence:INSDC:YBR221C"
                     /note="similar to Saccharomyces cerevisiae PDB1 (YBR221C);
                     ancestral locus Anc_6.119"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684371.1"
                     /db_xref="GeneID:11535056"
                     /db_xref="GOA:G8BPK6"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR027110"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G8BPK6"
                     /translation="MFKNTLKATSLLRSSYVPSLKNGSRLASTKTMTVRDALNSAIAE
                     ELDRDDDVFLIGEEVAQYNGAYKVSKGLLDRFGERRIIDTPITEYGFAGMAIGAAFKG
                     LKPIVEFMSFNFSLQAIDAVVNSAAKTHYMSGGTQTCQIVFRGPNGAAFGVAAQHSQD
                     FSAWYGSIPGLKVLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEMSEESFSP
                     DFTLPYKAKVEREGKDISIITYTRNVEFSLKAAEILSQQHGIDAEVINLRSIRPLDVE
                     AIVKSLKKTNHLITVESTFPSFGVGSEIVAQIMESEGFDYLDAPVKRVTGADVPTPYA
                     KELEDFAFPDPDTIVRAVKETLSVD"
     gene            <610063..>613599
                     /gene="TPHA0B02650"
                     /locus_tag="TPHA_0B02650"
                     /db_xref="GeneID:11534937"
     mRNA            <610063..>613599
                     /gene="TPHA0B02650"
                     /locus_tag="TPHA_0B02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684324.1"
                     /db_xref="GeneID:11534937"
     CDS             610063..613599
                     /gene="TPHA0B02650"
                     /locus_tag="TPHA_0B02650"
                     /inference="similar to DNA sequence:INSDC:YBR218C,YGL062W"
                     /note="similar to Saccharomyces cerevisiae PYC2 (YBR218C)
                     and PYC1 (YGL062W); ancestral locus Anc_6.115"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684372.1"
                     /db_xref="GeneID:11534937"
                     /db_xref="GOA:G8BPK7"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR003379"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR005930"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:G8BPK7"
                     /translation="MPTNKFSGLRDNYSLLGEKNKILVANRGEIPIRIFRTAHELSLR
                     TIAIYSHEDKLSLHRSKADESYVIGKEGEFTPVGAYLAIDEIINIAKRHGVDFIHPGY
                     GFLSENSEFADKVIKAGITWIGPPPEVIESVGDKVSARNLAAKADVPTVPGTPGPIET
                     VEQAEAFVKEYGYPVIVKAAYGGGGRGMRVVREGEDIADAFQRARSEAVTAFGNGTCF
                     IERFLNKPKHIEVQLLADKYGNVVHLFERDCSVQRRHQKVVEVAPALTLPIEVRNAIL
                     TDAVKLAKVAGYQNAGTAEFLVDDQNRHYFIEINPRIQVEHTITEEITGIDIVSAQIQ
                     IAAGASLEDLGLLQDRITTKGFAIQCRITTEDPYKNFQPDTGKLEVYRSAGGNGVRLD
                     GGNVYVGAIISPHYDSMLVKCTCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLITLL
                     TNPVFIDGSYWTTFIDDTPELFTVIKSRNRGQKILNYLADIAVNGPQVKGQSSLPKLT
                     SNPIVPVLHDENKNVIDVNNTPPAGWRQVLLEQGPEGFAKEVRKFDGTLIMDTTWRDA
                     HQSLLATRIRTYDLATIAPTTAHALSNAFALECWGGATFDVAMRFLNEDPWERLRTLR
                     KLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVAQAKENGVDIFRVFDALNDLEQLKVG
                     VDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEITDKIVKMGTHILGIKDMAGTLK
                     PGAAKLLVGSIRAKYPDLPIHVHSHDSAGTAVTSMVACALAGADVVDVATNSMSGLTS
                     QGSVNAFLASVDGTINTGVDAKKVTELDAYWAEVRLLYSGFDADLKGPDPEVYDHEIP
                     GGQLTNLLFQAQQLGLGEQWNETKRAYKEANELLGDIVKVTPTSKVVGDLAQFMVTNK
                     LTSDDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRTDILKGKRKKLTTRPGLEL
                     APFDLPKIKEELEARFDDIDECDVASYNMYPKVYEDFRKVYEEFGDLSVIPTKNFLAP
                     PAIGEEIEIHIEKGKSLIVKFQAIGTLNKENGTREVYFEMNGESRKIVVNDRAQKVET
                     IAKPKVDAHDPFQVGAPMAGVIVEVKVHKGSLIKKGQPVAILSAMKMEMVISATADGI
                     VQQVLVNDGEAVDASDLLVVLEDDTLITGDKQ"
     gene            complement(<613893..>614570)
                     /gene="TPHA0B02660"
                     /locus_tag="TPHA_0B02660"
                     /db_xref="GeneID:11534769"
     mRNA            complement(<613893..>614570)
                     /gene="TPHA0B02660"
                     /locus_tag="TPHA_0B02660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684325.1"
                     /db_xref="GeneID:11534769"
     CDS             complement(613893..614570)
                     /gene="TPHA0B02660"
                     /locus_tag="TPHA_0B02660"
                     /inference="similar to DNA sequence:INSDC:YBR217W"
                     /note="similar to Saccharomyces cerevisiae ATG12
                     (YBR217W); ancestral locus Anc_6.113"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684373.1"
                     /db_xref="GeneID:11534769"
                     /db_xref="GOA:G8BPK8"
                     /db_xref="InterPro:IPR007242"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8BPK8"
                     /translation="MSGLLESESESESGTEDDLFADSIVSTNLDAQVDGSRLNNVSNV
                     NSIENRLEQYSRRLSLLGLEVEHPKEGDVTPDYRIDITIEDRNENSVLVEGQNMPATT
                     SLILENIKRNIDDKIVNLDDLEDNKLKALRSNESQIDKKKIQIRFQAIGNVLPINPNT
                     CTISTEQPFATVILFVKRKLKMKDVYCYVNNSFAPNPQQNIGDLWDQFKIGNALIVSY
                     CATVAFG"
     gene            <615054..>617048
                     /gene="TPHA0B02670"
                     /locus_tag="TPHA_0B02670"
                     /db_xref="GeneID:11534826"
     mRNA            <615054..>617048
                     /gene="TPHA0B02670"
                     /locus_tag="TPHA_0B02670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684326.1"
                     /db_xref="GeneID:11534826"
     CDS             615054..617048
                     /gene="TPHA0B02670"
                     /locus_tag="TPHA_0B02670"
                     /inference="similar to DNA sequence:INSDC:YBR216C,YGL060W"
                     /note="similar to Saccharomyces cerevisiae YBP1 (YBR216C)
                     and YBP2 (YGL060W); ancestral locus Anc_6.112"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684374.1"
                     /db_xref="GeneID:11534826"
                     /db_xref="InterPro:IPR013877"
                     /db_xref="UniProtKB/TrEMBL:G8BPK9"
                     /translation="MLEDLKTINELVIQSFSQAGEDAISIITTIDISCEEVNLNGTRE
                     QKEEFLSMLLGQLQAHPEIVAKIAWDLPDMLFQFLNSSNINIENALQQSSIIRIIMKS
                     FNEIAMNGSPKECFLTACDMVSNLKVLEFYIHNDTNSDTTPESGKDTIPLNQIPLERN
                     PNEFFFGLQLHIIFELLSTSMRRISTLYPSKYLGMAAASILKFVDNNVANVDNMVIIL
                     RRIFTLVRGYTQNDIPKDLKENKNIKKSELNLIAEQETVIQGKLLRSLITTSLEKCLS
                     TFNLSVDSIVFNSLAHKPTNFSEYYIAMFDMISRIYHIVLSFDIDLEDELKKYMKESN
                     SIYKSLPKDSDISSETAKDKIYKAVYKLSYTYQLQKVSKQTELSIDELGVFILTGFHY
                     RETGSHLLTDINIVDAIYTYIRISTIPLHCKGFKNESAESVSRYWLWVVLSNTSTDKI
                     QKDLEAVPSYVLNVFFEMVLSATVVTVNSDNRLLGFTLLTRILCLVKEEITFKFMIHI
                     LESDRDNSSKSCILGIMKDLMTRTYICPTSKEIDTDELDKKISNLDIEEKEEKESCVS
                     ESPSKRYYLSCSESRIKCIHNACVVQVSKVISNPENVSDSLLLLNYLRFFINVAEQWD
                     QNVLKELHELIQTQIVKIEKQNVEIKSIIDANNSIKEKLH"
     gene            complement(<617203..>618612)
                     /gene="TPHA0B02680"
                     /locus_tag="TPHA_0B02680"
                     /db_xref="GeneID:11535093"
     mRNA            complement(<617203..>618612)
                     /gene="TPHA0B02680"
                     /locus_tag="TPHA_0B02680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684327.1"
                     /db_xref="GeneID:11535093"
     CDS             complement(617203..618612)
                     /gene="TPHA0B02680"
                     /locus_tag="TPHA_0B02680"
                     /inference="similar to DNA sequence:INSDC:YBR215W"
                     /note="similar to Saccharomyces cerevisiae HPC2 (YBR215W);
                     ancestral locus Anc_6.111"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684375.1"
                     /db_xref="GeneID:11535093"
                     /db_xref="InterPro:IPR014840"
                     /db_xref="UniProtKB/TrEMBL:G8BPL0"
                     /translation="MQRELMLLDDREVDCLDKKRESSQVDDDSESKKQKTLNIAEELA
                     KNRNNNTSNSSLVLKSNSSQSPTPNAEPQNQAQSIEPQVSHVSQVKISSLLSDEGPSA
                     TTAMDTKELLQTPTVSTPSIKKPITKTPATAPVKIVPSPASKAKKSNSIDSILTKTKI
                     KSKSVTNTPIAKKQVLTTTTVSKSKGNTPKPKSKSASKSNSSKNINLKTLSSTTPAND
                     AATPSATALKKEKSIITDKNIPKLQPSADKNENTIDKKLPKVLLPASQIEKPSLLGVF
                     ENNTNNTNNKQKDEDAEPVVILNIPLYPAKNEDYLDENGQVVFNFAQIERSRFSKDLP
                     PKTKDLDELKAAKRNLFSDLNETTGKYDGIDGQEEDLENDDYDDDDDDENEDEIEEGK
                     LTTSPSKKKSHPNKGKNLIGKYDVEDPFIDDSELAWEEQRAATKDGFFVYFGPLIEKG
                     YYASLERINGKMKRGGIKN"
     gene            <620423..>621889
                     /gene="TPHA0B02700"
                     /locus_tag="TPHA_0B02700"
                     /db_xref="GeneID:11534840"
     mRNA            <620423..>621889
                     /gene="TPHA0B02700"
                     /locus_tag="TPHA_0B02700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684328.1"
                     /db_xref="GeneID:11534840"
     CDS             620423..621889
                     /gene="TPHA0B02700"
                     /locus_tag="TPHA_0B02700"
                     /inference="similar to DNA sequence:INSDC:YGL055W"
                     /note="similar to Saccharomyces cerevisiae OLE1 (YGL055W);
                     ancestral locus Anc_6.106"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684376.1"
                     /db_xref="GeneID:11534840"
                     /db_xref="GOA:G8BPL1"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR001522"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="InterPro:IPR009160"
                     /db_xref="InterPro:IPR015876"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:G8BPL1"
                     /translation="MSQTHTIEALDVASANVIATGLHKKTKRVVNGLGSLMGSKEMVD
                     LTNESINTTNVNLPSSLSSSSSTTTNRKHISEQPWTLHNWHEHINWLNFVLVVLIPAI
                     GWYLALSGLIPLKLKTALFSVFYYALGGASITAGYHRLWSHRSYSARWPLRLFFALFG
                     SASVQGSAKWWGHSHRIHHRYTDTNRDPYDARKGLWYSHMGWMLLKPNPKYKARADIQ
                     DLNDDWIVRFQHRHYIPLMLIFAFILPSIIAGRYFNDYLGGFLYAGIIRVFCIQQATF
                     CINSMAHYIGAQPFDDKRTPRDNWLTALVTFGEGYHNFHHEFPSDYRNAIKWYQYDPT
                     KVIIYLTSLVGLSYDLKTFSSLAIKQALVQQEQKKLDKKKNALTWGPSLTNLPKWDKA
                     QFIEESKTNGNLIVISGIVHDVKGYITEHPGGQLLIKSALGKDATSAFNGGVYRHSNA
                     ATNVLANLRVAVIVESEESALKFAARRGEHYYDEKKTI"
     gene            <622335..>623375
                     /gene="TPHA0B02710"
                     /locus_tag="TPHA_0B02710"
                     /db_xref="GeneID:11535059"
     mRNA            <622335..>623375
                     /gene="TPHA0B02710"
                     /locus_tag="TPHA_0B02710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684329.1"
                     /db_xref="GeneID:11535059"
     CDS             622335..623375
                     /gene="TPHA0B02710"
                     /locus_tag="TPHA_0B02710"
                     /inference="similar to DNA sequence:INSDC:YBR211C"
                     /note="similar to Saccharomyces cerevisiae AME1 (YBR211C);
                     ancestral locus Anc_6.103"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684377.1"
                     /db_xref="GeneID:11535059"
                     /db_xref="UniProtKB/TrEMBL:G8BPL2"
                     /translation="MDALDRGTKLLIRQRGRGVKLRKLLEKQIFDDLGTINNDLIIGD
                     LKFEDSQLGDEGNLNDRDIIISQIEPDDNVAHQDESPEIDPQMFDQNNDEEYVSEVSE
                     GDIDQKVNQQTLFGNQDLERQMNYDDIDTRRYNFKDLPIRQLSSSITSVTTIDVLRLL
                     FVNLFENNLIPQATIDFKGTDNIVHKLLYKLDVRIFESVVDGIVNDFKDIMDINVSNN
                     ELCYQLKKIVKVREENNEDLVKVRNVVQKLRIEGEYFKVKKEQKNINKKIKLNEKLNK
                     LNNILLNNNKEDSDKYARLNVSKINRTEAHDIKTFSRLMDPYNGRVARIQKINNYLQN
                     NLSRNYDLISND"
     gene            complement(<623844..>624260)
                     /gene="TPHA0B02720"
                     /locus_tag="TPHA_0B02720"
                     /db_xref="GeneID:11534752"
     mRNA            complement(<623844..>624260)
                     /gene="TPHA0B02720"
                     /locus_tag="TPHA_0B02720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684330.1"
                     /db_xref="GeneID:11534752"
     CDS             complement(623844..624260)
                     /gene="TPHA0B02720"
                     /locus_tag="TPHA_0B02720"
                     /inference="similar to DNA sequence:INSDC:YBR210W,YGL054C"
                     /note="similar to Saccharomyces cerevisiae ERV15 (YBR210W)
                     and ERV14 (YGL054C); ancestral locus Anc_6.102"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684378.1"
                     /db_xref="GeneID:11534752"
                     /db_xref="GOA:G8BPL3"
                     /db_xref="InterPro:IPR003377"
                     /db_xref="UniProtKB/TrEMBL:G8BPL3"
                     /translation="MSALIFIFAVIANCVNLFAQVHFTILYADLESDYINPIELCSRV
                     NKLIAPEAALHAFLSVLFLLTGHWFVFAINLPLLAFNGNKLYKKLQLLDATEIFRTLN
                     KHKRESFLKLGFYLLLFFYYLYRMIATLIAEGANDY"
     gene            <624814..>625341
                     /gene="TPHA0B02730"
                     /locus_tag="TPHA_0B02730"
                     /db_xref="GeneID:11532806"
     mRNA            <624814..>625341
                     /gene="TPHA0B02730"
                     /locus_tag="TPHA_0B02730"
                     /product="mitochondrial 37S ribosomal protein RSM18"
                     /transcript_id="XM_003684331.1"
                     /db_xref="GeneID:11532806"
     CDS             624814..625341
                     /gene="TPHA0B02730"
                     /locus_tag="TPHA_0B02730"
                     /inference="similar to DNA sequence:INSDC:YER050C"
                     /note="similar to Saccharomyces cerevisiae RSM18
                     (YER050C); ancestral locus Anc_7.223"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM18"
                     /protein_id="XP_003684379.1"
                     /db_xref="GeneID:11532806"
                     /db_xref="GOA:G8BPL4"
                     /db_xref="InterPro:IPR001648"
                     /db_xref="UniProtKB/TrEMBL:G8BPL4"
                     /translation="MCRNRMSKNIISTLNPVRTFSSNNMLRLPFKINLKPIEKSSIDI
                     TPINNTIGNAEPRKNIDSKLTKKFQTGAIYDPFDFSLSKIYLDKKNSSKKNSINDYFD
                     VYDINPLDLYTSPDVLSKFLSSTGKILHRDVTGLSAKNQRRLSKAVRRCQAFGLISKT
                     HRDISMLPSISSGKL"
     gene            complement(<625578..>626906)
                     /gene="TPHA0B02740"
                     /locus_tag="TPHA_0B02740"
                     /db_xref="GeneID:11535037"
     mRNA            complement(<625578..>626906)
                     /gene="TPHA0B02740"
                     /locus_tag="TPHA_0B02740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684332.1"
                     /db_xref="GeneID:11535037"
     CDS             complement(625578..626906)
                     /gene="TPHA0B02740"
                     /locus_tag="TPHA_0B02740"
                     /inference="similar to DNA sequence:INSDC:YIL042C"
                     /note="similar to Saccharomyces cerevisiae PKP1 (YIL042C);
                     ancestral locus Anc_7.222"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684380.1"
                     /db_xref="GeneID:11535037"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR018955"
                     /db_xref="UniProtKB/TrEMBL:G8BPL5"
                     /translation="MLARRSINYKKLHWLLNNVHYTLVPRIETGIAVTLCLSKNYYST
                     PSESLNTDHITKYDTRKKINKYESLDFNKTYDIRTNIELLIQDYANKPIPPLSYDFLT
                     SFKPPLTDNDMYMFSIRSINLLLAYTSRRLKAIQNLPYIAVVNPNVEESNSLYLKTLT
                     SLLSIEYPYDLHYTEKIKTLLTQFLDDHQDTLVTLSKGLQEINEIYSNAKIIAFLNDH
                     LRDRIAMKLIATHYLTLIEQSDQIKAGTLKDSEMVGVLHRSLSISALIKRVSEFVGDL
                     TFIQYDRVIPVKILTGENITFPCIPTNLEYVLTEVIKNASRAHIESRKPGLDSIEKPI
                     EVSIFYNKTNNKLEIRICDFGGGIKPDVEAKMWDYSYSTVEAKKNDNLLDANLMPGED
                     VNSVCGMGFGLPLCRAYLKMFDDRIDIQSLLGWGTDVYIHLNGPSKELLQ"
     gene            <627808..>628899
                     /gene="TPHA0B02750"
                     /locus_tag="TPHA_0B02750"
                     /db_xref="GeneID:11534815"
     mRNA            <627808..>628899
                     /gene="TPHA0B02750"
                     /locus_tag="TPHA_0B02750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684333.1"
                     /db_xref="GeneID:11534815"
     CDS             627808..628899
                     /gene="TPHA0B02750"
                     /locus_tag="TPHA_0B02750"
                     /inference="similar to DNA sequence:INSDC:YIL041W"
                     /note="similar to Saccharomyces cerevisiae GVP36
                     (YIL041W); ancestral locus Anc_7.221"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684381.1"
                     /db_xref="GeneID:11534815"
                     /db_xref="InterPro:IPR018859"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:G8BPL6"
                     /translation="MAFNSFSSSFNKKFQELSEKTQEMTSTIPHVAQNTQRLMKEKLG
                     QAKDISTLPQEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFGESFWEFTDSV
                     GEKFSALNISEHNNKVKIPKTLNYALHNVFLTANEKVKLLHEPLDNSLSETLASLSET
                     EADIAEARLHQDSLVKSRINYQLKEELSQNFERAAKYRKAVHHKRFNYDVAKTNFEHA
                     KPEKQATLSAQADILKDEFEQATKDATIVMQEIISNSRLEHILKELAVSQLVYHQRST
                     DLLNKFLDAQNDAITERERREIVSGNADMIGRPSEANTYERELEDRKDKQDTSEIKMD
                     DNESINSKVASETKPEEELDTELEAEDGK"
     gene            complement(629077..629148)
                     /gene="TPHA0Btrna7Q"
                     /locus_tag="TPHA_0Btrna7Q"
                     /db_xref="GeneID:11534777"
     tRNA            complement(629077..629148)
                     /gene="TPHA0Btrna7Q"
                     /locus_tag="TPHA_0Btrna7Q"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAA"
                     /db_xref="GeneID:11534777"
     gene            <630541..>630972
                     /gene="TPHA0B02760"
                     /locus_tag="TPHA_0B02760"
                     /db_xref="GeneID:11534851"
     mRNA            <630541..>630972
                     /gene="TPHA0B02760"
                     /locus_tag="TPHA_0B02760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684334.1"
                     /db_xref="GeneID:11534851"
     CDS             630541..630972
                     /gene="TPHA0B02760"
                     /locus_tag="TPHA_0B02760"
                     /inference="similar to DNA sequence:INSDC:YIL040W"
                     /note="similar to Saccharomyces cerevisiae APQ12
                     (YIL040W); ancestral locus Anc_7.218"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684382.1"
                     /db_xref="GeneID:11534851"
                     /db_xref="UniProtKB/TrEMBL:G8BPL7"
                     /translation="MANDLEIQIQTLITAFVSYLINVIQISIPFITQFSNAHPTLFLG
                     IISVIIMYVAIRIILSIWSILKRLFYVSLFIFAFLIYLRGIDQFFNNDVPFLYNLVLQ
                     DKDLETIIIQSCAYLSSTSVTSSTLLYKFLKSKVVEYISQL"
     gene            <631381..>632823
                     /gene="TPHA0B02770"
                     /locus_tag="TPHA_0B02770"
                     /db_xref="GeneID:11534876"
     mRNA            <631381..>632823
                     /gene="TPHA0B02770"
                     /locus_tag="TPHA_0B02770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684335.1"
                     /db_xref="GeneID:11534876"
     CDS             631381..632823
                     /gene="TPHA0B02770"
                     /locus_tag="TPHA_0B02770"
                     /inference="similar to DNA sequence:INSDC:YIL039W"
                     /note="similar to Saccharomyces cerevisiae YIL039W;
                     ancestral locus Anc_7.216"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684383.1"
                     /db_xref="GeneID:11534876"
                     /db_xref="GOA:G8BPL8"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8BPL8"
                     /translation="MILRFLIKVSFIIASLVVLTTNIYIYTYPSVHPTKCFWHCNELD
                     FLPYRVKDASKIELALYYSYRYIKDVTKQMILKRYDEETVNKTNEIRLLAFGDPQIKG
                     NSESTPYRTRLDTFGNDFYLGHIFDTMVRRLNPTHVAVMGDLFSSQWIDDSEFYNRTS
                     RYMRRIFKRNTDILFDINNESHDENGQYQVNTEKWIESKNLFSYEFENIDESTPIDNE
                     FGYEDLYSWDEDSDPTKDSYLFINTTGNHDIGYSGDITYELLARYNEMFGKDNYWVEY
                     NKGKDNAWRIVVLNTLLLDGPAYCPELLDNTWEFLYQVHDRNFSGSTVLITHVPFYKP
                     EGICADGPQFTYYDDEMLRSQNHISEENTNEVFDLIFDNGKSGIILTGHDHMGCETYY
                     DRKLSDNSWVPHAGKLLNYNNVIREITVKSMMGQYKGNTGVVTGKFDQANRTWSWHYS
                     TCPFTNEHAWWIAKGSLVVWSIIFSIFILV"
     gene            complement(<633307..>634449)
                     /gene="TPHA0B02780"
                     /locus_tag="TPHA_0B02780"
                     /db_xref="GeneID:11534875"
     mRNA            complement(<633307..>634449)
                     /gene="TPHA0B02780"
                     /locus_tag="TPHA_0B02780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684336.1"
                     /db_xref="GeneID:11534875"
     CDS             complement(633307..634449)
                     /gene="TPHA0B02780"
                     /locus_tag="TPHA_0B02780"
                     /inference="similar to DNA sequence:INSDC:YIL035C"
                     /note="similar to Saccharomyces cerevisiae CKA1 (YIL035C);
                     ancestral locus Anc_7.209"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684384.1"
                     /db_xref="GeneID:11534875"
                     /db_xref="GOA:G8BPL9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8BPL9"
                     /translation="MRSRVWSEARVYTNINKQRDKDYWDYENTTIEWSNDHGNYEIEA
                     NVGRGKYSEVFKGIELKNRRSNVIKMLKPVKKKKIKREIKILTNLSNEQHPTTAKPYN
                     EEEYYVSKKQEVLKFKREYLYDKPHKGHENIIQLLNVIKDPISKTPALVFEYVKNVDF
                     RILYPKLTAMDIKYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHTARKLRLIDWGLA
                     ELYHPNTEYNVRVASRFFKGPELLVDYRMYDYSLDLWSFGTMLASMVFQKEPFFHGTS
                     NTDQLVKIVRVLGSDDFEQYLMKYEITLPNEFHNMDQFIRRPWHRFVNDSNRLLCGDE
                     EIIDLIDNLLRYDHQERLTAKEAMGHPWFAPIRNNEYTIDDDILID"
     gene            complement(<634936..>635778)
                     /gene="TPHA0B02790"
                     /locus_tag="TPHA_0B02790"
                     /db_xref="GeneID:11534852"
     mRNA            complement(<634936..>635778)
                     /gene="TPHA0B02790"
                     /locus_tag="TPHA_0B02790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684337.1"
                     /db_xref="GeneID:11534852"
     CDS             complement(634936..635778)
                     /gene="TPHA0B02790"
                     /locus_tag="TPHA_0B02790"
                     /inference="similar to DNA sequence:INSDC:YIL034C"
                     /note="similar to Saccharomyces cerevisiae CAP2 (YIL034C);
                     ancestral locus Anc_7.208"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684385.1"
                     /db_xref="GeneID:11534852"
                     /db_xref="GOA:G8BPM0"
                     /db_xref="InterPro:IPR001698"
                     /db_xref="InterPro:IPR019771"
                     /db_xref="UniProtKB/TrEMBL:G8BPM0"
                     /translation="MNSEDSYDAALDLLRRLNPSRLEHHLKNLIQLEPTLAEDLLSSV
                     DIPLTIKRDPKDSQKEYLCCDYNRDADSHRSPWSNEYFPELSEQDLEESPFPSEPLRK
                     LEILFNDSFDVYRDLYYEGGISSAYLWDVADDTSNIVRDFAGVVLFKKSNQSSSSWDS
                     IHVLEATFENDNEVTYRITTTILLRLDKDNSIKLSGNLSRQTEKTVTINASNNADQIN
                     IAHITNVGSMIEDIEYQMRILLEAVYFEKTRDIFHETKNGAVSTEQKNKTAHEEIIKG
                     LQSL"
     gene            complement(<636209..>638764)
                     /gene="TPHA0B02800"
                     /locus_tag="TPHA_0B02800"
                     /db_xref="GeneID:11534837"
     mRNA            complement(<636209..>638764)
                     /gene="TPHA0B02800"
                     /locus_tag="TPHA_0B02800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684338.1"
                     /db_xref="GeneID:11534837"
     CDS             complement(636209..638764)
                     /gene="TPHA0B02800"
                     /locus_tag="TPHA_0B02800"
                     /inference="similar to DNA sequence:INSDC:YFR038W"
                     /note="similar to Saccharomyces cerevisiae YFR038W;
                     ancestral locus Anc_7.205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684386.1"
                     /db_xref="GeneID:11534837"
                     /db_xref="GOA:G8BPM1"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPM1"
                     /translation="MARTTRSANKLSKTNSRQSVKSYREKDESDLEVESDADGFSTDD
                     NISEDNDIQIWLKDDLSKENDVKLDSDDEDSSNKDQELNALLKNKYSKNENDDDENED
                     SDEDGADTATVSLKLKKLNEFVKQSQVYSSIIADTLLERTKQRLEEEQKARESNKENI
                     DVKEVEPPKKKQRKIRNIVDFFKKTDKSTEVKNEIEETHKTEAVVDEEQMLSSQPNLL
                     KNCILKQYQLEGLNWLVTLYENGLNGILADDMGLGKTIQTIALLAFIYEMDTKGPFLI
                     AAPLSTIDNWVSEFDRFAPDIPVLKYYHQNGIKERTRLLNNFFKETKGTGVILTSYEI
                     IIRDADEIMSRQWKFLVVDEGHRLKNINCRLIQELKRINTSNRLLLTGTPLQNNISEL
                     WSLLNFILPDIFTDFEIFNKWFDFESLHLGSNSKKLNKLINDELEKNLISNLHTILKP
                     FLLRRLKKIVLADILPPKREYIINCPLAPMQKKFYTKALSGQLKVTIFKELVKQFFTL
                     NTGHIGTVSNKSIRDFINFELHYGKENKADLKDQSETIQNMHKLYQEHLHRDFKNKKL
                     MNMMMQLRQIVDSTFLFYFPYLEPEELTLDILLQSSGKLQVLQKLAIPMIKKGHKILI
                     FSQFVNMLDLLEDWCDLNSIKSLRIDGTVDNDTRKEQIKLFDNPKDKHQVFLLSTRAA
                     GLGINLVAADTVFIFDSDWNPQVDLQAMDRCYRIGQTKPVIVYRLCCDNTIEHIILTR
                     AANKRMLERMVIQMGNFNKLKTLAMNERSFLQTGPASNKVKNTELVQELSLLLSKQNS
                     SIGFKRDSGDNPESILTHTEIKALTDRSDASYRSEREMNYPHITLFETTLGLS"
     gene            <639564..>641177
                     /gene="TPHA0B02810"
                     /locus_tag="TPHA_0B02810"
                     /db_xref="GeneID:11534786"
     mRNA            <639564..>641177
                     /gene="TPHA0B02810"
                     /locus_tag="TPHA_0B02810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684339.1"
                     /db_xref="GeneID:11534786"
     CDS             639564..641177
                     /gene="TPHA0B02810"
                     /locus_tag="TPHA_0B02810"
                     /inference="similar to DNA sequence:INSDC:YFR037C"
                     /note="similar to Saccharomyces cerevisiae RSC8 (YFR037C);
                     ancestral locus Anc_7.204"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684387.1"
                     /db_xref="GeneID:11534786"
                     /db_xref="GOA:G8BPM2"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:G8BPM2"
                     /translation="MTDLVSTVAADGVANVTSNEIIQTKVEPAPAKVNYEEEATKLEN
                     KSYRFLAKQVHPVIIPSYASWFDFSKINDIERKAIPDFFDGSANYKTPTTYKDTRNFL
                     INTYRLTPYEYLTMTAVRQNLGLDVTSIFKIHAFLEKWGLINYQLDPKTKPSSLSSKY
                     KGHYEVVLDTADGLKPFIKEEIIEDKKENENKADAVEQDKEKPILSTINNDVKFTELE
                     KFPINLSLETDVYNTLSEFISLEPEDRLKKKLNRSYICHTCGNDTVFVRYHNLRARDI
                     NICSRCYQEGHFGANFQASDFIRIDNNTSSMEWTEQEIFLLLEGIELYEDQWQRIVQH
                     IGTERTVVECVEKFLKLPIEDSYINDAIGKLRSKYSNNTLEGSNTTKEEQIENAKNVI
                     SGINHTVEYLIDGQNDEVLKKMIPESANKVMSKYLKEAQIVTHELINLSAQGLNIRIE
                     ELKTLEKALIAEFDKLELEKSKLADNRKTLNDQVDQINEELKNMNITNTLTLVSQDGD
                     LNKSTAEKSEDLYQTSDDIEKKKKESTSN"
     gene            <641721..>643034
                     /gene="TPHA0B02820"
                     /locus_tag="TPHA_0B02820"
                     /db_xref="GeneID:11534729"
     mRNA            <641721..>643034
                     /gene="TPHA0B02820"
                     /locus_tag="TPHA_0B02820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684340.1"
                     /db_xref="GeneID:11534729"
     CDS             641721..643034
                     /gene="TPHA0B02820"
                     /locus_tag="TPHA_0B02820"
                     /inference="similar to DNA sequence:INSDC:YOR209C"
                     /note="similar to Saccharomyces cerevisiae NPT1 (YOR209C);
                     ancestral locus Anc_8.625"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684388.1"
                     /db_xref="GeneID:11534729"
                     /db_xref="GOA:G8BPM3"
                     /db_xref="InterPro:IPR002638"
                     /db_xref="InterPro:IPR006406"
                     /db_xref="InterPro:IPR007229"
                     /db_xref="UniProtKB/TrEMBL:G8BPM3"
                     /translation="MTTPVIKSLLDTDMYKLTMHAAVFTNFPESKVVYKYTNRSSQMK
                     FTLDGINWLKEQFHSLANLTFTAEDIQYLKTVIPYLPYNYIQYISSPEFKLKPDEQIK
                     FTYEAASEGDINDTTGKQFYDLHIFVEGFWKETILYEIPILALVSEAYFKFTETDWSY
                     ENQVEIAYQKAKTLFQNNAKFSEFGTRRRRSYRTQELVLQGIMKAVNENAEVNSKLFL
                     GTSNVLFAKEFNVKPIGTVAHEWIMGIASITGDYVNANKNSMKYWVETFGLDNAGLAL
                     TDTFGTEDFLKSFIPPYSDKYVGVRQDSGDPEEYTKKIAHHYHHVLKLPKDTKVICYS
                     DSLNPEKAIHYAAIAKEHGLVPTFGIGTNFTNDFYKKTNSSIISEPLNIVLKLLELNG
                     NHAIKISDNIGKNMGDPETIKKVKEVLGYSEKGWIGDNEAHRWSA"
     gene            complement(<643377..>646100)
                     /gene="TPHA0B02830"
                     /locus_tag="TPHA_0B02830"
                     /db_xref="GeneID:11534767"
     mRNA            complement(<643377..>646100)
                     /gene="TPHA0B02830"
                     /locus_tag="TPHA_0B02830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684341.1"
                     /db_xref="GeneID:11534767"
     CDS             complement(643377..646100)
                     /gene="TPHA0B02830"
                     /locus_tag="TPHA_0B02830"
                     /inference="similar to DNA sequence:INSDC:YOR208W"
                     /note="similar to Saccharomyces cerevisiae PTP2 (YOR208W);
                     ancestral locus Anc_8.623"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684389.1"
                     /db_xref="GeneID:11534767"
                     /db_xref="GOA:G8BPM4"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G8BPM4"
                     /translation="MNVFSNDISSRNIGGAQNIDSFKLPTIDSTPDNTSVKKLNIYEI
                     NSPNNNYIFRPSLPAANNKEKIDLNDDLYHLANLIDTQDGKMQKAIHLLREHVKSYND
                     STEDSKILLFDLTINNKWNQVDELKDFGKYINIVHLPLPSTLIKRPSFNFRKLLRTTI
                     PDVNKKKELITLVRDSKIFLIYDDISNVNSCLISTYWFMKKLNEFTLDMHEDNDNNNS
                     DLMDNKYGNGISEIQTVNNIQDNKSTEIKHSDMYIVTSDELKSNLADPTLETSQNHLF
                     TNAKVKFHQESKGSIKNRLKNMNFNLTIKIPQHSSPSDKTSMFLGSIKKDTMNYSPTS
                     LDKYFKLDIPKVLLDKANSKYIPNWLQNLIAEQVDKIYNDNTENDLKKTKTENNVLLK
                     ILHQFDLLEHLENQRLENCLNYSQSKDNNRSNTTLGKSAKVNMSPVVDVAKPKASINM
                     YSLPSLQKQFKKQKFDQINYVPVEFTKKSNTIEVPKVIIPKLITTSADSPPSMGNKNN
                     SPTTNSDSETLATPLEYYEITQGIQSFTRNRYSNILPYEHTRVKLQPSPISGIRPVVL
                     GNNSSANNSSNNLTVHGQAFTSKTESKENEDSSYFDMSESASTSEEKSKLLKAEEFND
                     YFNANYLRLSQINPDFEYIATQAPLPSTVDDFWKVIITNKIHVIVSLLSNDELNLRKW
                     HIYWNADLMRKHEVVCTETYENVCDIDGCILRIFKVKRQCIGASANSLNHGELETEQT
                     VYQIQYTKWLDSCSVEMNIVLKLHHLKNALVDNPMAVLNDIKIGNTKCYNDNSCSCVH
                     KTTMKNYLNVKTPILVHCSAGCGRTGVFITLDFLINILNKRSNRNNKINVWDMSEDLI
                     FIVVNELRKQRISMVQNFTQYVTCYESILEYFSLLIENNHADEEKRKINDS"
     gene            complement(<647976..>650084)
                     /gene="TPHA0B02840"
                     /locus_tag="TPHA_0B02840"
                     /db_xref="GeneID:11534911"
     mRNA            complement(<647976..>650084)
                     /gene="TPHA0B02840"
                     /locus_tag="TPHA_0B02840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684342.1"
                     /db_xref="GeneID:11534911"
     CDS             complement(647976..650084)
                     /gene="TPHA0B02840"
                     /locus_tag="TPHA_0B02840"
                     /inference="similar to DNA sequence:INSDC:YOR206W"
                     /note="similar to Saccharomyces cerevisiae NOC2 (YOR206W);
                     ancestral locus Anc_8.617"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684390.1"
                     /db_xref="GeneID:11534911"
                     /db_xref="InterPro:IPR005343"
                     /db_xref="UniProtKB/TrEMBL:G8BPM5"
                     /translation="MVSFSKSNKKSTSKKSARSNKSKPKPEKVQKFQEDKETSKLTEV
                     EISEVVGAMPEKVEKQSKKSQKSKKSKKSKAVSDEESSSDDEDDAQTMKDTMEALSKD
                     DPDFFKYLKENDGDLLKFESVNPLDAISDSESDDQDKQADNTKESEEEVEEVNTEEIS
                     SKVDLTVKLVNEWRESLTEKPTLKIIKEVIIAFKVAVHLNDDEKVEEFKYTVTDEKAF
                     EELMFLTLKELPIFVQKMAPYTIKNETRILEPSNDVKRLSILLKSHATSLLILLNDVT
                     NTSNAALVLFSVDKFLPYYLPYRKLLKKIILAIVDIWSTTRDVETQIATFAFLFSAAK
                     EFKKSVLDLLLKTTYSTFIKYCRSTNMRSMPLINFQKNSAAELFALDPNLSYQVAFEY
                     IRQLAINLRNAMTAMTKKTSRSNSAEAYKSIYNWQYCHSLDFWSRVLSLSCNHSLGSS
                     KQANPLKELIYPLTQVTIGVIKLNPTPQYMPLRFYLIRSLIRLSQNTGTMIPIYPLLT
                     EVLNTTAFTKKPKKKENLPAFDFEFNIKCNQAYLGTRAYQNGLGGEFIDILGEYLVLY
                     SKSISFPEFVTPIAIGLRRYLKTNKTNFIFNKALANLLDKIKANVTYIEKRRSTADFS
                     VSEVNEVANFLNEVSWENTPLGSYIVIQREIKEEKSRLQRESLEDADKDQLEKDIENV
                     QKMLGDDNDEDDAVDIELSD"
     gene            complement(<650888..>652774)
                     /gene="TPHA0B02850"
                     /locus_tag="TPHA_0B02850"
                     /db_xref="GeneID:11535095"
     mRNA            complement(<650888..>652774)
                     /gene="TPHA0B02850"
                     /locus_tag="TPHA_0B02850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684343.1"
                     /db_xref="GeneID:11535095"
     CDS             complement(650888..652774)
                     /gene="TPHA0B02850"
                     /locus_tag="TPHA_0B02850"
                     /inference="similar to DNA sequence:INSDC:YOR204W,YPL119C"
                     /note="similar to Saccharomyces cerevisiae DED1 (YOR204W)
                     and DBP1 (YPL119C); ancestral locus Anc_8.614"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684391.1"
                     /db_xref="GeneID:11535095"
                     /db_xref="GOA:G8BPM6"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPM6"
                     /translation="MSDLEKQVQNLNINEGENDSNQNASSYVPPHLRNKRGGQSRSFN
                     DRSNAGQSSRFSNNGGFSRGNGGVGNNRGSRGGFYGNGGGRSNDSRFNGGHPGRGRWV
                     NGEHVPGTKNENLEIQLFGVAEDPSFQSSGINFDSYDDIPVEASGTDVPEAITEFTSP
                     PLDSLLLENIHLARFTKPTPVQKYSVPIVAQGRDLMACAQTGSGKTGGFLFPVLSQSF
                     KNGPAPVPEDLKRSFLRKGNPTALVLAPTRELATQIYDEAKKFTYRSWVRPVVIYGGS
                     DVGTQIRELERGCDLLVATPGRLNDLLERGRVSLANVKYLVLDEADRMLDMGFEPQIR
                     HIVDGCDMPDANNRQTLMFSATFPDDIQHLARDFLNDYIFLSVGRVGSTSENITQRIL
                     YVEDMDKKSALLDLLAAENDGLTLIFVETKRMADELTDFLIMQDFMATAIHGDRTQIE
                     RERALAAFKGGRANVLVATAVAARGLDIPNVTHVINYDLPTDIDDYVHRIGRTGRAGN
                     TGVATSFFNRGNRNVVKGLNDLLIEANQEVPDFVTDVLRESGRSGKSSGYSSRNNSSR
                     DFRKSGSNTGGWGNNSRSSSSRGGWGASKPASGGWGESRSSSNGGWGNSGTSGSSANK
                     SSWW"
     gene            <653945..>655060
                     /gene="TPHA0B02860"
                     /locus_tag="TPHA_0B02860"
                     /db_xref="GeneID:11535143"
     mRNA            <653945..>655060
                     /gene="TPHA0B02860"
                     /locus_tag="TPHA_0B02860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684344.1"
                     /db_xref="GeneID:11535143"
     CDS             653945..655060
                     /gene="TPHA0B02860"
                     /locus_tag="TPHA_0B02860"
                     /inference="similar to DNA sequence:INSDC:YPL118W"
                     /note="similar to Saccharomyces cerevisiae MRP51
                     (YPL118W); ancestral locus Anc_8.613"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684392.1"
                     /db_xref="GeneID:11535143"
                     /db_xref="InterPro:IPR016712"
                     /db_xref="UniProtKB/TrEMBL:G8BPM7"
                     /translation="MSHLSNLLRNSRLAHLPKTNKPLVSTSDKYFYPTHQIIETKPAL
                     LHRNEWGLKSTIPGRKSSSDYDSSRNKIKRTKYLVFNELDTLERITTFEKLGNSQYNR
                     LRFKEMNLHPTYNPGVVNPLFSGDSSSKDQSAPLSSVLNLQPGANNTAKINKLKAKRS
                     YLKEWILENDPQSLKYKKFNLKDMSGKMXLYNFLEIDEQMNKNNKNRQNXINLNKQNM
                     RKVIGTGGLTYNLKGKLKNSPNGIVQKTIVPGRFINVDGFDRLAAIGGFISNASSSSP
                     MSSQVVHNMGDFIRQQKFPFELQHAAVQGNGKIVIKSKVVNDYLNQMNKDRINVATRR
                     YEQNPKKFNRKGNTGSSSSADTVKQAEELLKILTKFE"
     gene            <655435..>656679
                     /gene="TPHA0B02870"
                     /locus_tag="TPHA_0B02870"
                     /db_xref="GeneID:11535182"
     mRNA            <655435..>656679
                     /gene="TPHA0B02870"
                     /locus_tag="TPHA_0B02870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684345.1"
                     /db_xref="GeneID:11535182"
     CDS             655435..656679
                     /gene="TPHA0B02870"
                     /locus_tag="TPHA_0B02870"
                     /inference="similar to DNA sequence:INSDC:YOR201C"
                     /note="similar to Saccharomyces cerevisiae MRM1 (YOR201C);
                     ancestral locus Anc_8.611"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684393.1"
                     /db_xref="GeneID:11535182"
                     /db_xref="GOA:G8BPM8"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR004441"
                     /db_xref="InterPro:IPR013123"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:G8BPM8"
                     /translation="MNFARNSSNGKQLLYIFKRGLAARPAFKPSNVKNETKATFDNNI
                     LIKERNRKKRWEIENVSKDDFFKKYAHIHARQKRESPRHSKAKYETTSPPNRNSYKKK
                     LRSDLFVNPLVEYIYGRNTIVAALNNPKREYFTSLYYYGSAFEELPTDIRDKCEELNV
                     KRIAVDKHRLNILTNNGVHNNLVLETKRLQPPEVTYLGECDEERSEAQLVCNEEPVFT
                     NDDEETTRSFDVQTMKYLKDEKRNKKFPLGLYLDEISDPHNIGSIIRSAYFLGVDFIL
                     MSRKNCSALTPAVNKTSSGAIELMPIYYVDKPMNFFEESRKNGWSFVSSYLTDMKGST
                     KKHIQKEQILELEDLGGICNEMPVILVVGSESKGIRTNLIMRSDFFVQIPFGRSTDDS
                     NQTIDSLNVGVAAALLINNIIR"
     gene            <657768..>659264
                     /gene="TPHA0B02880"
                     /locus_tag="TPHA_0B02880"
                     /db_xref="GeneID:11534702"
     mRNA            <657768..>659264
                     /gene="TPHA0B02880"
                     /locus_tag="TPHA_0B02880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684346.1"
                     /db_xref="GeneID:11534702"
     CDS             657768..659264
                     /gene="TPHA0B02880"
                     /locus_tag="TPHA_0B02880"
                     /inference="similar to DNA sequence:INSDC:YOR198C"
                     /note="similar to Saccharomyces cerevisiae BFR1 (YOR198C);
                     ancestral locus Anc_8.609"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684394.1"
                     /db_xref="GeneID:11534702"
                     /db_xref="UniProtKB/TrEMBL:G8BPM9"
                     /translation="MSAESTHNKNNNNKIKRPDVAVRDRKLDTLNVQLKKIDNEIAIL
                     KKQIDQTQVNDVQQDERNKLNTKTKEIIKTQAELKTKRNAIFENIKLLDSQIKRKTAE
                     IDEKLGSSSAAKKNKSRYNSAADIKLRLVEIDEAISSGELSLVEEKLLVKESQQLNKL
                     QKDLSLVEPIKKSIEEDRSKIAEMKEELNAMNPKELSSQFDEAQKQLNALHEKTQGVY
                     DKRNTLFNKRSLLYNKRDEIYQQIRKIRQDFDNEFKAFRSKLENERLKREEDEKLSKI
                     IEEKEEKLSKLQDKLLHAKQPAFTFEIEAIENSLTVLDPSYVKPKKEIFEQESSLATS
                     APVRKVENDLVPIKKENDDIFYNTVPSKSKKFKKKNQNKQAQAATLSADGKFSLEPTL
                     IATLAELDVTVPISQDDVSKTIEQLKKKHEDFVARQDEQTEKILLLQKRILLLLNFPT
                     KKRKKQSRRNWKKRELLNKLKRKLKQLQLNISWLFNMFNLFSHAFHVA"
     gene            complement(<659614..>661518)
                     /gene="TPHA0B02890"
                     /locus_tag="TPHA_0B02890"
                     /db_xref="GeneID:11534703"
     mRNA            complement(<659614..>661518)
                     /gene="TPHA0B02890"
                     /locus_tag="TPHA_0B02890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684347.1"
                     /db_xref="GeneID:11534703"
     CDS             complement(659614..661518)
                     /gene="TPHA0B02890"
                     /locus_tag="TPHA_0B02890"
                     /inference="similar to DNA sequence:INSDC:YHR114W"
                     /note="similar to Saccharomyces cerevisiae BZZ1 (YHR114W);
                     ancestral locus Anc_2.159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684395.1"
                     /db_xref="GeneID:11534703"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:G8BPN0"
                     /translation="MSTVQLSIGNELKDSYKNTHSWVQNNIKWLRELETFYKKRAEIE
                     REYSLKLSQLTSEYFNKKSASTVGLSVGDTPSTTPGSIEAATVVTWNEILTQTELVSK
                     DHGKLGQQFESQVAAQIAGLFGKCDITLTKIEAFQNEITQKKTSSVQELEKGKKDYDA
                     SCVAMENARNKNTKSPGTKNQNKLNEKEAEMNISKNSYLIKINQSNRIKDKYYFQDVP
                     ECLDLLQDLNESRILLLNDIWRKASSYERTLAATVQNRMDASDSVVTQNKPHLSTAMF
                     IKHNVRLWKEPADYVYKPSQVWHDDEKFSVPSEVEANDLRLKLARAKKTSILMMTKQN
                     RIITIVKVKCSKKKIKSEEGENQGQELYEVLKNYLNVMAPFTSHETLKLKAEVEMESI
                     QNNTPSEFDLSIDNINVSSQKKRGTFFKSLTGGLLSNDSPSLVSRSHSKSSKGHLSLF
                     SGLSHKSVHSNEDHDNGISNISENDDSTSTYTTDTTSIKAPQAVIKSSSSSNSNKVLY
                     QYNKQDADEISIDVGDSISLVQADTGSGWTRIKNNTTGEEGLVPTSYVEIKTQESRGP
                     APVAPPSRRKTTTTRKVQALYDYEAQGDDEISISVGDTITVIKGDDGSGWTFGELNGI
                     KGLFPSSYCK"
     gene            <662015..>662833
                     /gene="TPHA0B02900"
                     /locus_tag="TPHA_0B02900"
                     /db_xref="GeneID:11535186"
     mRNA            <662015..>662833
                     /gene="TPHA0B02900"
                     /locus_tag="TPHA_0B02900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684348.1"
                     /db_xref="GeneID:11535186"
     CDS             662015..662833
                     /gene="TPHA0B02900"
                     /locus_tag="TPHA_0B02900"
                     /inference="similar to DNA sequence:INSDC:YOR115C"
                     /note="similar to Saccharomyces cerevisiae TRS33
                     (YOR115C); ancestral locus Anc_2.160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684396.1"
                     /db_xref="GeneID:11535186"
                     /db_xref="InterPro:IPR007194"
                     /db_xref="InterPro:IPR024096"
                     /db_xref="UniProtKB/TrEMBL:G8BPN1"
                     /translation="MSTPPIQTGQVLTSQQKAQQFKLFEDSLPKVNQLAFQLLLNEVV
                     PLSMAVEEKVFDDKIQVNESEDQTNQKAEDVDNSDASNITKDIEDKLHITPELDLPSH
                     VLIHQISTTNAEKREGVIKRLQSIGFNIGSKLTELLVFKNNPNIRFKDAEVLLIMKFI
                     CRDVWKQIYGKQIDNLKTNHRGTFYLFDYDYRPIRNFVVDGDISDPSLLEKETSLAQP
                     FLEIPIGIITGVLSSLGFKSEVVACKASFVDKPDGTSKLNFPKGVSFHIQIVNQ"
     gene            complement(<662998..>665151)
                     /gene="TPHA0B02910"
                     /locus_tag="TPHA_0B02910"
                     /db_xref="GeneID:11534925"
     mRNA            complement(<662998..>665151)
                     /gene="TPHA0B02910"
                     /locus_tag="TPHA_0B02910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684349.1"
                     /db_xref="GeneID:11534925"
     CDS             complement(662998..665151)
                     /gene="TPHA0B02910"
                     /locus_tag="TPHA_0B02910"
                     /inference="similar to DNA sequence:INSDC:YOR113W"
                     /note="similar to Saccharomyces cerevisiae AZF1 (YOR113W);
                     ancestral locus Anc_2.162"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684397.1"
                     /db_xref="GeneID:11534925"
                     /db_xref="GOA:G8BPN2"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BPN2"
                     /translation="MANKKSNSNKSGVSNNQDDNYSESKLDDPRRDSLSIFSVNNQPR
                     LSNTEVSIASFLNIADQNATSSDNNNTNNSSGGMSAKANTSQNKSAGAKSAQKSSNSI
                     SKGSVVGGAANPNMMNPDMSAIGRGFSIVNSMWPQQPQQQMKQSNNNNNSNYNNGNQG
                     QFQIPQSRNNSLKFPVDDLDFQFRRNSSIIRAANMPPANVLAQQQYQYQRPSVSAMPQ
                     QGTLQPQQQLINGQGLMYPQLQQIMTNYPQQRVQETATQPPAKKQKTRKPRKNSKKGR
                     NNSAAATGNKDETKSKQNLQNVSPDLDKENAVYLNNNNNNSNNNKLYLDVKLQNDAAG
                     LGPQSTDTSRGLLGVTKVDQLMLIIEARKKGVTEKIKTTDNGELILDRTTDILPPSNQ
                     LVGGVEKPKSSHGMKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEFCGKRFTQGG
                     NLRTHQRLHTGEKPYNCEMCGKRFSRKGNLAAHALTHQKLKPYICKLENCNKSFTQLG
                     NMKAHQNRFHLKTLMRLTSKLASMNENTDIPKEERELLEYLATIYKNSNKGIKGRGKN
                     ANNGISISMSSRLSGTGNSQILQAQQLGNINGLTIPGSLSMPGHMMPDNTTVLMDPSK
                     EMVKLPSPTHNLQSDKIGGVNYEFAPIQNQQQNLTGIPNSNEFDFNLEQQGVPKGMTQ
                     HGRVIQQQHQLQQQQQQQQQPFHERVHFNDINFKG"
     gene            <666060..>666452
                     /gene="TPHA0B02920"
                     /locus_tag="TPHA_0B02920"
                     /db_xref="GeneID:11534699"
     mRNA            <666060..>666452
                     /gene="TPHA0B02920"
                     /locus_tag="TPHA_0B02920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684350.1"
                     /db_xref="GeneID:11534699"
     CDS             666060..666452
                     /gene="TPHA0B02920"
                     /locus_tag="TPHA_0B02920"
                     /inference="similar to DNA sequence:INSDC:YNL113W"
                     /note="similar to Saccharomyces cerevisiae RPC19
                     (YNL113W); ancestral locus Anc_2.163"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684398.1"
                     /db_xref="GeneID:11534699"
                     /db_xref="GOA:G8BPN3"
                     /db_xref="InterPro:IPR008193"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="UniProtKB/TrEMBL:G8BPN3"
                     /translation="MSDEVQTSKPVDEMEVDSVPEVDEVDVNAVDEDKIKILPNATSP
                     DGTSASFQISEEDHTLGNALRHIIMKNPEVEFCGYSIPHPSETLLNLRIQTYGNTTAV
                     EALQKGLKDLMDMCDVVEEKFTQRIKEL"
     gene            <666924..>668207
                     /gene="TPHA0B02930"
                     /locus_tag="TPHA_0B02930"
                     /db_xref="GeneID:11535187"
     mRNA            <666924..>668207
                     /gene="TPHA0B02930"
                     /locus_tag="TPHA_0B02930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684351.1"
                     /db_xref="GeneID:11535187"
     CDS             666924..668207
                     /gene="TPHA0B02930"
                     /locus_tag="TPHA_0B02930"
                     /inference="similar to DNA sequence:INSDC:YNL112W"
                     /note="similar to Saccharomyces cerevisiae DBP2 (YNL112W);
                     ancestral locus Anc_2.164"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684399.1"
                     /db_xref="GeneID:11535187"
                     /db_xref="GOA:G8BPN4"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPN4"
                     /translation="MGFGRDQQYNKSNFNSRGGDFRGGRSSDRNSYNRDEQFNAGGFH
                     GRSGGRQNYNQPQDLVRPNWEVEMPNLPPFEKNFYHEHESVSKRDDNEIREFRKENEM
                     TITGHDIPKPITNFDEAGFPDYVLEEVKAEGFDKPTAIQCQGWPMALSGRDMIGVAAT
                     GSGKTLSYCLPGIVHINAQPLLSPGDGPIVLVLSPTRELAVQIQKECSKFGQSSRIRN
                     TCVYGGVPRGQQIRDLIRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDM
                     GFEPQIRKIVDQIRPDRQTLMWSATWPKEVQQLARDYLNDPIQVQIGSLELSASHTIT
                     QLVEVVSDFEKRDRLNKHLVTASEDKESKILIFASTKRTCDEITKYLREDGWPALAIH
                     GDKDQRERDWVLQEFRDGRSPIMVATDVAARGIGM"
     gene            complement(<669850..>671919)
                     /gene="TPHA0B02940"
                     /locus_tag="TPHA_0B02940"
                     /db_xref="GeneID:11534861"
     mRNA            complement(<669850..>671919)
                     /gene="TPHA0B02940"
                     /locus_tag="TPHA_0B02940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684352.1"
                     /db_xref="GeneID:11534861"
     CDS             complement(669850..671919)
                     /gene="TPHA0B02940"
                     /locus_tag="TPHA_0B02940"
                     /inference="similar to DNA sequence:INSDC:YOR112W"
                     /note="similar to Saccharomyces cerevisiae CEX1 (YOR112W);
                     ancestral locus Anc_2.165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684400.1"
                     /db_xref="GeneID:11534861"
                     /db_xref="GOA:G8BPN5"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:G8BPN5"
                     /translation="MNFSSIFKSISNFQFPYTLEENSIHKTELWTVFHGIRKADSVPI
                     TAFKANKNSGTDELITNCLQKAKVMKIPGLCPVFEIYDSDPNNTYIITERVSPFNWDQ
                     LTTYQRNLQALQLGIAQLLDTLKILEEFIIGTISPESIYVNEKGQWLIFGLELLVKRS
                     DVNSHIFSNMSKHYYTIQGFTTYSNDYKTVDALNMYHLIKHFLSGKVPKDWNTAMNML
                     SKGSITCSVFLQKIVNSQTWLNNRLIRLDKDLKEIHIKDAEGKFIIMSTFESLYFESR
                     QTFSNMSPGFIVGAIIPELISIVNWLQTPQSITNKNSKILHFLAILLELTDEHQFYPK
                     EFKELTIQMFKLPDRQIRFLLLIYLPKLLEPLGKNDITNRVFPQYLQGLSDSDVTLRL
                     KTLKTVPVIVPSISERQLNNELLRYLAKTQVDPDVEVRTWTILIMTKVASTLSASGSR
                     ASILGTAFTKSLKDPDIKPRLAALYGLEKSIDLLDVSTIAGKILTVIAPAVLDKDPLV
                     RSKAKVLFNKYLEKLESEAASVATDTKDESQDIDFDNYGTNDNELSEQFMTSLRLNSP
                     SLEEVNTLKKSSGAFQNDDWDSNNAINEDIQWGDNDAWGEETAFENNNIPVLNINNLQ
                     GKKISIDDSWNNDILEEQEPITHTTKSTAGKVKPKMRTIKTTSSRTLTLDIEDNENIN
                     DGWGDEW"
     gene            complement(<672465..>673121)
                     /gene="TPHA0B02950"
                     /locus_tag="TPHA_0B02950"
                     /db_xref="GeneID:11534855"
     mRNA            complement(<672465..>673121)
                     /gene="TPHA0B02950"
                     /locus_tag="TPHA_0B02950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684353.1"
                     /db_xref="GeneID:11534855"
     CDS             complement(672465..673121)
                     /gene="TPHA0B02950"
                     /locus_tag="TPHA_0B02950"
                     /inference="similar to DNA sequence:INSDC:YNL110C"
                     /note="similar to Saccharomyces cerevisiae NOP15
                     (YNL110C); ancestral locus Anc_2.167"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684401.1"
                     /db_xref="GeneID:11534855"
                     /db_xref="GOA:G8BPN6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BPN6"
                     /translation="MAKVTANKKLNAPVKEVKEVQASTQLEEEIHTESSDESADDATS
                     GKDDDVVEGLSSDEETNTSTHNIKKLTPKTKTKDNSKKATDMYSGIIYISRLPKGFHE
                     RQLSKYFSQFGDLKQVKLARNKKTGNSRHYGFIEFVNKDDAKIAQESMNNYLVLGHLL
                     KVVLMPKDTKIEKLLKYRPSKFSLNTTKKSEEELKKNANIKHELRLNKLSESGIEFKW
                     "
     gene            complement(<673638..>677066)
                     /gene="TPHA0B02960"
                     /locus_tag="TPHA_0B02960"
                     /db_xref="GeneID:11534834"
     mRNA            complement(<673638..>677066)
                     /gene="TPHA0B02960"
                     /locus_tag="TPHA_0B02960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684354.1"
                     /db_xref="GeneID:11534834"
     CDS             complement(673638..677066)
                     /gene="TPHA0B02960"
                     /locus_tag="TPHA_0B02960"
                     /inference="similar to DNA sequence:INSDC:YNL106C,YOR109W"
                     /note="similar to Saccharomyces cerevisiae INP52 (YNL106C)
                     and INP53 (YOR109W); ancestral locus Anc_2.171"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684402.1"
                     /db_xref="GeneID:11534834"
                     /db_xref="GOA:G8BPN7"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:G8BPN7"
                     /translation="MHILVANNPDRRISIVSNSFALVFRAVGNKNTNHQSFKAAACAV
                     ELIPKADLKGQGYKKLSSYEIYGFVGLLEIGDLIFIGTITRKSRVAQPVPHETVNKIS
                     GVEFFCLNDSRWDYLEINSSGYPIMPESESAPHQESVPKHPCHEIRKLLSNGSFYYST
                     DFDLTSTLQRRGFISHSLSSDNFEKEYMWNSFLMKEIITYRDRLDVNARQILDDEGFL
                     TTVIRGFAETFITYVKNLKIGLTVISKQSWKRAGTRFNARGIDDESNVANFVETELIM
                     FSNQYCYSFTQIRGSVPIFWEQDTALINPKVSITRSVEATQPVFDEHFVRLTNKYGSV
                     NVINLLSTRSSEIGLTKRYRQHLQLSKKVSLNSDTFLTEFDFHKETSQVGFVGSKKLL
                     PLVTDFILENGYFSYDVREKRVISEQHGVFRTNCLDCLDRTNLVQQMLSLTVFKLFLE
                     DFQLINSKDYVEDTDFASKHNALWADHGDQISQIYTGTNALKSSFSRKGKMSFAGALS
                     DATKSVSRMYINNFMDKDKQQNIDALLGRLPHQQAVELYDPINEYVTQQLEKKKDNFT
                     SYSSADIFIGTYNVNGISRPTDLSQWLFPIGDKFKPDIVILGMQEVIEMSAGSILNAD
                     STKGSFWESMVSQCLNQFDEKYLLLRVQQMTSLLMLFFVKKSKAHKIKQVEGSSKKTG
                     FGGMTGNKGAVAIRFQYNETSFCAVNAHFAAGSGNVDERRNDYESIMKSITFARSKTV
                     RNHDSIFWLGDLNYRISLSNEQVRKALMDKGENYIEKLLTYDQLTQEINTGVVFQNFK
                     EPTIQFRPTYKFDIGTNRYDSSEKARTPSWTDRIVYRGANLQPLAYSDVDMRISDHHP
                     VYAAYKAKIVCIDENVKNKLSKDLYEEFKASHPNEVGSKVLQLVDIDTEANKILEKYK
                     ISSKPSSNSLLDFDIQASPSRKSPSNILSSSASLSSIPLQPSSRVSSASEVYLPRNVQ
                     QPSSRASSTSEESITRNLPPPLKATTLQSAVKNDGATRFVPEPPKSQSQPPAAPVAAT
                     PLQGSTTERKPAFSSPSPPKPRKALPPGFSDVILTPKNSSSPSSPALPIAEKVKPAAP
                     PSLHAKTSNESTKPDTKRETKDNDTITKNPPTVPVKKAELEHLSMDAWRPLTPK"
     gene            complement(<677695..>678564)
                     /gene="TPHA0B02970"
                     /locus_tag="TPHA_0B02970"
                     /db_xref="GeneID:11534742"
     mRNA            complement(<677695..>678564)
                     /gene="TPHA0B02970"
                     /locus_tag="TPHA_0B02970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684355.1"
                     /db_xref="GeneID:11534742"
     CDS             complement(677695..678564)
                     /gene="TPHA0B02970"
                     /locus_tag="TPHA_0B02970"
                     /inference="similar to DNA sequence:INSDC:YOR106W"
                     /note="similar to Saccharomyces cerevisiae VAM3 (YOR106W);
                     ancestral locus Anc_2.175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684403.1"
                     /db_xref="GeneID:11534742"
                     /db_xref="GOA:G8BPN8"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:G8BPN8"
                     /translation="MSFIDIESQKVTGDRPDERISNGDIEAQTNNSQVVELVNMIKLL
                     KREVNKIGSPNDNIQVRNKIDQHLIPELHKKKEFIAKLLENSIGNGNGEYSSVDANYR
                     TIKLYREQISSDLEGLLKQFEMLKLKNPLKTNTNVNVKHSLNIYNNAGDNDPNNLATL
                     ATEQIPDLQQQEQKQVSLLAQSERQLLLNEDELSYQSIIQQERGEEINKIRNKVGEVN
                     TIFKQLSELVTEQSDQIDSIDNNINSLSDNLQVSNKALNKAEESQRKKNRCGFVVLVV
                     LLIISSIILLAML"
     gene            <679253..>681502
                     /gene="TPHA0B02980"
                     /locus_tag="TPHA_0B02980"
                     /db_xref="GeneID:11534757"
     mRNA            <679253..>681502
                     /gene="TPHA0B02980"
                     /locus_tag="TPHA_0B02980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684356.1"
                     /db_xref="GeneID:11534757"
     CDS             679253..681502
                     /gene="TPHA0B02980"
                     /locus_tag="TPHA_0B02980"
                     /inference="similar to DNA sequence:INSDC:YNL101W"
                     /note="similar to Saccharomyces cerevisiae AVT4 (YNL101W);
                     ancestral locus Anc_2.177"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684404.1"
                     /db_xref="GeneID:11534757"
                     /db_xref="GOA:G8BPN9"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:G8BPN9"
                     /translation="MDGNSSKFSNVRSLNIPNSNSSRNKCPSSITTPKGSFGGRSMRT
                     DNGEPLNYALIDIQTPNFKTVHPNREGVIINSLRDNYLNTSTFSRKFSKSSHSGSDYK
                     SANGSQLNFHSEQNDETSPKIQNVNNNISLNNIYLRNDDSVLLDHDSNMHSEGGDITR
                     DFYNIVKKTDPESVHNSHVLQRTKSSPNIAPSSIAANEKISASGINIPGGFRREYIVN
                     KLRSKQKLKDTFVNKRHIQDRCDGQLSSLELSGYGSIEESEDYNNKVPFLTRNFLEFL
                     YVYGHFAGESFEDDFISEIDKQYLTGTPGQIEEVPLLSRKGISRVTSGVRVSKPMIQT
                     AKGKTPTTKAFLLLLKSFIGTGILFLPNAFSKGGLLFSIGMLLFFGLYSYWCYFILIR
                     SKQITKVSSFGDIGLILYGRWMKTIILCSLVLTQIGFSAAYVIFCAKNLRAFIINVFN
                     FPDFNISYLMIFQLIVFIPLSFVRNVSKLSLTSLMANFMIMGGLLIVLFFCIKHLFID
                     LQMKPEAGVIYGFNPDLWSVFIGTAIFAFEGIGLIIPVQDSMKHPEHFPFVLFLVILT
                     ATVLFILIGTIGYLAYGKYIETVILMNLSQSNVFVNLVQLFYSVAILLSTPLQLFPAI
                     KIIENRMFTSFRSTDNGSSQFLSNSGKLNWRIKWRKNCLRSIIVSCVILIAYLGYNNL
                     DKFVSLIGSFACIPLVYMYPPMLHLKSYSIPSLKQHKFNFTVIFDFSLIVLGGISMLY
                     TSYRSIMDS"
     gene            complement(<681772..>682599)
                     /gene="TPHA0B02990"
                     /locus_tag="TPHA_0B02990"
                     /db_xref="GeneID:11534813"
     mRNA            complement(<681772..>682599)
                     /gene="TPHA0B02990"
                     /locus_tag="TPHA_0B02990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684357.1"
                     /db_xref="GeneID:11534813"
     CDS             complement(681772..682599)
                     /gene="TPHA0B02990"
                     /locus_tag="TPHA_0B02990"
                     /inference="similar to DNA sequence:INSDC:YOR104W"
                     /note="similar to Saccharomyces cerevisiae PIN2 (YOR104W);
                     ancestral locus Anc_2.179"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684405.1"
                     /db_xref="GeneID:11534813"
                     /db_xref="UniProtKB/TrEMBL:G8BPP0"
                     /translation="MLDICLVPRVFKRNDLISTADSFKSWDTCMDNKACKIIAIVGIV
                     LACVVALWLIGAVLTCFRQGVTGIAQFFCWCCQCRNSDNRNNQPMPTNDSYNPNRMGM
                     PPATVIYQPIQPPQNVYYKSNNEDFYEEKSPHDVYELEQDFDLEKQKMISRENSIRRN
                     VKKDQPTRMPPKIYESDENSNQVGSMPGAFSSKDALMHNGNFSSEFNNESNQAYGQQF
                     GTNYNPPTSYNGRYGDNNQSFYGNGIQNSAQYGSPNRMPYPQDDDQVRYNYYPNGRY"
     gene            complement(<683258..>684175)
                     /gene="TPHA0B03000"
                     /locus_tag="TPHA_0B03000"
                     /db_xref="GeneID:11534711"
     mRNA            complement(<683258..>684175)
                     /gene="TPHA0B03000"
                     /locus_tag="TPHA_0B03000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684358.1"
                     /db_xref="GeneID:11534711"
     CDS             complement(683258..684175)
                     /gene="TPHA0B03000"
                     /locus_tag="TPHA_0B03000"
                     /inference="similar to DNA sequence:INSDC:YNL098C,YOR101W"
                     /note="similar to Saccharomyces cerevisiae RAS2 (YNL098C)
                     and RAS1 (YOR101W); ancestral locus Anc_2.182"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684406.1"
                     /db_xref="GeneID:11534711"
                     /db_xref="GOA:G8BPP1"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPP1"
                     /translation="MLGKSSIREYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIED
                     SYRKQIVLDNDVSILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRNSYEELLNY
                     YQQIQRVKDADYIPIVVVGNKSDLETERQVSYEEGMNLAKHMTAPFFETSAKQDINVQ
                     DAFYELSRLVRDEGGAYNIQNIEHANEHDENNINANIADDVSNTYNNTANSNEENAAN
                     NPNSGNTNNINTIDNNMNNVGERDASHTAHDSHNKENKQNQAFPSNTANNKNSHKSDD
                     TKTARANQSKSSATSPKEKSSGGGCCVIC"
     gene            <686766..>687374
                     /gene="TPHA0B03010"
                     /locus_tag="TPHA_0B03010"
                     /db_xref="GeneID:11535098"
     mRNA            <686766..>687374
                     /gene="TPHA0B03010"
                     /locus_tag="TPHA_0B03010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684359.1"
                     /db_xref="GeneID:11535098"
     CDS             686766..687374
                     /gene="TPHA0B03010"
                     /locus_tag="TPHA_0B03010"
                     /inference="similar to DNA sequence:INSDC:YJL140W"
                     /note="similar to Saccharomyces cerevisiae RPB4 (YJL140W);
                     ancestral locus Anc_1.208"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684407.1"
                     /db_xref="GeneID:11535098"
                     /db_xref="GOA:G8BPP2"
                     /db_xref="InterPro:IPR005574"
                     /db_xref="InterPro:IPR006590"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="UniProtKB/TrEMBL:G8BPP2"
                     /translation="MNISTSNQTKIRRLKKVEEEENAATLQLGPEFQLQQINHQGEVE
                     ELIALNLSESRLLIKEALVERRKIFKRSQKGKQISEGLNSGEEDNEDKEFMQAETREK
                     ELDSLDLLLEQTTGGNNKDLKNSMGYLTNFSRFRDQETVGAVIQLLRSTGLHPFEVAQ
                     LGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY"
     gene            complement(<687603..>688865)
                     /gene="TPHA0B03020"
                     /locus_tag="TPHA_0B03020"
                     /db_xref="GeneID:11535130"
     mRNA            complement(<687603..>688865)
                     /gene="TPHA0B03020"
                     /locus_tag="TPHA_0B03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684360.1"
                     /db_xref="GeneID:11535130"
     CDS             complement(687603..688865)
                     /gene="TPHA0B03020"
                     /locus_tag="TPHA_0B03020"
                     /inference="similar to DNA sequence:INSDC:YJL139C,YKR061W"
                     /note="similar to Saccharomyces cerevisiae YUR1 (YJL139C)
                     and KTR2 (YKR061W); ancestral locus Anc_1.209"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684408.1"
                     /db_xref="GeneID:11535130"
                     /db_xref="GOA:G8BPP3"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BPP3"
                     /translation="MFNRKLNYFTITIVLYILCISYTYKSGIQLLISENTLFRSSNQV
                     LAKYDEVRNRETYSDLKFSTNTYDAKVISKFPNNFGQINAKENATLLMLTRNFELKEV
                     LKSMRSLEDRFNWRYHYDWTFMNDIPFSFEFQEATTAMASGKTTYVTIPKSDWNRPSS
                     INETRFEESLKKMSEDDVIYGGSKSYRNMCRFNSGYFYKQSVLDSYDYYFRVEPSVEY
                     FCDFPYDPFKLMREKNKKYGFVIATYEYEETIPTLWDTIEKYIDLKSNTTDINMTSNS
                     YDFITDQSIIGKFGLGRKSSCSYNMCHFWSNFEIGDLNFFRSTKYQDFFDYLDASGGF
                     YYERWGDAPVHSIAASLLLETNEIIHFDELGYSHSPFMTCPYSYYMRIAHRCQCDYDN
                     VNNIPLTLSSCLMRWWKNGAGKFFTKEN"
     gene            complement(<689451..>690260)
                     /gene="TPHA0B03030"
                     /locus_tag="TPHA_0B03030"
                     /db_xref="GeneID:11535136"
     mRNA            complement(<689451..>690260)
                     /gene="TPHA0B03030"
                     /locus_tag="TPHA_0B03030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684361.1"
                     /db_xref="GeneID:11535136"
     CDS             complement(689451..690260)
                     /gene="TPHA0B03030"
                     /locus_tag="TPHA_0B03030"
                     /inference="similar to DNA sequence:INSDC:YKR060W"
                     /note="similar to Saccharomyces cerevisiae UTP30
                     (YKR060W); ancestral locus Anc_1.210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684409.1"
                     /db_xref="GeneID:11535136"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="UniProtKB/TrEMBL:G8BPP4"
                     /translation="MSTNLKLNKKKNVQQALESLIHVHEVDPKLVNDKNVHVQITMGK
                     KMGITKDYVPRIIPLSSKMTTPSQLNILLVTKDPSQFYKETLSNDANTSEMFKEIISV
                     KNLKKRFRGAKLNQLYKDFDLIVADFRVHHLLPAILGNKFYNSNKKLPFVVKLSRAEK
                     LRFQKQKEECDPKYVRAQIRSICKNTSYVPNNDNLVSVKIGIFGKHTVEEMMENINDV
                     VTFLSDKSKKPQGGVIKGGVSSVFVKSSNSASLPIYERPQEIESKKQLPLL"
     gene            complement(<690810..>692000)
                     /gene="TPHA0B03040"
                     /locus_tag="TPHA_0B03040"
                     /db_xref="GeneID:11535114"
     mRNA            complement(<690810..>692000)
                     /gene="TPHA0B03040"
                     /locus_tag="TPHA_0B03040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684362.1"
                     /db_xref="GeneID:11535114"
     CDS             complement(690810..692000)
                     /gene="TPHA0B03040"
                     /locus_tag="TPHA_0B03040"
                     /inference="similar to DNA sequence:INSDC:YJL138C,YKR059W"
                     /note="similar to Saccharomyces cerevisiae TIF2 (YJL138C)
                     and TIF1 (YKR059W); ancestral locus Anc_1.211"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684410.1"
                     /db_xref="GeneID:11535114"
                     /db_xref="GOA:G8BPP5"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPP5"
                     /translation="MSAEGISEVEENQIQTNYDKVVYNFDDMNLKEELLKGVYGYGFE
                     EPSAIQQRAILPIVEKHDVLAQAQSGTGKTGTFSIAALERIDSSIKSPQALILAPTRE
                     LALQIQKVVIALALHMDVKVHACIGGTSFVEDSEGLRDAQIVVGTPGRVSDNIQRRRF
                     KTDNIKMFILDEADEMLSSGFREQIYQIFTMLPPTTQVVLLSATLPNDVLEVTTKFMR
                     NPVRILVKKDELTLEGIKQFYINVEEDDYKFDCLTDLYDSISVTQAVIFCNTRRKVEE
                     LTQKLTENNFTVSSIYSDLPQQERDVIMKEFRSGSSRILISTDLLARGIDVQQVSLVI
                     NYDLPTNKENYIHRIGRGGRFGRKGVAINFVTNQDVGAMRELEQFYSTQIEELPADVA
                     EMFA"
     gene            complement(<693601..>694506)
                     /gene="TPHA0B03050"
                     /locus_tag="TPHA_0B03050"
                     /db_xref="GeneID:11535077"
     mRNA            complement(join(<693601..693840,694483..>694506))
                     /gene="TPHA0B03050"
                     /locus_tag="TPHA_0B03050"
                     /product="40S ribosomal protein S21"
                     /transcript_id="XM_003684363.1"
                     /db_xref="GeneID:11535077"
     CDS             complement(join(693601..693840,694483..694506))
                     /gene="TPHA0B03050"
                     /locus_tag="TPHA_0B03050"
                     /inference="similar to DNA sequence:INSDC:YJL136C,YKR057W"
                     /note="similar to Saccharomyces cerevisiae RPS21B
                     (YJL136C) and RPS21A (YKR057W); ancestral locus Anc_1.213"
                     /codon_start=1
                     /product="40S ribosomal protein S21"
                     /protein_id="XP_003684411.1"
                     /db_xref="GeneID:11535077"
                     /db_xref="GOA:G8BPP6"
                     /db_xref="InterPro:IPR001931"
                     /db_xref="InterPro:IPR018279"
                     /db_xref="UniProtKB/TrEMBL:G8BPP6"
                     /translation="MENDKGQLVELYVPRKCSATNNIIKAKDHASVQINVAKVDEEGR
                     AIPGEYITYALSGKVRGSGEADDALNRLAQNDGLLKNVWSYSR"
     gene            complement(<695421..>696458)
                     /gene="TPHA0B03060"
                     /locus_tag="TPHA_0B03060"
                     /db_xref="GeneID:11534921"
     mRNA            complement(<695421..>696458)
                     /gene="TPHA0B03060"
                     /locus_tag="TPHA_0B03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684364.1"
                     /db_xref="GeneID:11534921"
     CDS             complement(695421..696458)
                     /gene="TPHA0B03060"
                     /locus_tag="TPHA_0B03060"
                     /inference="similar to DNA sequence:INSDC:YKR055W"
                     /note="similar to Saccharomyces cerevisiae RHO4 (YKR055W);
                     ancestral locus Anc_1.215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684412.1"
                     /db_xref="GeneID:11534921"
                     /db_xref="GOA:G8BPP7"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPP7"
                     /translation="MTDLLDSYSATTAVTDTINANKNVDKVNVLDYYVDDINQNSITN
                     SSSHTKMNGSDSLIVSNSNKSQTHTSVVDTPGMVLLNINSPELNIEDSDVISYQHMKN
                     NNENTPKYSNCIPIKIVTLGDSSVGKTSLLLTYIQNNGNEKNSTDENKIPKVLDEYRH
                     YVEGPYNKQIEFSLWDVSADKKDENYRPFAYDEADIIFICYSIDNPSSLINAENIWVP
                     EVKHFTTGIPIILVGLKRDLYFDDTLDLEDNLILSKEAEEVYKNLKLNGHIQVSSKTN
                     YKVNELFSSTINMLINKKLAETQGASDFMKNIIPTKKKININHLIPIPKLRIKKRDQN
                     VLYYKELMLQL"
     gene            <698191..>699423
                     /gene="TPHA0B03070"
                     /locus_tag="TPHA_0B03070"
                     /db_xref="GeneID:11534771"
     mRNA            <698191..>699423
                     /gene="TPHA0B03070"
                     /locus_tag="TPHA_0B03070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684365.1"
                     /db_xref="GeneID:11534771"
     CDS             698191..699423
                     /gene="TPHA0B03070"
                     /locus_tag="TPHA_0B03070"
                     /inference="similar to DNA sequence:INSDC:YJL134W,YKR053C"
                     /note="similar to Saccharomyces cerevisiae LCB3 (YJL134W)
                     and YSR3 (YKR053C); ancestral locus Anc_1.217"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684413.1"
                     /db_xref="GeneID:11534771"
                     /db_xref="GOA:G8BPP8"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:G8BPP8"
                     /translation="MTHLTIARTRSLSNPNVFSGSKENILVDPGNHPDSHFEPHMSPL
                     RFKMRSYLLQYTDSQSTYLAKWQQYYRSDFLDIYFSYSASLASHTFYVICLPIPVFFD
                     QYNLVRDLVYIIGSSIYLSGFLKDYWCLPRPQSPPVKRITLSEYTSKEYGAPSSHTAN
                     AVGVTLLFLLRIWQHDYISIGWKLFYLCLAIFYNLTLVLGRVYCGMHGILDITSGAII
                     GVICFLARLTIPPFLKSMNFHPSEYLLFPMISTACGLFILLYQTVPIDVCPCFDDTVA
                     FIGVLVGMDVSHWAIERYSLEHVVNNLGDLERASTLLVSTKFLLGVILVVVWKYALSK
                     PFLIFLLKNILRIKDDRKLIEAKVTAWQAEHPHECAPYFGRSKFEIYLRFLSYIGIPL
                     TVLLFCPYLFTTIGLIVP"
     gene            <700900..>701817
                     /gene="TPHA0B03080"
                     /locus_tag="TPHA_0B03080"
                     /db_xref="GeneID:11535040"
     mRNA            <700900..>701817
                     /gene="TPHA0B03080"
                     /locus_tag="TPHA_0B03080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684366.1"
                     /db_xref="GeneID:11535040"
     CDS             700900..701817
                     /gene="TPHA0B03080"
                     /locus_tag="TPHA_0B03080"
                     /inference="similar to DNA sequence:INSDC:YJL133W,YKR052C"
                     /note="similar to Saccharomyces cerevisiae MRS3 (YJL133W)
                     and MRS4 (YKR052C); ancestral locus Anc_1.219"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684414.1"
                     /db_xref="GeneID:11535040"
                     /db_xref="GOA:G8BPP9"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8BPP9"
                     /translation="MSGVEEIDYEALPDSASLSSQLMAGAFAGIMEHFVMFPFDALKT
                     RIQSQTQSTLPKNLIKQISKITTTEGSLALWKGVQSMILGAGPAHAVYFSTYEYMKKT
                     LIDQKDMQTHQPLKTALSGATATIASDALMNPFDTIKQRMQLSGSEKTWSVTKNIYHK
                     EGLRAFYYSYPTTIAMNIPFVSLNFVIYESSTKLFNPTNEYNPLVHCLCGGLSGATCA
                     AITTPLDCIKTVLQVRGSKSVSLEVMKKANTFRKAADAIYHVHGWKGFLRGIKPRIIA
                     NVPATAISWTAYECAKHFLMENRTDHVNN"
     gene            complement(<702115..>703428)
                     /gene="TPHA0B03090"
                     /locus_tag="TPHA_0B03090"
                     /db_xref="GeneID:11535155"
     mRNA            complement(<702115..>703428)
                     /gene="TPHA0B03090"
                     /locus_tag="TPHA_0B03090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684367.1"
                     /db_xref="GeneID:11535155"
     CDS             complement(702115..703428)
                     /gene="TPHA0B03090"
                     /locus_tag="TPHA_0B03090"
                     /inference="similar to DNA sequence:INSDC:YKR051W"
                     /note="similar to Saccharomyces cerevisiae YKR051W;
                     ancestral locus Anc_1.220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684415.1"
                     /db_xref="GeneID:11535155"
                     /db_xref="InterPro:IPR005178"
                     /db_xref="UniProtKB/TrEMBL:G8BPQ0"
                     /translation="MINDDSKVLSVIKFLCFLSSTIAITISFYDIVRHFQNYRKPLEQ
                     RLTIRILLVVPIFSLTCFISIVKPGFAHFVTDPIREVYEAFIIFTFFSLLTLILGGER
                     KIVSELSLEHGTIKQPVFIIGNFLKPLDLSDPEDFLQVKRGILQYVWFKPLYCCSLLA
                     LETWKSIKARYLLLFLYNISVTWSLYNLALFWIYFAPNLKKFHPWSKFLCVKLIIFAS
                     YWQSVIIELLISVGIMGSSGDGPEERAHFSYICQNTVLCLEMIFFALLHVKAFSWSDY
                     SYKILPKCARMEFMYALRDTFCAYDVKWDFKHTLLVGSNYYTYQNFDITYTDGDLMAA
                     MSFESRNRQLHKGFRFSNDGRQRYQITDYGSILDGDPLRAAVSYGSKNASHELEEEAW
                     DNSIGEMQYRIDDPNYPVIWEVAGHRYTNDMNTIRESLRNSNGYN"
     gene            complement(<703892..>705046)
                     /gene="TPHA0B03100"
                     /locus_tag="TPHA_0B03100"
                     /db_xref="GeneID:11535165"
     mRNA            complement(<703892..>705046)
                     /gene="TPHA0B03100"
                     /locus_tag="TPHA_0B03100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684368.1"
                     /db_xref="GeneID:11535165"
     CDS             complement(703892..705046)
                     /gene="TPHA0B03100"
                     /locus_tag="TPHA_0B03100"
                     /inference="similar to DNA sequence:INSDC:YJL131C"
                     /note="similar to Saccharomyces cerevisiae YJL131C;
                     ancestral locus Anc_1.222"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684416.1"
                     /db_xref="GeneID:11535165"
                     /db_xref="InterPro:IPR029427"
                     /db_xref="UniProtKB/TrEMBL:G8BPQ1"
                     /translation="MLALKDKVSYSSASSLMSCIRHFSHSRCILYELNFDKTSTALNS
                     SIKVNSEKIKGETKSNEDGKSIKFSLADLYNKTQKSNVRSSNYSNSYKSRSFKSNPII
                     LQKKSSNLPNWINGTEKAKLAATLTYKEILKHNKFGKIKTINPTTGKLTDSKIQDIIR
                     NIDLDKNGIQIVNFEKNMDESITPIVKIIESKIALEKYSQDLAKIKNQELVESGSSAN
                     KFKGKKPNEKSAKSIKYIRITWRIENDDLRRQKAHEIQTALKRGMKVHIFIDDNYNAS
                     NNWITDFELHLNDSDHKLTKSENTKRESLVKTLEQIFQSDSISPIIAGSIKSKMLIKL
                     SPIQEKTESKGDSNKDNKAKDLKTQKKLLRQQKLEERTKRKQERLKRNML"
     gene            complement(<705601..>712251)
                     /gene="TPHA0B03110"
                     /locus_tag="TPHA_0B03110"
                     /db_xref="GeneID:11535113"
     mRNA            complement(<705601..>712251)
                     /gene="TPHA0B03110"
                     /locus_tag="TPHA_0B03110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684369.1"
                     /db_xref="GeneID:11535113"
     CDS             complement(705601..712251)
                     /gene="TPHA0B03110"
                     /locus_tag="TPHA_0B03110"
                     /inference="similar to DNA sequence:INSDC:YJL130C"
                     /note="similar to Saccharomyces cerevisiae URA2 (YJL130C);
                     ancestral locus Anc_1.223"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684417.1"
                     /db_xref="GeneID:11535113"
                     /db_xref="GOA:G8BPQ2"
                     /db_xref="InterPro:IPR002082"
                     /db_xref="InterPro:IPR002474"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005480"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005483"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /db_xref="InterPro:IPR006274"
                     /db_xref="InterPro:IPR006275"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:G8BPQ2"
                     /translation="MMISSVVPTAPITPPMEATGDRMIVLELKDGTALQGYSFGAEKS
                     ISGELVFQTGMVGYPESITDPSYEGQILVITFPLVGNYGVPDRNLMDEFVESIPRYFE
                     SNRIHVAGLVISHYTDQYSHWLAKSSLGQWLKEEGIPAIYGVDTRALTKHLTVSGSIL
                     GRLCLQNSGASNESANTENWSQSFNVPEWVDPNVENLVEKVSTKEPVLYTPPQDNKYV
                     TLQKTSNGKILRILALDVGMKYNQIRCFIKRGVELKVVPWNYDFTKDDDYDGLFISNG
                     PGDPAVLTEVIEKLSYVLEKKKTPVFGICLGHQLLARAAGATTIKMKFGNRGHNIPCT
                     SSISGRCYITSQNHGFAVDVDSLKNGWKPLFTNANDGSNEGMYNAQLPYFSVQFHPES
                     TPGPRDTEFLFDVFIQSVKEHKESGILKAVEFPGGKLEDNLKAHPRVQPKKVLVLGSG
                     GLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVYFLPVTAEFV
                     RKVILHERPDAIYVTFGGQTALSVGIELKDEFETLGVKVLGTPIDTIITTEDRELFAK
                     AIDEINEKCAKSKAANSVDEALAAVKDIGFPVIVRAAYALGGLGSGFANNEKELVDLC
                     NVAFASSPQVLVERSMKGWKEVEYEVVRDAFDNCITVCNMENFDPLGIHTGDSIVVAP
                     SQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALA
                     SKATGYPLAYTAAKLGLNIQLNEIKNSVTKKTCACFEPSLDYCVVKMPRWDLKKFNRV
                     STELSSSMKSVGEVMSIGRTFEEAIQKAIRSTEYANLGFNETDMDIDIDYELNNPSDL
                     RVFAIANAFSKLGYSVDKVWELTRIDKWFLNKLYNLIQFGNNITSFNTIENLPSLVLK
                     EAKQLGFDDRQIAKFLGSNEVAIRHLRKEYGITPFVKQIDTVAAEFPAHTNYLYITYN
                     ASSNDVTFEDNGVMVLGSGVYRIGSSVEFDWCAVTAVRTLRANNIKTIMINYNPETVS
                     TDYDEADRLYFETINLERVLDIYEIESSSGVLVSMGGQTSNNIVMSLHRENVKILGTL
                     PEMIDSAENRYKFSRMLDQIGVDQPAWKELTSINEAEEFADKVGYPVLVRPSYVLSGA
                     AMNTVYSKADLASYLNQAVEVSRDYPVVLTKYIENAKEIEMDAVARNGELVMHVVSEH
                     VENAGVHSGDATLVVPPQDLDPKTVERIVVATAKIGKALKITGPYNIQFIAKDNEIKV
                     IECNVRASRSFPFISKVVGVNLIELATKAIMGLPITPYPVSKLPEDYVAIKVPQFSFP
                     RLAGADPVLGVEMASTGEVACFGHSKYEAYLKALLATGFKLPKKNILLSIGSFKEKQE
                     LLPCVKKLYNMGYKLFATAGTADFITEHNIPVQYLEVLSEDNEKSEYSLTQHLANNKI
                     DLYINLPSANRYRRPASYVSKGYKTRRMAVDYSVPLVTNVKCAKLLIEALSRNLKLEV
                     SERDSQTSHRTINLPGLVNISSFAPNVSNVIKGVDELKELSRVSLEAGFIHNMFMARA
                     MRGPIISDVHSLRAAYSTANGCSYTNYSFTVSGTAYNSDTVAETAPDVTSLFLPFHEL
                     ENKFSTVSDLLKNWPVDKPVIAEAKTSELASIILLASLQNRSIHITGVSNKEDLALIK
                     TVKEKDTKVTCDVNVYSLFVTQNDYPEAVFLPTVEDQEYFWNNLESIDAFSVGSLPTQ
                     LATVTSNPVSTGLGVKDTLPLLLSAVDAGKLTIEDIVSKLHDNPISIFHLPLPEAIVE
                     VDMDYPFRHVKRWSPFNTTKLNGGIERVVVDNETLVLSGELVNDTTRGNVIVSAASAP
                     VPVVEPIVPRGSISKKRFSFSAERPTFSDDEEEFDQPLEQKLMSSRPPKEIVPPGAIQ
                     NLIRANNPFKGRNILSIKQFKRSDFHALFAVAQEMRAAVERYGILDIMKRHIITTIFY
                     EPSTRTSSSFIAAMERLGGRTVNINPNVSSVKKGETLQDTIRTLASYSDAIVMRHPDE
                     MSVHTAAKYSPVPIINGGNGSREHPTQAFLDLFTIREELGTVNGITVTFMGDLKNGRT
                     IHSLCRLLQFYQLRINLVSPNELRLPNALRQELVNKGMLGVESEELTSDIISKSDVLY
                     CTRVQEERFENRDDYERLKDTYIIDNKILAHAKQNMAIMHPLPRVNEIKEEVDYDHRA
                     AYFREMKYGLYVRMALLAMVLGVDDH"
     gene            complement(<714338..>718525)
                     /gene="TPHA0B03120"
                     /locus_tag="TPHA_0B03120"
                     /db_xref="GeneID:11534889"
     mRNA            complement(<714338..>718525)
                     /gene="TPHA0B03120"
                     /locus_tag="TPHA_0B03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684370.1"
                     /db_xref="GeneID:11534889"
     CDS             complement(714338..718525)
                     /gene="TPHA0B03120"
                     /locus_tag="TPHA_0B03120"
                     /inference="similar to DNA sequence:INSDC:YJL129C,YKR050W"
                     /note="similar to Saccharomyces cerevisiae TRK1 (YJL129C)
                     and TRK2 (YKR050W); ancestral locus Anc_1.224"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684418.1"
                     /db_xref="GeneID:11534889"
                     /db_xref="GOA:G8BPQ3"
                     /db_xref="InterPro:IPR003445"
                     /db_xref="InterPro:IPR004773"
                     /db_xref="InterPro:IPR015958"
                     /db_xref="UniProtKB/TrEMBL:G8BPQ3"
                     /translation="MAIRRTLTRVSTSVSVYYKKTLGHRIRDYISNCGHYFHPIKKYV
                     FPNFIAVHYAYTILITILGSILMYPVRNHKYIDILFLACGAATQGGLNTIDVNSLTLY
                     QQIIIYIMCMISTPIFIHGSLAFVRLYWFERHFDGIRTSSKRDFKMRRTRTILNREIT
                     ARTMSRGRFDTINSHNITKNTPNDKNPINFQEQLFSGKLQIRDNEKASESDSDANARN
                     SSSKQSAANELREISGNDIEPVGSSGAGKLQFVASNTSNQTQILGRRDSTDISPADMY
                     RSIAMLQEQHQEREEDDGPALVIGAPNEEKIVEKDNVPKLYPVSSQDELCLENNSNDN
                     IDAQNIKRVLEPGETRDISGNKIKSENINSTIGSDLNSLKSIRMYNRKLSTDSNPTTQ
                     SSNNDSEICDDSRSDASNGSSTINHNKLEYVSRHFLNNKEYQKTKHLHSNNIPLEQTM
                     TNDDDSVVTSESSNSDYSASSSVAIESNSMVEMQTLDNNSTYDDSPAESSKPSLKNNE
                     ESNSEDDLSNHIETSNRNTPRIQFDITEPPRKRRTTSMYQDISPSPKSYKKSYKPHRT
                     KFLRHIPKGDRIKKRIKRTITNNSFDKNKFDFSFSKSHPGNRGLYNAEGAEVEDSFSN
                     KLASEEGSLNSINSAGNNGKNDEHTIHDLTRARTFDVLDNIDLQKLSESPEFQKAVYE
                     NWKNKHRKKRSISRNDYNDTGDNNLFHNTLNESSGEISPNNTKEVIDYFSPSSLHYSR
                     LPKKLDRRSSKENENDFNFMADSNTPYRLHFDPDYALPHQKPKLSRSMSTNYLSWQPV
                     VGRNSTFVGLNSFQKNELGGVEYRATKLLCLLLLIYYIGFHIITFIFLVPWIINRKYY
                     EHIVRADGVSPAWWGFFTAMSGFNDLGLTLTPDSMISFNAAIFPLVVLIWFIIIGNTG
                     FPILFRIVIWFVFKLSPDLSAVRESSGFLLDHPRRCFTLLFPNAATLWLLVTLIALNA
                     TDLILFIIFDFGSAVVKDLSKGRRVLVGLFQGVSTRTAGFAVVDLSKLHPAIQVSYML
                     MMYVSVLPLAISIRRTNVYEEQSLGIYSADSGFPEETFEDLSDSSSSSDESDATEGSN
                     LVIDKSERKRLAKIKKEKKRKRKQKRRREKELKKRKNSTKSFVGAHLRRQLSFDLWYL
                     FLGLFIICICEGSKIQDDSIPSFNIFSILFEIVSAYGTVGLSLGYPNSNQSFSGQFTT
                     LSKLVIIALLIRGRARGLPYSVDRAIMLPSGKVEDMDHLQELERIKPRRKSYIAVSPT
                     DDENMANLDTILEEPGDSEPEDPLNTYLKSSIKKASKSYHKVLNKITGSKQKKGHRHH
                     HHRHRHDDNEHNNNNDDNNNETNTKYQNTSDQYGDQQYEYLVNGDIDEENHISPNEII
                     KGNSKLKSDIYETMAND"
     gene            complement(<719624..>721372)
                     /gene="TPHA0B03130"
                     /locus_tag="TPHA_0B03130"
                     /db_xref="GeneID:11534913"
     mRNA            complement(<719624..>721372)
                     /gene="TPHA0B03130"
                     /locus_tag="TPHA_0B03130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684371.1"
                     /db_xref="GeneID:11534913"
     CDS             complement(719624..721372)
                     /gene="TPHA0B03130"
                     /locus_tag="TPHA_0B03130"
                     /inference="similar to DNA sequence:INSDC:YJL128C"
                     /note="similar to Saccharomyces cerevisiae PBS2 (YJL128C);
                     ancestral locus Anc_1.225"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684419.1"
                     /db_xref="GeneID:11534913"
                     /db_xref="GOA:G8BPQ4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BPQ4"
                     /translation="MGDGLIKDSIEKAHSFNLPRSASHTLSAENNQLHTPNVSSFKLN
                     SYNADDHKFDIQQNYTTLNKKLRYKLSNFQQSRMAHKPYKDISSPSTPPSISPTPCSP
                     TLKCSEFLNLHPNRVAPKRPIENDKLTSVSHTTSINNCDKLKSTTSRRPSLSARRGMR
                     LSLNKLGLKETTENKNKKLHSHKDNNEKDYLMFKTKQTDTVTGTGSNTNVAPPSTLSA
                     LDVCDNYDDDDDDDNDMFSHQMATPLTPANLPLEMDLGKQEANEFTNFSGGVFESFAP
                     FLDIDTGSINFEGKLSLSPQGIEYSNGSSSKFSIDDFEYLEKLGEGNYGQVFKVLHKT
                     TGIIMALKKIKLELETSKLNQISMELEVLHNCNSPYVIDFYGAFFVEGTVYICMEYMD
                     GGSLSSVTEKNKKLTHADCDDTSLQISGIEEQQLSKIAESIIRGLMELKDSHNIMHRD
                     VKPSNIVYSKTEGSIKLCDFGVSGNLVASLAKTNIGCQSYMAPERINSNDQTSVPYSV
                     HSDIWSLGITIVELALGYYPYPAEIYDNIFSQLNAIVSGPVPTLPSDKFSTNAQDFIS
                     LCLKKIHTKDGHIKNY"
     gene            complement(<722462..>722620)
                     /gene="TPHA0B03140"
                     /locus_tag="TPHA_0B03140"
                     /db_xref="GeneID:11535152"
     mRNA            complement(<722462..>722620)
                     /gene="TPHA0B03140"
                     /locus_tag="TPHA_0B03140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684372.1"
                     /db_xref="GeneID:11535152"
     CDS             complement(722462..722620)
                     /gene="TPHA0B03140"
                     /locus_tag="TPHA_0B03140"
                     /inference="similar to DNA sequence:INSDC:YJL127C-B"
                     /note="similar to Saccharomyces cerevisiae YJL127C-B;
                     ancestral locus Anc_1.226"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684420.1"
                     /db_xref="GeneID:11535152"
                     /db_xref="UniProtKB/TrEMBL:G8BPQ5"
                     /translation="MTSFFHQIKNIFVESHSPYQQILLSRKAFFQFIGFLGGCVIITV
                     ATQSTYLD"
     gene            complement(<723285..>725453)
                     /gene="TPHA0B03150"
                     /locus_tag="TPHA_0B03150"
                     /db_xref="GeneID:11535151"
     mRNA            complement(<723285..>725453)
                     /gene="TPHA0B03150"
                     /locus_tag="TPHA_0B03150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684373.1"
                     /db_xref="GeneID:11535151"
     CDS             complement(723285..725453)
                     /gene="TPHA0B03150"
                     /locus_tag="TPHA_0B03150"
                     /inference="similar to DNA sequence:INSDC:YJL127C"
                     /note="similar to Saccharomyces cerevisiae SPT10
                     (YJL127C); ancestral locus Anc_1.227"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684421.1"
                     /db_xref="GeneID:11535151"
                     /db_xref="GOA:G8BPQ6"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR015416"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G8BPQ6"
                     /translation="MNIFSQVGGLSPNYDKNFISNGDVHGRETDDGEFDDSVNMMYHT
                     PLQPHTLLLKDGETTATMYPLPANPELLPIGLLAFLLDEFNMEIEKGDSFPFYEPLSL
                     SKFKEVWFQKDGHICIMVLGEIPELDYSIENDISDLENNYGTNIETMRNSSYYKKRKQ
                     RRNLSLNIQWEKQCLGLFSLNPAYPGRSSHVVTGSFLVNAGIRGKGIGKTLVETFNEW
                     AKRLGFTSCYFPLIYSTSVGIRRIFEVLNFKRIGKIPESGILKGFDVPVDSFIYGKEY
                     THITKGMDSLRDPEKTEDISKYERLIYYLKVKKYPPYCDRNEKARLRVSSKTHYLLNG
                     KLMTKGREIIFDPLKQKQIAMEMHLVEHQGINKITSKIVERYHWKGIKNTVSEVLAQC
                     LKCKMRHLDGTGVVVMPNDNVPQAHMLPENAIASANLLHINKPSRGNDAGSMIEDAKF
                     IYDNDLSDVDGGVNVPMNYNHLQSNTNMHKNTSSKMTIHKYNNNNSTNNNGNSTDNDN
                     NDNDNNIEHNGDKSMSKRSDINSNGKTVSPMMDEDEEFYHSSTLSQMAAAAVRNLQNE
                     TEKDEIIEPTPPDSLNNNITLPTPFLSPTSSNTTNKHKMKLSNENNTKLMSETAMRTN
                     AVIERRDIQLANEEDEDLMQEENPANQEVEMNSFNRFIGEENDRRKRKYLEVAEVALP
                     HHNNKNRRKHNNTTSSTESRNHHHQQHKKKRILLITAVAI"
     gene            <726271..>726684
                     /gene="TPHA0B03160"
                     /locus_tag="TPHA_0B03160"
                     /db_xref="GeneID:11534967"
     mRNA            <726271..>726684
                     /gene="TPHA0B03160"
                     /locus_tag="TPHA_0B03160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684374.1"
                     /db_xref="GeneID:11534967"
     CDS             726271..726684
                     /gene="TPHA0B03160"
                     /locus_tag="TPHA_0B03160"
                     /inference="similar to DNA sequence:INSDC:YKR049C"
                     /note="similar to Saccharomyces cerevisiae FMP46
                     (YKR049C); ancestral locus Anc_1.231"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684422.1"
                     /db_xref="GeneID:11534967"
                     /db_xref="GOA:G8BPQ7"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR012882"
                     /db_xref="UniProtKB/TrEMBL:G8BPQ7"
                     /translation="MSLFRTLQNQPRVISLFTQGVEVNSGSKILYNELNKHCKSADAK
                     TRFNIEVHKTFPTLDQLKYMVDINPKVVEQQVPNLMKIISAKNNSGIFGSSLETCIKE
                     GIWNPEKSIWMDWEKKSIGNNLSSLQTYLKSLETK"
     gene            complement(<726863..>727570)
                     /gene="TPHA0B03170"
                     /locus_tag="TPHA_0B03170"
                     /db_xref="GeneID:11534751"
     mRNA            complement(<726863..>727570)
                     /gene="TPHA0B03170"
                     /locus_tag="TPHA_0B03170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684375.1"
                     /db_xref="GeneID:11534751"
     CDS             complement(726863..727570)
                     /gene="TPHA0B03170"
                     /locus_tag="TPHA_0B03170"
                     /inference="similar to DNA sequence:INSDC:YJL121C"
                     /note="similar to Saccharomyces cerevisiae RPE1 (YJL121C);
                     ancestral locus Anc_1.234"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684423.1"
                     /db_xref="GeneID:11534751"
                     /db_xref="GOA:G8BPQ8"
                     /db_xref="InterPro:IPR000056"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR026019"
                     /db_xref="UniProtKB/TrEMBL:G8BPQ8"
                     /translation="MVKSIIAPSILASDFSNLGCDCHRVINAGADWLHIDVMDGHFVP
                     NITLGQPIVESLRKAVPRPGDVSDKPKAFFDCHMMVSNPEQWVEDFAKCGADQFTFHY
                     ESTKDPLALVKLIKSHGIRAACAIKPGTPVDVLFELGKYLDMALVMTVEPGFGGQKFM
                     PDMMPKVAKLRELFPQLDIQVDGGLGKETIPMAANAGANVIVAGTSVFKASDPVDVIS
                     FMREKVNDNLKSKNLLD"
     gene            complement(<728704..>731073)
                     /gene="TPHA0B03180"
                     /locus_tag="TPHA_0B03180"
                     /db_xref="GeneID:11535185"
     mRNA            complement(<728704..>731073)
                     /gene="TPHA0B03180"
                     /locus_tag="TPHA_0B03180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684376.1"
                     /db_xref="GeneID:11535185"
     CDS             complement(728704..731073)
                     /gene="TPHA0B03180"
                     /locus_tag="TPHA_0B03180"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684424.1"
                     /db_xref="GeneID:11535185"
                     /db_xref="InterPro:IPR013103"
                     /db_xref="UniProtKB/TrEMBL:G8BPQ9"
                     /translation="MLFNQIQSMFNKSIEEQHSWASKSLRTVAKQIIAAERGTYLSDS
                     EKENNMQKVLDHFEALMLIALNPDHQATCLNLLGRNETINSSDVISVISNNVSANNND
                     VTSSPDNSDSEFRPSQYLRRSIVSSVEPESPALQAQIQQLHSALKAQQEAAALEIERQ
                     TSSNTRLMKQIDELKANHTTELNKAKQEFERHIEHIRPHNQRHNHTDESIVGQSLPEV
                     DGVRLVKSRHLNPTESHDRNIRYTQFEAAAGEKLIYLYNTQNGKIISTEDALAQYTEA
                     SQSSPPLPPVAVSQQLFPDPPFLRVLPQSFVPATADSPLTTNELMHIQSSSSELDELA
                     SSPTSASSHSIHPVLTAVLVAHQSYEAQLPRTINQAMSHPDAAEWKAACIRELSAFRS
                     HETYELVPLPTGRRSLGSRWVFTEKSNGLKKARLVAQGNSQKEGIDYSETFAPVIRYD
                     SVRLFLAMAASLKLRIHQMDVDTAFLNSAIDGEVYVRQPPGFLDSHYPTHVWKLKGGM
                     YGLKQAPFLWNTHINETLLSFGFTRHAGEYGLYFSKSADGLVLVALYVDDLLIAAPSS
                     KAMTPLKELLCSSYSMKDLGPVNKFLGMTIKQSENSISLDLSEYISSAASTSQINVDK
                     AVHTPLSKTTDLFGDTSPLLINITPYQSLIGQLLFAANAGRPDISFAVSTLSRFLESP
                     RQVHFAAAQRLLQYLYTTRYDSLCYKTSHPLSISIYTDASTASKDDLPFSTGGYITTM
                     ADGAVTWSSRKIKSTVCLSSTEAECIAGSEAVKESQWLVNFFKFMDLKI"
     gene            <732233..>733318
                     /gene="TPHA0B03190"
                     /locus_tag="TPHA_0B03190"
                     /db_xref="GeneID:11534888"
     mRNA            <732233..>733318
                     /gene="TPHA0B03190"
                     /locus_tag="TPHA_0B03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684377.1"
                     /db_xref="GeneID:11534888"
     CDS             732233..733318
                     /gene="TPHA0B03190"
                     /locus_tag="TPHA_0B03190"
                     /inference="similar to DNA sequence:INSDC:YKR046C"
                     /note="similar to Saccharomyces cerevisiae PET10
                     (YKR046C); ancestral locus Anc_1.236"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684425.1"
                     /db_xref="GeneID:11534888"
                     /db_xref="UniProtKB/TrEMBL:G8BPR0"
                     /translation="MGIKNTINDITMSNSNSNSQDDFSKHEVKIVIDKKTIEKFTQSS
                     PTLNHLAKYKVISIFLNYFLNLPFFSSIVSWIICYNYKFKKTLLESNNVPIVAKRIYQ
                     RAENLIWKCDEVFNYLILREGIDHFFLELNKRHYLPGVWLLWFYIDYLANFIDVLLKE
                     LVIKPFKISYITKNENNSNLGSNSNLNLELNSNAKDLETKKKSNGTTYDNLSNLNYNS
                     SNEDLEELNNKNIVELPHLYELTSTTKSISKDIQEKLNDNYNSYIKPTTQKLTNLYID
                     EPKKIMSQVHSAKSTEIYKTVSGSYEENFKKNNESIPRAIVSTGKDIGSLTLEKLTKT
                     KQQQAHTDKAKESTTPKFFKEKITILV"
     gene            <734025..>734927
                     /gene="TPHA0B03200"
                     /locus_tag="TPHA_0B03200"
                     /db_xref="GeneID:11534785"
     mRNA            <734025..>734927
                     /gene="TPHA0B03200"
                     /locus_tag="TPHA_0B03200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684378.1"
                     /db_xref="GeneID:11534785"
     CDS             734025..734927
                     /gene="TPHA0B03200"
                     /locus_tag="TPHA_0B03200"
                     /inference="similar to DNA sequence:INSDC:YJL117W"
                     /note="similar to Saccharomyces cerevisiae PHO86
                     (YJL117W); ancestral locus Anc_1.238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684426.1"
                     /db_xref="GeneID:11534785"
                     /db_xref="InterPro:IPR024297"
                     /db_xref="UniProtKB/TrEMBL:G8BPR1"
                     /translation="MPPKHSLRIPQIDASLDKPLNVDAPPTIYGTTLKPEFATAAINL
                     AIDFIKRSQSIANQYLLFHPLTLFTISLFLVTYWAINLVFPTNITATSVSGYLYQFAV
                     VNKHALGSGLLFTVILTSFVFTLLSRVTDTYFKSKINEITEANGETVFGVNLKNLIVK
                     DSEEGKSKQLQNTHIVVYRETPIALVTVSENKALSSPESLVIAISSIGCRKVYTKSGI
                     LEDLLDWTMIRTRSIAKEGNYGNSMKILYAVYSFDKDTKQVLKSKGFKLIQAVKVQDN
                     RILGGLFGLKTELWGVQFRIEQDK"
     gene            complement(<735078..>736520)
                     /gene="TPHA0B03210"
                     /locus_tag="TPHA_0B03210"
                     /db_xref="GeneID:11534922"
     mRNA            complement(<735078..>736520)
                     /gene="TPHA0B03210"
                     /locus_tag="TPHA_0B03210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684379.1"
                     /db_xref="GeneID:11534922"
     CDS             complement(735078..736520)
                     /gene="TPHA0B03210"
                     /locus_tag="TPHA_0B03210"
                     /inference="similar to DNA sequence:INSDC:YKR044W"
                     /note="similar to Saccharomyces cerevisiae UIP5 (YKR044W);
                     ancestral locus Anc_1.239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684427.1"
                     /db_xref="GeneID:11534922"
                     /db_xref="GOA:G8BPR2"
                     /db_xref="InterPro:IPR005052"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:G8BPR2"
                     /translation="MQGAKNKFVQFIGIASIFLIFQLITRHLNPLEARSISGYRSYNE
                     DLTKDNYNTDFNLKNNQRKSSIVRVNNPDASLSIPFLDKINNYWHIAGNTEIRNANYI
                     RLSNNDIPNSYGSIMSNSIGDNKINDFETILSFRLKSTNNVNSKKHNYKSKRAENNYN
                     EGLVFMISPENGFIKANLHSSYSKKQYELNTNGIISNNHELMGFPSNLPGLALVIDMH
                     SDQASDEKYAAPFFDAFVLTNPSHHKYDLEHDGDSDNIVWLNKNTQKHIKLKNSIMDG
                     TLVELRLIYLESISFLKVDIRYPNEGKFWIELFQTNHPIYLPKNPKTQERYIGVSALT
                     KNKPSSNIEILNIETNEFHYRDDLNKQESDEETSFDFAKEIQLFLSQEFGERIEIEKD
                     DFIKLQMRKSQPYLNAHDKENKMKNTYHNSNNTNESGMIKASIILILKIAFFTIMIIA
                     LYFISVYARVILKHRKKIYGNHGTGLPLYK"
     gene            <737777..>738583
                     /gene="TPHA0B03220"
                     /locus_tag="TPHA_0B03220"
                     /db_xref="GeneID:11534956"
     mRNA            <737777..>738583
                     /gene="TPHA0B03220"
                     /locus_tag="TPHA_0B03220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684380.1"
                     /db_xref="GeneID:11534956"
     CDS             737777..738583
                     /gene="TPHA0B03220"
                     /locus_tag="TPHA_0B03220"
                     /inference="similar to DNA sequence:INSDC:YKR043C"
                     /note="similar to Saccharomyces cerevisiae YKR043C;
                     ancestral locus Anc_1.240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684428.1"
                     /db_xref="GeneID:11534956"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G8BPR3"
                     /translation="MAPTPRLVAIRHGQTEWSKSGQYTGSTDLPLTEDGVEEMRTAGL
                     SIFQKNNLISPERVTYIVVSPRTRAQQTMNLMLESVPEERKKHIKVIVDEDVREWEYG
                     DYEGRLTSEIIELRKSRGLDKERPWLIWRDGCENGESSEQFGFRLSRAIQRIRQLHKI
                     SHEKNEAADILLFAHGHSIRYLSALWFGLGVEKECSEEQKKEVVHRYDNNGELIPDVH
                     METYSHMVSNPNFLLCPGGMVVLGYSHGCLDEPALELSGAFIPQNSICLT"
     gene            complement(<739198..>740322)
                     /gene="TPHA0B03230"
                     /locus_tag="TPHA_0B03230"
                     /db_xref="GeneID:11534920"
     mRNA            complement(<739198..>740322)
                     /gene="TPHA0B03230"
                     /locus_tag="TPHA_0B03230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684381.1"
                     /db_xref="GeneID:11534920"
     CDS             complement(739198..740322)
                     /gene="TPHA0B03230"
                     /locus_tag="TPHA_0B03230"
                     /inference="similar to DNA sequence:INSDC:YJL116C,YKR042W"
                     /note="similar to Saccharomyces cerevisiae NCA3 (YJL116C)
                     and UTH1 (YKR042W); ancestral locus Anc_1.241"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684429.1"
                     /db_xref="GeneID:11534920"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="UniProtKB/TrEMBL:G8BPR4"
                     /translation="MQFSKLILSASILAASTNAAPAHNHGKHEHGKQDKRDIVTITEV
                     VDVNGNVINNLGQLKATTTLVGNSNVVQNVVVSATTATTAVAAVSTSGSSSSSSSSSS
                     IDGDLSDFSAPSKKFVDGTIKCSDFPSGQGVIPVSWIGMNGWTSILNSNGDTSSECTD
                     GFYCSYACQAGMSKTQWPSEQPSNGASIGGLYCKDGYLYRSNTDTDYLCEWGQQSASA
                     VNQLSSESISLCRTDYPGSENMDIPTLVGAGSSKPISVVNQDSYYTWQGKKTSTQYYV
                     NNAGVSVEDGCIWGSEGSGVGNWAPVVLGAGYTDGITYLSIIPNPNNSETPNFNLKIV
                     ATDGSTVNGDCKYENGVYTGGSTDGCTVSVTSGSAEFVFY"
     gene            <743153..>744910
                     /gene="TPHA0B03240"
                     /locus_tag="TPHA_0B03240"
                     /db_xref="GeneID:11535032"
     mRNA            <743153..>744910
                     /gene="TPHA0B03240"
                     /locus_tag="TPHA_0B03240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684382.1"
                     /db_xref="GeneID:11535032"
     CDS             743153..744910
                     /gene="TPHA0B03240"
                     /locus_tag="TPHA_0B03240"
                     /inference="similar to DNA sequence:INSDC:YDR109C"
                     /note="similar to Saccharomyces cerevisiae YDR109C;
                     ancestral locus Anc_8.257"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684430.1"
                     /db_xref="GeneID:11535032"
                     /db_xref="GOA:G8BPR5"
                     /db_xref="InterPro:IPR006003"
                     /db_xref="InterPro:IPR018484"
                     /db_xref="InterPro:IPR018485"
                     /db_xref="UniProtKB/TrEMBL:G8BPR5"
                     /translation="MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFIT
                     QSSNEIWDAILDIIKRVIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDD
                     SNQNIILWMDHRAASETDLINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHR
                     CVFLDLADFLTYKATGKIVHSFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELST
                     NNFEKLGGSINLKEGNFLIPGDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTV
                     ASDVSDRVCSDSPQELNKIEGSLGRIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLA
                     ENMWATEGGQSFTGALLDNIIETHPAYQELERITSRQNKNIFVYLDEKLEELRVNRKL
                     DSVFYLTKNMFIYGDYYGNRSPLADPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQ
                     TRHIIDTLVTHGHGITAIYMSGGHCKNKLLMELISNCCVLPLVLSKYIDSSVVFGAAI
                     LGSVAAKINSMKENKLEYSLNDVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVY
                     LDMIDTNIKYRKKMEEVYK"
     gene            <745716..>749363
                     /gene="TPHA0B03250"
                     /locus_tag="TPHA_0B03250"
                     /db_xref="GeneID:11534935"
     mRNA            <745716..>749363
                     /gene="TPHA0B03250"
                     /locus_tag="TPHA_0B03250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684383.1"
                     /db_xref="GeneID:11534935"
     CDS             745716..749363
                     /gene="TPHA0B03250"
                     /locus_tag="TPHA_0B03250"
                     /inference="similar to DNA sequence:INSDC:YLR084C"
                     /note="similar to Saccharomyces cerevisiae RAX2 (YLR084C);
                     ancestral locus Anc_8.256"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684431.1"
                     /db_xref="GeneID:11534935"
                     /db_xref="InterPro:IPR024982"
                     /db_xref="UniProtKB/TrEMBL:G8BPR6"
                     /translation="MSIISTIVRLVVLFSLANNATASSLSNILKLLNIQEFELPNLNF
                     NNTSNSIQLLGDVENLQFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQLEVGSND
                     TDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQDLGNITSILVDE
                     EIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLNDDNILF
                     VGMFDTLGNSSLLTYNTTSNFSNFTNSTENSSTIQLEQQISLKYATWDAGTAYFDQNN
                     FVCEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGI
                     MNLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWSESY
                     QEFAFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTESTSL
                     FSSSVLSDNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDFSIKMYTPGCLA
                     DGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYST
                     ILPDLDSAIIVADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSNFTSDTKTK
                     VGNNSIHQLALSQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQLNSDLELRNTVVVDNG
                     GETTRIENYSQGLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGDNVTTFANFTYEGSE
                     LLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNEPLK
                     LYGNSSLESLTFSSSIVPYAAVFLNDTANLYAYKDGENSKIIYGNNMTTSLDFSGTLN
                     KLSFSNNSSLLFANAITNNGSSSLVISNISDGMSLASENLNNYGYITSMIDFNSNNTI
                     LVSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQ
                     NYSSITLASLDIKGYNISVLSDDSKIEISSFIHDGQSITVWSNDTIMEYKSEKWNEIS
                     FPNTTSKYIESVEAVSIDLQNSTSNVSKILFAYGEFNSTLYGRLNAMLFRAGDWKPYF
                     SINNFQVNEDPAITLFENRDLSSLFNSKNSLPANITSAETSSRSTVSSATATTVVNKI
                     EGKHSKIDRGFVVLIALALAVGTVALLGLFGVTIAYIFRDEQKYESIKPRIDGQEMLD
                     TVPPEKLMKFI"
     gene            complement(<749568..>751712)
                     /gene="TPHA0B03260"
                     /locus_tag="TPHA_0B03260"
                     /db_xref="GeneID:11534909"
     mRNA            complement(<749568..>751712)
                     /gene="TPHA0B03260"
                     /locus_tag="TPHA_0B03260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684384.1"
                     /db_xref="GeneID:11534909"
     CDS             complement(749568..751712)
                     /gene="TPHA0B03260"
                     /locus_tag="TPHA_0B03260"
                     /inference="similar to DNA sequence:INSDC:YDR108W"
                     /note="similar to Saccharomyces cerevisiae GSG1 (YDR108W);
                     ancestral locus Anc_8.255"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684432.1"
                     /db_xref="GeneID:11534909"
                     /db_xref="InterPro:IPR024420"
                     /db_xref="UniProtKB/TrEMBL:G8BPR7"
                     /translation="MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTAT
                     VELDSHISEEYGIDSFYTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIE
                     ETKVKLNEDEKMEEELQSDQNVINPTNDPTVNNNYLDVDTKTDNLLPKSSQTTRNRSR
                     SNSLFQRDSTQSQFIRFTRPIEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDD
                     IDHKTLQKSLYHRFFSSAISSTNCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIA
                     FKNQNTTINNFPIFMSTNDILPVFVLCYNGSSAEESEKSTELSKKIKKQLFAECIRMP
                     LWDKRYSDDITVKLHQPAMSSLDEMLYVFQTSKTDKLPLTLINLIYDQLEILTNDLMI
                     PFMQRKITFWEETILQPKKSLFQGTKLFRKFMGRPSMTNGRQENIPIKDNQGNEYFAS
                     TSNVFLLRKLADWSMMISDFKTAYTTFESLLEDIEMYPKYLASCLEWCAVCILMGAQN
                     IVTTKMIKNDVNPLIERSLDVYGNCALLLNSIAESEESPDTEPVRSYETRCMLITSEL
                     FLSLSDTWTSTPYALSNLETILSECKLGACSQIMIWERLSDCYNLRTDPRVKHKLRSN
                     ISTSSVSEVSEEEIKKQDVSSIVLKGLTRQRKASFFRLLAAKKWAEQHQWRQVSWCLN
                     DISEMYQDTVFGKRESLIYQKLKRNLLENSKK"
     gene            <752622..>753455
                     /gene="TPHA0B03270"
                     /locus_tag="TPHA_0B03270"
                     /db_xref="GeneID:11535126"
     mRNA            <752622..>753455
                     /gene="TPHA0B03270"
                     /locus_tag="TPHA_0B03270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684385.1"
                     /db_xref="GeneID:11535126"
     CDS             752622..753455
                     /gene="TPHA0B03270"
                     /locus_tag="TPHA_0B03270"
                     /inference="similar to DNA sequence:INSDC:YER180C"
                     /note="similar to Saccharomyces cerevisiae ISC10
                     (YER180C); ancestral locus Anc_8.252"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684433.1"
                     /db_xref="GeneID:11535126"
                     /db_xref="UniProtKB/TrEMBL:G8BPR8"
                     /translation="MTDTTFYCHQLKTGEEKNSAIIQPNQNISTLQEIILDNKTNIKP
                     QLNDNKIFKKNISINKENNGVSTKKALLQKSFTNSDLNHIGDLGEINSNYTIDSPSLR
                     KVIFENERYKHFKELSYFMKTCNVPNPSFPSKTEYFNYLPHCVNENNEFRSFDKKETY
                     LQENSEHIVTCMLQDFLNNRRPIFPRELEFQELYSSLTFKDKVLHFLFGRDKNGFFRL
                     EKLKDFFENSLIFPYKCEPYFENENESYFEDSITYSDIYLSDNELIPTAEETEIEMEY
                     L"
     gene            complement(<753620..>754462)
                     /gene="TPHA0B03280"
                     /locus_tag="TPHA_0B03280"
                     /db_xref="GeneID:11535190"
     mRNA            complement(<753620..>754462)
                     /gene="TPHA0B03280"
                     /locus_tag="TPHA_0B03280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684386.1"
                     /db_xref="GeneID:11535190"
     CDS             complement(753620..754462)
                     /gene="TPHA0B03280"
                     /locus_tag="TPHA_0B03280"
                     /inference="similar to DNA sequence:INSDC:YDR106W"
                     /note="similar to Saccharomyces cerevisiae ARP10
                     (YDR106W); ancestral locus Anc_8.251"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684434.1"
                     /db_xref="GeneID:11535190"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="UniProtKB/TrEMBL:G8BPR9"
                     /translation="MNRAIIFDFKDGYLYVGKELSCQPHFCIPWLAVNTPDSGYLNAS
                     FSRLRDVFHNKLNESSLNRNIVIVDDVLCSTRIKKLLCELFLNKLKCKQLVFIPSAIA
                     ECISSGSDRGLVLEIYNNRVVLTPCYDNRIIETGIIESLGSLKSKKTIEDIGLTENCF
                     STKTFDKLLNFDDGGHDLNEMPLVGLILKVLKQLPIDIRKSLLSNIIISHESKEVDLN
                     SIRHHIKLLPDSAIILSLGSWTGASIFSIYAEQQKVKSEYMVTAQEYLCDNYRVPDWF
                     ENRF"
     gene            complement(<754858..>757395)
                     /gene="TPHA0B03290"
                     /locus_tag="TPHA_0B03290"
                     /db_xref="GeneID:11535083"
     mRNA            complement(<754858..>757395)
                     /gene="TPHA0B03290"
                     /locus_tag="TPHA_0B03290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684387.1"
                     /db_xref="GeneID:11535083"
     CDS             complement(754858..757395)
                     /gene="TPHA0B03290"
                     /locus_tag="TPHA_0B03290"
                     /inference="similar to DNA sequence:INSDC:YDR103W"
                     /note="similar to Saccharomyces cerevisiae STE5 (YDR103W);
                     ancestral locus Anc_8.247"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684435.1"
                     /db_xref="GeneID:11535083"
                     /db_xref="GOA:G8BPS0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR021106"
                     /db_xref="UniProtKB/TrEMBL:G8BPS0"
                     /translation="MISTLVPLENEQVIHQYINVETGEASTHLKTPESQTFLHSMEKI
                     SPSSFIKNKNWKFGFNKPKKYDRKEKIKHPVEFENSTKRKPPPLPKLNELSPLKAFPE
                     RQSSLPRPSSILFNPKKEHLSYSSTSGTISGTVNSSKKSNSLTNLSSELQKPHNSNSE
                     GHRNKKSFINATCTLCNEFVSNRAPGEKIIELTCGHPIHEDCLTISFGNSSDYDVNNN
                     YSLFPKCQSCLLANKSSKRCIPVSEEIKDKLMSNFLLNNSMSPIEQSIEIDSQMVNET
                     MSAKLSPIQRLEKIHKFPNSRTSSPISLFTRANDSRLSGLDGLPFVKPIGVLPVNTVL
                     DNKKSRIGSTIYASPQIISSNLETQSLHSVETLDAQENYVESEQSDNSIPILRSFFTE
                     SLLSDFPDKLKKSQFDEDHGLLRLVDTFSTSFNGTEYSAGNCFLFEKSIILSKSSKSN
                     EDTASHILATSNDNFGNVTVFNLGEGFVIETIDSSVLKIKFSAETNPVSSYLYLTENL
                     KTNTSSIIEKWISGLLDLTFTFNCKHFTSTLELPPVLKNSDADTSNATFFALVNNNKI
                     VEVTHLDNESTGTILRRSVCMPTTGTTDFTVDSLMSVVTSFSSIISMKMKKPENLLLV
                     VQIDFRKLNQGEELVIKNTIRALTLNYSDLHMCFVDNHSKVIKIVPTKDIVNGTDYFK
                     DLSQIKGSTSFSPSWLLSELYPDGVKTSLGVSVISNTKMDETESILFMDFDKFNGLGR
                     KKVHQLKVHVGFLNIDYSEEIQELLEINNWNLLLESLCFTFDIVYGQDEDTVDFAINK
                     NNTISRSTTPTLLLDPNDSASDLESLTTILLGTATPSTRDSPLTISS"
     gene            <759814..>761583
                     /gene="TPHA0B03300"
                     /locus_tag="TPHA_0B03300"
                     /db_xref="GeneID:11534714"
     mRNA            <759814..>761583
                     /gene="TPHA0B03300"
                     /locus_tag="TPHA_0B03300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684388.1"
                     /db_xref="GeneID:11534714"
     CDS             759814..761583
                     /gene="TPHA0B03300"
                     /locus_tag="TPHA_0B03300"
                     /inference="similar to DNA sequence:INSDC:YDR101C"
                     /note="similar to Saccharomyces cerevisiae ARX1 (YDR101C);
                     ancestral locus Anc_8.245"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684436.1"
                     /db_xref="GeneID:11534714"
                     /db_xref="GOA:G8BPS1"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="UniProtKB/TrEMBL:G8BPS1"
                     /translation="MALAISHEDTQILLKDKNVIQESVLDKYRTAGQVVQTALKYITG
                     LINDSYHYKKSKVLSISELCLLTDSFILNCLSQFYTNKVNEKGIAFPTSIDVNQISNG
                     WSPEIEDSENLKHWNRNLKDTELQSTVTGLLNEGDVVKITLGVHIDGYTSQVSHTMII
                     YPVDETNTKPTGPLLGGKADAVAAAHIAVETVNSLLNCALTPEKLPPTLGSSAQSING
                     QLLRSVVDTIARSYNCCVVPGSRIRRVRRFLAGQNEGIVAERDFKGVVWAESHQEAEL
                     VSQSDSVKDLSIIERGHSELTNASAIPTDQFVVQAGEAYLVDIKMASLEKCPKRGLVT
                     LETIDKFTGKTDNVNSLIARPTIFVRDYAHTHILKLKTSKQLLSKIDKQGVYPLKLSN
                     LSKLALSKDITPDELNELKRELRSSRLGMNEIVNNFLCIEAPIQAAKWVPWDHILKVT
                     NPNGNLSYDATASLTLPGHELPLPKLGVSALKLRQLMTSSKEALSIPVARESNTILLC
                     TDDVSSGEGPELLKLTGGSKTCPPSWVHSKYELDPQDSIVQGIFQLASLSKDKRFGLS
                     SRETQPMKNLHNNTKSASDSMQM"
     gene            complement(<762238..>763008)
                     /gene="TPHA0B03310"
                     /locus_tag="TPHA_0B03310"
                     /db_xref="GeneID:11534824"
     mRNA            complement(<762238..>763008)
                     /gene="TPHA0B03310"
                     /locus_tag="TPHA_0B03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684389.1"
                     /db_xref="GeneID:11534824"
     CDS             complement(762238..763008)
                     /gene="TPHA0B03310"
                     /locus_tag="TPHA_0B03310"
                     /inference="similar to DNA sequence:INSDC:YDR099W,YER177W"
                     /note="similar to Saccharomyces cerevisiae BMH2 (YDR099W)
                     and BMH1 (YER177W); ancestral locus Anc_8.243"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684437.1"
                     /db_xref="GeneID:11534824"
                     /db_xref="GOA:G8BPS2"
                     /db_xref="InterPro:IPR000308"
                     /db_xref="InterPro:IPR023409"
                     /db_xref="InterPro:IPR023410"
                     /db_xref="UniProtKB/TrEMBL:G8BPS2"
                     /translation="MSQSREDSVYLAKLAEQAERYEEMVENMKVVASSGQELSVEERN
                     LLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVSLIRTYRSKIETELTKISDDI
                     LSVLDSHLIPYATTGESKVFYYKMKGDYYRYLAEFSSGDVRDKATDSSLEAYKTASEI
                     ATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKD
                     SALIMQLLRDNLTLWTSDMSESNQAEQPSDEAQAQAPK"
     gene            766262..766333
                     /gene="TPHA0Btrna8Q"
                     /locus_tag="TPHA_0Btrna8Q"
                     /db_xref="GeneID:11534820"
     tRNA            766262..766333
                     /gene="TPHA0Btrna8Q"
                     /locus_tag="TPHA_0Btrna8Q"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAA"
                     /db_xref="GeneID:11534820"
     gene            complement(<766491..>769892)
                     /gene="TPHA0B03320"
                     /locus_tag="TPHA_0B03320"
                     /db_xref="GeneID:11534766"
     mRNA            complement(<766491..>769892)
                     /gene="TPHA0B03320"
                     /locus_tag="TPHA_0B03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684390.1"
                     /db_xref="GeneID:11534766"
     CDS             complement(766491..769892)
                     /gene="TPHA0B03320"
                     /locus_tag="TPHA_0B03320"
                     /inference="similar to DNA sequence:INSDC:YER176W"
                     /note="similar to Saccharomyces cerevisiae ECM32
                     (YER176W); ancestral locus Anc_8.242"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684438.1"
                     /db_xref="GeneID:11534766"
                     /db_xref="GOA:G8BPS3"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPS3"
                     /translation="MSKQIGSNSRKPQQDMSKFQCLTCSQVLDAESMMKHLSSTRHKA
                     ITDILRDEDVSCEECSDSNIHQLQIIRFGGEDMALLCNTCFKKEYANENEKPNTCYSL
                     SNGSILKSWSNYLKVRDCVCGNCGKESHLNVNSRKNVLCDQCLQKESVNRKTLLNDYI
                     SESSGRFLYLFLGIPETKKVNKVQKRKGRKMGRGKKKGRDKGKKGEGKPKKVLTVHEQ
                     MAKRAYETKKMNNIIESTNSISLDSFKGIRASSSSPTPSKLIPTSKSFGQSISSMSSS
                     KSQTKPSTLRQNNNASTSSKRQSSANATIAKSSRNLKTSSNRSDKSHGVKTINSPAKK
                     VNNTSARQERAEFRSKPDKKGNKNTSSNFTFKSHEDSNSVANGPKSVKLDNKSLPKKG
                     DSNEKNKKYSNTKENDGKSTKNTGNRNQSEKIRDEISKRVTSNATKGNGNNSADKVKE
                     AKKTNNSNNKVEEIEEGVPIKEFTKYIPQMTYADLESYFLNFSHALFLEQKLEADFIQ
                     NFEIIWPRKDTERVFVIHIKQNNNPEIEKMLSPTFAKLGVLPFINRQVIMLSNQEETQ
                     VWYCYVKEVASRRGNIQILLELFYWNNQKLPNTRRNEEFKILPCSAQTNRIMFAMTSI
                     KNQRFVALLLGVKPVRQIDFKNRIQFSKETLNDSQKSAIQHVLNNSITILQGPPGTGK
                     TSTIEEIILQMIKNFNSFPILCVAASNIAIDNIAEKLLESKPDIKILRILSEGKEQQY
                     GKDHPLGKICLHNIVNDQLSENGIDTLIKVRSGRIKDVSKNQLNKLMTEQNNISDRYV
                     SQAQILLTTNIAAGGRQLKSIKEVPVVIMDEATQSSEMSTLVPLSLPGIRTFVFVGDE
                     KQLSSFSNVPQLEMSLFERILLNGSYKNPHMLDTQYRMHPQISRFPIEKFYDNKLLDG
                     VTEEQKKWPGIEHPLYFHQCDKGLENKVFNYNRGSRGFTYTNKHEVKEIVKFIYRLIL
                     EKNVPRTEIGIITPYSAQRDLISETLQKDLVVNPERLEMEREVDDLDLLNSRLRAKTS
                     GLSNDGNKVNTINIINGVFISTIDSFQGHEKGFIIFSCVRNNKENKIGFVSDKRRMNV
                     ALTRAKHGLIMIGNKNILKKDTKLWASYIDYLEKHNLIHTNLDEY"
     gene            <770614..>771363
                     /gene="TPHA0B03340"
                     /locus_tag="TPHA_0B03340"
                     /db_xref="GeneID:11534948"
     mRNA            <770614..>771363
                     /gene="TPHA0B03340"
                     /locus_tag="TPHA_0B03340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684391.1"
                     /db_xref="GeneID:11534948"
     CDS             770614..771363
                     /gene="TPHA0B03340"
                     /locus_tag="TPHA_0B03340"
                     /inference="similar to DNA sequence:INSDC:YDR098C,YER174C"
                     /note="similar to Saccharomyces cerevisiae GRX3 (YDR098C)
                     and GRX4 (YER174C); ancestral locus Anc_8.240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684439.1"
                     /db_xref="GeneID:11534948"
                     /db_xref="GOA:G8BPS4"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR004480"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:G8BPS4"
                     /translation="MAVISINDQDQFTKLTTTEANGRLICLYLYTNWAEPCKVMTEVF
                     QTLSEDPTNSNILFLSTDADEFSEIAELFNVSAVPYFIIIQNETILNEISGADPKEFI
                     AALDQCKKQLEDGNLNSKEEATSNQNGNDDADEGEDEGENEETEEELNERLTKLTRAA
                     PVMLFMKGNPTEPKCGFSRQLVGILREYQLRFGFFDILKDDSVRQGLKKFSDWPTFPQ
                     LYINGEFQGGLDIIKRSLEEDNDFFQNALES"
     gene            complement(<771611..>773683)
                     /gene="TPHA0B03350"
                     /locus_tag="TPHA_0B03350"
                     /db_xref="GeneID:11534895"
     mRNA            complement(<771611..>773683)
                     /gene="TPHA0B03350"
                     /locus_tag="TPHA_0B03350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684392.1"
                     /db_xref="GeneID:11534895"
     CDS             complement(771611..773683)
                     /gene="TPHA0B03350"
                     /locus_tag="TPHA_0B03350"
                     /inference="similar to DNA sequence:INSDC:YER173W"
                     /note="similar to Saccharomyces cerevisiae RAD24
                     (YER173W); ancestral locus Anc_8.239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684440.1"
                     /db_xref="GeneID:11534895"
                     /db_xref="GOA:G8BPS5"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004582"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPS5"
                     /translation="MERPTLQRGLSSLQSQNVTWNTSKPASPTKTNNRNRYINTARKK
                     TETGQSDNGGTMIRNEANDEPKYNIESIPWYSKYSPKTLEDVVIHKRKLEDVKNELEN
                     MLSGRSSTRVLLITGPSGSSKSTIIEKLAEKLIPRYRFNQGVYTSLRSFSSPDINSNQ
                     FITKYENDTIELNSSTVNSFDQFLRNAKYKTGNNLSLILVEELPNIFHMDTRMAFRKS
                     LEEWLYSNDARLPPLVVCLTECEIKSTEKSNINSFSVDTIFNAETVLGRELLNNPRLK
                     RLKFNPINATLMKKHLTMLATENKDLLKQNNKWEVKELFIKELSLISGDLRSSIAAFE
                     FWASSSTNLSMFTRNEAISFFHAIGKIIHGSKEISDDNELINDLFQGSSNLVNSNNFK
                     LGLLENYDVPNKGKFSIDMASTITDALSLSDRYDTSVELLEHSARLIRYSYDQFKSKD
                     HQSGKPKFSREWKIKRLQQEFIIESEDYMNVSMYKYQESKSMYNTILYDSYYSPYIKK
                     IRNFKKKSLAYYLETLSDSKASRRRKAEIIEKNKDYFKIDENVDLLNRFGGDIKIISN
                     EEVMSTVDDESLKLPQSITNLMEQKQSRLKVLSEKYDNNFLTNRYELDISNVELDKEA
                     DFEDDPIIDSSDGEFLNKTHVAETSHLDEDEDDSLYEILSQKKPLTKELNSKRINESL
                     SDSDLDDL"
     gene            <774118..>780630
                     /gene="TPHA0B03360"
                     /locus_tag="TPHA_0B03360"
                     /db_xref="GeneID:11535066"
     mRNA            <774118..>780630
                     /gene="TPHA0B03360"
                     /locus_tag="TPHA_0B03360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684393.1"
                     /db_xref="GeneID:11535066"
     CDS             774118..780630
                     /gene="TPHA0B03360"
                     /locus_tag="TPHA_0B03360"
                     /inference="similar to DNA sequence:INSDC:YER172C"
                     /note="similar to Saccharomyces cerevisiae BRR2 (YER172C);
                     ancestral locus Anc_8.238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684441.1"
                     /db_xref="GeneID:11535066"
                     /db_xref="GOA:G8BPS6"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPS6"
                     /translation="MESEREMDRKRIKEIYRSDEMSNLVLTSNKQSKSGEKNNIKEAE
                     ASQPKSVAGVISKNDMGSAMKHDLETSSLKDELSLNIQTYPGDAANKKEDLQPKNTSN
                     RYGNTLLDLDELTEIKYHPTNDTTFLIYEEILQWVISIIGNDIPHQVIIETTDLLISL
                     FKEDEENTHDTQMKLTKIEEILQMPINKLNFQSLMKLMNNITDYSTQKYESSNTKTGN
                     AIAVVSSEDEDDTQDQPELDFQEHHTNIDTKFITKKDIGRNETTDSHVLNSSKSNIIL
                     GTTNYKIFSDTKIYDVNPNYLYNIIFSSNLKNPHKATMPNFENIIELLSSEHLTASAL
                     SKSLKAHKIDISDELIDNMILNKDKLKWGLLLSKSNDSDKDKIIEEMKNNNLLPLIDE
                     YLNYFTGKVKRKLEPSNQTGYNDSDDDTFTPKRAKTLSKSLQYLNLEEFQKYNRISDV
                     SANKIVLPNGSFKRVKPKYEEIHIPPLKQVLLDYTLINITDLPKWAQSAFPPNEIEVL
                     NAIQSKVYGAAFETDENMLVCAPTGAGKTNIALLAILRCISKHFSTSKETLQLNNFKI
                     VFIAPLKALVQEQVREFQRRLSPYGIKVSELTGDSNLSRSQINETQILVSTPEKWDII
                     TRKSNDLTYVNLVDLVIIDEVHLLHDPRGPVIESIVSRSLIDANIKNPRIMAMSATLP
                     NYKDVAKFLRVKEPYLFYFDSTFRPCPLSQQFCGITEKSSIKKISAMNEVCYDKVLES
                     VTEGHQVIVFVHSRKDTHRTAEYLKKEFLKNHLLDKIKKPDAGSKEILRKETETIKNS
                     KLKDLCTFGIGIHHAGLDRSDRSLSEDLFADGLLQVLVSTATLAWGVNLPAHTVIIKG
                     TEVYSPETSKWEKLSAQDVLQMLGRAGRPRYDTHGKGIIITNQTDIKYYLAVLTNQLS
                     IQSYLSEKLVDCLNAEIVLGNVININDAKNWFQHTFLYIRMLVSPKTYNIPNLENFDS
                     FMFSLMHTCFRILHDGKLVVYNDKELTVESTELGKIASHYYIDHESIKLYYDNINSNM
                     DTSELLQTFSLSSEFKFVSVRTEERKELMTLKSRSPFPIPESMDENSTKIIILLQSYI
                     SRIQFEGLALNADMTFIIQNAGRLMKAIYEICLYKNYARQTKTAISLCKCIDNRMWSA
                     NSPLRQFKGCPNEVIKRTEASYTQWDDYLKIQSPSEVGKAIRSEKNGKLIYDLLRRFP
                     KVQLECQVQTITPTIFLFDLTFTPTWIWDSRYHKTSEPFIIIVEDSDGKEILYSNYIL
                     INKNELGQDHMLSFTLELPKNNNSQVPPNIFINIISEKWIKSSETLSVSLAKLIKPRK
                     FTAPMKANDIELVFTSRLQVPEFSNVFNFDKFDFHISSCFDVLYNSNDNIFISRTENP
                     QDSTGPELALLNHWRQNKGRAIYIHPSQTHIDHLVNVWQGKFSKIAEGQVIQKLTEDV
                     SINIKLLAQSHLILGTPEQLNFLSRKWPTRKNLQLVELLIYDGLQNVRNSITGSVYEI
                     LISRMNLMIAQLEKDIRIVGFSSPIANSRDFADFIGVNKKFMYNFSPQDRIEQLNVEF
                     ITHNNMGFKTPSNLSRRQAFDYILYNGKPRNYSIIYTQSRKECYKVARQFVSYLSYQN
                     TQSIDKPNVSSDEGIKHISDPSTKSALDAGIGIIYEGMPIANLDTILKLYNDGNISTL
                     LIPFESVKIAPKSNITIILDTEYYDEQHRCYYDCNIDNVNEMISHTVGNTDTHMGIVL
                     IFTNSYRKEYYQKFITEPVPVESSLLNNIHDYILNEICTSIIENKQDCMDLLTYSLFY
                     RRLHANPSYYGLSDVSAEGISQFLTTLVNDVIADLINCSLISPVSRPDADTINEDRDE
                     EGINNDENFIILPFSNVLVKYNISFYTMKYFLNNLTSASTLKDILLLLSNSREFDTVP
                     LREGDLSYLQNLEKRLPLKFTGNIHNDPRKFKLFILFQSYFSRISLSTELKNDLHAVL
                     KHVCNLTATVVDILAGNGWLNSTTAMDLLQMFVQGVWDTDNSLKQIPLFDKDILSKCA
                     VKGVDSVYDFMALEDEDREEILSIDNIELNKIANFVNNYPNIELKYQIENINRIEMNS
                     IKEIMVTISRDEEPESTLVISEKYPYDKIENWWLVLGECDTRELYAIRKVTLSKESQS
                     FKLPFSLDRQGTHKLTLFCVCDSYLDADKEVSFDVTVA"
     gene            <781256..>784690
                     /gene="TPHA0B03370"
                     /locus_tag="TPHA_0B03370"
                     /db_xref="GeneID:11535057"
     mRNA            <781256..>784690
                     /gene="TPHA0B03370"
                     /locus_tag="TPHA_0B03370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684394.1"
                     /db_xref="GeneID:11535057"
     CDS             781256..784690
                     /gene="TPHA0B03370"
                     /locus_tag="TPHA_0B03370"
                     /inference="similar to DNA sequence:INSDC:YDR097C"
                     /note="similar to Saccharomyces cerevisiae MSH6 (YDR097C);
                     ancestral locus Anc_8.235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684442.1"
                     /db_xref="GeneID:11535057"
                     /db_xref="GOA:G8BPS7"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="InterPro:IPR015536"
                     /db_xref="InterPro:IPR016151"
                     /db_xref="InterPro:IPR017261"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPS7"
                     /translation="MKTLANDLNIPQSEDTIIEPKASTPVKHENVINPVKEEEDSDGF
                     EDDTFISSSRRNAKRVISYAEDSDSDDEPLIKKQSRKIRKVRSDDDDDDLEFTLDTSV
                     VSEKEDEEEYIEPKKTFSDSNDDDDDDILSLVEKPKRAVAKTFKPLVKASPKPVFKSK
                     TFAQAPKHANFNKQHQERYQWLIDIRDAEKRPMTDPEYDPKTLYIPTSAWNKFTAFEK
                     QYWEIKSKMWDCVVFFKKGKFFELYEKDAILGNTLFDLKIAGGGRANMNLAGIPEMSF
                     DHWASQFIEYGYKVAKVDQRESMLAKEMREGSKGIVKRELECVLTSGTLTESNMLHSD
                     LATYCLAVREEPGNFYEADTQNIVSVDSTLKNKLFGVSFIDTATGEIQLIELEDDNEC
                     TKLETLMSQVRPKEIIMEKDNLSNLAHKIIKFNSAPQAIMNYLKAGEEFYDFYKTHDE
                     LLSEENNYFKDSSEWPAILQTYYKNKKQVGFSALGGLLYYLKWLKLDGNLISLGNMKE
                     YDLVGSQKSLILDGVTLQNLEIFSNSFDGSDKGTLFKLFNLSITPMGKRMMKNWVMHP
                     LLQKSDIEKRLDSVDLLLSDVELRDVFESHFIRLPDLERMLARIHSTTIKMKDFEKVI
                     QGFETIVKMIDTLKDRANKGALGIYISQIPVDLRSSVDKWSNSFDRACAIEEDKIIPI
                     KGVEPEFDESLNQIKVIEDELNKILLEYRKRFKCSSIQYKDSGKELFTIEVPMAATKQ
                     IPSSWVQMGSNKSTKRYYSDEVSVLARSMAEAREKHKIVENDLKNRICKKFDSLYKEV
                     WKPTVTMISNIDCILALTRTSESLGYPSCRPKFVDEVDENTGNKLNGFMKFKSLRHPC
                     FNLGSTTVKEFIPNDIELGNDVSRVTLLTGANAAGKSTVLRMSCIAVIMAQIGCYVPC
                     GSAELSPVDRIMTRLGANDNIMQGKSTFFVELSETKKMLDLATNRSLLVLDELGRGGS
                     SNDGFAIAECVLYHLATHIQSMSFFATHYAALGLNFKGHPDVRPMKMNILVDEQTRNI
                     TFLYQLVNGESGKSFGMHVASMCGISKTIVDEAQIAAENHEHTSEIIKKQNLALKGLN
                     KERVDMPLGLQSDFIRLTKGDGLTNSKLGTGENVTIYDNNIKANVLKTLFSLIESI"
     gene            <785228..>786877
                     /gene="TPHA0B03380"
                     /locus_tag="TPHA_0B03380"
                     /db_xref="GeneID:11535049"
     mRNA            <785228..>786877
                     /gene="TPHA0B03380"
                     /locus_tag="TPHA_0B03380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684395.1"
                     /db_xref="GeneID:11535049"
     CDS             785228..786877
                     /gene="TPHA0B03380"
                     /locus_tag="TPHA_0B03380"
                     /inference="similar to DNA sequence:INSDC:YER168C"
                     /note="similar to Saccharomyces cerevisiae CCA1 (YER168C);
                     ancestral locus Anc_8.233"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684443.1"
                     /db_xref="GeneID:11535049"
                     /db_xref="GOA:G8BPS8"
                     /db_xref="InterPro:IPR002646"
                     /db_xref="UniProtKB/TrEMBL:G8BPS8"
                     /translation="MYSYFKLLNKSIIQNKLQTIICYRTMSTSQKRLPAIQLTPLESK
                     ICTLLNEFTSDYNASNNEAEALELRITGGWVRDKLLGSQSNDLDIAVNIMSGESFALK
                     LNDYLTENFRKYNVEPHSIHKIDKNPEKSKHLETATTKLFGVEVDFVNLRSEEYTDDS
                     RIPTVEFGTPKQDALRRDATLNALFYNIGKNEIEDLTNSGLQDLKDRTLRTPLPPRKT
                     FLDDPLRILRLIRFASRYNFKLDPETLETMKDSDINLAFYVKISRERIGVEMEKIIDG
                     ETPLIGINLIQYTHIDNVIFHWHNDNTIVDFNKTNNTKDFNLISEIYDNSVLNAHIKD
                     VVKVLNNKAKLENDIPILYSLIKKSPAFKRIFLLGFILLPFQNLKIIWNVKKKVNNKI
                     PVTESIVKDGLKFNKNEASLIALIVDSIEHYNEIVTKFNNDRNSLSRSEIGLFLREFK
                     GNWQVVHFVTLLNQLASKNESCLNNYSNFYNYIIESDLKDCYDLRPLINGKRLLTLSG
                     MKPGPWMGKINDLAIVWQLEHPDGTEDQLLEHLKSLLPTVI"
     gene            complement(<787511..>792292)
                     /gene="TPHA0B03400"
                     /locus_tag="TPHA_0B03400"
                     /db_xref="GeneID:11535120"
     mRNA            complement(<787511..>792292)
                     /gene="TPHA0B03400"
                     /locus_tag="TPHA_0B03400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684396.1"
                     /db_xref="GeneID:11535120"
     CDS             complement(787511..792292)
                     /gene="TPHA0B03400"
                     /locus_tag="TPHA_0B03400"
                     /inference="similar to DNA sequence:INSDC:YDR093W,YER166W"
                     /note="similar to Saccharomyces cerevisiae DNF2 (YDR093W)
                     and DNF1 (YER166W); ancestral locus Anc_8.231"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684444.1"
                     /db_xref="GeneID:11535120"
                     /db_xref="GOA:G8BPS9"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="InterPro:IPR026871"
                     /db_xref="UniProtKB/TrEMBL:G8BPS9"
                     /translation="MPSGNPFEDQIDNNNNPFETNMENSNGSESHNDTNPKVQFLNTD
                     EFKDVAFDNDNENSLSYDDQNDAHSFEATPHLNKKDNKGAFEPFEDELETHTSLKNDL
                     EDEAEDNELNHNGNRMKRLRWGTHRNKKGRPNVGRAKTLKWAKKNFQNPFEEFIGMED
                     SLDDAAEKNRADEHRTVYFNMDMPADTLDEDGHPIVDYVRNKIRTTKYTPITFFPKNI
                     LFQFQNFANVYFLVLIILGAFQIFGVTNPGFASVPLIVIVCITAFKDAIEDSRRTVLD
                     LEVNNTRTYILSGVPNNNVSVDNISLWRKFKKANSRLLFKFIDYCKESFTEEGKKKKA
                     QRQRNKLHVQRTREASGNPRNSLDSMESYRGSAEYGRPSLDYDVDEPYDMYANNGTVI
                     DKSLPPREDCKFSKDYWKNVNVGDIVRIHNDDEIPADIILLSTSDHDGGCYVETKNLD
                     GETNLKVRNALKCSIPVRSSRDIGRSKFWIESEGPHANLYTYQGNLKYVDPATGDMSN
                     EPININNLLLRGCTLRNTKWAMGIVIFTGNDTKIMLNAGVTPTKKSRIARELNFSVVI
                     NFLLLFVLCFVSGIINGVYYNKSGTSRNYFEYGTIGGSPATNGFVSFWVAVILYQSLV
                     PISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGT
                     LTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGINVEEEGRREKAEIAKDKDTMIAD
                     LKSISNNSQFYPDEMTFVSKEFVKDLKGENGDYQKKCDEHFMLALSLCHSVLVEPHKN
                     DPDRLDLKAQSPDEAALVGTARDLGFSFVGKTKTGLIVEIQGVQKEFQVLNILEFNSS
                     RKRMSCIIKIPGPTPESEPSALLICKGADSIIYSRLSKDNNQNDETLLEKTALHLEQY
                     ATEGLRTLCIAQREISWSEYEKWSKQYDVAASSLNNREEELERISDQIERDLVLLGGT
                     AIEDRLQDGVPDSIALLADAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVIKSQG
                     EDVSKYGEDPFEIVNSLLSKYLREHFNMSGNELELAEAKLQHDVPHGNFGVVIDGDAL
                     KLALSGEDIRRKFLLLCKNCKAVLCCRVSPSQKAAVTKLVKNTLDVMTLAIGDGSNDV
                     AMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYLTRLVLVHGRWSYKRLAEMIPSFFY
                     KNVIFTLALFFYGIYNNFDGSYLFEYTYLSFYNLAFTSLPVIFMGILDQDVNDTISLL
                     VPELYKVGILRLEWNQRKFIWYMVDGLYQSIICFFFPYLIYHKTMYVSNNGLGLEHRY
                     YVGTMVATIAVIACNLYILIHQYRWDWFTGFFIGLSIIVLYGWTGIWTSSLISNEYFK
                     AASRIYGVPVFWGITFIGVMFCLLPRFTYDVFLKLFYPSDVDIIREMWARGDFNQYPQ
                     GYDPTDPNRPNITKNSLVSNEKKIQLNVADDEDPFSDSAMYFGGNNSNRSLATEEIPM
                     SFIDRPDGTPMLIRKDQPNNWTSPKENQDLLFSPNINSDEERVPRRSMGARTSLDQTR
                     EQMLTSNQLDTRFSVDRARVSLELPGVTHAEDLMKRQSRET"
     gene            complement(<793271..>793729)
                     /gene="TPHA0B03410"
                     /locus_tag="TPHA_0B03410"
                     /db_xref="GeneID:11534802"
     mRNA            complement(<793271..>793729)
                     /gene="TPHA0B03410"
                     /locus_tag="TPHA_0B03410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684397.1"
                     /db_xref="GeneID:11534802"
     CDS             complement(793271..793729)
                     /gene="TPHA0B03410"
                     /locus_tag="TPHA_0B03410"
                     /inference="similar to DNA sequence:INSDC:YDR092W"
                     /note="similar to Saccharomyces cerevisiae UBC13
                     (YDR092W); ancestral locus Anc_8.230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684445.1"
                     /db_xref="GeneID:11534802"
                     /db_xref="GOA:G8BPT0"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:G8BPT0"
                     /translation="MASLPKRIIKETERLVSDPVPGITAEPHDDNLRYFSVTIEGPEG
                     SPYEHGIFDLELFLPDDYPMESPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIR
                     TVLLSIQALLASPNPNDPLANDVAEDWIKNETGAIATAKEWTQKYAQAKE"
     gene            complement(<794369..>796108)
                     /gene="TPHA0B03420"
                     /locus_tag="TPHA_0B03420"
                     /db_xref="GeneID:11535180"
     mRNA            complement(<794369..>796108)
                     /gene="TPHA0B03420"
                     /locus_tag="TPHA_0B03420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684398.1"
                     /db_xref="GeneID:11535180"
     CDS             complement(794369..796108)
                     /gene="TPHA0B03420"
                     /locus_tag="TPHA_0B03420"
                     /inference="similar to DNA sequence:INSDC:YER165W"
                     /note="similar to Saccharomyces cerevisiae PAB1 (YER165W);
                     ancestral locus Anc_8.229"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684446.1"
                     /db_xref="GeneID:11535180"
                     /db_xref="GOA:G8BPT1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR002004"
                     /db_xref="InterPro:IPR006515"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BPT1"
                     /translation="MSDIADKTVEQLEKLNINETEGAPAASETEGTPAASETEANNSN
                     VDTTSASLYVGELDPSVSEALLYDIFSPIGPVTSIRVCRDAITKTSLGYAYVNFNDHE
                     SGRTAIEKLNYSPIKGKPCRIMWSQRDPALRKKGAGNIFIKNLHPDIDNKALHDTFSV
                     FGNILSCKIATDETGKSKGFGFVHFEEDNAAVEAVDAINGMMLNGREVYVAQHVSKKD
                     RESKLEEVKANFTNVYVKNVDVDTPEDEFTALFSKYGPITSIAMEKDSEGKFRGFGFI
                     NFENHDDAAKAVEELNDLEFKGQKLYVGRAQKKYERLQELKKQYEASRLEKLAKYQGV
                     NLFVKNLDDSIDDEKLEAEFAPFGSITSAKVMRNEEGKSKNFGFVCFSTPEEATKAIT
                     EKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQLRYQQATAAAAAAAAGMPGQFM
                     QPMFYGVMPPRGVPFNGPNSPMGAVPRQQFRNGPVYGVPPQGAPQGNFPGNDQLYQQK
                     QRQALGEELYKRVSSKTSDEEAAGKITGMILDLPPQEVMPLLENDELFEQHFNEASAA
                     YESFKQEQQEQQQ"
     gene            complement(<797463..>802016)
                     /gene="TPHA0B03430"
                     /locus_tag="TPHA_0B03430"
                     /db_xref="GeneID:11534958"
     mRNA            complement(<797463..>802016)
                     /gene="TPHA0B03430"
                     /locus_tag="TPHA_0B03430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684399.1"
                     /db_xref="GeneID:11534958"
     CDS             complement(797463..802016)
                     /gene="TPHA0B03430"
                     /locus_tag="TPHA_0B03430"
                     /inference="similar to DNA sequence:INSDC:YER164W"
                     /note="similar to Saccharomyces cerevisiae CHD1 (YER164W);
                     ancestral locus Anc_8.228"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684447.1"
                     /db_xref="GeneID:11534958"
                     /db_xref="GOA:G8BPT2"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016197"
                     /db_xref="InterPro:IPR023779"
                     /db_xref="InterPro:IPR023780"
                     /db_xref="InterPro:IPR025260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPT2"
                     /translation="MVKGISEEVLENPGLYGLRRSNRATTGTSVNYQLESDEDDDDEI
                     VNTRSKRRKNNYSSDADEVDDENGFNDDDESDLDDLDDFIDDDDYDVGSKKKSKTINE
                     RNKSSSKSSNRSRGKSKSKPKKEEDDVNLPTRFSSRNSKTVNYNVDYTDDDLLESENE
                     RNNNYDGFDSENEAFSSDEYEYSNTPQVEDVHSIDIIITHRINPIFTEEKKLEILKTV
                     PDLNQCKTNYEFLVKWSDKSYLHNTWESYDSLGPIKGIKRLDNYCKQFVIQDQQIRLD
                     PYVTKEDLEIMDMDLERRLDEFKEYEIPERIIDSDRVVIDEDENKTQLQYLVKWKRLN
                     YDEATWEDSNDIVKLAPQQVRNFQSRSTSKILPQNSNIYSKDRPQFEKLDEQPSFIKN
                     GELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVV
                     VPLSTIPAWQETFEKWAPDLNCIYYMGNQKSRDLIREFEFYTNPNAKTKKHIKFNVLL
                     TTYEYILKDRTELGNIKWQFLAVDEAHRLKNAESSLYESLNSFKVTNRLLITGTPLQN
                     NIKELAALVDFLMPNRFQIDQEIDFENQDSEQEEYIRTLHKRLQPFILRRLKKDVEKS
                     LPSKTERILRVELSDVQTEYYKNILTKNYSALTAGTKGGHFSLLNIMSELKKASNHPY
                     LFDYAEDRVLQKFGDGNKSRENILRGLIMSSGKMVLVDQLLTRLKKDGHRVLIFSQMV
                     RMLDILGDYLSIKGINFQRLDGTIPSAQRRIAIDHFNEPGSTDDIFLLSTRAGGLGIN
                     LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEILERARKKM
                     ILEYAIISLGVTDGTNLSSKSKSKDPTSSDLAEILKFGAGNMFAAKDNQRKLEDLNLD
                     DVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPEEELKKLKDEEQR
                     RKDEEYVQEQLQMMNRRKNAIQKIKNSVNGDGTSPDSDSDDGNRSSSRKRAKCNNMNS
                     IGEREIRALYKAILKHGDLTPQLGGLIAAGSLPMKSIEKYEEVYNDMMEEAQTAVEKN
                     EQERNEIFEKLEKDAHDYRLKLKTEGIKIEDQPKVNPITKLAAKKREKKAVLFEFYGV
                     KALNAESLINRSNDLKFLYDYINKRFNSDSLKFNLGARVPKAVQNWNCNWSRVDDEKL
                     LVGVFKYGYGSWSKIRDDPFLGLGDKIFLNDSIDSKKSVKKEKEANGVKPEEETTSTE
                     AEKKGKGITGSSKKVPGTIHLGRRVDYLINFMKDENNDTTGTSSDKSSNNGFKKRVRK
                     PATHSTSGTEKSPSLPTSMSTNTSATTPSAATTTTNNSNNSEHPSKRHKPLPKGPGGS
                     SPSSHGNDHPKPLPTGPAALMHKTKTASPDPAITNHQHEIEYPDMDEEECRTTMTPMR
                     KSLMRLRKGGKGLDRKEWANILKTELISIGKFIDMHKTDSKKTVPTTFRKHLWSYSAM
                     FWPIAVKSSKLIAMYDKISNVQK"
     gene            <803436..>804293
                     /gene="TPHA0B03440"
                     /locus_tag="TPHA_0B03440"
                     /db_xref="GeneID:11534814"
     mRNA            <803436..>804293
                     /gene="TPHA0B03440"
                     /locus_tag="TPHA_0B03440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684400.1"
                     /db_xref="GeneID:11534814"
     CDS             803436..804293
                     /gene="TPHA0B03440"
                     /locus_tag="TPHA_0B03440"
                     /inference="similar to DNA sequence:INSDC:YER163C"
                     /note="similar to Saccharomyces cerevisiae YER163C;
                     ancestral locus Anc_8.226"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684448.1"
                     /db_xref="GeneID:11534814"
                     /db_xref="InterPro:IPR006840"
                     /db_xref="InterPro:IPR013024"
                     /db_xref="UniProtKB/TrEMBL:G8BPT3"
                     /translation="MTNKVDSVADKGVWILGYGSLIYKPPPYFKHRLPVTIKGFVRRF
                     WQSSVDHRGTHEKPGRVATLINYDEIKLDKVLLDDFEKYNTHDNLDTLAVVYYIPEEH
                     VSKVTQYLDVREQNGYQRYNLNVELEITDDYIMETYVDDEETLQSLLGLYNGLKYNEI
                     GDKKLIETSVYIGTLDNFAFVGPEIIKDTAKIIAHSVGPSGPNYEYLKLLYESLIELQ
                     TVFKLSNAKSSSSSSASSNSNSTSDMAIAALKSKIDDSLLAEKVIEELVIEDYLHSLL
                     EEVELLRIS"
     gene            <804735..>807314
                     /gene="TPHA0B03450"
                     /locus_tag="TPHA_0B03450"
                     /db_xref="GeneID:11534866"
     mRNA            <804735..>807314
                     /gene="TPHA0B03450"
                     /locus_tag="TPHA_0B03450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684401.1"
                     /db_xref="GeneID:11534866"
     CDS             804735..807314
                     /gene="TPHA0B03450"
                     /locus_tag="TPHA_0B03450"
                     /inference="similar to DNA sequence:INSDC:YER162C"
                     /note="similar to Saccharomyces cerevisiae RAD4 (YER162C);
                     ancestral locus Anc_8.225"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684449.1"
                     /db_xref="GeneID:11534866"
                     /db_xref="GOA:G8BPT4"
                     /db_xref="InterPro:IPR004583"
                     /db_xref="InterPro:IPR018325"
                     /db_xref="InterPro:IPR018326"
                     /db_xref="InterPro:IPR018327"
                     /db_xref="InterPro:IPR018328"
                     /db_xref="UniProtKB/TrEMBL:G8BPT4"
                     /translation="MNSSDKNISKEQFHLIRKILQEKKEAGVQTNRPLKRKKRRLRSE
                     IPNVETSTEPSIVINLEEEAPSATNFKNEPEVIDLENEEEQRININSDAKRKRCIAVK
                     YKAGNTDKVPKSGDDYLNEFQEVGKENSETEHEDDEEEGFESEDFEDVPMVDNDVDDS
                     RIQDVSVTFDSNNTQNSSKKKIVRNACSNVERIRRKEDHMIYLVMFSLAGFIRNQWIN
                     NSKLHKKLSKMISDEIFALLHPENDKELIIRSERKLLDGLKKCMEVYEKKWKILNAYD
                     STAFYMRFWNELPYESTQQLINKRNRLNTHNTLEEKSFIKQVNKGIGDRDIYVQGFVA
                     LLRSCQINARLVMSCQPPDFSNLKEKDNDTNPYILKDEVIKYPIFWCEVWNKFSKKWL
                     SIDPINLKIIESVKANSKLEPKGVIQTKRNIMRYVLAFDRKLGCKDVTRRYIQWYNCK
                     SRKKRINKDKEGQEWYNKLISALQKRKRMKIDDFEDEYFKERDINEGFPDTISELKNH
                     PYYVLESDLRQNEILKPGSKECGYLRKNNKSKQTLRVYRRDDVLVLRSAKDWYMKGRI
                     LKAGCRALKRVKKRINSSNFDDDDDNIERLYPYEETELYIPPLAKADGEIKKNAYGNI
                     EIFTSSMIPKNCVLIESPVAIKACKAIHIEFAPSVTGFKFEKGNKAKPILSGVVVANW
                     FREAVECAIDSIEYSIVEEKRKERELAALKEWNSLFLKLRISSNLNSAYGKVKDENKK
                     IRAISDENNSESDEDFSMGGFLPARKNDHTGYLNEGSQSDAQSDDDFPPQGYLPQRVH
                     TKYNEEDDYVDEEEENYYEGEENDEMIANRNKLTASPSATEQMDEEFDDFMSEMNTEY
                     TGI"
     gene            <807704..>808729
                     /gene="TPHA0B03460"
                     /locus_tag="TPHA_0B03460"
                     /db_xref="GeneID:11534794"
     mRNA            <807704..>808729
                     /gene="TPHA0B03460"
                     /locus_tag="TPHA_0B03460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684402.1"
                     /db_xref="GeneID:11534794"
     CDS             807704..808729
                     /gene="TPHA0B03460"
                     /locus_tag="TPHA_0B03460"
                     /inference="similar to DNA sequence:INSDC:YER161C"
                     /note="similar to Saccharomyces cerevisiae SPT2 (YER161C);
                     ancestral locus Anc_8.224"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684450.1"
                     /db_xref="GeneID:11534794"
                     /db_xref="InterPro:IPR013256"
                     /db_xref="UniProtKB/TrEMBL:G8BPT5"
                     /translation="MSFLSKLSALKKKTENGTVDRKSITPTELPPSEVSLLPVKYSRS
                     EDPAVKRLKELRRKENLKNNITKNKAASRSATLTRQRSSTTSKIDNSTETTFKRKPGQ
                     NTKAFSNQGQLKKKPTALKKISFEDLMKQAESNNVPNSNGDQSLKNVNNKRPLLTKPG
                     FKSRKVTKPNMKNVRRSEVSVTHRAENISKKDNGPVMVKLPTMGIAKPNAKLIQKMKH
                     KNSKGKGFGDRYGKSSQDHYDSEEDSDLDDFIDDDEDNDGYGDLEAAGDPGYNRDDIW
                     AIFNKGRPRPSHSYYEDDDGDMEANELEIMEEEEEARRMARLEDKREEAWLKKHEEAK
                     RLQKLGR"
     gene            complement(<808883..>811498)
                     /gene="TPHA0B03470"
                     /locus_tag="TPHA_0B03470"
                     /db_xref="GeneID:11535163"
     mRNA            complement(<808883..>811498)
                     /gene="TPHA0B03470"
                     /locus_tag="TPHA_0B03470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684403.1"
                     /db_xref="GeneID:11535163"
     CDS             complement(808883..811498)
                     /gene="TPHA0B03470"
                     /locus_tag="TPHA_0B03470"
                     /inference="similar to DNA sequence:INSDC:YDR089W"
                     /note="similar to Saccharomyces cerevisiae YDR089W;
                     ancestral locus Anc_8.223"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684451.1"
                     /db_xref="GeneID:11535163"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="UniProtKB/TrEMBL:G8BPT6"
                     /translation="MKFASLILDKSVPEWKYNNIDYTKLKIAIKKATTPNGNENHYLD
                     NLSKLFKEQIKNVNIFTSLKIKELSNRIVLLESSILNCKRRNSSSLSSKKRAFQLINL
                     HLNDCKSELQKLSRYIIVQRIAIRKLFKKIIKHSQHDVLQTKAYLETIKCSPEFKYGY
                     EGTSFITLDLDSYLLEISLIQDVLFEAFSEYKKEKANKRSKKNSNLIHENVHLKSLDF
                     DTIFLGRSTKVQSFLISFENIEEFKFLILKSGFNLVDDNIAETSKVVIKNSASLSPKN
                     SARSVRSFQDLTTPTKNSIAPLGQQLQPLKTIVSTSPQESPFGNSNPQSSPTNTISNK
                     NSRASSFTVDARSSQSHEEYFFLKAEKNEYTFLTSKSSNQYPDILLKSGSENREDSNI
                     LLCSVGGLRGHIVTNTISQAYVNLLKHRDNTTTVNNIDFDGLDSISKMAVKWITSHKL
                     GLKEPGYSFKRTRFLKYTKNAIYYLSIDQNFVIDNEEILHNFVEIRKVPHIENNENNT
                     SSSLVSDLTRVAHINNDIVIGKICKSMITNKVQAFPIDYEDTIWRIIHYLSNKRNKCS
                     ELFTFLLKQIYDVEENSALNCEEFFEVGKQLISEMVPRETQKEEVPALISKASNNTEI
                     SNPRSRQRRDTQRQNVSTMEPERYWNEFDDGEDFENNTFYVDEEDNPGTGNFQDNNDQ
                     GFIRFNRSLILNMYNLFQNIRNKLGIQDDLTPEPLLQNLRRTSLYTEGSSLLHSNVST
                     SASQNDFNQLYEFNKLEIEDSTSVYEYRHDQVVTLFYLSALAVSATTSGITFGIILAL
                     FTGHADEASLEVEDILVIIIIISLLISMLLNCASILILFSRYKLAPMWHYAMSFSMFI
                     LVTFIVCYGVIEILM"
     gene            <812798..>813661
                     /gene="TPHA0B03480"
                     /locus_tag="TPHA_0B03480"
                     /db_xref="GeneID:11534868"
     mRNA            <812798..>813661
                     /gene="TPHA0B03480"
                     /locus_tag="TPHA_0B03480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684404.1"
                     /db_xref="GeneID:11534868"
     CDS             812798..813661
                     /gene="TPHA0B03480"
                     /locus_tag="TPHA_0B03480"
                     /inference="similar to DNA sequence:INSDC:YDR087C"
                     /note="similar to Saccharomyces cerevisiae RRP1 (YDR087C);
                     ancestral locus Anc_8.221"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684452.1"
                     /db_xref="GeneID:11534868"
                     /db_xref="GOA:G8BPT7"
                     /db_xref="InterPro:IPR010301"
                     /db_xref="UniProtKB/TrEMBL:G8BPT7"
                     /translation="METTGFVKQLASNNRKVRVNALEKLTELLATVNFKKAKQLQFDK
                     LWKGLYFSMWFSDKPRPQQRLANELGALFLTYFKESDNSEKNTEKLCMNDAAFIKFSK
                     AFWRVILMEWLNIDKWRLDKYLLLVRRVLYNQLKYMQLRNWDELLVEKYLTKVLKKLP
                     LSGDRKVYTGVPIHITDIFLDEWERLMRNDDVPQEEIADEDFEEKEYDFITLVKETPL
                     PKFIDIFQKLTEDQHVSKVLKSRIKEDLLEDTRLLEWEIINDEDSDEEEEREDVVAEE
                     DNDDDTEWKGF"
     gene            <814081..>814308
                     /gene="TPHA0B03490"
                     /locus_tag="TPHA_0B03490"
                     /db_xref="GeneID:11534972"
     mRNA            <814081..>814308
                     /gene="TPHA0B03490"
                     /locus_tag="TPHA_0B03490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684405.1"
                     /db_xref="GeneID:11534972"
     CDS             814081..814308
                     /gene="TPHA0B03490"
                     /locus_tag="TPHA_0B03490"
                     /inference="similar to DNA sequence:INSDC:YDR086C"
                     /note="similar to Saccharomyces cerevisiae SSS1 (YDR086C);
                     ancestral locus Anc_8.220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684453.1"
                     /db_xref="GeneID:11534972"
                     /db_xref="GOA:G8BPT8"
                     /db_xref="InterPro:IPR001901"
                     /db_xref="InterPro:IPR008158"
                     /db_xref="InterPro:IPR022943"
                     /db_xref="InterPro:IPR023391"
                     /db_xref="UniProtKB/TrEMBL:G8BPT8"
                     /translation="MSKESKENANSPIEKLAGTPLEFVKEGTQFINKCKKPDTKEYTK
                     IIRAVGLGFVAVGVIGYAIKLIHIPIRYLIV"
     gene            <814931..>815374
                     /gene="TPHA0B03500"
                     /locus_tag="TPHA_0B03500"
                     /db_xref="GeneID:11535102"
     mRNA            <814931..>815374
                     /gene="TPHA0B03500"
                     /locus_tag="TPHA_0B03500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684406.1"
                     /db_xref="GeneID:11535102"
     CDS             814931..815374
                     /gene="TPHA0B03500"
                     /locus_tag="TPHA_0B03500"
                     /inference="similar to DNA sequence:INSDC:YER159C"
                     /note="similar to Saccharomyces cerevisiae BUR6 (YER159C);
                     ancestral locus Anc_8.219"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684454.1"
                     /db_xref="GeneID:11535102"
                     /db_xref="GOA:G8BPT9"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G8BPT9"
                     /translation="MDNSQFINPFVKEESENETVKVEGEESEYGVEQKGFDNSEEKKF
                     DTEEFKELQVIFEQIKTHFPPAKIKKIMQTDDDIGKVSQATPVIAGRSLEFFLALLVK
                     KSYDIAKSKNLKRISGEIMKQTILTDEKFDFLRENVCGETAADNE"
     gene            <816477..>818174
                     /gene="TPHA0B03510"
                     /locus_tag="TPHA_0B03510"
                     /db_xref="GeneID:11534739"
     mRNA            <816477..>818174
                     /gene="TPHA0B03510"
                     /locus_tag="TPHA_0B03510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684407.1"
                     /db_xref="GeneID:11534739"
     CDS             816477..818174
                     /gene="TPHA0B03510"
                     /locus_tag="TPHA_0B03510"
                     /note="ancestral locus Anc_8.218"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684455.1"
                     /db_xref="GeneID:11534739"
                     /db_xref="GOA:G8BPU0"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="UniProtKB/TrEMBL:G8BPU0"
                     /translation="MGSLSFTAAHAIIWPTYGVLLVSATAVAYYYRNSKTFLNANGTQ
                     SAIPLAFNFVASGLGCGILSTYPQIANIDGLHGLLVYALAGGLPMFVFSFLGPLIRKK
                     TPHGFILSEWVFHRFGIAAGWYLSACTILTMYLFMVSELASLKYAVETLTGIKALPVV
                     IIECVVTSIYTTVGGFKISFLTDTLQVSIVFILLIIVSCAMGSYISIDKSKIEPSGLL
                     KANRLGWQLIYILTIAIFTNDLFLNGFWLRTFASRSDKDLLIGCSIAAFLLTAIVTVV
                     GVTGFIAVWAGFVEVADEENSGAAFFILLAQLPSWVMGFTLVFVLILSTCTLDSLQSA
                     LVSTISNDVFRNKIPILYTRIIVVVIMVPVVVVGLIAEDVLSIYLIVDLLSSSVVPVL
                     VLGLWSKFDSFWTAWEVIGGGLAGIFGVWVYGTIYYHSAREGGKLLLIWNGLYIQDWG
                     AFGAFVVAPVASMVISFIILAIRLYSIKLYQADTTVGHRFRDVCDSLGKITGITWLYR
                     TTKYWDNKLIKELDYSEAISDSSEGIVEIQETTSLADSKDSILKQRSSITVTPTEWD"
     gene            <819859..>821400
                     /gene="TPHA0B03520"
                     /locus_tag="TPHA_0B03520"
                     /db_xref="GeneID:11535172"
     mRNA            <819859..>821400
                     /gene="TPHA0B03520"
                     /locus_tag="TPHA_0B03520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684408.1"
                     /db_xref="GeneID:11535172"
     CDS             819859..821400
                     /gene="TPHA0B03520"
                     /locus_tag="TPHA_0B03520"
                     /inference="similar to DNA sequence:INSDC:YDR085C,YER158C"
                     /note="similar to Saccharomyces cerevisiae AFR1 (YDR085C)
                     and YER158C; ancestral locus Anc_8.217"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684456.1"
                     /db_xref="GeneID:11535172"
                     /db_xref="UniProtKB/TrEMBL:G8BPU1"
                     /translation="MGFGNGSMMNIPRSNSTSDLFDLSASFSPHFGHASCSYTRFEKP
                     TYDVYTGGRSMSLNNGIYKSSSYSNDSFRERRLKNHNANAYLLRRQQMQREFNFPNGE
                     HFTPRYIIHNQNRRNRNMPRSNSLQNIESPKNFFNQSNNNNNMRRMYTSSPLKHSVSS
                     SKLNLPAHSRNANEKNGHRPLKGSASTSNLGLDNINFDIDLNGSSMTKLDSGSKNKND
                     SKNKIDKGISNWKSDDKLKQFNNDKINIKNKKKTKIFSIFKKLFGDSKKKTLSKKAEF
                     VDEKKIDDILDQNINDNSIDSDLLHDVTFDHEKDQEQILLDIDLVFDNLILQSDNGML
                     TSGEHYDIISNENTNLSSVTDILPPRSVKRPYIHNKKSLKQFYDRAPGSEDGTERILN
                     RLTQEWHSIHFDDLDTTLLNSTSVSTIDSVASSTTTVETDDSKINSSMKKAFRFADYV
                     HVSDTWSAMEYNRSDLSFRNNQRLFLNQNRNNLLDNIKNELNSFKSIEMEVHEQSRQN
                     TQYFI"
     gene            complement(821523..821594)
                     /gene="TPHA0Btrna12E"
                     /locus_tag="TPHA_0Btrna12E"
                     /db_xref="GeneID:11534878"
     tRNA            complement(821523..821594)
                     /gene="TPHA0Btrna12E"
                     /locus_tag="TPHA_0Btrna12E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:11534878"
     gene            <823638..>826523
                     /gene="TPHA0B03530"
                     /locus_tag="TPHA_0B03530"
                     /db_xref="GeneID:11534764"
     mRNA            <823638..>826523
                     /gene="TPHA0B03530"
                     /locus_tag="TPHA_0B03530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684409.1"
                     /db_xref="GeneID:11534764"
     CDS             823638..826523
                     /gene="TPHA0B03530"
                     /locus_tag="TPHA_0B03530"
                     /inference="similar to DNA sequence:INSDC:YCR037C,YJL198W"
                     /note="similar to Saccharomyces cerevisiae PHO87 (YCR037C)
                     and PHO90 (YJL198W); ancestral locus Anc_1.136"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684457.1"
                     /db_xref="GeneID:11534764"
                     /db_xref="GOA:G8BPU2"
                     /db_xref="InterPro:IPR001898"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="UniProtKB/TrEMBL:G8BPU2"
                     /translation="MRFSHFLKYNAVPEWQNHYMDYNALKNLIYTLQTDELKQQDTTI
                     DDANEDGDQKSYFTRKLKSNFFKKGNGNSNSSRKSSSKSVNNIIEINNKTKNAGQHDD
                     GNDNDEAGKVGISALDNADFVQEETFELDDYKNLSSSNKNSKKSGNSLQKPTNLIRNA
                     SFKKVKGKFWEHSRRSSSASDSESKTLSNTYDTFVSNLSTEKFKVDDFYKRLEAKFYE
                     KYETLIKDFEKQGIYITTGDDFQNPDISDLNSEFTTGSLGKQQIPVSVVLSENLQNSN
                     NSTINNDMFSDEDFDEEDEDFESKDNTALLHYSQFNVKSQKKSLLKQSVINLYIDLSQ
                     LKSFIELNKMGFSKITKKADKVLHLNTREELIQSEEFFTDTYTFLSETINELNFKITQ
                     LITLLAKLMGNPFRMDEYKKELKQYLHDHIVWERSNTWKDMLGIDSYVNEEELAREAE
                     AKKKADREHLYLDCYSYPLPFQIHTKKPKIDIENLLIPKLFFTKKAFKIAFIFVVTAI
                     LLGIKTFNDPVEHRCMALVECVAFLWASVALPLWVTAMLVPLLTVLFRVLKNDDGTVM
                     TAVDASSTILASMWSSTIMILLAGFTLSAALARYEVAKVLASWLLAFAGEKPRNVLLM
                     AMAVVFFLSMWISNVASPVLTYSLMSPILDPLLADDPFAKSLVLGVALAANVGGLSSP
                     ISSPQNIISMEYLTPYNIGWGQFFAVALPVGIITLLLFWGLMCLTFDLSKTKIEKFVP
                     IKTAFTMKQYFVVAVTLATILLWCVESEIESAFGSSGQIAVLPIAIFFGSGLLGLQDL
                     QAFPWSIVILAMGGIALGKGVQSSGLLATIANALQRRIDHDSAEAVLCIFGILMLVVG
                     TFVSHTVSAIIIVPLVQQVGNKLSEAKAAPILVFGCTLLASGGMGLASSGFPNITAIS
                     KLDRNGDPYLSMLTFISRGVPASLIVFVVVITVGYGIMSSILKPVVS"
     gene            <826895..>829249
                     /gene="TPHA0B03540"
                     /locus_tag="TPHA_0B03540"
                     /db_xref="GeneID:11532803"
     mRNA            <826895..>829249
                     /gene="TPHA0B03540"
                     /locus_tag="TPHA_0B03540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684410.1"
                     /db_xref="GeneID:11532803"
     CDS             826895..829249
                     /gene="TPHA0B03540"
                     /locus_tag="TPHA_0B03540"
                     /inference="similar to DNA sequence:INSDC:YFR013W,YOL017W"
                     /note="similar to Saccharomyces cerevisiae IOC3 (YFR013W)
                     and ESC8 (YOL017W); ancestral locus Anc_1.373"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684458.1"
                     /db_xref="GeneID:11532803"
                     /db_xref="UniProtKB/TrEMBL:G8BPU3"
                     /translation="MASDGNSSIDVINDENIKEVKGTIKNNKVIKPQSNKKTKKSTTT
                     ANSQKRQRKISDFQNVKTVHKAIRTNAHLLPNKIKGRATDSKSQKNAKSRGKNSANDD
                     NDENDDDDSDSPNGKKDEKVDITMKNELFHFHNILQPDFEKLNLKDSVWSSNVALNSS
                     DFLTADKSLHNKMMKEIDNPNQTKEQDNYLSFLKNMKSVSYAGDIVKIMSFINKFYNV
                     FDPELLDISYQDFEIGLDLYPEATDNDGQEIKKYSDYIDTKIIIECEDKMNLIFLTTL
                     KLLLVNLKTDNQLDLHRPYASFANLKTKEVFTKLVRGMRQNALNWGLPKEWREFIDSD
                     KNILDKNDPDESDLKNNSSNDNLNDSLETDPTSEIINIPLFNMQLGKTGIFAIEPKDR
                     IILLKTLVNWCISYSTRIHNEIYRLSHIKESEFGLNTQHVSRLMLEGYDLTTAQFYKL
                     CKLVELRYENKLKRIKSRKPMTEEKQQEFDNKLKILKEIQKQVEKSPKEDQVSTNISF
                     YNEWLEIFAGDFQSNPLSDPFEDSNRLRSQEFFIGRLPQLGDFYLPILSTYYDPKGTI
                     PPYTGARELHNYFKKFSTNNQNSLSKFKNIEKIQVPQFKILFCNTSAIVQDSSKIEAN
                     TSIGSYWYEVCHDVKSLEIFIENISNSIENISKEIVKNKEKEDVSENCLFYAKLEIFR
                     DFLKNIHSVFDTIETRKVEYDDISSTSRSLRSSKRGRVNYYDEDKDSAGDNEKEDENY
                     ADEDNLEEQGDEDDEDDEGLQNSEVYVKESRSERMLRRNKNRRK"
     gene            complement(<829454..>831625)
                     /gene="TPHA0B03550"
                     /locus_tag="TPHA_0B03550"
                     /db_xref="GeneID:11535109"
     mRNA            complement(<829454..>831625)
                     /gene="TPHA0B03550"
                     /locus_tag="TPHA_0B03550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684411.1"
                     /db_xref="GeneID:11535109"
     CDS             complement(829454..831625)
                     /gene="TPHA0B03550"
                     /locus_tag="TPHA_0B03550"
                     /inference="similar to DNA sequence:INSDC:YFR015C,YLR258W"
                     /note="similar to Saccharomyces cerevisiae GSY1 (YFR015C)
                     and GSY2 (YLR258W); ancestral locus Anc_1.375"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684459.1"
                     /db_xref="GeneID:11535109"
                     /db_xref="GOA:G8BPU4"
                     /db_xref="InterPro:IPR008631"
                     /db_xref="UniProtKB/TrEMBL:G8BPU4"
                     /translation="MPRGIKNHLLFEIATEVANRVGGIYSVLKSKTPVTVQQYHDKYH
                     LIGPLNFDTYQNEVETIDIYDINNFISKDSSDSNNSDEDPDGLLAVRDTLISMKEKNV
                     NFVYGRWLIEGAPRVILFDLNSLQGYLNDWKSDIWNLVGIPTPESDLETNNAVLLGYA
                     VVWFLGELVTRDSTHAIIAHFHEWLAGIALPLCRKKRIDVVTIFTTHATILGRYLCAS
                     GETDFYNTLQDIDVDHEAGKFGIYHRYCIERAAAHTADVFTTVSQITAFEAEHLLKRK
                     PDGILPNGLNVTKFQAVHEFQNLHAVKKEKINDFVQGHFHGCYDFNLDDTLYFFIAGR
                     YEYKNKGADMYIEALARLNYRLKVSGSKKTVVAFIIMPAKTNSFTVEALRSQAVVKSL
                     ENTVNEVTKLISRRIFDHAMKYPHFGINNEIPTDLNELLHDSDKVLLKRRVLALRRPY
                     GQLPPVVTHNMCDDDADPILNKIRHVQLFNNQSDRVKVIFHPEFLNANNPILGLDYDE
                     FVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGAYMEDLIERDQAKDYGIY
                     IVDRRFKNPDESVEQLVDYMEEFVKKNRRQRINQRNRTERLSDILDWKRMGLEYIKAR
                     QLALYRAYPDVFKQYATANGEEDNINDTDMYSMAGDKKIKIKRSLSVPGSPTDFRLRS
                     GSITPSTVYMTPGDLGTLQDAVNADDYFVLSNDKEFDDDEA"
     gene            complement(<832814..>833134)
                     /gene="TPHA0B03560"
                     /locus_tag="TPHA_0B03560"
                     /db_xref="GeneID:11534865"
     mRNA            complement(<832814..>833134)
                     /gene="TPHA0B03560"
                     /locus_tag="TPHA_0B03560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684412.1"
                     /db_xref="GeneID:11534865"
     CDS             complement(832814..833134)
                     /gene="TPHA0B03560"
                     /locus_tag="TPHA_0B03560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684460.1"
                     /db_xref="GeneID:11534865"
                     /db_xref="GOA:G8BPU5"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR011899"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR014025"
                     /db_xref="UniProtKB/TrEMBL:G8BPU5"
                     /translation="MSAPTAQSVKELIAAKPIFVAAKSYCPYCQASKSTLFKELNVPA
                     DKATVLDLDQMQDGQAIQAILAELTQQNTVPNIFINGKHIGGNSDLQALKNNGELQKL
                     VAAL"
     gene            complement(834353..834425)
                     /gene="TPHA0Btrna12A"
                     /locus_tag="TPHA_0Btrna12A"
                     /db_xref="GeneID:11534872"
     tRNA            complement(834353..834425)
                     /gene="TPHA0Btrna12A"
                     /locus_tag="TPHA_0Btrna12A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:11534872"
     gene            complement(<834660..>835130)
                     /gene="TPHA0B03570"
                     /locus_tag="TPHA_0B03570"
                     /db_xref="GeneID:11534927"
     mRNA            complement(<834660..>835130)
                     /gene="TPHA0B03570"
                     /locus_tag="TPHA_0B03570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684413.1"
                     /db_xref="GeneID:11534927"
     CDS             complement(834660..835130)
                     /gene="TPHA0B03570"
                     /locus_tag="TPHA_0B03570"
                     /inference="similar to DNA sequence:INSDC:YLR170C"
                     /note="similar to Saccharomyces cerevisiae APS1 (YLR170C);
                     ancestral locus Anc_1.388"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684461.1"
                     /db_xref="GeneID:11534927"
                     /db_xref="GOA:G8BPU6"
                     /db_xref="InterPro:IPR000804"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="UniProtKB/TrEMBL:G8BPU6"
                     /translation="MANIKYMLLISRQGKLRLQKWYTAIAAKEKTKIVKALTSIILAR
                     KKKMCNIVEYGDHKVVYRRYASLYFICGISQNSDNELLTLEIVHRYVETMDTYFGNVC
                     ELDIIFNFEKAYNILDEMIMCDGSITETSKSNVLNNIKTMDILENNDNLDRVLS"
     gene            complement(<835791..>836690)
                     /gene="TPHA0B03580"
                     /locus_tag="TPHA_0B03580"
                     /db_xref="GeneID:11534797"
     mRNA            complement(<835791..>836690)
                     /gene="TPHA0B03580"
                     /locus_tag="TPHA_0B03580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684414.1"
                     /db_xref="GeneID:11534797"
     CDS             complement(835791..836690)
                     /gene="TPHA0B03580"
                     /locus_tag="TPHA_0B03580"
                     /inference="similar to DNA sequence:INSDC:YLR172C"
                     /note="similar to Saccharomyces cerevisiae DPH5 (YLR172C);
                     ancestral locus Anc_1.387"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684462.1"
                     /db_xref="GeneID:11534797"
                     /db_xref="GOA:G8BPU7"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR004551"
                     /db_xref="InterPro:IPR014776"
                     /db_xref="InterPro:IPR014777"
                     /db_xref="UniProtKB/TrEMBL:G8BPU7"
                     /translation="MLYLIGLGLSYKSDITVRGLEAVRKCSAVYLEHYTSILMAASKE
                     ELEEYYGSEVILADRELVETGSEIILRDAREKDVAFLVVGDPFGATTHTDLVLRAKRE
                     NIPVEIIHNASVMNAVGACGLQLYNFGQTISMVFFTDSWRPDSWYEKILENRKIGLHT
                     LVLLDIKVKEQSIENMARGRLIYEPPRYMSISQCCEQLLEIEEVKGTKAYTPDTPAVA
                     ISRLGSDRQTFKSGTIKELSEYDSGEPLHSLVLLGRQCHELELEYLLEFCDDREKFKN
                     DVIKDQEFFKPAPWVPPVEEDDD"
     gene            complement(<837088..>838488)
                     /gene="TPHA0B03590"
                     /locus_tag="TPHA_0B03590"
                     /db_xref="GeneID:11534985"
     mRNA            complement(<837088..>838488)
                     /gene="TPHA0B03590"
                     /locus_tag="TPHA_0B03590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684415.1"
                     /db_xref="GeneID:11534985"
     CDS             complement(837088..838488)
                     /gene="TPHA0B03590"
                     /locus_tag="TPHA_0B03590"
                     /note="ancestral locus Anc_1.385"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684463.1"
                     /db_xref="GeneID:11534985"
                     /db_xref="UniProtKB/TrEMBL:G8BPU8"
                     /translation="MFIDYSSLTRYKEINDIFLSQCTILMKFYDEKTIQSKLEFIIRE
                     FESLDLNVPDAVFFMDESQLEQFLYLTLCNNQMKQAYDVIIRCPTLYLVEPDFLSPIK
                     YKEYYIFQIELCKQVKDLRKEYRYLRIKIFENVKNLIISLVPNMSSDLDNFENLNTLQ
                     KILFKFHSEISSFPYEVPDVKFDIPNIRNENTLELINKYGNQIKRFNFYNFMFMTVPS
                     DLGNYNFSNNDIKLLKTKHKINITFQYKNKEEVKLFPYTFDNDDQYKDEKCENVSICK
                     PSSLFSTATEYSKSVNLKPNYNSLLSSDANISGGSALFGNIFESSDDPIIFTDDDLVV
                     KEISLQKNNEINILNLKTSLPSSTLKPTYNLVSSNNTSYNRSESLPYKRNYHCTSEKE
                     NEIIITPRNQTLNDVTLNSHNTNILRDKKNLQEQMVNCKIKSLDEISIKEFIKYKLTR
                     LKIGIVAKSEYVYDNN"
     gene            <839120..>840835
                     /gene="TPHA0B03600"
                     /locus_tag="TPHA_0B03600"
                     /db_xref="GeneID:11535104"
     mRNA            <839120..>840835
                     /gene="TPHA0B03600"
                     /locus_tag="TPHA_0B03600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684416.1"
                     /db_xref="GeneID:11535104"
     CDS             839120..840835
                     /gene="TPHA0B03600"
                     /locus_tag="TPHA_0B03600"
                     /inference="similar to DNA sequence:INSDC:YLR253W"
                     /note="similar to Saccharomyces cerevisiae YLR253W;
                     ancestral locus Anc_1.383"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684464.1"
                     /db_xref="GeneID:11535104"
                     /db_xref="GOA:G8BPU9"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8BPU9"
                     /translation="MVFKLNNSLLFTAKRVINLNSKRLSSDATTRPATIKRLRLSKTQ
                     IAFGLATSVGIIEYNTNDTFHAFVRHVGLTTKRSGIVAQATVRCFYDYRKTLNNKYET
                     QEEYYNALDACHLRCALITLDALRQNGGIYIKLGQHISAMTYLLPPQWTDTMIPLQDH
                     CPKSTIEEIDNMFKHDLKMGIDEIFSEFNPEPIGVASLAQVHTATLNDTNDRVAVKCQ
                     HPSLKEFIPLDIMLTQLVFNLLDVFFPEYPLTWLGDELQTSIYVEINFEKEAKNAIDT
                     QNYFAKYKKQTALRIPNVISAHKRILIMEYITGRRLDDLQYLDENNISRAEVSSCLSH
                     IFNNMIFTPNVGIHCDPHGGNLAIRACKYGSSSNPHNFEIILYDHGLYRHPTTEMRRD
                     YAKFWLALFDQDQDKMKFYAKRFAHINDKQFPLFAAAITGRSIDTALNYDISSSRSKN
                     EIDVMSKGILKGNFLTNLMSILATIPRIVLLILKTNDLTRHLDECLQNPLGPERTFLI
                     MTQYCSKTVYDEDCEEINKLNIRWSWSWTLSHILAWLNYEKRVKKLVLYDIALWWKQN
                     IMTML"
     gene            complement(<841136..>841453)
                     /gene="TPHA0B03610"
                     /locus_tag="TPHA_0B03610"
                     /db_xref="GeneID:11534839"
     mRNA            complement(<841136..>841453)
                     /gene="TPHA0B03610"
                     /locus_tag="TPHA_0B03610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684417.1"
                     /db_xref="GeneID:11534839"
     CDS             complement(841136..841453)
                     /gene="TPHA0B03610"
                     /locus_tag="TPHA_0B03610"
                     /inference="similar to DNA sequence:INSDC:YLR254C"
                     /note="similar to Saccharomyces cerevisiae NDL1 (YLR254C);
                     ancestral locus Anc_1.382"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684465.1"
                     /db_xref="GeneID:11534839"
                     /db_xref="UniProtKB/TrEMBL:G8BPV0"
                     /translation="MSLIEELKTELEVLKLERDELNSVSADYEKQMEEVIENLKLEIK
                     EYKENIITLEIKNDELESENIINTSVIKNLRSQNDDLIEKNVILGDEILSLKETIYNL
                     KQR"
     gene            complement(<841685..>842716)
                     /gene="TPHA0B03620"
                     /locus_tag="TPHA_0B03620"
                     /db_xref="GeneID:11535170"
     mRNA            complement(<841685..>842716)
                     /gene="TPHA0B03620"
                     /locus_tag="TPHA_0B03620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684418.1"
                     /db_xref="GeneID:11535170"
     CDS             complement(841685..842716)
                     /gene="TPHA0B03620"
                     /locus_tag="TPHA_0B03620"
                     /inference="similar to DNA sequence:INSDC:YGL159W"
                     /note="similar to Saccharomyces cerevisiae YGL159W;
                     ancestral locus Anc_1.381"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684466.1"
                     /db_xref="GeneID:11535170"
                     /db_xref="InterPro:IPR003462"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023401"
                     /db_xref="UniProtKB/TrEMBL:G8BPV1"
                     /translation="MRIVTDKQIRDFFLQLDSNSIQGYIIELHKSLQYFSNDNSIIPN
                     RIVKSIPQSDVTHIYMPVISDLYSGLKNLVYNPSNGNGFVGTILIDDSMDGSLRGVLD
                     AKEITGIRTAMASCIPLLNHLQDYINDDAQTLNVTVFGTGLQSFWHIFILIKLYEQSK
                     LLKCINLTILFRNQELQLDSLLSNLENSTITLNIMQKNWNDNISDIITSSNIIFGCVP
                     STTPHLLYEDIMKNQKNGQCTYISLIGSYKPEMHECDSDLIDKFTSQNVKIIVDSIGH
                     TLIEAGELIQSHVKGSQLLEIGQLSKSNSPVLEIHQKKVTICKIVGLAIMDIAVANKY
                     LNDTYHMKS"
     gene            <844571..>848860
                     /gene="TPHA0B03630"
                     /locus_tag="TPHA_0B03630"
                     /db_xref="GeneID:11534881"
     mRNA            <844571..>848860
                     /gene="TPHA0B03630"
                     /locus_tag="TPHA_0B03630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684419.1"
                     /db_xref="GeneID:11534881"
     CDS             844571..848860
                     /gene="TPHA0B03630"
                     /locus_tag="TPHA_0B03630"
                     /inference="similar to DNA sequence:INSDC:YLR256W"
                     /note="similar to Saccharomyces cerevisiae HAP1 (YLR256W);
                     ancestral locus Anc_1.380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684467.1"
                     /db_xref="GeneID:11534881"
                     /db_xref="GOA:G8BPV2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G8BPV2"
                     /translation="MSYSSPNNNEEVRPAAIQDADKSSNISESAKNKIKRKRNRIPLS
                     CTICRKRKVKCDKTHPHCNQCVKTGVQHLCHYMEQSWAEEVEKEISKDAELKQLRDRV
                     KTLEETLAKVHLSSSYISPSTNTNTPDSITLSHNNSHLAILEENATNITNNDDDAIKN
                     EDSPFSKYENDELDLTVQFDMLHLKNKGTVHLGATHWLAIMKGDPYLKLLWSQIFTMR
                     ERLGEWYNKKSLHQQKKKKGSLMKKSKSKKGKCPVDHKQIMSQSSKHVDMNNDINNIN
                     NGKIISTRPIRAPISPSDTTSNSASYLSNSQNRSTLMLPPALPNAEGSNLTHSQFSQL
                     ENNSQKCPVDHSKFKPIIQQRPNSPINSNKPGSPLPPLIQLPQTNPPFSDISYTMSNP
                     QVMLRVCELLPPKSIISLYMDKFFKHIYAVIPIVDEQDFRKNINRILSLNTTTNFTPS
                     TMSKENVSSLNITKISDYCNLGILLILMRLTWLSLPSNALKIDIGSKYNSFGIQAPSN
                     ISSIRIKEENLLFKYEPSIEALKLVRKNLIKFDELSSFSNNNVSLFTVQFAIFYKLYL
                     QSGSDEAPGNNNSNSVNSIAGQDSETHQVLLSSITQMAFSCGLHRDPDNFPQLNSVAD
                     NSSGQSSNNNTTLDTLVQNSNHDPKGPTNSNASLTNDKNSTKTEQYNTTERFKHTWRK
                     TWYYIISLDVQQSLSLGTPRLLRNIRDISDTKLPSASKIDYVPDIKELIIVKNFTLFF
                     QIDLVIIAVLNHILNVSVAKRAKKSELDGLISSLKDLTHNKKSINEVLSTLIKKGLLY
                     TSEGSVDANIDESYGLPSLETIIYQQQAKSKNNSSTSKSEQEKKIELPHESTTKAMLF
                     FKHLTLRILLYLLNYILFTHYEPMGSENSTTRLLAKGYAQEALNYAMDGYKNSVYFFN
                     SIKNSNTTESMFNYMEVMLTPYCVDVGNRSLQFMICLILRIKSSPSSSLGENPIINGK
                     ISTSDSTSSYTSSDNDEDAGAKFSRKRKLMQDTNDDISRHLDLESCEDLAGTLYSRMT
                     LFYKMTKQISVKYTYVLKIFKSIQFFISLLQSPVSKNLISDNNAILMPGWQHPTIPNL
                     PSKYKNSTQFIMNADASQVQRCPIYQDTISAISESKNNFNNDSNVMPGMMDNHSIQLP
                     SIRSYTPITYNKSDVRNIEAINNSDLLKKRRTISNEPNSRISSPVLETSQQGTSSRNS
                     PLAFQGGAFNEPLPSIEGLKRSVPSVTSMRNMGNTSPMNSIGSPNAMPYMTHVQPLSN
                     QQPIHNNSIIGVNNTMNMNMSSGAMSPSMNIGMNLNVGLNMGMNLNMNMGNLNNIDPL
                     SNQHNVAIKLEADNTIPSNNEDLSTLVSPQSEASSGSFVIPDFEEFLMQDSSFNNGLM
                     IDASNLVEAVGFNPLESQDLVRMDSEIIPIDKLGMPGFQNMNGGGNFPVWN"
     gene            complement(<849621..>851036)
                     /gene="TPHA0B03635"
                     /locus_tag="TPHA_0B03635"
                     /db_xref="GeneID:11535189"
     mRNA            complement(<849621..>851036)
                     /gene="TPHA0B03635"
                     /locus_tag="TPHA_0B03635"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684420.1"
                     /db_xref="GeneID:11535189"
     CDS             complement(849621..851036)
                     /gene="TPHA0B03635"
                     /locus_tag="TPHA_0B03635"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684468.1"
                     /db_xref="GeneID:11535189"
                     /db_xref="UniProtKB/TrEMBL:G8BPV3"
                     /translation="MDYTRATEVANDTNLDVGTNQHKLVSPHGGLTRMDNDHSSSQVV
                     KETLQSNIEIPNENTDVFIRAFKNRLSTLEGLYKKTMAKHDELLNSTEAGDYLSKITE
                     LEGEEKGLALTIEKLRTKIIDREGLLNNRTTAHTRKSLNYTELATDNDYQQSNELPVT
                     SYSKTKEGNQQINLINNGSLVFRTLNGKEVVINKNYLPLNIEFKLINIEDLPLWIKQF
                     VKFLNYYNLDNLNELPESTIIDPIEDQFIKDQLKEHIKCEDIYDFIFVDNSSLKIVNE
                     VKRIFIRKLNFVARQKLWKQVSITEKSNNLALQLNLLNKLVGIEEFINTDKMEIFNLI
                     INRINGQVLQRINAVPIDLSKITPTQYVGIIRNHAEDALEFHEQMKQFYSSERAEVKS
                     NSKNPENIRPIVKKVKRNPETLRPIEQKGKEKSSTNRSIHKELLYFKATITNNRDVIE
                     RKLFFSSIRKSATKSIEDESV"
     gene            complement(<851392..>854469)
                     /gene="TPHA0B03640"
                     /locus_tag="TPHA_0B03640"
                     /db_xref="GeneID:11534858"
     mRNA            complement(<851392..>854469)
                     /gene="TPHA0B03640"
                     /locus_tag="TPHA_0B03640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684421.1"
                     /db_xref="GeneID:11534858"
     CDS             complement(851392..854469)
                     /gene="TPHA0B03640"
                     /locus_tag="TPHA_0B03640"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684469.1"
                     /db_xref="GeneID:11534858"
                     /db_xref="GOA:G8BPV4"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013103"
                     /db_xref="UniProtKB/TrEMBL:G8BPV4"
                     /translation="MKQHDHIKDSMNKHYEQMQPGQSWSLDIRGPLGKNPAKVDNYLL
                     LMVDNVSRFLLVSTHTNKNKETISLQIKNNIQYIEKQYDRIVKELIVDRGSEFTNDSL
                     KTYVSEKGIKLMLTDTNDHASNARAERFIGIMNNDIRTLMHNSDLPWALWKYAALAAA
                     RIRNLFMTKKLNCSPMTTLSGKNEQIRFNSFLPFGAHAFVKNQTNNKLTNQGIPAITL
                     CKDPNSFGYLFYLPQTRKVISTMSYILANSEVNGDFIDPNKVLSEIVPDNDDTNEVTS
                     EDALEIEAEPSNADDITIIEGIENDTQYKIPPNIQEDTVYGLDTINIHDNQKVSDHTR
                     SSTADEEVKEPTLEQDTTNTSDNHSVHEAHMSTLPKDTATATSHIGILPDSVAESEPV
                     RNVSDQELLLINRFDNKNSDKFPSTEAMKQRRTKLFLKEFASITRRPLKSRKRELTTL
                     DLEEFEAAEEQKKKIKLRSVQAVNKIRTLYFKTAITNNTDVRERKLFSEAFEKELQNL
                     LKMQVFDTSISIPRNQVPANRIIPLQTIFTVKRDGTHKARIVCRGDKQTEATYSNYHT
                     DLLQIDTLKLFLMIANNRKMWIQTLDINHAFLYADLREEIYVPLPHDRRFVTPLKKAL
                     YGLKQSPKEWNEHLKKFLNSIDLDDSRHTPGIFRNHDYSIMIAVYVDDCVIAAKSQEL
                     LDEFVSTLRNRFELKIIGKMNQGILRTDVLGMDLDYNIDEGKISLSLQSYIESIENDW
                     LDKISHIKTTSIPHVSSYEHNIKNIDSMDTKTRSKKINELQKINGVINYIRSRCRYDV
                     EFAANKLARSVNFPADNVFYMADKLMNYIFQTKSEKIVFTRETTDNPAITLLSDASLG
                     TEHDMKSRMGIMLWYGENLYKVISRASSAVRNSSTEAELDAIYEGSKEAYYLKKILEE
                     MNLQKDPTVISITDSKPSIQYLKNNYNSNRRDRFLDLKLAKLEERIRADDLLIYKIAG
                     TDNIADVLTKPVSCEDFKKLRSSMQNKLTPKDILTITDPGEFHSPSSSISTIS"
     gene            complement(<854557..>856308)
                     /gene="TPHA0B03645"
                     /locus_tag="TPHA_0B03645"
                     /db_xref="GeneID:11534923"
     mRNA            complement(<854557..>856308)
                     /gene="TPHA0B03645"
                     /locus_tag="TPHA_0B03645"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684422.1"
                     /db_xref="GeneID:11534923"
     CDS             complement(854557..856308)
                     /gene="TPHA0B03645"
                     /locus_tag="TPHA_0B03645"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684470.1"
                     /db_xref="GeneID:11534923"
                     /db_xref="UniProtKB/TrEMBL:G8BPV5"
                     /translation="MDYTRATEVANDTNLDVGTTQHKLVSPHGGLTRMDNDHSSSQVV
                     KETLQSNIEIPNENTDVFIRAFKNRLSTLEGLYEKTMMKHDEFLNSIEAGDYLSKITK
                     LEEEEKGLELNIEKLRTKIIDREGPLNNRTTAHTRTSINNTVTNGSNKEEGNQQTNLM
                     NNGSLMFKTLNGKEVVINKNYLPLNIEFKLINIEDLPLWIKEFVKFLNYYNLDNLNEL
                     PESTIIDPVEDQFIKGQLKENIKCEDIYDFIFMENSSIEILNEVKRIFLRKLNFAKRQ
                     KLWKQVSITEKSNNLALQLNLLNKLVGIEEFIDTNKMEIFNLIINRINNQVLQRINAV
                     PIDLSKITPTQYLGIIKKHAEDAFEFHEQIKQFYLSEREEAKSNSKNPETLRPIVKKV
                     QRNPVQTKISTKKNQLKSAVDTVIDSGSGINFTNKKGLIFNYRKLTTIPEYSGVGSSS
                     NLQIIGQGSLRVRMDNNGKYQYIPVYYCPDEDATVLSAIGLRKTLGFIITEDYKNLKN
                     DSISIKIHNVANTTWIKSNDLLLSSKDNRTSEKLTKASSIRWIKPSTSFNNKTVTIHE
                     AHERYKSSSCRCHSSQY"
     gene            856800..856870
                     /gene="TPHA0Btrna15G"
                     /locus_tag="TPHA_0Btrna15G"
                     /db_xref="GeneID:11534951"
     tRNA            856800..856870
                     /gene="TPHA0Btrna15G"
                     /locus_tag="TPHA_0Btrna15G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11534951"
     gene            complement(<857083..>861813)
                     /gene="TPHA0B03650"
                     /locus_tag="TPHA_0B03650"
                     /db_xref="GeneID:11534798"
     mRNA            complement(<857083..>861813)
                     /gene="TPHA0B03650"
                     /locus_tag="TPHA_0B03650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684423.1"
                     /db_xref="GeneID:11534798"
     CDS             complement(857083..861813)
                     /gene="TPHA0B03650"
                     /locus_tag="TPHA_0B03650"
                     /inference="similar to DNA sequence:INSDC:YLR247C"
                     /note="similar to Saccharomyces cerevisiae YLR247C;
                     ancestral locus Anc_1.389"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684471.1"
                     /db_xref="GeneID:11534798"
                     /db_xref="GOA:G8BPV6"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPV6"
                     /translation="MVCVHENIDNVDFIIDENNVRYMNDNKRIYEHLVNVNDRRITDL
                     LDQKKSKYKNQNLINLIDLKFTNNAASINFDSNDDMNCCDVVLQYNEVIDIDKDNNDR
                     KNYTVTVNDPHNNGTILFILNVDEIKKQNVIIDDLLKIASNKYLELEMLLNKDVNSSQ
                     DQDSIDKNLESQQDANNTRKKSRKKKRKLNNSISNNPLKIVSNFYKDFLLQNSKLKYS
                     KDFKYWEISFSLLLISSKSQFNKFSNETVRILDRLYSNHLKEKDINNRVVDLNSNFIQ
                     KLFNHRTTSYTKQRLKDLKLEFYSKIEGLNDITLLPFQMETIQWMLEKEKKMFESTFD
                     SNIGIFRLNEFLNFNVSYGYEIMKLKISDESSTSLDRKNLLFWNKFTNYILPYQEAME
                     IYENAHKVPENYGARGLISEEMGLGKTIEVLSVLLLNKRDLPTPIADNRTSLYFTSND
                     FKRIRKAKTTLICCPNAILQQWINEINSHISDVTVFYYKGYHHMKEVFNIDDIDEIVE
                     NLSKYDIIITTYNTVSVEVHYAEYNSNLRKRRNAEVPKYNYSSPISLIQFHRIILDEV
                     QMLRSDSTNVAKCTSLLHRVHTWGVSGTPIHIIPDIHTVLSYLQIHPFKDIPKIVSSI
                     NLSVLDVTKRQNMTEISRENELLKSSIDGVSFNINNLLDIFQIFDLCIRHTKHDVKSQ
                     INIPEQYNYIIPLEFSPVEWDNYLDVWNTFIRMSGYNSDGSGRTRLSTIELNQYLTKL
                     RYLCCHAILPDSHNKLSKNNKSNPNLVYNMDDILKIMTMEAKDKLDSLYRENYQLKIK
                     GAQAKMELQNNPKAAIDYLLEIKDKLISDLSSKCNVSDPFNVILDSIANSENTETVNE
                     MEPGNIITEKGKVDDNLRLKAYMDLLHQCLFFIANGYYFLGSHRLEKVDDENEKIKLL
                     HLESDNDTKAELKLLKYTDVYNENEMKVIESNQILEQKYYELADLLRKQILSSRIEKV
                     NETIIDVKSYFQSKSKAHILNLKLIEFNFKDDFSNSLIVSKVFKLLGLLISSLNEQTI
                     QFNDLVQELLTLSYNPLSKTYDGEDSEEVRNEKSKEYADSIDFQDKVFGIFSCLERIL
                     QNRSAIMTSEDDIKLPKKLNLMGQNLSEYHLDLLKNLKLVQGTPFKPIFDELKNLRVV
                     KGSNVPLDNAKVSSSTFEDYLLSFEGHINGYKKEIKDMKESLKMINSIYNSKVEYYSH
                     LQSISDSLVSLLQLEPHQRSNIVRAIKNDNQYKINLKQIMTTGSRLKYLDSLTTLQES
                     IEQNKTFTCPICLGLIHTGSMISCGHFFCNNCIFSWLKLNSNCPLCKRDTTQSQLYNF
                     KFKNEITEESTNNEELSDIRAPQKPNHPNIESNIDIFIEKYKEFPKLSDVHNIVIKTS
                     FGAKIDFTVKLILYLKLKAANENDREPQILMYSQSMEFLKVISHVLKLHDIKQLSCLS
                     NTSNVGQTISNFKQDPSITCLLLNIKSLGAGLNLLNARHIILLDPIINHGDELQAKSR
                     NNRIGQAQTTFVWNLMIKNSVEENILKYKCKLENKKKIVKKSMNIDLDDELSSNEEQK
                     FELNEGTGEVVSKNHLWNCLFQGN"
     gene            <863280..>864548
                     /gene="TPHA0B03660"
                     /locus_tag="TPHA_0B03660"
                     /db_xref="GeneID:11534708"
     mRNA            <863280..>864548
                     /gene="TPHA0B03660"
                     /locus_tag="TPHA_0B03660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684424.1"
                     /db_xref="GeneID:11534708"
     CDS             863280..864548
                     /gene="TPHA0B03660"
                     /locus_tag="TPHA_0B03660"
                     /inference="similar to DNA sequence:INSDC:YLR174W,YNL009W"
                     /note="similar to Saccharomyces cerevisiae IDP2 (YLR174W)
                     and IDP3 (YNL009W); ancestral locus Anc_1.396"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684472.1"
                     /db_xref="GeneID:11534708"
                     /db_xref="GOA:G8BPV7"
                     /db_xref="InterPro:IPR004790"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:G8BPV7"
                     /translation="MADIKKVVVKNPIVEMDGDEQTRIIWDLIKNQLILPFLEIDLKY
                     YDLGVENRDLTDDKVTTESAEATLLYNVAVKCATITPDEARVEEFNLKKMWLSPNGTI
                     RNIIGGTVFREPIIIPKIKKIVPNWEKPIIIGRHAHGDQYRATDFVIPKDCSHGKLKL
                     VFEPKAPSSSTEKIERIVYEFNGNDNGGVALAMYNTTNSIVGFARSSFEFALERKLPL
                     YSTTKNTILKKYDGQFKDIFESMYKEEYEEKFKALNIWYEHRLIDDMVAQMLKSKGGF
                     IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISDDGKTFESEAAHGTVTRHYRQHQLGK
                     ETSTNSIASIFAWTKGIIQRGKLDNTPDVIKFGELLEAATIDTVDKDDIMTKDLALIL
                     GRTDRASYVTTEEFIEAVAKRLKNKFLSSI"
     gene            <865392..>866312
                     /gene="TPHA0B03670"
                     /locus_tag="TPHA_0B03670"
                     /db_xref="GeneID:11534801"
     mRNA            <865392..>866312
                     /gene="TPHA0B03670"
                     /locus_tag="TPHA_0B03670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684425.1"
                     /db_xref="GeneID:11534801"
     CDS             865392..866312
                     /gene="TPHA0B03670"
                     /locus_tag="TPHA_0B03670"
                     /inference="similar to DNA sequence:INSDC:YCL010C"
                     /note="similar to Saccharomyces cerevisiae SGF29
                     (YCL010C); ancestral locus Anc_1.409"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684473.1"
                     /db_xref="GeneID:11534801"
                     /db_xref="InterPro:IPR010750"
                     /db_xref="UniProtKB/TrEMBL:G8BPV8"
                     /translation="MENQWNSVVSSLQDIYNANEVNNFDEDVALKELNFNDLSNDSLT
                     SHITQLQEHMENVNRAKRLLSSIRENLNYIINDTDSKNREDPFTKIESTSNASSSTVT
                     TRAHNNTSIPNNNALLRDRTGETATGANTRIKQETHTEPITPAGKNNGSGTNGKIYWV
                     SQYNAITSIKLGSNVAYKPKKSIDGEWFHCEVVKISIDGLRFEVKDPEPDEFGNPGKI
                     FKCTWKDIILIPPENATKAQMPNYPTNTRVLARYPETTTFYPAIIISTKRDGTCRLKF
                     DGEEEVDRETELPRRYVLPLPNISAKPFKK"
     gene            <866836..>867237
                     /gene="TPHA0B03680"
                     /locus_tag="TPHA_0B03680"
                     /db_xref="GeneID:11534735"
     mRNA            <866836..>867237
                     /gene="TPHA0B03680"
                     /locus_tag="TPHA_0B03680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684426.1"
                     /db_xref="GeneID:11534735"
     CDS             866836..867237
                     /gene="TPHA0B03680"
                     /locus_tag="TPHA_0B03680"
                     /inference="similar to DNA sequence:INSDC:YCL012C"
                     /note="similar to Saccharomyces cerevisiae YCL012C;
                     ancestral locus Anc_1.407"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684474.1"
                     /db_xref="GeneID:11534735"
                     /db_xref="InterPro:IPR018559"
                     /db_xref="UniProtKB/TrEMBL:G8BPV9"
                     /translation="MFPSLSVKQLFWMHIFMLSVIFAYRKREYLSGQLSSLRNRYNRR
                     YIRSEGINSSFSDDIEAGLSSTNFDLESGNVGDQREGLDDIAKEEIKKIMAEKNLSFD
                     AARLAYTEEKFGKNNIAADGMPKDPKTVTLA"
     gene            complement(<867413..>872398)
                     /gene="TPHA0B03690"
                     /locus_tag="TPHA_0B03690"
                     /db_xref="GeneID:11534973"
     mRNA            complement(<867413..>872398)
                     /gene="TPHA0B03690"
                     /locus_tag="TPHA_0B03690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684427.1"
                     /db_xref="GeneID:11534973"
     CDS             complement(867413..872398)
                     /gene="TPHA0B03690"
                     /locus_tag="TPHA_0B03690"
                     /inference="similar to DNA sequence:INSDC:YCL014W"
                     /note="similar to Saccharomyces cerevisiae BUD3 (YCL014W);
                     ancestral locus Anc_1.406"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684475.1"
                     /db_xref="GeneID:11534973"
                     /db_xref="GOA:G8BPW0"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR021895"
                     /db_xref="UniProtKB/TrEMBL:G8BPW0"
                     /translation="MSADENTSDYSDEKLIEVPKLDSNPQIDSVDASKSETNTNQEIT
                     LFNNLTFNNIGQDHDGYDDDDLKLMSDIIKKADIFQGTDEIIWGRFIIFVKKVKGSTT
                     TDALVLDKLGTTLLKDLDFSKKSQYHSAVENLDPEFQKNDTRKNIAVALLMKYNTLTT
                     AQVNRIKSKTIKYTYDPRHAGGLASRCIDLLEKKDKLDRNTLIKKVEKYILSVGLVQK
                     RTVNSVLLDVVYDNTEAKVDMNNQIVYYLGEQLEQLFNPLSEYSPEQTEYTYRPPDED
                     TSETAGEYESNILQKLDDETDLVQSICNELIQFQTNFALNLVDFLQKFLIPLRVEALN
                     GNIKNLSTVKLNRLFPPTIDEVTRINCIFLDSLKLASPYGAYEIMKACDITIPYFYKA
                     YTRHEAATKDYSKNITLFLEKFKDNIPYSDTYNKIKLETIIKGPQEKLLKLKLILNRL
                     WESKKWPKSQESQAKIWYDNTIDIIHSFATLKEPISSYSTRVFTPSGKILTELAKHWP
                     VELQYKWLKRRVVGVFDVEITNDSNTRGLIVIFSDYIVFLEIQNSNQYYEKSRLRNKP
                     LLSDILMNSLINEIALPPKIPTLSVKHYCYINNISVSIFEDDNIRFDSYNNDNVFSIS
                     YKLISNSSTVRQVADLVTKASILEKDTAFHLFRSLTKNISLYSTAHELVSYNDEGVKS
                     KFALFLNTTPDKELLTVNKLHAAIFARIVDVDDIPNMELTVITSDNRKKKVIIKANKL
                     REELCNILSLELTNCFSSLRSPFYSQLLKANEFLIEETSKRIVMHKKDEEKESLKKNK
                     KEETLEEFDFSHQKTKSFSTITTFRSYASDLHDVSDTELKSNLTEEKKNKSVANKSSV
                     VKQLDSIKEGKQNDLKAQNNAKSQGKLSSQSNRTSQSNLKTQNKVTVDSIKNNSTKIP
                     VKTKPIKVKAVSKQEKSKKDNKSGFLTNFKGMFKKTKQNKTSDIKSITTKSNKIKTSK
                     KQSSKPSKVHTDKNIVPDPKLKENKAKKSSSVQNKPEKSNKTVKSNSSNANEDNDPSA
                     SINNQRISSVVRNKDFGKPSIEVGTGLTDKDCSSNGIIQSDETALLGDKVMKSIEKLT
                     AANDDETNSNDNHSRESLSSAKNLTEANENIQESTDDLVNKTFDDDPFGNYEIQKEPL
                     NSKERDNANGSEELPKVLTSNIDKEVKVKTMNKELKGSVELIANDVYDKRLPSLPHSS
                     ETNDTILSQSQSQSQSSNHLEKIGDFISKLETKKNDSNPLDASTNGKLVNHIFPIIPK
                     PTKKAVNIERSESFIELFELTRLVIDEVDGNYNWKRLGTNTLSDNVAIQKNKSKLIPE
                     QPTIPEQPTIFEQQEEFFDASEFVEEGEHDEIIPPKNIIVESETSNLSANSNDAANHT
                     IDFLEEIGDMMDNILKPDSKKVSSTTNNQPKFKVISNSPVRIINKTFKAQDSTQVPNQ
                     LDNVPDLQLVDDERSVHNKVVAIAPNEVDIPSKNQQVNEHSSKKNENTDMLDDLDFSS
                     FDISFDNSTINTSAVNSPERELTNVGINRRQLTNTGPTVYKLPPLSMNERVISGSKKL
                     NNITNNKLTIPNSGSFVEDVIWVSPSKLTLDDESNTSNHIADNFDTKKDNNSNSPFLI
                     SSQDNMNSKPKSSNSAKLSSEFSYAYLANYLEISQDDEEKHKLPEKLQFNE"
     gene            <872878..>874056
                     /gene="TPHA0B03700"
                     /locus_tag="TPHA_0B03700"
                     /db_xref="GeneID:11535062"
     mRNA            <872878..>874056
                     /gene="TPHA0B03700"
                     /locus_tag="TPHA_0B03700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684428.1"
                     /db_xref="GeneID:11535062"
     CDS             872878..874056
                     /gene="TPHA0B03700"
                     /locus_tag="TPHA_0B03700"
                     /inference="similar to DNA sequence:INSDC:YCL016C"
                     /note="similar to Saccharomyces cerevisiae DCC1 (YCL016C);
                     ancestral locus Anc_1.405"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684476.1"
                     /db_xref="GeneID:11535062"
                     /db_xref="InterPro:IPR019128"
                     /db_xref="UniProtKB/TrEMBL:G8BPW1"
                     /translation="MSINLHTKLKNDYSYKLIQLTPDLLKILTNKENRNSLQFKSVSR
                     DLNNDDETNQNNDVVLCSDDKTWLMRQMNHSNTVLLMKEFIPDEAPDSDKVPLFGTNT
                     APNKDYLGFVRTTFEYETQLINNPLVNLNNIPIYNGEIEFPKKSEKLHIKDKKTILKN
                     SLCSREEFDRRWTNIGGCRINGYMCILSSDFMSKVLHIVLMSIMAESLDTKNLTIKDI
                     YNAVNKDINEDQENTKNNLYSKDVVETVIKKFSLMNIESKQETWRLNMKEIVMWYGIN
                     ALKKYVSKKSMSQDEFLIKWKSLFPPYFPSEMDLQLLAGWYYRPSSNSIQYISKDILP
                     NDIKDRFKMLFKLQSQWQQEDIVPFIEEFNTKNLKIDSFIMKFSRRKRIGNKFIISSR
                     "
     gene            complement(<874214..>875128)
                     /gene="TPHA0B03710"
                     /locus_tag="TPHA_0B03710"
                     /db_xref="GeneID:11535101"
     mRNA            complement(<874214..>875128)
                     /gene="TPHA0B03710"
                     /locus_tag="TPHA_0B03710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684429.1"
                     /db_xref="GeneID:11535101"
     CDS             complement(874214..875128)
                     /gene="TPHA0B03710"
                     /locus_tag="TPHA_0B03710"
                     /inference="similar to DNA sequence:INSDC:YNL003C"
                     /note="similar to Saccharomyces cerevisiae PET8 (YNL003C);
                     ancestral locus Anc_1.404"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684477.1"
                     /db_xref="GeneID:11535101"
                     /db_xref="GOA:G8BPW2"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8BPW2"
                     /translation="MAYDGFLISLLSGAAAGTSTDLLFFPIDTIKTRLQAKGGFFYNG
                     GYRGIYKGLGSAVIASAPSASLFFVTYDYMKVELKQMLLRYNKNNQSEWINTVTHMTA
                     SSLGEISACMVRVPAEVIKQRTQTSISKNNSTSWQTFKTLLKNENGQGFRNNFYRGWA
                     STILREIPFTCIQFPLYEYLKKAWLLHDIDILSEKSEMISTDSLNTTLSPWKGAICGS
                     IAGGIAAATTTPLDVLKTRIMLSDKSMGTIKLVQNLYHEEGMKVFFKGVGPRSMWISA
                     GGAVFLGVYEITRSVLINTKSHQKPFIE"
     gene            <876426..>877982
                     /gene="TPHA0B03720"
                     /locus_tag="TPHA_0B03720"
                     /db_xref="GeneID:11534817"
     mRNA            <876426..>877982
                     /gene="TPHA0B03720"
                     /locus_tag="TPHA_0B03720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684430.1"
                     /db_xref="GeneID:11534817"
     CDS             876426..877982
                     /gene="TPHA0B03720"
                     /locus_tag="TPHA_0B03720"
                     /inference="similar to DNA sequence:INSDC:YCL017C"
                     /note="similar to Saccharomyces cerevisiae NFS1 (YCL017C);
                     ancestral locus Anc_1.403"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684478.1"
                     /db_xref="GeneID:11534817"
                     /db_xref="GOA:G8BPW3"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR010240"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020578"
                     /db_xref="UniProtKB/TrEMBL:G8BPW3"
                     /translation="MIRGTRGRLVGLFRSSALLRNNSRIYNNYNRRRDVLVLKSLDHV
                     RCYSAAVSAVKKLVDDVSLEIHTDIQAAAKEQSEVRNNAASTSNKESKTESEAAILSS
                     SNALKHAYQENTGFGTRPIYLDMQATTPTDPRVLDTMMKFFTGLYGNPHSNTHAYGWE
                     TNKEIEKARKHVADLINADPKEIIFTSGATESNNTVVKGVARFYKKTKNHIITTRTEH
                     KCVLEAARSMMNEGFEITFLSVDENGLIDLEDLKKNIRPTTCLVSVMAVNNEIGVLQP
                     IKEIGEICRKNKVFFHTDAAQAYGKIPMDVNKMNIDLLSISSHKIYGPKGIGALYVRR
                     RPRVRLEPLLSGGGQERGLRSGTLAPPLVAGFGEAARLMKQEYESDHKHITELSDRLT
                     KGLLSVEHATLNGSPSHRYPGCVNVSFAYVEGESLLMALRDIALSSGSACTSASLEPS
                     YVLHALGKDDALAHSSIRFGIGRFTTNEEVDYVIKAIVERVKYLRELSPLWEMVQEGI
                     DLDSIQWSGH"
     gene            complement(<878199..>879296)
                     /gene="TPHA0B03730"
                     /locus_tag="TPHA_0B03730"
                     /db_xref="GeneID:11534749"
     mRNA            complement(<878199..>879296)
                     /gene="TPHA0B03730"
                     /locus_tag="TPHA_0B03730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684431.1"
                     /db_xref="GeneID:11534749"
     CDS             complement(878199..879296)
                     /gene="TPHA0B03730"
                     /locus_tag="TPHA_0B03730"
                     /inference="similar to DNA sequence:INSDC:YCL018W"
                     /note="similar to Saccharomyces cerevisiae LEU2 (YCL018W);
                     ancestral locus Anc_1.402"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684479.1"
                     /db_xref="GeneID:11534749"
                     /db_xref="GOA:G8BPW4"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004429"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:G8BPW4"
                     /translation="MPEIKNIVVLPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEY
                     HLIGGAAIDATGNPLPDESLEASKRADAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQ
                     LYANLRPCNFASDSLLDLSPLKEKYAKGTDFTVVRELVGGIYFGKRKEDDGDGVAWDS
                     EQYSVPEVQRITRMAAFLAMQHNPPLPIWSLDKANVLASSRLWRKTVEETIQNEFPSL
                     KVSHQLIDSAAMILVKNPTQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLSSLP
                     DTNSAFGLYEPCHGSAPDLPKGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAVRRVL
                     DNNIRTADLGGSNSTSDIGDAVAKIVKEILT"
     gene            complement(<880136..>881095)
                     /gene="TPHA0B03740"
                     /locus_tag="TPHA_0B03740"
                     /db_xref="GeneID:11535063"
     mRNA            complement(<880136..>881095)
                     /gene="TPHA0B03740"
                     /locus_tag="TPHA_0B03740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684432.1"
                     /db_xref="GeneID:11535063"
     CDS             complement(880136..881095)
                     /gene="TPHA0B03740"
                     /locus_tag="TPHA_0B03740"
                     /inference="similar to DNA sequence:INSDC:YNL002C"
                     /note="similar to Saccharomyces cerevisiae RLP7 (YNL002C);
                     ancestral locus Anc_1.401"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684480.1"
                     /db_xref="GeneID:11535063"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="InterPro:IPR018038"
                     /db_xref="UniProtKB/TrEMBL:G8BPW5"
                     /translation="MSANLNSNPEVLLRKRRNADRIRLERQEKVKQRQILREKQKRDN
                     KNKFLRFENIAATALASERETERVKRISTVEIKKSMNDVSNLGSVSDFILKITEKTPE
                     QILEEQESGITIEGEEDNLIREKIRYNNEETLIFVVRVDGPLLAKAPQKVQKILTILR
                     LTEKNTGVFVILNKLVFPLLKMIAPYVVIGKPSLSTVRSLIQKRSRILVKDEENPHSA
                     NSMKEVILNDNNVIEEQLGSEGIICMEDIIHQIDKMGDKFQTCSFFLQPFRLNQEVSG
                     FSALSKLRRIQVAESQDKLRFKSNSSSAPITEVDIDALIGKMN"
     gene            <885941..>888460
                     /gene="TPHA0B03750"
                     /locus_tag="TPHA_0B03750"
                     /db_xref="GeneID:11532804"
     mRNA            <885941..>888460
                     /gene="TPHA0B03750"
                     /locus_tag="TPHA_0B03750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684433.1"
                     /db_xref="GeneID:11532804"
     CDS             885941..888460
                     /gene="TPHA0B03750"
                     /locus_tag="TPHA_0B03750"
                     /inference="similar to DNA sequence:INSDC:YLR176C"
                     /note="similar to Saccharomyces cerevisiae RFX1 (YLR176C);
                     ancestral locus Anc_1.400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684481.1"
                     /db_xref="GeneID:11532804"
                     /db_xref="GOA:G8BPW6"
                     /db_xref="InterPro:IPR003150"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:G8BPW6"
                     /translation="MSNTQTIIYNNNIRSDNQVWSFNMNNNNNNKSSSSNNIMNNLNN
                     YPYSPPFNPSNNGISNNIVPNNNSNSNLRFISPINNTFDNSNKSGNNSPTVDTRYRSL
                     PSPLLSTKDSNNYSINNNILQGYDNKPYIPTILSNSSSGSNGTAAPAPAPVNINKLPF
                     SLPPTAISSSQNLQVNNPLNNHIGMARPLITKPTINSQNIVNQNGSHMPYQNGYNELP
                     HLRRTIPEIMNQHQAFNNSNASIIVTSNSAQYSMQAQKFHTQIMNSNTRKNTQETIAK
                     SIAEKYKDKPISEYVPIVRNSEMEFLKLNSKTHSKSTIQIAEQMRKKERQVYAFIWLM
                     QNCVSDETSFVPRGRIFSQYASSCVHNSLKPLSQASLGKLIRSVFPNLKTRRLGMRGQ
                     SKYHYCGLKLANDTQTQNEILSDEDSVISTDKKSNIIISGASENLPGSPINGSEDPNN
                     ESKLQYLSPNTKSDMDGSFSNDNSSLENDDIFSPSSNNSSNSPSRYCKDKQPTITNND
                     EILIYLYSGNDLPFVNGNLYDVIFNDDEVKSSNFNLKYPQIPLELLKDDMDRDIVSSL
                     ESMYYAHCNTLYQNIRYLKFDEIENSLSIFSSGSISPQMYNLFISNKLSDWVAECDMI
                     VHSYLVKFLSSMLVNHFIDQQDGTLSELSLKNLEQFADSYSNMLEKSIIDLPRTTANK
                     KLNIAKMFSRLLKKLISLLRIIKTFSTTIVTIKEMDEDTLSVIDFDNVMDILDSDVTP
                     DRRIEIRNFVITEMQAFINDINSDNNETSNADKGEMIFSRIAKSLCDLFSKLENTPVI
                     KIMCNAVRITDSLMTELSIKPVDNLLPWFLYNTLSHHLFFI"
     gene            <889402..>890469
                     /gene="TPHA0B03760"
                     /locus_tag="TPHA_0B03760"
                     /db_xref="GeneID:11535156"
     mRNA            <889402..>890469
                     /gene="TPHA0B03760"
                     /locus_tag="TPHA_0B03760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684434.1"
                     /db_xref="GeneID:11535156"
     CDS             889402..890469
                     /gene="TPHA0B03760"
                     /locus_tag="TPHA_0B03760"
                     /inference="similar to DNA sequence:INSDC:YNL007C"
                     /note="similar to Saccharomyces cerevisiae SIS1 (YNL007C);
                     ancestral locus Anc_1.398"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684482.1"
                     /db_xref="GeneID:11535156"
                     /db_xref="GOA:G8BPW7"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:G8BPW7"
                     /translation="MVKETKLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGNTEK
                     FKEISEAFEILSDSNKREVYDQYGLEAARGNGPQFGPGGMPGGPGGSGGAHTFSNDDA
                     FNIFSQFFGGSSGGSMPGGASFSFGGMPGGMGGMPGGMGGGSPFGGMGGGMPGGMPGG
                     MPGGMGGMPGSFGSRGASPAEEEVVTVDLPVSLEDLFQGKKKTFKIGRKGQNGVQEKV
                     QVDIQLKAGWKAGTKITFKNYGDYNPSTGGRKTLQFVIKEKVHPNFKREDDTLVYYLP
                     LTFKESLLGFQKTIQTIDGRTLPISRVQPVQPNDSSTYPGQGMPMTKKPGQRGDMIVK
                     YKIEYPTTLTDDQRRAIDELF"
     gene            <890983..>892545
                     /gene="TPHA0B03770"
                     /locus_tag="TPHA_0B03770"
                     /db_xref="GeneID:11535183"
     mRNA            <890983..>892545
                     /gene="TPHA0B03770"
                     /locus_tag="TPHA_0B03770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684435.1"
                     /db_xref="GeneID:11535183"
     CDS             890983..892545
                     /gene="TPHA0B03770"
                     /locus_tag="TPHA_0B03770"
                     /inference="similar to DNA sequence:INSDC:YHR048W"
                     /note="similar to Saccharomyces cerevisiae YHR048W;
                     ancestral locus Anc_5.284"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684483.1"
                     /db_xref="GeneID:11535183"
                     /db_xref="GOA:G8BPW8"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8BPW8"
                     /translation="MSSLNDFDVNNFAEKNTSEQEIINSMDDKATDTSSRNEIDNSIS
                     DKDSLSSFEVKFDNESEIPDPEDIKRILPIYRKYIIGMVITLTSMVITIISSCWTLIS
                     DRIMDHFHISHEVSVLGISFYIFGLGVGPLFLSPLSELYGRRKTFIISLFFSIVWQCL
                     VIWSKTIEGVMFGRFLSGFFGSAFLSVAGGLFTDIFEKKNIGIPITIYTTSPMLGPAL
                     GPIISGALHGTNYKWTFITMLLASGLSFICVILLVPETYEPVLLIEKAKRLRKETGDE
                     RFFAPMELQRRDTNLLNSIANSARGPFGLLIRDPMMATLCFYTGLVLAIVYLFFVAFP
                     YIFETIYEFGAVEVGCAYVGLLVGILLASPTSFIIQKHYEKKVADNNGISTPEMRFEA
                     LYYGAFLTPIGLMIFCWTCYRKVHWIGPIIGSSIFGSGVFYVFTGVFSYTVDGYRKFS
                     ATAMACNSFVRSTMSAVFPLFGLQMYKGMGVNWAGFLIACITTAMIPVPFLFEKYGAK
                     LRAKSPYAWDDN"
     gene            <893510..>894469
                     /gene="TPHA0B03780"
                     /locus_tag="TPHA_0B03780"
                     /db_xref="GeneID:11535138"
     mRNA            <893510..>894469
                     /gene="TPHA0B03780"
                     /locus_tag="TPHA_0B03780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684436.1"
                     /db_xref="GeneID:11535138"
     CDS             893510..894469
                     /gene="TPHA0B03780"
                     /locus_tag="TPHA_0B03780"
                     /inference="similar to DNA sequence:INSDC:YCR002C"
                     /note="similar to Saccharomyces cerevisiae CDC10
                     (YCR002C); ancestral locus Anc_1.419"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684484.1"
                     /db_xref="GeneID:11535138"
                     /db_xref="GOA:G8BPW9"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPW9"
                     /translation="MSINPATVQPVSYVGFDTITSQIEHRLLKKGFAFNIMAVGQSGL
                     GKSTLLNSLFSSHLIDSATGGEISKLPITKTTEITVSSHTLQEDRVQLKVNVIDTPGF
                     GDFIDNNRAWDPIVKYIKEQHSLYLRKELTTNRERHITDSRVHALLYFIKPNGSGLKD
                     LDIEALKKLTEIANVIPVIAKADTLTITERNEFRSILQEDFIKHDLKMYPYDDNDLTE
                     EELELNKSIRSIIPFAVVGSETDVELNGETFKGRKTRWGVLNIEDIDQCEFVYLREFL
                     IRTHLQDLIESTSFVHYESFRSRQLIALKETASNRNSVPMTQR"
     gene            complement(<895974..>897581)
                     /gene="TPHA0B03790"
                     /locus_tag="TPHA_0B03790"
                     /db_xref="GeneID:11535158"
     mRNA            complement(<895974..>897581)
                     /gene="TPHA0B03790"
                     /locus_tag="TPHA_0B03790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684437.1"
                     /db_xref="GeneID:11535158"
     CDS             complement(895974..897581)
                     /gene="TPHA0B03790"
                     /locus_tag="TPHA_0B03790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684485.1"
                     /db_xref="GeneID:11535158"
                     /db_xref="UniProtKB/TrEMBL:G8BPX0"
                     /translation="MQRLPIQSDPVNFTDFHKSMKVKPRSVDYNILYFDLKSKCRKKK
                     FYGEILFDDKIEKWEEYGKYKKDPTNRLLISYEDALRWNNTTSQVNEYLLTACRYSNL
                     YTKKKNINRNALETNEEKCKKVVMNELLSILPYFEEISNEKFTLRLWEDLKTIISRYV
                     LIFPWALLLTVYKLKNEIIIKCYSNCKNSPQDKKVEYHFNQHPIYVTTLSKNEILHLQ
                     SNFNFKTNIVDELDEYLIDRIEYLHKIYNRLHNLDLKNISSDLFFFDTTSYTNVTKTN
                     TGIANNNVANIRFVNEYQFDNKTNKKDCTYDVDIKCFDPTKENGETKENYQMYLYKSL
                     LNHKDLYWDVTNDNCCSWNRKLQIIEDKIIKNNAHLTHGFHRNHDFFQYSGISQQLHE
                     KQVYNLRGIYNELRINTGYSYRDCDYMKLDRIGLMNIFYDLIPCFFQKQSDSNLLQCW
                     KLLLNVIHTYGVEFPWALFFSLLELRSKLSHINPNFYHNNKKKTTIIKSLHTFTGLFR
                     KCRPNIHIIIQMTDTLKLSFFVIWTIT"
     gene            898812..898883
                     /gene="TPHA0Btrna13R"
                     /locus_tag="TPHA_0Btrna13R"
                     /db_xref="GeneID:11534886"
     tRNA            898812..898883
                     /gene="TPHA0Btrna13R"
                     /locus_tag="TPHA_0Btrna13R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGA"
                     /db_xref="GeneID:11534886"
     gene            complement(<899051..>900193)
                     /gene="TPHA0B03800"
                     /locus_tag="TPHA_0B03800"
                     /db_xref="GeneID:11534707"
     mRNA            complement(<899051..>900193)
                     /gene="TPHA0B03800"
                     /locus_tag="TPHA_0B03800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684438.1"
                     /db_xref="GeneID:11534707"
     CDS             complement(899051..900193)
                     /gene="TPHA0B03800"
                     /locus_tag="TPHA_0B03800"
                     /inference="similar to DNA sequence:INSDC:YCL005W"
                     /note="similar to Saccharomyces cerevisiae LDB16
                     (YCL005W); ancestral locus Anc_1.414"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684486.1"
                     /db_xref="GeneID:11534707"
                     /db_xref="UniProtKB/TrEMBL:G8BPX1"
                     /translation="MINLLELTQVGTRTFKGILIFSFSFVCFILRLIETMLVWIYTNL
                     IKQAFITWYTLVGILLFTPLSILLRTTFQYLMLPLNIPLRIFFNYTIQELVTGVDKKE
                     SFYLFTTMLQYTLVLFLAGSIIGLFLGSILGLLHSTIRIPGIYIDFPNIILRWIPSVK
                     QKINKVTDYIFKTFGNIYNFRRPFSSSSNNTKDMSINLNSTGTLTPPRSPTHLSLNIE
                     KYEDQHHQKSGKRDSLSGWKAVNSTRTRSSVSSKEDALELASILPSNYFQENETTTPV
                     LVNKDTKTIYIRRNSSKDPLDTHNNNKEEEEEEEEEEEEEEEEEEEEEEVETSMSNIW
                     DRFDDIPSTLRTENEEGTSMGLSMGIATNINSEQRILNKLKNRKKK"
     gene            complement(<900827..>901295)
                     /gene="TPHA0B03810"
                     /locus_tag="TPHA_0B03810"
                     /db_xref="GeneID:11534887"
     mRNA            complement(join(<900827..900956,901089..901169,
                     901288..>901295))
                     /gene="TPHA0B03810"
                     /locus_tag="TPHA_0B03810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684439.1"
                     /db_xref="GeneID:11534887"
     CDS             complement(join(900827..900956,901089..901169,
                     901288..901295))
                     /gene="TPHA0B03810"
                     /locus_tag="TPHA_0B03810"
                     /inference="similar to DNA sequence:INSDC:YCL005W-A"
                     /note="similar to Saccharomyces cerevisiae VMA9
                     (YCL005W-A); ancestral locus Anc_1.413"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684487.1"
                     /db_xref="GeneID:11534887"
                     /db_xref="GOA:G8BPX2"
                     /db_xref="InterPro:IPR008389"
                     /db_xref="UniProtKB/TrEMBL:G8BPX2"
                     /translation="MSFYTVVITFIVVALASGAFWVFAPKQNQTVWRSTVILALAMMY
                     LMWAITYLCQLHPLVVPRRSDLRPEFAE"
     gene            <902102..>903538
                     /gene="TPHA0B03820"
                     /locus_tag="TPHA_0B03820"
                     /db_xref="GeneID:11532807"
     mRNA            <902102..>903538
                     /gene="TPHA0B03820"
                     /locus_tag="TPHA_0B03820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684440.1"
                     /db_xref="GeneID:11532807"
     CDS             902102..903538
                     /gene="TPHA0B03820"
                     /locus_tag="TPHA_0B03820"
                     /inference="similar to DNA sequence:INSDC:YLR175W"
                     /note="similar to Saccharomyces cerevisiae CBF5 (YLR175W);
                     ancestral locus Anc_1.397"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684488.1"
                     /db_xref="GeneID:11532807"
                     /db_xref="GOA:G8BPX3"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR002501"
                     /db_xref="InterPro:IPR004521"
                     /db_xref="InterPro:IPR004802"
                     /db_xref="InterPro:IPR012960"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:G8BPX3"
                     /translation="MSQDYVIKPESVAPSSETSEWPLLLKNYDKLLVRSGHYTPIPSG
                     SAPLKRDLKSYISSGVINLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKVTGCLI
                     VCVDRATRLVKSQQGAGKEYVCIVRLHDALKDEKELGRGLENLTGALFQRPPLISAVK
                     RQLRVRTIYDSNLIEFDNKRNLGVFWASCEAGTYMRTLCVHLGMLLGVGGHMQELRRV
                     RSGALGESDNMVTLHDVMDAQWVYDNTRDESYLRKIIQPLETLLVGYKRIVVKDSAVN
                     AVCYGAKLMIPGLLRYEEGIELYDEVVLMTTKGEAIAVAIAQMSTVDLASCDHGVVAT
                     VKRCIMERDLYPRRWGLGPIAQKKKQMKADGKLDKFGRVNENTPAEWKKEYVPLDKSE
                     GASTSTETVKEEKPLIKEVEKKEVKKEEKKEEKKEDKKEKKEKKEKKEKKEKKEKKEK
                     KEKKEKKEKKRKAEDNSENDDKKKKKSE"
     gene            complement(<904357..>905097)
                     /gene="TPHA0B03830"
                     /locus_tag="TPHA_0B03830"
                     /db_xref="GeneID:11534957"
     mRNA            complement(<904357..>905097)
                     /gene="TPHA0B03830"
                     /locus_tag="TPHA_0B03830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684441.1"
                     /db_xref="GeneID:11534957"
     CDS             complement(904357..905097)
                     /gene="TPHA0B03830"
                     /locus_tag="TPHA_0B03830"
                     /inference="similar to DNA sequence:INSDC:YCR004C"
                     /note="similar to Saccharomyces cerevisiae YCP4 (YCR004C);
                     ancestral locus Anc_1.421"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684489.1"
                     /db_xref="GeneID:11534957"
                     /db_xref="GOA:G8BPX4"
                     /db_xref="InterPro:IPR005025"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR010089"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:G8BPX4"
                     /translation="MVRIAIISYSLYGHTEKIALAIQRSIINAGGSADLYRVDETLPD
                     EVLQKMKAPPKTTSIPIASTDVLLNYDAFLFGVPTRFGTCSAQWSTFWDRTGGIWAKG
                     SLNGKAAAFFVSSASIGGGQESTVKSCLNYLVHHGMIFIPLGYNQCFSELANITETHG
                     GSPWGAGTLAGADGSRFPSELELRIASIQGKTFYEIVKNIYDDSEVTNKGANIPKTEG
                     NNTQANKKTLKQVNVDKKNKKKSNCTIS"
     gene            complement(<905799..>907223)
                     /gene="TPHA0B03840"
                     /locus_tag="TPHA_0B03840"
                     /db_xref="GeneID:11534744"
     mRNA            complement(<905799..>907223)
                     /gene="TPHA0B03840"
                     /locus_tag="TPHA_0B03840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684442.1"
                     /db_xref="GeneID:11534744"
     CDS             complement(905799..907223)
                     /gene="TPHA0B03840"
                     /locus_tag="TPHA_0B03840"
                     /inference="similar to DNA sequence:INSDC:YCR005C,YNR001C"
                     /note="similar to Saccharomyces cerevisiae CIT2 (YCR005C)
                     and CIT1 (YNR001C); ancestral locus Anc_1.422"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684490.1"
                     /db_xref="GeneID:11534744"
                     /db_xref="GOA:G8BPX5"
                     /db_xref="InterPro:IPR002020"
                     /db_xref="InterPro:IPR010109"
                     /db_xref="InterPro:IPR016141"
                     /db_xref="InterPro:IPR016142"
                     /db_xref="InterPro:IPR019810"
                     /db_xref="UniProtKB/TrEMBL:G8BPX5"
                     /translation="MSSIVLTNSKKYLLNNTKNNYLINLSINSLRNYTNSEKTLKERF
                     AEIFPEKQQEIKDFKKNYGHVVIDSVKLEQAYGGMRGIKGLVWEGSVLDPEEGIKFRG
                     RTIPEIQKQLPKAVGGQEPLPEAIFWLLLTGEIPNEAQVKAFSADLASRSELPEHVVK
                     LLDNLPKNLHPMAQFSMAVTALESESKFAKAYAQGVSKKDYWNYTFEDSLDLLGKLPM
                     IASKIYRNVFKDGKIASIDPNADYGKNLANLLGFQNNDFVDLMRLYLTIHSDHEGGNV
                     SAHTTHLVGSALSSPYLSLSAGLNGLAGPLHGRANQEVLEWLFKLREEVKGDYSKETI
                     EKYLWDTLNSGRVVPGYGHAVLRKTDPRYTAQREFALKHFPDYELFKLVSTIYEVAPK
                     VLTKHGKTKNPWPNVDSHSGVLLQYYGLTEASFYTVLFGVARAFGVLPQLITDRAVGL
                     SIERPKSFSTEKYRDLVKSIITKN"
     gene            complement(908443..908514)
                     /gene="TPHA0Btrna8P"
                     /locus_tag="TPHA_0Btrna8P"
                     /db_xref="GeneID:11534784"
     tRNA            complement(908443..908514)
                     /gene="TPHA0Btrna8P"
                     /locus_tag="TPHA_0Btrna8P"
                     /product="tRNA-Pro"
                     /note="codon recognized: CCU"
                     /db_xref="GeneID:11534784"
     gene            <909219..>910841
                     /gene="TPHA0B03850"
                     /locus_tag="TPHA_0B03850"
                     /db_xref="GeneID:11535064"
     mRNA            <909219..>910841
                     /gene="TPHA0B03850"
                     /locus_tag="TPHA_0B03850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684443.1"
                     /db_xref="GeneID:11535064"
     CDS             909219..910841
                     /gene="TPHA0B03850"
                     /locus_tag="TPHA_0B03850"
                     /inference="similar to DNA sequence:INSDC:YCR008W"
                     /note="similar to Saccharomyces cerevisiae SAT4 (YCR008W);
                     ancestral locus Anc_1.423"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684491.1"
                     /db_xref="GeneID:11535064"
                     /db_xref="GOA:G8BPX6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BPX6"
                     /translation="MAAVVHQNTSLTKKNSFLKRNITKYFGSNQVQANDSITKTNDLT
                     IETKNLQPSSSPPSTVSSNSSSINSTPKVQNNPSCNDSTPTLTSVTNPNNNVFEVNNK
                     LSINEDATHIHNLQNLKRKDNISSFIKKISISKNKNEGVKNIANAKWAVQDLFTDNNF
                     TVEKSNNFNSNSNSDNNNNNGNNTKHNKSNLWNSNNNSSPLCTQNRISGFLKNINENV
                     DVSSSKGPNDLPMPKSAPKPTLSTTVMETHAKMNFSDIYGCCKEIIGKGSYGTVRLCQ
                     KKSELKNSKPIFYAVKEIKRKENESCDIFLRRITSEFCISSSLKHPNIVQTLDLFADN
                     EKNYFEVMEYCPGGDLFTLITSSENGKLTQIEADCFFKQILSGVNYMHDMGVAHRDLK
                     PENILLTATGIVKIIDFGSSECFRMAWETNVHYTDYICGSTQYIAPEEYTKEKFDPRA
                     VDVWACGMIYMAMVIGRHLWTTAQKSDEIYSTFLNDIKTEDGFEPIENFSDVNCKNVI
                     YSILEPSPSRRLTTKQIMNCPWVKGIQCCGSK"
     gene            complement(<911176..>911973)
                     /gene="TPHA0B03860"
                     /locus_tag="TPHA_0B03860"
                     /db_xref="GeneID:11534940"
     mRNA            complement(<911176..>911973)
                     /gene="TPHA0B03860"
                     /locus_tag="TPHA_0B03860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684444.1"
                     /db_xref="GeneID:11534940"
     CDS             complement(911176..911973)
                     /gene="TPHA0B03860"
                     /locus_tag="TPHA_0B03860"
                     /inference="similar to DNA sequence:INSDC:YCR009C"
                     /note="similar to Saccharomyces cerevisiae RVS161
                     (YCR009C); ancestral locus Anc_1.424"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684492.1"
                     /db_xref="GeneID:11534940"
                     /db_xref="GOA:G8BPX7"
                     /db_xref="InterPro:IPR004148"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:G8BPX7"
                     /translation="MSWDGFKKAINRAGNSVIIKNVDKTIDKEYNIEERRYRVLQKSG
                     ESLQKESKAYLDSLRQVTQSQVTIAEVISSLYDDSKFVSGGGYNVGNYYLQSVQDFDS
                     ETVKQLDGPFRETILDPITKFSSYFKEIDEGIKKRDHKKQDYDAAKAKVRRLVDKPAK
                     DSSKLPRAEKELQFAKDVFDNLNDQLKAELPQLIALRVPYYDPSFEALVKIQMRFCTD
                     GYSRLAQVQQYLDQQSRDDYANGQLDAKIEDLLHQMTSLDICALGFK"
     gene            complement(<913069..>913887)
                     /gene="TPHA0B03870"
                     /locus_tag="TPHA_0B03870"
                     /db_xref="GeneID:11535074"
     mRNA            complement(<913069..>913887)
                     /gene="TPHA0B03870"
                     /locus_tag="TPHA_0B03870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684445.1"
                     /db_xref="GeneID:11535074"
     CDS             complement(913069..913887)
                     /gene="TPHA0B03870"
                     /locus_tag="TPHA_0B03870"
                     /inference="similar to DNA sequence:INSDC:YCR010C,YNR002C"
                     /note="similar to Saccharomyces cerevisiae ADY2 (YCR010C)
                     and ATO2 (YNR002C); ancestral locus Anc_1.425"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684493.1"
                     /db_xref="GeneID:11535074"
                     /db_xref="GOA:G8BPX8"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="UniProtKB/TrEMBL:G8BPX8"
                     /translation="MVSESEQVVRSSSNDVYEDNQAMKNDSSEDLGKIYTSGENNEYV
                     YIGRTKFLKADLYDAFGGTLQPGLAPPSSHKFANPAPLGLSAFALTTFVLSMFNARAQ
                     GITTPNVVVGLAMFYGGLVQLIAGIWEIALENTFGGTALCSYGGFWLSFGAIHIPWFG
                     ILSAYEGKEAQLQDALGFYLLGWAIFTFGLTICTMKSTVMFFALFFLLAVTFLLLSIG
                     EFAASVGSTRAGGVLGVIVAFIAWYNAYAGVATRQNSYVLARPFALPTNDHVLI"
     gene            complement(<915207..>916289)
                     /gene="TPHA0B03880"
                     /locus_tag="TPHA_0B03880"
                     /db_xref="GeneID:11534931"
     mRNA            complement(<915207..>916289)
                     /gene="TPHA0B03880"
                     /locus_tag="TPHA_0B03880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684446.1"
                     /db_xref="GeneID:11534931"
     CDS             complement(915207..916289)
                     /gene="TPHA0B03880"
                     /locus_tag="TPHA_0B03880"
                     /inference="similar to DNA sequence:INSDC:YNR003C"
                     /note="similar to Saccharomyces cerevisiae RPC34
                     (YNR003C); ancestral locus Anc_1.426"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684494.1"
                     /db_xref="GeneID:11534931"
                     /db_xref="GOA:G8BPX9"
                     /db_xref="InterPro:IPR007832"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016049"
                     /db_xref="UniProtKB/TrEMBL:G8BPX9"
                     /translation="MSSMSGLAKSATIELSDSAKNLHNGMVKNIDKTLFTQQELQDLS
                     NISSLSDLMILIQELLNKNLIKLVKQNNELKFQAVDISEAAKKSTMTAEESLVYSYIE
                     ASGREGIWTKTIKARTNLHQHVVLKCLKSLESQRYVKSVKSVKYPTRKIYMLYNLQPS
                     IDITGGPWFTDSELDVEFINSLLTIVWRYVSEKSFPNGFKNFSNENGKKTLYAPHVKN
                     YSTAEEILNFISNAQVANVELNIDNIRSLCEVLVYDDKLEKTQHDCYRVTLQSVLQLT
                     NNNNITSSSTSTSISNGDNNENSIQIKKEDETTSETTKSIQQPNKIKNNLMDIEENEF
                     SIFNHYNYLPASQQDKEAVYFDEWVL"
     gene            complement(<916593..>917606)
                     /gene="TPHA0B03890"
                     /locus_tag="TPHA_0B03890"
                     /db_xref="GeneID:11534910"
     mRNA            complement(<916593..>917606)
                     /gene="TPHA0B03890"
                     /locus_tag="TPHA_0B03890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684447.1"
                     /db_xref="GeneID:11534910"
     CDS             complement(916593..917606)
                     /gene="TPHA0B03890"
                     /locus_tag="TPHA_0B03890"
                     /inference="similar to DNA sequence:INSDC:YCR015C"
                     /note="similar to Saccharomyces cerevisiae YCR015C;
                     ancestral locus Anc_1.430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684495.1"
                     /db_xref="GeneID:11534910"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G8BPY0"
                     /translation="MTNRNIIIADFDETITYDDTIAVLSKLPYFVRSQAYRSSNNKCQ
                     SNAPLKSIPDWEYFVNYYMEVYSKNINSIKRKLPILEFDQNNTRVNYLSKLNAEIQYQ
                     DELKELIELKSVDNIVNNGTFAGISIDDLKNYLKSLDQNGSNLIRKEFKHYIFEFRKA
                     NKDENNLYIISINWSKEFIYNLINGIHDKSKDETIKLENIYCNDLLLDHSNEEFYTGD
                     FSRNSVTGSDKFRILNNLSQKYNASGKLLWFVGDSETDLLSILQPDVNGILLLDPSSS
                     EKNKVKFLKIVRNLLNANNEVIKNYIQNENVQFVKLFEKYKGSDRYVYLAKNWNVFVK
                     LII"
     gene            <920520..>922184
                     /gene="TPHA0B03900"
                     /locus_tag="TPHA_0B03900"
                     /db_xref="GeneID:11534809"
     mRNA            <920520..>922184
                     /gene="TPHA0B03900"
                     /locus_tag="TPHA_0B03900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684448.1"
                     /db_xref="GeneID:11534809"
     CDS             920520..922184
                     /gene="TPHA0B03900"
                     /locus_tag="TPHA_0B03900"
                     /note="ancestral locus Anc_1.432"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684496.1"
                     /db_xref="GeneID:11534809"
                     /db_xref="GOA:G8BPY1"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8BPY1"
                     /translation="MTTFTDFILLRNTNYKGALYDKFPKIYNVYFIAIISCLSGLMFG
                     FDISSMSSMIGTEGYIEYFGTPDSTTQGGITASMAAGSLGGALVSPKFSDAFGRRVSL
                     HLCAAFWIIGAIIQCASQNVGMLVAGRVISGIGIGFGSSTAPVYCSEVSPPKIRGTIA
                     GIFQFSVTLGIMILFYIGYGCHFIQSDAAFRVTWGLQLVPGVILLIFTFFLPESPRWL
                     ATHDRFDEAKFVVAKVGAKGDIHDPEVKLQCQEIREQALIDKEADAFTYFDLFRKKTI
                     RKTIVGMSAQMWQQLCGMNVMMYYIVYIFQMAGYSGNTLLVSGSIQYVLNVVMTIPAL
                     FLVDKVGRRPILIIGGIFMFSWLFAVAGLLATYSVPAPNGFNGDDTVRIRIPDSEPAA
                     AKGVIACCYLFVCSFAPTWGIGIWIYCSEIFNNVERAKGSALSASVNWAFNFALAMFV
                     PSAFKNITWKTYIIFGVFSVALTIQTFLMFPETKGKTLEEIDMMWAANIPAWKTASFE
                     PVLPEIDLSTDDQKQGSQDFDSNVNHVEDEKQVVYHNDIADDVSSL"
     gene            complement(<922610..>924733)
                     /gene="TPHA0B03910"
                     /locus_tag="TPHA_0B03910"
                     /db_xref="GeneID:11534800"
     mRNA            complement(<922610..>924733)
                     /gene="TPHA0B03910"
                     /locus_tag="TPHA_0B03910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684449.1"
                     /db_xref="GeneID:11534800"
     CDS             complement(922610..924733)
                     /gene="TPHA0B03910"
                     /locus_tag="TPHA_0B03910"
                     /inference="similar to DNA sequence:INSDC:YEL011W"
                     /note="similar to Saccharomyces cerevisiae GLC3 (YEL011W);
                     ancestral locus Anc_1.435"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684497.1"
                     /db_xref="GeneID:11534800"
                     /db_xref="GOA:G8BPY2"
                     /db_xref="InterPro:IPR004193"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR006048"
                     /db_xref="InterPro:IPR006407"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR015902"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G8BPY2"
                     /translation="MSEVPENVKGVVDFDSWLKPWANVLSERRYLADKYKYDIQHSTS
                     DGKEISLKEFARDSYKTYGLHVDSQTKEIVYQEWCPNAAKAYLIGDFNNWNESTHELT
                     RFDDFGNFKIVVKPIVENGSTSYAIKHDSKIKVMFVLNNGEKIYRLPAWITRSTQPDK
                     ETVKKYGPIYEGRFWNPENPYIFKSKRPTFNLTKDSLRIYEAHIGISSPEPTVASYKN
                     FTQNVLPRIRDLGYNCIQLMAIMEHAYYASFGYQVTNFFAISSRFGTPEDLKELIDTA
                     HSMGIIVLLDVVHSHASKNVEDGLNMFDGSDHHMFHSLTSGRGEHPLWDSRLFNYGKF
                     EVQRFLLANLAFYIDVYQFDGFRFDGVTSMLYVHHGVGENGAFSGDYNEYLSKERSHV
                     DHEALAYLMLANDLVHELLPNQAITIAEDVSGYPTLCLPRDIGGVGFDYRLAMALPDM
                     WIKLLKEKKDEDWDMGHIAFTLTNRRHGEKVVAYCESHDQALVGDKTLAFWLMDAEMY
                     TGMTILKETTPVIDRGIALHKMIRLITDSLGGEAYLNFEGNEFGHPEWLDFPNVNNND
                     SYHYARRQFNLVDDNLLRYQHLYNFDKAMQHTEGSYQWLNTPQAYISLKHEGDKVIVY
                     ERNGLLFLFNFNPKKSFNDYRIGVEVPGKYKIILNTDKPEFGGHNRIDEKSSFFTTNE
                     KWNDRNNYLQVYIPSRTAMILALDK"
     gene            complement(<925734..>926687)
                     /gene="TPHA0B03920"
                     /locus_tag="TPHA_0B03920"
                     /db_xref="GeneID:11535157"
     mRNA            complement(<925734..>926687)
                     /gene="TPHA0B03920"
                     /locus_tag="TPHA_0B03920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684450.1"
                     /db_xref="GeneID:11535157"
     CDS             complement(925734..926687)
                     /gene="TPHA0B03920"
                     /locus_tag="TPHA_0B03920"
                     /inference="similar to DNA sequence:INSDC:YEL017W"
                     /note="similar to Saccharomyces cerevisiae GTT3 (YEL017W);
                     ancestral locus Anc_1.445"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684498.1"
                     /db_xref="GeneID:11535157"
                     /db_xref="UniProtKB/TrEMBL:G8BPY3"
                     /translation="MSTKKSVFSRWNKTAILDLIEKLKVNDIPYSLKKTELIGLLENH
                     LKTLDTPLDDVLEYPELVEFYSNQKHDGKELKKEEDDSASLDDSNEANRSKMSNFIDF
                     TRLLPKKTADDEGIHSQEDEEYVYRSDEDLEDEDALDADELQSELDDLLAMEEHTPLQ
                     RIVLKLQQWNENVQDYLSTVYSIAFILHLVEFTIFFKYLLSHYPACDDLDVKENLMIV
                     VPNILLWFTVAIAIPCLVSYYFNFIRYDLPSMEFDPMIFSVVKIGFAYTLSGHSQALQ
                     IPKSLCHYEELRTFAELYKDALGQLPLFIGLVGCVLTLYIF"
     gene            <927904..>928026
                     /gene="TPHA0B03930"
                     /locus_tag="TPHA_0B03930"
                     /db_xref="GeneID:11534709"
     mRNA            <927904..>928026
                     /gene="TPHA0B03930"
                     /locus_tag="TPHA_0B03930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684451.1"
                     /db_xref="GeneID:11534709"
     CDS             927904..928026
                     /gene="TPHA0B03930"
                     /locus_tag="TPHA_0B03930"
                     /inference="similar to DNA
                     sequence:INSDC:YCR024C-A,YEL017C-A"
                     /note="similar to Saccharomyces cerevisiae PMP1
                     (YCR024C-A) and PMP2 (YEL017C-A); ancestral locus
                     Anc_1.446"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684499.1"
                     /db_xref="GeneID:11534709"
                     /db_xref="InterPro:IPR012589"
                     /db_xref="UniProtKB/TrEMBL:G8BPY4"
                     /translation="MTLPGGVILVFILVGLAVIAILATIAYRKWQARQKGLQRF"
     gene            <928983..>930710
                     /gene="TPHA0B03940"
                     /locus_tag="TPHA_0B03940"
                     /db_xref="GeneID:11534792"
     mRNA            <928983..>930710
                     /gene="TPHA0B03940"
                     /locus_tag="TPHA_0B03940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684452.1"
                     /db_xref="GeneID:11534792"
     CDS             928983..930710
                     /gene="TPHA0B03940"
                     /locus_tag="TPHA_0B03940"
                     /inference="similar to DNA sequence:INSDC:YEL020C"
                     /note="similar to Saccharomyces cerevisiae YEL020C;
                     ancestral locus Anc_1.450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684500.1"
                     /db_xref="GeneID:11534792"
                     /db_xref="GOA:G8BPY5"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G8BPY5"
                     /translation="MSGISVPDYISTVLKKYDIDTVFGIVGIPIVELAESFITNGIKF
                     ISFRNEQSASYAASLYGYLNNKPGVLLTVGGPGLIHALAGIYNSIENNWPLIVITGGI
                     ESQQKYKNGFQELNHIALLNSYMKFTGELSTENIDLLVYESMRNSMLSPKGVSFLEIP
                     GDLIHKSVGKNIGDSLAKHKPILVDALTFIPNDDILLETAKFLYDAMRKRDQNMLVIV
                     GKGAIGASSALRHFINCFNLPFLPTPMAKGIIEDSNELNVSSGRSMALKDADVILVFG
                     AKLNWILHYGDTPKFKDNVKFIQVDNNTKTIGLNNQRGLQNSLIGDIESTVKKLTMMI
                     NHLQNGQMITYKGLSKAIKEKILSNAIKLNEKENATPRVVPNANSLNYNVVFGRLKTL
                     FKDEETILVTEGANTMDVARISFPTDFPQHRIDCGTLATMGIGLGYAISTKLSKPNKS
                     VVLIQGDSAFGFSGLELETSVRFNLGLIVVIMNNSGIYHGTTKDHYLKGKYAPPTILS
                     QNCRYDIVGKGLGCAGYLITNLDELTKYFKLAMIRSIKYKETSVLNVLIEPGKQGKLE
                     FGWQSKPRL"
     gene            <931793..>933148
                     /gene="TPHA0B03950"
                     /locus_tag="TPHA_0B03950"
                     /db_xref="GeneID:11534954"
     mRNA            <931793..>933148
                     /gene="TPHA0B03950"
                     /locus_tag="TPHA_0B03950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684453.1"
                     /db_xref="GeneID:11534954"
     CDS             931793..933148
                     /gene="TPHA0B03950"
                     /locus_tag="TPHA_0B03950"
                     /note="ancestral locus Anc_1.454"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684501.1"
                     /db_xref="GeneID:11534954"
                     /db_xref="GOA:G8BPY6"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8BPY6"
                     /translation="MNPDVVESNSINDNVSDPTSSKSASTTIGALSAGGRSVVYQLTS
                     SYLRTPVKLFKPARFDYFHYVRVILTGDANNTAINNDSQSVKNKFWFKRFSNAHKYTS
                     MVENSSLGLLTKALNKYGWRVIPDRVLPPLLVNSATGIVLYSTYLASLTALSKPHTNA
                     EQYVTVFKLQDVFASGFLAGFAQSIISTPVDAIYTRSSTLEIFESIKKYNNLWIFALD
                     KVKEIGLIGCFSGFTLVAIKESFGFAIYFTTFELIKGTLSNFILNLVNSFRKFKFKVK
                     ESFDFNSEPTSINETASKQASTTFLTVKEEKWVKRSFIFMGGISAALLLQLFQYPFTK
                     IQKIHFSRLEAFDIYNRSFAKNSKVLQNNSLTFSNMILRHPKRSQFHIYYHSYFDTFT
                     HIHFIHKTTGDLTRWLYKGFTNRAMTTIPGTTIGLILLDYMRSKLEDDIITSTNQMIM
                     K"
     gene            complement(<933267..>937457)
                     /gene="TPHA0B03960"
                     /locus_tag="TPHA_0B03960"
                     /db_xref="GeneID:11534754"
     mRNA            complement(<933267..>937457)
                     /gene="TPHA0B03960"
                     /locus_tag="TPHA_0B03960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684454.1"
                     /db_xref="GeneID:11534754"
     CDS             complement(933267..937457)
                     /gene="TPHA0B03960"
                     /locus_tag="TPHA_0B03960"
                     /inference="similar to DNA sequence:INSDC:YEL022W,YJR031C"
                     /note="similar to Saccharomyces cerevisiae GEA2 (YEL022W)
                     and GEA1 (YJR031C); ancestral locus Anc_1.455"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684502.1"
                     /db_xref="GeneID:11534754"
                     /db_xref="GOA:G8BPY7"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR023394"
                     /db_xref="UniProtKB/TrEMBL:G8BPY7"
                     /translation="MVYHIPDFLDSRTLVIRECIRLSNSMRKHIIKNDYNQLGMSVVI
                     GTGNEFFTNAVDSNISINNGSAGNHPFNYLSKYNNMNNGDQLISKLLALKKKLLSNED
                     AMSTLSPVEILEPFLFIIVNSSVPGDITVQALETVGNFFSLKIAFDGIGIEYVRAYTE
                     TIRALTHCRFERSSSITDNSVLLKVVDMLQTLLVSPNSNILPDGVIYEVLQIILSMVC
                     NTRRTEILRKAAETSLINVTTRVFSRLADIEASESNHVYINSAVYAKNKLKKDTIGTS
                     KSESSDDVLNTKNTVNKDSSVKEAAKPAELIIGSGTSIIEDQYGLPVIIDYLNLLLSL
                     ILPEKNENASTEATLLSLKLLKIVIDISGTYFLLHPRLFAFVSDPIFKSVLYIIQNSE
                     NLLILQAVLELFATIYLVFGNSLQRQIELTLNCLLQIIYDKEDDKDKKKTNAVVNVQF
                     KELIMEQLSVLWTCSPSFFMSLFAEFDCDLDNVDISLNLINALINMTVSDNTSINASV
                     TIPSISLDGVFEFVEDIYDNIQCIDKTVYWSDKKLLPLLEQREQKTVFIESAALFNKK
                     PKEGISLLLEKGFISSDTDEDIAKFLFENNTRMNKKTIGLLLSDPDKKSLLNYFIGLY
                     DFNELRVDEALRILLTKFRLPGESQQIERIIECFAQKYVNDHKPENKNDNDSDNDKEI
                     VNPDLDSVFVLSYSIIMLNTDLHNPQVKEHMTFEDYSNNLKGCYNSKDFPHWYLDKIY
                     CSIRDKEIIMPEEHHGNKKWFDDAWNNIISSTLVVTENTLKKNSIINNLSKYELAQLN
                     EVMFSNVGIMLVEEFTKIILGTKDPYVFSKVILIIEKCLDIACFFNLSELYTNTLRHF
                     ATYTGLITKDDDEYTDDSVVEIYVESSNTHIPVSRTSIQLGEDFKKQQYLSSFFRIIR
                     KNNTTSMLSSKIWETTLALMINLYEKKLIDPDVFHDFQKQLCIGNLPKPKPAVVINKE
                     RINRGILSAFASYLKGDEEPSDDEIETALNALECIKKINVTMSVFGIGAQFTPEFIEL
                     ILKSIKTEITEANKSYFETEALFLIEITIALYLHCKDISKLGDKILDSVKSLSESEHI
                     TKKGLRRLVSYKLLLLSILMNKGDVLKETIDKNLLQQNEIFNDTFFSTDQGEGIIKSI
                     LLLAKPGSYRDLLYNDESFWQLLRNVVSNENHLSGVFDFINSSISNDSKIFTEMNFKW
                     ILGLLDEISSAGAIGNKWEINKESSAENPQKHVIETSIKSLFLTQFLFESSISSNKFN
                     EEQKLSLIQALSHQCLNPCSEISNYAIQCIGSSLTKEEVIKSLSMHSIQTIIREGLMP
                     LLELDESDNIKENYISDIIKMISKVYLINLRNQKVTTTTFDQILSLLKKYESDEHIKK
                     EIDYLVNENTSYLSEMAK"
     gene            <938053..>939243
                     /gene="TPHA0B03970"
                     /locus_tag="TPHA_0B03970"
                     /db_xref="GeneID:11535115"
     mRNA            <938053..>939243
                     /gene="TPHA0B03970"
                     /locus_tag="TPHA_0B03970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684455.1"
                     /db_xref="GeneID:11535115"
     CDS             938053..939243
                     /gene="TPHA0B03970"
                     /locus_tag="TPHA_0B03970"
                     /inference="similar to DNA sequence:INSDC:YJR032W"
                     /note="similar to Saccharomyces cerevisiae CPR7 (YJR032W);
                     ancestral locus Anc_1.456"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684503.1"
                     /db_xref="GeneID:11535115"
                     /db_xref="GOA:G8BPY8"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:G8BPY8"
                     /translation="MTSASSTLYFDISIDNVDIGRIVCELFEDKAPKATKNFKHLCNG
                     DTTIEGFKNLTFKGNYFHRIIKTFIVQCGDIVYGSDKFEKSDEIGTGGSSIYATAEEI
                     KDETKELKCYGNFDDENLGEFKEPFLLAMANTGEANTNSSQFFITVGVQPHLNGKHTI
                     FGKVLFGKHVVRTIENVSIDKDGFPEQCVLVKDCGIWDESMGVPLYNACNDKIGGDVY
                     EEDPNDDSNFDHDNFEESYNASNIIKESGSLLFKKKDFKNSLFKYQKSLRYVNEFMPD
                     MDMDKNNCLKFTTLKSKLYLNMSLNYYNLKMYDECMTYANYLLDLDNIPDIDQAKAYY
                     RRGNSYLMKKRYEDALASYKLCKEKNPEDKVIDQKIESVKSLIEANIEKTRKNLSKFF
                     TDPK"
     gene            complement(<939341..>943570)
                     /gene="TPHA0B03980"
                     /locus_tag="TPHA_0B03980"
                     /db_xref="GeneID:11535058"
     mRNA            complement(<939341..>943570)
                     /gene="TPHA0B03980"
                     /locus_tag="TPHA_0B03980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684456.1"
                     /db_xref="GeneID:11535058"
     CDS             complement(939341..943570)
                     /gene="TPHA0B03980"
                     /locus_tag="TPHA_0B03980"
                     /inference="similar to DNA sequence:INSDC:YJR033C"
                     /note="similar to Saccharomyces cerevisiae RAV1 (YJR033C);
                     ancestral locus Anc_1.457"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684504.1"
                     /db_xref="GeneID:11535058"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR022033"
                     /db_xref="UniProtKB/TrEMBL:G8BPY9"
                     /translation="MSLNFLPGRPNETIQTTCQATWQNHVILAYCSGNNLILLSNAYT
                     RLQTIYINSDCVAVDINSRNGFIALAYANKVNIYKPIHQVMRNPKWVLCCEIMHDESD
                     VNCIKWGSQEEIIVGSNYLSFWKINDEFGIYKPVLLWNKRQPKPVYICTISDDSQFVA
                     SVGKFDKTVKFWRKNTISGEQVLFHLTLLPHTDFVTFLKWKQLDADKSHSKDNGSSIS
                     RNGSFKSIGGRSNISSFEDPSLTQTLYTLSTDKKLQVWSCHDINSEKTVQNWGTIQLK
                     DEQRFVFIADSTTLSKILKEDIFEKHNIVGIPDLLFIVSYNGNCEVISLENLSLNPPK
                     PMSKKILFNKPLSKSFLITEPKFVYFSDAQAYISEDTKGMLSIVIHDLGGFVQHCNVD
                     VDSLVKDSSNEIVHNNYMFTGHNKSIQRLIRSSDGEAMLTISRFSENCVWCPLKISNG
                     STLWLKNIISTEVPIVHAVVHEKGNLVILLLENQKVQAWNCPNTYINREEKKAAIIAE
                     FNLSETDEEFGHIATMFNTPEPKHNHNRHYIAIIYDNGKTRSFEVSSEGKIIEVSSDS
                     LAVSDITVQDISIIDPVHSKFVSDRPLLSLISDSGVTRIYKANVNSSFKKITWIKSNE
                     INTGIQNAKQVRGSSTGKLGVMDSSGKRFSLWDLNRGVLEYEEEFEDDIEDIDWTSNE
                     YGQSIVSIGFTGFVLLYTQVRYDYTNNIPSYLPVEKIDITEHTAHDIGDSIWLNDATF
                     VVASGNQLYIKDKSLDLSDEFVSRSIGSRKILSNDILHLNSVLNGPLPVYHPQFLIQS
                     LYCNKLNLVKELVLRLFLEVRKINLNEYDISSLPSDLNVEREKFLVKSDKDYKIEIFP
                     DPYPSFNKSVVESLIDLLTKTSLPYLTRHQQLTLITVIEAVQDLSENKDILDYNGLLF
                     LLGVRLFHAHKPAQRGLTMRDVSWALHSDSKVLLLTSLDGRIGSWQSAKDHKISFWVT
                     ENDLIRKIEQIAKFEFSDGDTRDPSKCAIYYLALKKKQVLISLWKLSVGHPEQQKMIK
                     FLNHDFTEERWRTAALKNAFALLSKHRYMDAACFFLLAGSLTDAMNVLYKQVNDIDLA
                     ITVCRLYEGDNGPILGDFLKRVFLPEAILQDDRWMTSFIYWKLRKSEVAIKALVTAPF
                     ELEDNRDLVKKVQCVNKSFLVEDPALIIMYERLRRKNIKYFIGAQEIENKIEANLIVR
                     VCDIYRRMGCDFLALSLVTNWKFMMPVKNPKIHYTQDSQKENFGINTMASEPTTTNRM
                     RPSLFDKFNDDSSNFKQYKNTLPQTNATKNMLDDFESSRNESGIANMLDDFTNSKPTP
                     QSKNLLDSFTVPSPAPQAKSLRDDFTSPTPIAKPKSLLDDFVTPTQVLEPKNVLDSFS
                     ASNKTSSVTSESKSHGPSKPTKPKNLLDDFM"
     gene            <943976..>944302
                     /gene="TPHA0B03990"
                     /locus_tag="TPHA_0B03990"
                     /db_xref="GeneID:11532809"
     mRNA            <943976..>944302
                     /gene="TPHA0B03990"
                     /locus_tag="TPHA_0B03990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684457.1"
                     /db_xref="GeneID:11532809"
     CDS             943976..944302
                     /gene="TPHA0B03990"
                     /locus_tag="TPHA_0B03990"
                     /inference="similar to DNA sequence:INSDC:YJR034W"
                     /note="similar to Saccharomyces cerevisiae PET191
                     (YJR034W); ancestral locus Anc_1.458"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684505.1"
                     /db_xref="GeneID:11532809"
                     /db_xref="InterPro:IPR018793"
                     /db_xref="UniProtKB/TrEMBL:G8BPZ0"
                     /translation="MGASCHDQKRAVAICLQRSPCVMIQRNTPQKCIEDPALSKDLPE
                     LCLAQMKAFLDCKRGMVDMTKRFTGNATLSTGKYDEQYDKLCKGDFDPRDELHKLELL
                     NSQRKE"
     gene            <944733..>947942
                     /gene="TPHA0B04000"
                     /locus_tag="TPHA_0B04000"
                     /db_xref="GeneID:11534969"
     mRNA            <944733..>947942
                     /gene="TPHA0B04000"
                     /locus_tag="TPHA_0B04000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684458.1"
                     /db_xref="GeneID:11534969"
     CDS             944733..947942
                     /gene="TPHA0B04000"
                     /locus_tag="TPHA_0B04000"
                     /inference="similar to DNA sequence:INSDC:YJR035W"
                     /note="similar to Saccharomyces cerevisiae RAD26
                     (YJR035W); ancestral locus Anc_1.459"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684506.1"
                     /db_xref="GeneID:11534969"
                     /db_xref="GOA:G8BPZ1"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BPZ1"
                     /translation="MDEAELKLKLGVNVLSQSSLEQKIENDATSLVNRQLLENEENRL
                     ERAQNALTLVLKKKVTLERKINNASRISVRNNLQDQLTKLMKTEFIAAQKDIREIKER
                     LHDIKTNNDKSNISHHKKSDRLENESEKEYLIRTGQLTAFGTRVTFQIEDEDSLSFTE
                     NSHENQRSFMLANEQMIENLTDESDLDREINNNIKDELDSEYKDDSDDSFISDEGNDD
                     EKTIDEASSTPVKYSPGEVRDDGDELNYQKRLRSWVKQRSKNRIDDKNKDINEWLKPH
                     PDIPDAKLNDNFKIPGEIFSLLFNYQKTCIQWLYELNKQNCGGILGDEMGLGKTIQII
                     AYLASLHHSDRLNGPVLIVCPATVMKQWCNEFHHWWPPLRTVIIHQIGAGMSRNRKEE
                     DMSDSELEQFIMNSNPDEYSYEDMKDHSSRTKSQIKLKSNIVNLIDKVIKDGHILITT
                     YVGLRVHSDKLLDVNWSNVILDEGHKIRNPNSEIALTCKKLRTPNRIILSGTPIQNNL
                     NELWSLFDFIYPGKLGTLPVFQQQFVIPINMGGYANATNVQVQAGYKCATALRDMISP
                     YLLRRVKADVAKDLPTKKEMVLFCKLTMYQRSKYLEFLNSKELEQIQKGKRQVLFGID
                     ILRKICNHPDLLERDNKRLEKSYGDAKRSGKMQVVKQLLLLWKKQGHKALIFTQTKQM
                     LEILEEFISFKDDALNNIKFLRMDGSTNISQRQSLVDQFNNEDFDLFLLTTRVGGLGI
                     NLTGANRIIIFDPDWNPSTDMQARERAWRIGQKREVSIYRLMVTGTIEEKIYHRQIFK
                     QFIANKILSDPKQKRFFKMNELHNLFTLGDENGHATEELEQEVQKHTKDLQDSVTKES
                     DDFEQVVSLNGVSKLESFYSGKVQEKHKTEDDHLMEGLLGKGSLESVQSQKYLEESHS
                     RASSKIVEREANKIAEQALNALKKSRKVTKKYDIGTPTWTGKFGQAGKISKGKKIKKN
                     AGSASIIANIRKAKSESKNFIKPEEDNQVLTENESILLRIREYLFHKDGNFASSSDII
                     NNIGVKLTDQDEVIKVRALLRSIATFDKEKRGWTLNYDF"
     gene            <948185..>949936
                     /gene="TPHA0B04010"
                     /locus_tag="TPHA_0B04010"
                     /db_xref="GeneID:11534995"
     mRNA            <948185..>949936
                     /gene="TPHA0B04010"
                     /locus_tag="TPHA_0B04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684459.1"
                     /db_xref="GeneID:11534995"
     CDS             948185..949936
                     /gene="TPHA0B04010"
                     /locus_tag="TPHA_0B04010"
                     /inference="similar to DNA sequence:INSDC:YEL023C"
                     /note="similar to Saccharomyces cerevisiae YEL023C;
                     ancestral locus Anc_1.460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684507.1"
                     /db_xref="GeneID:11534995"
                     /db_xref="InterPro:IPR018712"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BPZ2"
                     /translation="MGDKNKNIILCFDGTLENFGAQPFTNVLKIYQMLDTSDKSKQVC
                     YYQPGIGTSADFDQSYHFKRILTGSYIKNIVDAMFAFSLASNIKKVYQYLMKHWNYGD
                     RIYMFGFSRGAFIARVLAGMLERVGLLNEGLEHLIDMAWNIYSYWESAEQPTIPNYTL
                     SIVEEFKRTFCTSHPIEVHFQGLFDSVNSVGIIRDRSFPYTQRSNIVNHIRHALAIDE
                     RRGKFKQQNFEFDVNHQSHLISKYRRHIYVKINSESWNASSNKDKHTMWDVKSRGHFQ
                     STTRSLSPFLPPTDPLSSSKLKLSKTLELPNKLMLNLSIYSSSLDPISTKVNVEGNFI
                     IAQVPRKKLENKYCPDLVEKWFSGDHADIGGSWAINCKTQELVSTIPLRWMLAEAITF
                     GVNFKDQSIHKFDEETSTINSILTPINDCLRFAQKKHLPKLFIDTQNDLNLDTNIPGS
                     SEQNINQLKRDLQKGKNIKRTKEELLKHMFNISCGSISKPMILLWWCLEYVPIGNRII
                     TSEGRLKTIFIPNLGRTRDIPESASLHWSVYWRIKYDPNYRPNNLPTYVKNILYEFEG
                     IRFGKKNQNYYRSSMLL"
     gene            complement(<950268..>953036)
                     /gene="TPHA0B04020"
                     /locus_tag="TPHA_0B04020"
                     /db_xref="GeneID:11534782"
     mRNA            complement(<950268..>953036)
                     /gene="TPHA0B04020"
                     /locus_tag="TPHA_0B04020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684460.1"
                     /db_xref="GeneID:11534782"
     CDS             complement(950268..953036)
                     /gene="TPHA0B04020"
                     /locus_tag="TPHA_0B04020"
                     /inference="similar to DNA sequence:INSDC:YJR036C"
                     /note="similar to Saccharomyces cerevisiae HUL4 (YJR036C);
                     ancestral locus Anc_1.462"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684508.1"
                     /db_xref="GeneID:11534782"
                     /db_xref="GOA:G8BPZ3"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="UniProtKB/TrEMBL:G8BPZ3"
                     /translation="MRTKTIVAAPINPKETSIANEQNTVIKEVSINCPCCGTLLRLPN
                     DIPKVRCVVCQVSTYIEKEQNELDEPQQNSEIATCSLTTLTKIINECKLKLKQMSNEP
                     KKDITSEEKSRMFNPVRNYLVECFHSIKILNNSFFIRNEKGEVHNAIIDFKELNSFYE
                     LLIKLPTRKPFYSMLCACNDMLKRPGLEYSLNDNNASFRWILIIWSNPMIRECLYYNT
                     SSTQSQSNDNLKKRGLTRFATSEINSVSYELTKRCIGYMSTFKIISKPKFEQFVNFLK
                     VLPLDILSQYVETVNLYITFQFSRIFKSRLNENIKPPQPRITNSRYSIVGSLYHTTSN
                     SRTTTSNNNNNNNNGMYTTNNNNHNLWYNSDDDDIDDIDGSNQPSPVGEGTWNQELNN
                     NELFDKLNGVDVPSKSDFKFKLHDYDTNWHIKNAANLMTIFKLANDSRETFKKLSTQC
                     YYNMMLDFIDYKQDFENWKKTKSLNRRSTIRSIRDYTNLKNTSTSSITFCQHPTLLSL
                     GLKISIMNYEVKRIMEFEAEQAFLKSIDQHKQFDVYFKIKVRRTHITSDSLKSIKNHP
                     KDFLKSLRVEFIDEPGIDAGGLRKEWFLLLSKSLFSPMNGLFVYNKQSYLSWFNINPG
                     SVDDKNEEMYYLFGLVLGLAIFNSTILDIQFPKALYKKLCHEQLKFGDYMELYPETGK
                     SLIKLLNYNEPDFEEAFSLNFETTYDNPMFESVPDKITDSQNRKVTVELCENGSLTPV
                     TNENKDKFIQKWFDFYMNKSIEKQFTKFKTGFYEVVSQCESSKLFNSEELEKLICGER
                     ESESYDFSMLRSVCTYTGGYTNNDTIINWFWEILESWDPELQKKLLQFVTGSDRIPST
                     GISTLTFKISKLTINPYTTYNKTTIEPLPLAHTCFNELCLWEFKNKEVLEKKLKIAIT
                     ESEGYGFK"
     gene            complement(<953824..>954204)
                     /gene="TPHA0B04030"
                     /locus_tag="TPHA_0B04030"
                     /db_xref="GeneID:11535177"
     mRNA            complement(<953824..>954204)
                     /gene="TPHA0B04030"
                     /locus_tag="TPHA_0B04030"
                     /product="small nucleolar ribonucleoprotein SNU13"
                     /transcript_id="XM_003684461.1"
                     /db_xref="GeneID:11535177"
     CDS             complement(953824..954204)
                     /gene="TPHA0B04030"
                     /locus_tag="TPHA_0B04030"
                     /inference="similar to DNA sequence:INSDC:YEL026W"
                     /note="similar to Saccharomyces cerevisiae SNU13
                     (YEL026W); ancestral locus Anc_1.465"
                     /codon_start=1
                     /product="small nucleolar ribonucleoprotein SNU13"
                     /protein_id="XP_003684509.1"
                     /db_xref="GeneID:11535177"
                     /db_xref="GOA:G8BPZ4"
                     /db_xref="InterPro:IPR002415"
                     /db_xref="InterPro:IPR004037"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR018492"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:G8BPZ4"
                     /translation="MSAPNPKAFPLADAELSQQILDVVQQSANLRQLKKGANEATKTL
                     NRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASI
                     TTNDASSIKNQIYAVKDKIETLLI"
     gene            <955032..>957497
                     /gene="TPHA0B04040"
                     /locus_tag="TPHA_0B04040"
                     /db_xref="GeneID:11534747"
     mRNA            <955032..>957497
                     /gene="TPHA0B04040"
                     /locus_tag="TPHA_0B04040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684462.1"
                     /db_xref="GeneID:11534747"
     CDS             955032..957497
                     /gene="TPHA0B04040"
                     /locus_tag="TPHA_0B04040"
                     /inference="similar to DNA sequence:INSDC:YJR040W"
                     /note="similar to Saccharomyces cerevisiae GEF1 (YJR040W);
                     ancestral locus Anc_1.466"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684510.1"
                     /db_xref="GeneID:11534747"
                     /db_xref="GOA:G8BPZ5"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001807"
                     /db_xref="InterPro:IPR014743"
                     /db_xref="UniProtKB/TrEMBL:G8BPZ5"
                     /translation="MSKYGPLSMGMDDAFDDSNNAVSPDFNSNSTGETVEKMIPEVAR
                     FDQFTTIDWIAEESTPVLLTNGALINVSNINDIDSNNENNGRAEFSRFGNYKKLIWER
                     SRAVITLTLIAITIGCIAAFLQIFTETLVNWKTGHCKRNWILNKSFCCSIDLSEEGKS
                     EDPVGKFVEAGMNFRKRMFMELSKREELDCVDDGLWVNRSGILAPFITFMLFSILFAL
                     ASNLLVKYVAPSATGSGISEIKVWVSGFQYNDKFLNIVTLFVKSIALPLAISSGLSVG
                     KEGPSVHYATCVGYVITNWLLKDVLTFSQQSEYLTATSAAGVAVAFGTPIGGVLFGLE
                     EIAPTNEFKLSTLWKSYYVALGAVATLKFINPFRNGMIVLFNVTYDRYWKASEIPIFI
                     LLGIFGGLYGKYVSKWNIHYVQFRRKYLSSWPTQEVLILTVFTAFISYFNEFLKLDMT
                     ESMGILFHECSSLNSGEESTFSHRLCTMDKNPTIASFIQITTSLAFATIFRTIMVVMS
                     YGAMIPAGIFVPSMAVGATFGRFVSLFVERIINDQSSITPGTYAFLGAAAALSGITNL
                     TITVVVIMFELTGAFIYIIPTMMVVAITRLVLEHEKVFGGIADQMILVNGFPYIELDS
                     EDTFMRQHTAEDIMTKDLKYLSETMNLSEIKDIVYSHAGSVLKGFPIIRDFDQSEPDK
                     VMIGYVLKKHLLAKLEEPDFMFTDEESVVVNFIEAKNDNNRVLDEALSLINFSDVVNF
                     SPITVKPNTPVSLLFRMFKQLGCKTIIVESQGIIKGLITVKDLLRFERSKHREIYGPF
                     YPESEFLSERFWPIVKQLINRFR"
     gene            complement(<957878..>958363)
                     /gene="TPHA0B04050"
                     /locus_tag="TPHA_0B04050"
                     /db_xref="GeneID:11535065"
     mRNA            complement(<957878..>958363)
                     /gene="TPHA0B04050"
                     /locus_tag="TPHA_0B04050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684463.1"
                     /db_xref="GeneID:11535065"
     CDS             complement(957878..958363)
                     /gene="TPHA0B04050"
                     /locus_tag="TPHA_0B04050"
                     /inference="similar to DNA sequence:INSDC:YEL027W"
                     /note="similar to Saccharomyces cerevisiae CUP5 (YEL027W);
                     ancestral locus Anc_1.469"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684511.1"
                     /db_xref="GeneID:11535065"
                     /db_xref="GOA:G8C1I0"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR011555"
                     /db_xref="UniProtKB/TrEMBL:G8C1I0"
                     /translation="MSTDLCPVYAPFFGAMGCAAAIIFTSFGAAYGTAKSGVGICATC
                     VLRPDLLFKNIVPVIMAGIIAIYGLVVSVLVCYSLGQKQALYTGFIQLGAGLSVGLSG
                     LAAGFAIGIVGDAGVRGNSQQPRLFVGMILILIFAEVLGLYGLIVALLLNSRATQDVV
                     C"
     gene            complement(<958989..>960167)
                     /gene="TPHA0B04060"
                     /locus_tag="TPHA_0B04060"
                     /db_xref="GeneID:11534710"
     mRNA            complement(<958989..>960167)
                     /gene="TPHA0B04060"
                     /locus_tag="TPHA_0B04060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684464.1"
                     /db_xref="GeneID:11534710"
     CDS             complement(958989..960167)
                     /gene="TPHA0B04060"
                     /locus_tag="TPHA_0B04060"
                     /inference="similar to DNA sequence:INSDC:YJR043C"
                     /note="similar to Saccharomyces cerevisiae POL32
                     (YJR043C); ancestral locus Anc_1.470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684512.1"
                     /db_xref="GeneID:11534710"
                     /db_xref="UniProtKB/TrEMBL:G8BPZ7"
                     /translation="MSDTLNTKIIEFINERLFTDVQAVQFQDLMSAFAVSHLQAKGFM
                     YEYYKQTTGMKFNCVILCVFKDGDMKIVNDISSFDSLNQDIVDCFIYAFNPMKEYIPM
                     SSISDHYKSLTIKNSVEYKGKIAEVNVASSVPKIVNRSHTADVSESKGTSTMSQRSKT
                     IAADGKNEAKSVKLNSSTTKSKPGSSLRSTEILAKMKRAREEKEEERQNELKKRKDEQ
                     NKKMQNDPKRKKQLESLKGIFDDEDEDDVELASEAADASTQETHLKTEEEKKVPAKTE
                     KDYENLEDLLDTTAEESLLGIKNPSSPKKVEALDEEENKEVPEEVSSSFVDEEGYIVT
                     QRPAPKTKTPSKSKQKPKTLPSSANKDKIKQESALKTRTTGVKKQTTLEGFFKKSSKK
                     "
     gene            complement(961091..961162)
                     /gene="TPHA0Btrna8M"
                     /locus_tag="TPHA_0Btrna8M"
                     /db_xref="GeneID:11535069"
     tRNA            complement(961091..961162)
                     /gene="TPHA0Btrna8M"
                     /locus_tag="TPHA_0Btrna8M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:11535069"
     gap             962411..963520
                     /estimated_length=1110
     gap             963766..963789
                     /estimated_length=24
     gene            964368..964438
                     /gene="TPHA0Btrna16G"
                     /locus_tag="TPHA_0Btrna16G"
                     /db_xref="GeneID:11534828"
     tRNA            964368..964438
                     /gene="TPHA0Btrna16G"
                     /locus_tag="TPHA_0Btrna16G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11534828"
     gene            <964764..>970793
                     /gene="TPHA0B04080"
                     /locus_tag="TPHA_0B04080"
                     /db_xref="GeneID:11534734"
     mRNA            <964764..>970793
                     /gene="TPHA0B04080"
                     /locus_tag="TPHA_0B04080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684465.1"
                     /db_xref="GeneID:11534734"
     CDS             964764..970793
                     /gene="TPHA0B04080"
                     /locus_tag="TPHA_0B04080"
                     /inference="similar to DNA sequence:INSDC:YJL207C"
                     /note="similar to Saccharomyces cerevisiae LAA1 (YJL207C);
                     ancestral locus Anc_1.127"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684513.1"
                     /db_xref="GeneID:11534734"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BPZ8"
                     /translation="MATSLLDRLSGSDNKRHELFVWSISKFELLSAFHNVSKSDTEKI
                     QFYHQSAKDTLDELNLLLRYLTSTEDANDYESHFVFIRIGQIYSLSLFILEDESPGKI
                     FDESEFLIKILSEEDIAIYASNTDDKKKKSPSSNKTHYVYTPAKDLATTILIQIVETF
                     GKELSSLAPLLNTLIFKYFKKMMEKSKYQHATFMTSLLRLYNALFRNCKDFVLDSTYT
                     SKFIKLSKVVFNDIYNDLQDYPVDFISTIIELWKIHFTHDAFIKQHSNNITNGLFVKF
                     IEAEIGIYGFSNDSSRIYTARVLSEILFDYYANKKIITLDEVWEFYTRAYVNAVSRDT
                     TSGCFESIINFIGLCLIVDKNFLSESNYIRIFTAICEIFKSENLIDIQMDSISRSIRY
                     LRYMHMILLPKLGESSKIMTLFNLLNPSTSNIDPDDSIASVFNNDTSDDMSINATVDT
                     QWLTVAQLDLSRILISSLSSSFGLEERIIRQIKDRIVNLSTNEIFNIRVHSNELLKEF
                     LTQFPQYLSETISDSLAFLTSEFKKKDKFSFAKAHGHALIIANVMEIADKDFVSFELI
                     MRITIFTTSFIKTHTTTTSDDIYYKGISCWVLLVGLMSYSDEQYIMMQTHQLFLFWKV
                     LLSPSFIYKNEDELYRNLEIRNHALACMLTYLNNIKIDEETGKQVSYLLTKCSNFNHS
                     ISLKSKKIDNVLLMNENRILQVYVKIHQYVKGNFNSSLLILIMKNFSNPNIYTEQTAS
                     YIASFYDDRKYRTVEEGKEEILQENTVNNLLRLNDGFSFGLSSKLTGLGISNNSLQQK
                     KHTISNISGGWPSKDYCWYYQFEDEVLRPISQVLSYDHLSMIYDTQFDSADPVYSPKV
                     TTSVIDSSMDIFSFVFPYLNSSIQTSVIENLNLSIYSKSATPMRRIAIAANVCVAIHN
                     TLQIFQKQELALDEQAGKLILESIKKIEFYNDSYITKLKADSNGLIIAAVVRGLPEEE
                     KANFVRSQTHMLINSVAETTEPYFRVFHTLSLATIFKYNSKYTQFEPIFDVIMTLIRD
                     PHPVVHSWALKSLHVLLEKHLMIDIRTSVEIIKTLEELLTDPSYGLYGCSTLRYNYNM
                     EFNSHIVISEIMKALTETVGPSLPELSESGALLSFKNIIISSTISSDIIFQIISSQVY
                     ENIATFKLDNILADHIFITLSKSIILNAVNIGIGSSYSNCKYTKCSELVASTSSLRAA
                     TEQFHILGQLFKLQKKQLFITDMEHLSWMYLSIYPKSKYVQEYFFEWLANCYTDDSHW
                     FEKLYLMFGISRKNVFQRFYKAYDTLLSKKGMLITEEKDLKNEDEDSINQKERDNQNQ
                     EVYSDKVPWQTQEVILKLMEYVLKEDPKNAVLAQNVSKLINIACQASSMSIISIKNLG
                     LNILSNILKQFSEIRDSQNPDKSILEQQEASITSSLMSAFSNGDSPRTIAVAINVAAE
                     FIASDIVPLAHLTRISKLFVTLLSNFNDKGSVLKIEDCVIKTQKAKKKIELSALNAWA
                     GIVKHAIISDNKELLNFINSYSDFLIPLWIISLREYVMIKYGRNMIIQSDEDNSIEGL
                     IESKKTKVELYEPIWLNFVEVLGLLMEKDQGLILNSLNENEIDSFMFVLLTQCIEKIT
                     SNFDNHAIKGHILPVIHNILRSNVPFGILFEDSIYIEVIGILDRLILTGSTEEKIAIV
                     DILNALIHAYTIRNTSEDEFLQGIDKLYELLRLLLNIVSDLVPFIKFNNFEGNSSNSD
                     ILSKQEIILLKKAFHVLELNISQFDDIFKLDLYTCLLFIIGRIFESEEHDILVPTVLP
                     LLKFISMDIIMNGLNIELLHIFYGSVKPIIFNQLSKQNTIATILMLTSVGYPGFTEKE
                     TDFITNTLLESLKISETSAITAQGLKTVIKNCFSNNASKVLTFKVLKKILNDLDSVEL
                     QNESSVIFSLIFELTKAINKDNDAKLVPAIVVCISFAMWYYMISPGNHEEASSVIITI
                     AKLNPEKFKITLASAFNQAQKKLIEKIVEESTSTKNDSSNLKSSVELKTFT"
     gene            <971109..>972107
                     /gene="TPHA0B04090"
                     /locus_tag="TPHA_0B04090"
                     /db_xref="GeneID:11534912"
     mRNA            <971109..>972107
                     /gene="TPHA0B04090"
                     /locus_tag="TPHA_0B04090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684466.1"
                     /db_xref="GeneID:11534912"
     CDS             971109..972107
                     /gene="TPHA0B04090"
                     /locus_tag="TPHA_0B04090"
                     /inference="similar to DNA sequence:INSDC:YJL208C"
                     /note="similar to Saccharomyces cerevisiae NUC1 (YJL208C);
                     ancestral locus Anc_1.126"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684514.1"
                     /db_xref="GeneID:11534912"
                     /db_xref="GOA:G8BPZ9"
                     /db_xref="InterPro:IPR001604"
                     /db_xref="InterPro:IPR018524"
                     /db_xref="InterPro:IPR020821"
                     /db_xref="UniProtKB/TrEMBL:G8BPZ9"
                     /translation="MSYKNIFTGLAGIGLGGSAATYFFGNTKASTTTQVGNVPAVSTG
                     KGKPSGTFSAVGSDLNPAGFYKYGFPAPIHDLDTKEQYISCYNRQTRNPYWVIEHITP
                     DSLSKRNSDRKYSVFTENELIPEMFRAKLSDYFRSGYDRGHQVPAADAKYSQNVMNDT
                     FVLTNICPQVGEGFNRDYWAHFEYFCRSLTKEYSSVRIMTGPLYLPKKDPIDGKFKIS
                     YEVIGNPPAVAVPTHFFKLIVAETPMKNPKSSSVSVAAFVLPNDKIPNETKLTDFEVP
                     VNALERSTGLELLKLLPENRRKKLCEEVNCQIVVREFNNANNNSKAPLALPPPKTN"
     gene            complement(<972228..>974201)
                     /gene="TPHA0B04100"
                     /locus_tag="TPHA_0B04100"
                     /db_xref="GeneID:11534721"
     mRNA            complement(<972228..>974201)
                     /gene="TPHA0B04100"
                     /locus_tag="TPHA_0B04100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684467.1"
                     /db_xref="GeneID:11534721"
     CDS             complement(972228..974201)
                     /gene="TPHA0B04100"
                     /locus_tag="TPHA_0B04100"
                     /inference="similar to DNA sequence:INSDC:YJL209W"
                     /note="similar to Saccharomyces cerevisiae CBP1 (YJL209W);
                     ancestral locus Anc_1.125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684515.1"
                     /db_xref="GeneID:11534721"
                     /db_xref="UniProtKB/TrEMBL:G8BQ00"
                     /translation="MRQIATAMVNNRMLNSIVLNTRKKCNIIAVRSVHTNNIKEEHMH
                     LLSNISTIFMNNNDLRSQEIKSAMQKYWNLRDNQSYKIKDFSILKSIGMTQYIQFIGT
                     WFHSSSILRMVFYRELIYHSKDSIDVCNHIVRSWEQNIDKNQHAGNKIFKTQFDVFNY
                     CIDSSLGRKDIVIAYDLYILYYKLFPNEPLDERIAKTLVTTITYLNPRFDDIYLMKFL
                     QLLNLYEERKIALKLNRYQISSLSNKTLANKDMILVNKIILEKLMKIDIEDSPDQATT
                     VNDRLTIACNLIKYDYSIKNGAGVYRTWEEIRGMKVNINHIDSRIIYRVLEIASRNKK
                     YRSLGVDIIKNLSPSVYCNDQLILPSIINFATRTKNLKLIEQIMKKINQKLHPDNFTL
                     VLQSKRCLSTLLRMHLVFNDSDGVDNVLKQIKEIFKEPDEEHYQAIITHLVKENSKMG
                     FQKALNLVYSVPVSKSLNSSSTIIDHLLQTSLFKNTGTMNNHVLNIISKLISRAHEAD
                     IHHNHSFWETIASIYIKNILKAYSLNTKKLTTDLDNLNQIDMLGLAKLIYQNSSQMKK
                     KNWDDISFNPFASLSPTDIKLKITKKNREVILKNISLVASRYERFDICHWCSSELYIH
                     GMTQEDLKLELNLTINKKFREKNLITTKNTKRL"
     gene            complement(<974549..>975319)
                     /gene="TPHA0B04120"
                     /locus_tag="TPHA_0B04120"
                     /db_xref="GeneID:11535012"
     mRNA            complement(<974549..>975319)
                     /gene="TPHA0B04120"
                     /locus_tag="TPHA_0B04120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684468.1"
                     /db_xref="GeneID:11535012"
     CDS             complement(974549..975319)
                     /gene="TPHA0B04120"
                     /locus_tag="TPHA_0B04120"
                     /inference="similar to DNA sequence:INSDC:YJL210W"
                     /note="similar to Saccharomyces cerevisiae PEX2 (YJL210W);
                     ancestral locus Anc_1.124"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684516.1"
                     /db_xref="GeneID:11535012"
                     /db_xref="UniProtKB/TrEMBL:G8BQ01"
                     /translation="MAGNMRAAHFDALELRDSLDTWFKTQLGTDNREALLLADTLFFN
                     ATNQSHANGTTKNLFLSLTTEGAYSSSKRLLFLMDVVGHYVIKRLHSTMLTVTGWPSQ
                     IWRQAVKFYGLADLLNFLFFLNGATSISPLYTLCKVHITLSNAQLRPEYYQNSMLASV
                     QLHNRQLLWNSVLELFSILLLNPWFNTRLRRAIKSSRTSPIENHGDNCMSCGLFPTNT
                     HFTDCCSSLYCYACVLDTLDLQRCIVCHSNNFKALPYY"
     gene            complement(<975513..>976463)
                     /gene="TPHA0B04130"
                     /locus_tag="TPHA_0B04130"
                     /db_xref="GeneID:11534902"
     mRNA            complement(<975513..>976463)
                     /gene="TPHA0B04130"
                     /locus_tag="TPHA_0B04130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684469.1"
                     /db_xref="GeneID:11534902"
     CDS             complement(975513..976463)
                     /gene="TPHA0B04130"
                     /locus_tag="TPHA_0B04130"
                     /inference="similar to DNA sequence:INSDC:YLR348C"
                     /note="similar to Saccharomyces cerevisiae DIC1 (YLR348C);
                     ancestral locus Anc_1.123"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684517.1"
                     /db_xref="GeneID:11534902"
                     /db_xref="GOA:G8BQ02"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8BQ02"
                     /translation="MPEKYPWWYGGCGGLVATFCTHPLDLTKVRLQTAPLGVDGRKPN
                     MLRMMASVDGRKPNMLRMMASVFRNEGLVGLYSGLSAAVLRQCTYTTARFGCYDLLKE
                     HVIPQNQLNNIWYLLPSSMLSGAIGGLVGNPADVVNIRMQNDTSLPVAKRRNYRNALD
                     GLYRIVLVEQNGGVRRLYAGWQPNLMRGVLMTASQVVTYDLFKNYLVSTLHMAPSEKK
                     THFTASLMAGLVATTVCSPADVMKTRIMNSHKHHEPVLASLLAEIRNEGIGFIFRGWV
                     PSFVRLAPFTVLIFLTVEQLKKHRVGMPSRDTATTAPTTD"
     gene            <977141..>977467
                     /gene="TPHA0B04140"
                     /locus_tag="TPHA_0B04140"
                     /db_xref="GeneID:11534845"
     mRNA            <977141..>977467
                     /gene="TPHA0B04140"
                     /locus_tag="TPHA_0B04140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684470.1"
                     /db_xref="GeneID:11534845"
     CDS             977141..977467
                     /gene="TPHA0B04140"
                     /locus_tag="TPHA_0B04140"
                     /inference="similar to DNA sequence:INSDC:YNL244C"
                     /note="similar to Saccharomyces cerevisiae SUI1 (YNL244C);
                     ancestral locus Anc_1.118"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684518.1"
                     /db_xref="GeneID:11534845"
                     /db_xref="GOA:G8BQ03"
                     /db_xref="InterPro:IPR001950"
                     /db_xref="InterPro:IPR005874"
                     /db_xref="UniProtKB/TrEMBL:G8BQ03"
                     /translation="MSIENLKSFDPFADTGDDETATSNYIHIRIQQRNGRKTLTTVQG
                     VPEEYDLKRILKVLKKDFACNGNIVKDSEMGEIIQLQGDQRAKVCEFMITQLGMQKKN
                     IKIHGF"
     gene            <977716..>978162
                     /gene="TPHA0B04150"
                     /locus_tag="TPHA_0B04150"
                     /db_xref="GeneID:11534961"
     mRNA            <977716..>978162
                     /gene="TPHA0B04150"
                     /locus_tag="TPHA_0B04150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684471.1"
                     /db_xref="GeneID:11534961"
     CDS             977716..978162
                     /gene="TPHA0B04150"
                     /locus_tag="TPHA_0B04150"
                     /inference="similar to DNA sequence:INSDC:YNL245C"
                     /note="similar to Saccharomyces cerevisiae CWC25
                     (YNL245C); ancestral locus Anc_1.117"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684519.1"
                     /db_xref="GeneID:11534961"
                     /db_xref="InterPro:IPR019339"
                     /db_xref="InterPro:IPR022209"
                     /db_xref="UniProtKB/TrEMBL:G8BQ04"
                     /translation="MGSGDLNLLKSWNPKLVKNREKVWVKEKELINEELKLKERQLEL
                     QKEKELDELVGAKTRALDWMYNDPLASSQTQNNDYLLGKKKLDASVVKKDSSTEELKK
                     DPTTNLVSQRQKFDYSLDDPMSAINKAKRKQIKKKNGKKQPKVHKQ"
     gene            complement(<978223..>979068)
                     /gene="TPHA0B04160"
                     /locus_tag="TPHA_0B04160"
                     /db_xref="GeneID:11534812"
     mRNA            complement(join(<978223..978994,979061..>979068))
                     /gene="TPHA0B04160"
                     /locus_tag="TPHA_0B04160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684472.1"
                     /db_xref="GeneID:11534812"
     CDS             complement(join(978223..978994,979061..979068))
                     /gene="TPHA0B04160"
                     /locus_tag="TPHA_0B04160"
                     /inference="similar to DNA sequence:INSDC:YNL246W"
                     /note="similar to Saccharomyces cerevisiae VPS75
                     (YNL246W); ancestral locus Anc_1.116"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684520.1"
                     /db_xref="GeneID:11534812"
                     /db_xref="GOA:G8BQ05"
                     /db_xref="InterPro:IPR002164"
                     /db_xref="UniProtKB/TrEMBL:G8BQ05"
                     /translation="MSDDVIESKAFLQLAESELKVDQIEKDVEEYRLSKMKPLYVERD
                     LIIEKIPDFWKIVLSQHSDFANYLRASDFTYVDCIEDVKVNWETVDKFSITIKFSGIE
                     GDFEAQTVTKHFSRQRVIDDGNTGRKGNEEEEEEEEGELLSSEVVDIKWPNKYDKINP
                     DKIEDKKSNEGKKNYRTGMKSLFAWFRWTGLKPGKEFPHGDSFVTLFVEDLYPYCVKY
                     YTEAQRDLEDENDDTGSEGHSSEGELELENDDEPPAKKTKI"
     gene            complement(<979327..>981627)
                     /gene="TPHA0B04170"
                     /locus_tag="TPHA_0B04170"
                     /db_xref="GeneID:11534955"
     mRNA            complement(<979327..>981627)
                     /gene="TPHA0B04170"
                     /locus_tag="TPHA_0B04170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684473.1"
                     /db_xref="GeneID:11534955"
     CDS             complement(979327..981627)
                     /gene="TPHA0B04170"
                     /locus_tag="TPHA_0B04170"
                     /inference="similar to DNA sequence:INSDC:YNL247W"
                     /note="similar to Saccharomyces cerevisiae YNL247W;
                     ancestral locus Anc_1.115"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684521.1"
                     /db_xref="GeneID:11534955"
                     /db_xref="GOA:G8BQ06"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR015803"
                     /db_xref="InterPro:IPR024909"
                     /db_xref="UniProtKB/TrEMBL:G8BQ06"
                     /translation="MCLVKYISKRIMSSSAPKIVQPKWHVPGATSSPDKRVLKLYNSL
                     TRSKVEFIPRSGTKEVSWYSCGPTVYDASHMGHARNYVSIDINRRILQDYFGYNVNFV
                     QNVTDVDDKIILRARQNYLFDKFVESNQTIDDTVVKKVMDSLLQYISKKLKQEDIKTI
                     DEYKVWMKSVDVEQKKIEDPKFPMHVTAINNAVRALSNVNDKEFYPLVKDVFVPLLDK
                     ELGSTIKDPEVFRKLPAYWEDQFNNDMAKLNVQFPDVTTRVSEYIPEIITFIEKIIAN
                     GYAYATSDGSVYFNTSKFDKAENHHYAKCQPWNKGQLDLINDAEGSLSNFSDLNGKQS
                     ASDFALWKASKPGEPEWQSPWGKGRPGWHIECSVMCSYILGENIDIHSGGVDLAFPHH
                     DNELAQSEAHFDNDQWINYFLHTGHLHIEGQKMSKSLKNFITIDEALKSYSPRQLRLA
                     FSSVQWNNQLDFKESLINEVKSTETAFNNFFANVRALNNDYKNNLAAADDYIPKRVGN
                     LEIQLLKDLKEAQEKVDIAFCDNLSTPQVIKALNDLISVSNTYISTSGSNIKIEPVLS
                     VCKFITKIVGVLGFPIRSDSLGWEEPSTSSTNGGASVEETVMPYVQVLAKFRDSVRSM
                     AIDKTDLNEFLKLTDKIRDEELLNLNIALDDRNGQSSLVKFLSDKEKADMIKFNSEKL
                     AKEQEKLAKKLAQQKLNEAKEKERMEKAKVAPEDMFKTDAYTEWDAQGLPTKDKEGNE
                     VTKSMTKKLRKQWDQQKKLHDEYLSK"
     gene            <982736..>984742
                     /gene="TPHA0B04180"
                     /locus_tag="TPHA_0B04180"
                     /db_xref="GeneID:11535052"
     mRNA            <982736..>984742
                     /gene="TPHA0B04180"
                     /locus_tag="TPHA_0B04180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684474.1"
                     /db_xref="GeneID:11535052"
     CDS             982736..984742
                     /gene="TPHA0B04180"
                     /locus_tag="TPHA_0B04180"
                     /inference="similar to DNA sequence:INSDC:YJR098C"
                     /note="similar to Saccharomyces cerevisiae YJR098C;
                     ancestral locus Anc_1.114"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684522.1"
                     /db_xref="GeneID:11535052"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BQ07"
                     /translation="MVELAPPENKINSNLDNGIEINIAKKARHVGSDLGKDRRHPNKS
                     EKKHEKISNSEASRIIGGADVRSSASRKQNNDIEFNALSDADSDSEVQSEESVDDVAE
                     SLESYSGESICSNANSDVNSEELELHPFESHKIFSFQLPFGGKSNTSTMSKLKSILTT
                     PLPEFGESSELQVRKARVKEKLRRQESISTIEEQILFRDAKGMGNVRSMAIKESLHMG
                     SLKNTIRTISNDFHRITGDTSVPELDRIETIFDELEGDLVIMGGYRGSILRDKKTGRR
                     VWIPIKTALNLREEDLLIGPTKNDEMQEEDKIKPDDMLKNVGPIDVSRKLIKRLRSSG
                     KLHVEEFGYDWRLSLDIPAKHLLDKLQSLYDTQVEKKGVYIVAHSMGGMVTHKVLQTH
                     THLIRGVIYVGCPSQCPNILGPIRFGDEVMINKKILSPEANFFMRSSFSFLPIDGRCF
                     VDKKQKKRYDLDFFDPDVWVELGLSPLVNKKRKEYFGELKSTESVTSLTGFNTYLSGS
                     QKLIQTLNPMKLLKSVTSSEDLVEDIQEESFEFKTSYEDSYSYLKRTLAETKDFLNSL
                     NYIPEKKYPPLAIVYGNKVPTVRGAKVNGLDDIKEGRYFDFYYGPGDGVVHHKWLLPE
                     RRGFPVDAKIPSRAGHVSLMTDMKAMGKAFIALVDNEKVAKKHK"
     gene            complement(<984952..>985458)
                     /gene="TPHA0B04190"
                     /locus_tag="TPHA_0B04190"
                     /db_xref="GeneID:11535176"
     mRNA            complement(<984952..>985458)
                     /gene="TPHA0B04190"
                     /locus_tag="TPHA_0B04190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684475.1"
                     /db_xref="GeneID:11535176"
     CDS             complement(984952..985458)
                     /gene="TPHA0B04190"
                     /locus_tag="TPHA_0B04190"
                     /inference="similar to DNA sequence:INSDC:YJR097W"
                     /note="similar to Saccharomyces cerevisiae JJJ3 (YJR097W);
                     ancestral locus Anc_1.113"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684523.1"
                     /db_xref="GeneID:11535176"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR007872"
                     /db_xref="UniProtKB/TrEMBL:G8BQ08"
                     /translation="MTGYTLRVSHYEVLGVTTDSTLMDIKRAYKEKLLNVHPDKNKGQ
                     APKSNTYSVNQIQEAYGVLAEQTLRTQYDASLELIQKANGFYNNGEGLDEYSLDGFRF
                     NEETLLYSIDCPRCKTKDGMHISEKLLERHVDENDLSDDGYLVLIQCVSCSLWIKVNF
                     EQGETDEE"
     gene            <986014..>987243
                     /gene="TPHA0B04200"
                     /locus_tag="TPHA_0B04200"
                     /db_xref="GeneID:11534884"
     mRNA            <986014..>987243
                     /gene="TPHA0B04200"
                     /locus_tag="TPHA_0B04200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684476.1"
                     /db_xref="GeneID:11534884"
     CDS             986014..987243
                     /gene="TPHA0B04200"
                     /locus_tag="TPHA_0B04200"
                     /inference="similar to DNA sequence:INSDC:YNL248C"
                     /note="similar to Saccharomyces cerevisiae RPA49
                     (YNL248C); ancestral locus Anc_1.112"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684524.1"
                     /db_xref="GeneID:11534884"
                     /db_xref="GOA:G8BQ09"
                     /db_xref="InterPro:IPR009668"
                     /db_xref="UniProtKB/TrEMBL:G8BQ09"
                     /translation="MSNENIKVDGYQNEVSAVVGNFFKGCAIPEDTKFDLYENKKSKD
                     GKYVIHGQNKRLEYEGASDELVSQSNQYVVGVFNPEKKKVELYRVPLLKSKVISKSSK
                     NLAGPKIKSDETRMSVLRNKLGEAFGTKKAKKAITDLEKNRIDADKLAGSAIDIVASV
                     RTAAKDLPTRAELQESLSNDRPTPLANVDATDVEQVYPIHNIISKKELAFIRVGPLMK
                     EDDSEKKLEMLPYTKSHYISKKLESISQSENMTKMQLLYYLSLLLGVYDSRRVNNRVK
                     LMERLNSPPDAIVDGIFDKFTILRASHFGKSKDRSFFIDPQHEDKLLCYILAIILHLD
                     NFIVEISPLAQELNIKPSRLVNLFRILGCIVKGATVSQAEAFGIPKSTASTYKIATLK
                     VPFRLPEMVRRGRGPQR"
     gene            complement(<987462..>991373)
                     /gene="TPHA0B04210"
                     /locus_tag="TPHA_0B04210"
                     /db_xref="GeneID:11534725"
     mRNA            complement(<987462..>991373)
                     /gene="TPHA0B04210"
                     /locus_tag="TPHA_0B04210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684477.1"
                     /db_xref="GeneID:11534725"
     CDS             complement(987462..991373)
                     /gene="TPHA0B04210"
                     /locus_tag="TPHA_0B04210"
                     /inference="similar to DNA sequence:INSDC:YNL250W"
                     /note="similar to Saccharomyces cerevisiae RAD50
                     (YNL250W); ancestral locus Anc_1.110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684525.1"
                     /db_xref="GeneID:11534725"
                     /db_xref="GOA:G8BQ10"
                     /db_xref="InterPro:IPR004584"
                     /db_xref="InterPro:IPR007517"
                     /db_xref="InterPro:IPR013134"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BQ10"
                     /translation="MSAIYKLSIQGIRSFDSNDRETIEFGKPLTLIVGSNGSGKTTII
                     ECLKYATTGDLPPNSKGGAFVHDPKITGEKDIRAQVKLAFTSANGLNMIVTRNIQLLV
                     KKTNNTFKTLDGQLVSITQDGYRSTLSTRTTDLDTHVPLYMGVPKAILEYVIFCHQED
                     SLWPLSEPANLKKKFDEIFQAMKFTKALDNLKVIKKDMSVDIKLLKQSVEHLKVDKDR
                     SKATKFNIEKLQHKCEQFKKTVKEIESQLVDITKQSDEVFKTNQDFQKVLAHLENLKR
                     NREYISHQINRLSETINVISLPVEEIEQNLVIFDRDTATKDDQIKQLENDISELKQNV
                     NQIQEQSNILLEKQGKLKSYYDIYINNLSSLKNLKENVSRQYNINKEFSDETFQTALN
                     DHLDKENNHLLQLNNTFSNELEGLNSKKSTLDYDLVVQLQQQEYNKKDKIKASEKLDN
                     IHTELIKITCTEEELNVEKENLTKYIDKLKIADGNDTATDVNLEIKKENDHMLLLEKE
                     LEETQEMITKANKQSDLYAKLALIKKSSSEKQMLFDKNLNILSMNPVILSEPIIIDEN
                     IEITFNTFFKNLQKNLEDDNNKLQSITREYTEADIRTENCKEELDKTENLIGRLEKKL
                     VEMLPEDCPIDEYDDALLESEASYKTAVENLKMHQTTLAFNRKALEVAENSNCCYLCS
                     REFDSTGLKSKLLNELKAKTNQQFELDLVETMKHEKEYLDSLRKLEKDVNSLFNEREL
                     VNKLKTDFESNKTKSDKLRAEVKIQDAHIKSLKEKLETVTSTIRPLIEENFHLQKEIS
                     SLNNDLQNITDELKLYNISSDGLLTLEELQSKQTLCNQTLREKRKKISLLQDGRESRA
                     KEKATLSGIIKDRSLKVEKMKNDLLKKESLENERNLKLEEVSNIEVRLNSFEKDVKLL
                     QNKITEINANITKLKDQHDKAALNKKEIIEGLSKTMDQFKTLQNSIKEFELTGNADLK
                     ACNEELEDYKSKLKNINVAIDQKTANLSKLKEELIDSNSRKKNLMDNLELHSLKVKLS
                     NTEKEINCIDVENAERQRDKYQEEISRLRNLYEQLSADNAGKLGEIKQLQNQIDSLSH
                     QLHTDYKDIDNKYKTEWAKLQTKTFVTEDINTYSKALDSAIMRYHGLKMQDINRIIDE
                     LWKKTYSGTDVDSIQIRSDETSSTVKGKSYNYRVVMFKQDAELDMRGRCSAGQKVLAS
                     IIIRLALSETFGVNCGVIALDEPTTNLDEENIESLAKSLHNIIQFRQHQKNFQLIVIT
                     HDEKFLNNMNASQFSDHFFKVKRDDRQKSLIEWVDINKVVD"
     gene            <992359..>994167
                     /gene="TPHA0B04220"
                     /locus_tag="TPHA_0B04220"
                     /db_xref="GeneID:11534952"
     mRNA            <992359..>994167
                     /gene="TPHA0B04220"
                     /locus_tag="TPHA_0B04220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684478.1"
                     /db_xref="GeneID:11534952"
     CDS             992359..994167
                     /gene="TPHA0B04220"
                     /locus_tag="TPHA_0B04220"
                     /inference="similar to DNA sequence:INSDC:YNL251C"
                     /note="similar to Saccharomyces cerevisiae NRD1 (YNL251C);
                     ancestral locus Anc_1.109"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684526.1"
                     /db_xref="GeneID:11534952"
                     /db_xref="GOA:G8BQ11"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR006569"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BQ11"
                     /translation="MSEVGDFQDFVTTLESFRDLKSGISGSRIKKLTTYALENVNDGE
                     KIMNVIINYSKTCPPSHKLGSLYIIDSIGRAYLDEKRAKDEIINSEAKHGSFAHALYI
                     LGQVIESLIIEATEKSIEDNKDKIRTLIDIWDRAGLFRKDILNSVRAKCFSMNVYQNN
                     TPHSNTNEITNNVKVASLSTGQNDQILPEDIKDRCIAILDNLKPLPVVPDVELPEKLS
                     SSDLSEQQIALFQLLSNIHLQTSGPVVSSTRDNNNVAGHVTTEYGSRRDREREREFTN
                     KRTRSKSPPQQHKRKQNYGQDYSNNNTHNSHNSHNSNTNSSSSSANQNNNHHLYPDER
                     NVQSNQHYRQNTVSYDPSIPPDCVKVLSRTLFIGGVPPTMREWDLANAMQPFAAVQSV
                     ILNNARKHAFVKVYSRQEAENALAHFNKDGALPLRTRWGVGFGPRDCCDYQHGYSIIP
                     LHRLTDADKMWSTSAQWGGTNNEPLVPGIVFEEPDINISEGVSSKSISYKVPSDSIRS
                     QQNYQNVMHHHPQPPQQQQQQMMYGGYQDTKYNNNNFMPPPPPQQQYNQHMPPQPHMP
                     HMPPQPHMPPQQQPQGFDPTAQLNSLMSMLNQQPPR"
     gene            <994626..>995438
                     /gene="TPHA0B04230"
                     /locus_tag="TPHA_0B04230"
                     /db_xref="GeneID:11534942"
     mRNA            <994626..>995438
                     /gene="TPHA0B04230"
                     /locus_tag="TPHA_0B04230"
                     /product="mitochondrial 54S ribosomal protein YmL17/YmL30"
                     /transcript_id="XM_003684479.1"
                     /db_xref="GeneID:11534942"
     CDS             994626..995438
                     /gene="TPHA0B04230"
                     /locus_tag="TPHA_0B04230"
                     /inference="similar to DNA sequence:INSDC:YNL252C"
                     /note="similar to Saccharomyces cerevisiae MRPL17
                     (YNL252C); ancestral locus Anc_1.108"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL17/YmL30"
                     /protein_id="XP_003684527.1"
                     /db_xref="GeneID:11534942"
                     /db_xref="InterPro:IPR021757"
                     /db_xref="UniProtKB/TrEMBL:G8BQ12"
                     /translation="MLSIRRSLATSSEKAVSSSLRAGIILSRNPIVTPDVTNFEQNYY
                     TYQALLERRLMWTFPHYYYFKRGTLSQSKFSSAQPGPISKLPGVWFPKGVPDVKHNRE
                     RRLKQEVVLPKSKGDVQEGNGKSDDLTRSIEPNSRITEADKTNDITSLERKLSRTLYL
                     LVQNKNKIWTFPNFDATNTGLHKDAEEGLRSLGGEKMYTWTVSKKPLGFIENKDGSKE
                     FLIKSHILAGSFQLLKKNEHNISNFAWLTKEEIKEKVSQSYYNYTEFMLADN"
     gene            complement(<995664..>997187)
                     /gene="TPHA0B04250"
                     /locus_tag="TPHA_0B04250"
                     /db_xref="GeneID:11534788"
     mRNA            complement(<995664..>997187)
                     /gene="TPHA0B04250"
                     /locus_tag="TPHA_0B04250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684480.1"
                     /db_xref="GeneID:11534788"
     CDS             complement(995664..997187)
                     /gene="TPHA0B04250"
                     /locus_tag="TPHA_0B04250"
                     /inference="similar to DNA sequence:INSDC:YNL253W"
                     /note="similar to Saccharomyces cerevisiae TEX1 (YNL253W);
                     ancestral locus Anc_1.107"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684528.1"
                     /db_xref="GeneID:11534788"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8BQ13"
                     /translation="MSLSKPPVRGERNTSVKKPVVPDTTNNELATSIYKQATMDKKLS
                     EKLTRTITDELLNKKNVEHITDDRRLLILSRAKSRFVVGISPNEVYAIEFQPTGKALA
                     YSRYDGSLTVWFLVHDTFNRSFKAYKKDAMGVEKPITSISWNSNEVGQFATVSNSNYI
                     QIWNVDHNTHSLTKYRTLNLDSSDAKLRFTKCHYDPSSQWLAAVTKNNEICLFDVKAN
                     HKQVHFYNFNEEVEGSITFICWNNHGNYIIVGTSIGEISLLRVNNNKELKNIIKVPAH
                     RGKITGLKVTPLGDKLVSVGEDGACLIWDLESLTCISTIVECESNIRTFDLSPSGKLL
                     VVVSEEGKFRFYDMITTEKINDYDQKHLDSDFIVKFYPNKSWLMISGENDTLCRLYSE
                     KGHSDELSFWKSFHPEVFPENEKARTYNDLNAKKSKHDWNSEQALLRGSNRDSNRDSS
                     RAPNRGASRESSRGPDRESNRGLNRNINRGIGRDSSRGPNRNKRPRANPRPARFSHN"
     gene            <997914..>998960
                     /gene="TPHA0B04260"
                     /locus_tag="TPHA_0B04260"
                     /db_xref="GeneID:11534827"
     mRNA            <997914..>998960
                     /gene="TPHA0B04260"
                     /locus_tag="TPHA_0B04260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684481.1"
                     /db_xref="GeneID:11534827"
     CDS             997914..998960
                     /gene="TPHA0B04260"
                     /locus_tag="TPHA_0B04260"
                     /inference="similar to DNA sequence:INSDC:YNL254C"
                     /note="similar to Saccharomyces cerevisiae YNL254C;
                     ancestral locus Anc_1.106"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684529.1"
                     /db_xref="GeneID:11534827"
                     /db_xref="InterPro:IPR028094"
                     /db_xref="UniProtKB/TrEMBL:G8BQ14"
                     /translation="MNDTESRTNINKRRRVYQTNDGNNNKVNIMKRLAKLRDNKRKVK
                     KLKAADTDISSDEFDSMSDDRNSKCTPGYSLADLNCPLLQDEGKSRKKKSSDIIEQGP
                     EIEEVQLQQKLHDDVIEATSQQSSLLKKLSTEEHLDHIWTGDFEKRIPTNAKTELTAD
                     EVEETKAYFMKKYQLPNVLYFDELLAKVKPKFNIVDKILKGKMASPYYIEAKHLHKNS
                     KKALLSTDEFRHMDMTKFQAGFYGLKRQLRLGQEIYNKFRVMLLSNKSPTLKWWGALD
                     FAQFVLAPELLLHLCIEEMNLQKKAETTEEGHSDEELDARELAYDLFKSTIVFGTSVA
                     DAYPLEEWESHIRT"
     gene            <999401..>999898
                     /gene="TPHA0B04270"
                     /locus_tag="TPHA_0B04270"
                     /db_xref="GeneID:11534943"
     mRNA            <999401..>999898
                     /gene="TPHA0B04270"
                     /locus_tag="TPHA_0B04270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684482.1"
                     /db_xref="GeneID:11534943"
     CDS             999401..999898
                     /gene="TPHA0B04270"
                     /locus_tag="TPHA_0B04270"
                     /inference="similar to DNA sequence:INSDC:YNL255C"
                     /note="similar to Saccharomyces cerevisiae GIS2 (YNL255C);
                     ancestral locus Anc_1.105"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684530.1"
                     /db_xref="GeneID:11534943"
                     /db_xref="GOA:G8BQ15"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:G8BQ15"
                     /translation="MSQKACYVCGKLGHLAEDCDSDRLCYNCNQAGHLQSECTLPRSV
                     EHKQCYNCGETGHVRSECSVQRCFNCNQTGHISKDCSEPRKQKFNNGMSAQRFSRNNK
                     VSCYKCGGPNHMAKDCLQEDFKCYSCGGVGHLSKDCPSGSGVNAKVCYNCNQTGHISR
                     ECPSY"
     gene            complement(<1000206..>1002758)
                     /gene="TPHA0B04280"
                     /locus_tag="TPHA_0B04280"
                     /db_xref="GeneID:11535135"
     mRNA            complement(<1000206..>1002758)
                     /gene="TPHA0B04280"
                     /locus_tag="TPHA_0B04280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684483.1"
                     /db_xref="GeneID:11535135"
     CDS             complement(1000206..1002758)
                     /gene="TPHA0B04280"
                     /locus_tag="TPHA_0B04280"
                     /inference="similar to DNA sequence:INSDC:YNL256W"
                     /note="similar to Saccharomyces cerevisiae FOL1 (YNL256W);
                     ancestral locus Anc_1.104"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684531.1"
                     /db_xref="GeneID:11535135"
                     /db_xref="GOA:G8BQ16"
                     /db_xref="InterPro:IPR000489"
                     /db_xref="InterPro:IPR000550"
                     /db_xref="InterPro:IPR006157"
                     /db_xref="InterPro:IPR006390"
                     /db_xref="InterPro:IPR011005"
                     /db_xref="UniProtKB/TrEMBL:G8BQ16"
                     /translation="MSINILKNRSINTSRQLSGRTVRNMSQQTVENNKDVVYIKKLEL
                     ATTVGTDAWNQMSKQKLLVSLKMETDFRKAASNDDLNYTLNYALISKQIENFVNNTRH
                     GKWDSLGSLSRNLSTHLMKNFKGIEKLNLQANLKSSHLRCNDFTIAINSNKNNDELQD
                     ELVISNLHVLTLIGVYPFERLNKQNATLDIIIPWQKKDVFQPPYKKIIDKVVDYVENS
                     NFLTVEALVENVAKVISMDKYFKNLQNKEDIIISVKVLKLNAITQTEGVGVSCKRNLL
                     DLDQLELPTINNNVVNGEKNNAYDLPSQIINNFSITHDEGFNTVYLAFGSNVGDVFSN
                     IVEALKILSSTKDVTVSKVSSLFQSNPMYFGDQRKFINGVLEVKTKLNPDEVLQLCKK
                     IEYEDLKRVKHFDNGPRSIDLDIILFMNSKNEDIIVSTENLVIPHPRMLERSFVLEPL
                     CELLDPTFSHPITTEPILKHLESIYRLQDEANILWKVTPIINKNHYGKLSDTERFMKY
                     KNNVKLDPFKKTLIHQTVSPTYLMSIVNTTPDSFSDGGHIFNEIEKQMKFVETVYEGT
                     KAFRENIIFDIGGCSTRPNSIQCCQEEEIDRTIPLIKGIRNNEKLDQSRIIISIDTYR
                     AEVARQAIEAGVDIINDISGGSFDAELFDVVAKNPQISYVLSHIRGDISTMSSLNEYE
                     ATPSQSNENIKEYLNGELINDNLFYPLIRSVCYELAKRYQHALQKGVKRWQIIIDPGL
                     GFSKKGKQNLEIIKQLPLIKNYSVELPSLKGEGNDYVNFANMPILVGPSRKKFIGDMI
                     EESEPVKRDFATGAMIASCVGFDTNIVRVHNAVDCSKVLKIADELYRSDDLQ"
     gene            <1003779..>1005251
                     /gene="TPHA0B04290"
                     /locus_tag="TPHA_0B04290"
                     /db_xref="GeneID:11534978"
     mRNA            <1003779..>1005251
                     /gene="TPHA0B04290"
                     /locus_tag="TPHA_0B04290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684484.1"
                     /db_xref="GeneID:11534978"
     CDS             1003779..1005251
                     /gene="TPHA0B04290"
                     /locus_tag="TPHA_0B04290"
                     /inference="similar to DNA sequence:INSDC:YGR255C"
                     /note="similar to Saccharomyces cerevisiae COQ6 (YGR255C);
                     ancestral locus Anc_1.103"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684532.1"
                     /db_xref="GeneID:11534978"
                     /db_xref="GOA:G8BQ17"
                     /db_xref="InterPro:IPR000689"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR010971"
                     /db_xref="InterPro:IPR018168"
                     /db_xref="UniProtKB/TrEMBL:G8BQ17"
                     /translation="MLSSRSRFIFNKKIVRSLATSAAGVKTARVKAAGTTPQLTDVLI
                     VGGGPAGLTLAAAIQSSHELRKFKTVLVEAGDTISKVKPFYNSPPDYYTNRVVSLTPP
                     SIDFLTKKINVKLMENRMMPYDGMYVTDGISNATIDMEKDSLAYMIEILNVQSSLLAR
                     IDELNCKDRLQIIDKTKVESIVYSDPNDTKSWPIVTLSNGQRFQTRLLVGADGFNSPV
                     RTFSGIQSRGWFYNKFGVVSTMKLEYTPFKIRGWQRFLPTGPIAHLPLPDDNATLVWS
                     TTDELSELLLSIKEEEFTALINAAFVLDNADMKYYYKHLQNKSMTSKQLIDDVTYRID
                     EEFAKLPNESDIDEKYPTKVKMILGPSRARFPLKMFHADKYCTDRIVLLGDAAHATHP
                     LAGQGLNMGQGDTEALVDALEKASKRGLDIGSELALDPFWAERYPTNTLLLGVADKCH
                     KIYSTDFPPVVKLRSLGADVINNFSPLKNLITDTLGSSAK"
     gene            <1005558..>1006562
                     /gene="TPHA0B04300"
                     /locus_tag="TPHA_0B04300"
                     /db_xref="GeneID:11534992"
     mRNA            <1005558..>1006562
                     /gene="TPHA0B04300"
                     /locus_tag="TPHA_0B04300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684485.1"
                     /db_xref="GeneID:11534992"
     CDS             1005558..1006562
                     /gene="TPHA0B04300"
                     /locus_tag="TPHA_0B04300"
                     /note="ancestral locus Anc_1.102"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684533.1"
                     /db_xref="GeneID:11534992"
                     /db_xref="GOA:G8BQ18"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:G8BQ18"
                     /translation="MSVLLETTAGDIVIDLAYNEFQLEAYNFLKLCKCNYYKYQKIVK
                     NGDEINFGDPIIGFKERNDQLVYETSINGLLDVSEETTLVPKLIKTTSKNSDNSTGET
                     GLEKGSIAFKVIKQDGIDLIGSKVVLKLVSCLYPAKELAYFGNVPRQYWEVLDKFMQL
                     DDKMEIRVKNILIIRDPFPDPEGFQQFDVPLPIGDVELPSELIEKHQAKSKMSLLKSE
                     IENQELALEIIGDIPSSTIKPLKTVLFVCKLNAMTNAKDLAQIFSRFGQIISVEIVRD
                     KDTGRSLGYGFIEFDSEGAVELAYSNMEGVIIDDKKIHVDFSQSVSKLASQWTCGKNK
                     "
     gene            <1006818..>1008044
                     /gene="TPHA0B04310"
                     /locus_tag="TPHA_0B04310"
                     /db_xref="GeneID:11535011"
     mRNA            <1006818..>1008044
                     /gene="TPHA0B04310"
                     /locus_tag="TPHA_0B04310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684486.1"
                     /db_xref="GeneID:11535011"
     CDS             1006818..1008044
                     /gene="TPHA0B04310"
                     /locus_tag="TPHA_0B04310"
                     /inference="similar to DNA sequence:INSDC:YDR058C"
                     /note="similar to Saccharomyces cerevisiae TGL2 (YDR058C);
                     ancestral locus Anc_1.101"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684534.1"
                     /db_xref="GeneID:11535011"
                     /db_xref="GOA:G8BQ19"
                     /db_xref="InterPro:IPR012908"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BQ19"
                     /translation="MNYYFSSQGLVDIWKHIYPENGRDVHRNQYFEPFSSLVNDPQSE
                     LLRYFNEKQEEIRSNTSKSLFTNILQAKDTIFEVPPLREFHAPKNPVVLCHGLSGFDK
                     LLLIPLSSQFIQLLTNNMIANGSDFSMEDLPETDIMQNVKMSLIEVDYWNGIKQILEL
                     NGCTVLTATVPGFGTIEKRALALNQYLEKEAIKISSDKDKFSTGRSNKIKLNLVSHSM
                     GGLDSRYLISNIPSDLYDIVSLTTIATPHRGSQLADFVVDKFNTIRMNSPIKDTRTLL
                     PRSIYQLTTYYMKYFNNITPDRPDVKYFSYGCCFNPNWYNLFFPTWNIIDKATNGEPN
                     DGMVTVSSSKWGEYSGTLANTDHMDIINWRNRLKIESTQWLTSFEGKKKVKVQTCIDP
                     LQFYLLIADNLGRKGF"
     gene            <1008503..>1012198
                     /gene="TPHA0B04320"
                     /locus_tag="TPHA_0B04320"
                     /db_xref="GeneID:11534761"
     mRNA            <1008503..>1012198
                     /gene="TPHA0B04320"
                     /locus_tag="TPHA_0B04320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684487.1"
                     /db_xref="GeneID:11534761"
     CDS             1008503..1012198
                     /gene="TPHA0B04320"
                     /locus_tag="TPHA_0B04320"
                     /inference="similar to DNA sequence:INSDC:YHR155W,YNL257C"
                     /note="similar to Saccharomyces cerevisiae YSP1 (YHR155W)
                     and SIP3 (YNL257C); ancestral locus Anc_1.100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684535.1"
                     /db_xref="GeneID:11534761"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G8BQ20"
                     /translation="MTSDSNRNQETEFKQLKLISVTFKEASLDSPSFRATVNYFEHRI
                     DIFQKLWLEKISEFIREKYSPAFQNFETHVGVMVSNMDPLTKLFNTGMISNQLYTPIL
                     VDNTTSDYSELQTHFTRTLIRDGSVLSECLTQLNDNCISVYRTSRKKFEKTQKIYDDL
                     LFKSNILIKPNLDVDPEASMKMAFAIFEAKMKYLKAALDLVDVIASTKLQLDEFVVNT
                     ISRISDNNTIKQKFSSEVIDLSPKMTKYVNDYKQWMLRTANAAKELKSEIESAKKQIY
                     DYVEERARPSTDILEYTISRINSESLINKKIFDLKVRKAPEKAGWLFMKTYIGSSTKP
                     TWVRNWCFIQNSVFGMFVLSDTKTYVQETDKFGVLLTHVRYEPDEDRKYCFEVKILGN
                     KYSEETGDNEKDLTIVFHTESLRELKSWLTAFALAQRYVLGLNKNSYEYDVAFRRFSP
                     DFLEFASTSSNSVEKMITSNDDNTRSLLELLNAEFSEYDSLKFANEELSKIYIQSTMI
                     STKLSKLATFSHLFQNSNWLPSAPIANIWGVTNWTAYSVLDSSTILKGMTTDSVEDYP
                     PNYPNAMKISDIEFKSIFFSIDHRVLKYPDLLILFKFSSFWCPNERQSFSTICYVTDS
                     HIYCFTNTNGFISLLKNKIANIQNIEQDKNESNLLHFHDSNGPYISIYIHFDEPKVIL
                     TKLKYLTKNRCIKQPKQGSELYSILSKIETTILNQKKEETERLENELITRSKPNQSVK
                     INEEAVKSFWDMNEESYNTILRSKELQDKSTAHHSNTYEIGSKGLTHIIFGNRSDAFP
                     TAFYLAKKKKVYDKNIGLSWMRDVDEKTGEDILYRTLSIELSLFDRLINVGSNKVTSV
                     DSNSISVKQRFVKALENNYYEIEQSPIYIKLPLCRLLRGEQRYTITEPYDPEYQIASK
                     FSIPNSKSFLTVFYNINIIDAKTGNVVTRERLHEKIMKKLVISRCRYEYMWLKKVIKY
                     YLERIGKHGRTIKAIKMCGDFTPDPAAVKDDITKNSVKNDDEKVIIVYSYTLILRIIL
                     KYAFSKFANVILLSVRGMFGIVQLLGTGFADMSKFSLILLFFTILLNSFLSSRSNLTY
                     WTTKRVNVFFDNFLKEDNNDLRMDRLIMLHEDELIGGNGDYNSNESLPAWLKYKQKMF
                     HDTEFKENRYEISSKRNKILIELKLLKNMERELVHERFQEFLEKEIERCNLLKENAGE
                     VISNDPKLSNYCKNCEEEYDNLKSLLL"
     gene            <1013193..>1015418
                     /gene="TPHA0B04330"
                     /locus_tag="TPHA_0B04330"
                     /db_xref="GeneID:11534930"
     mRNA            <1013193..>1015418
                     /gene="TPHA0B04330"
                     /locus_tag="TPHA_0B04330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684488.1"
                     /db_xref="GeneID:11534930"
     CDS             1013193..1015418
                     /gene="TPHA0B04330"
                     /locus_tag="TPHA_0B04330"
                     /inference="similar to DNA sequence:INSDC:YNL258C"
                     /note="similar to Saccharomyces cerevisiae DSL1 (YNL258C);
                     ancestral locus Anc_1.99"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684536.1"
                     /db_xref="GeneID:11534930"
                     /db_xref="InterPro:IPR021875"
                     /db_xref="InterPro:IPR021876"
                     /db_xref="UniProtKB/TrEMBL:G8BQ21"
                     /translation="MSSETSGISVLNEQSIKESLLQDPLLFRNKSGDSVDSNSNELLS
                     FESVMNKDTALVAELHDLNSLKQISDLILEFNANWEYIEVENCYYSLLNLRKKLKQND
                     TVLAKQNIRFQQSVITYVESLHLKLIEKVSDLLTEKFWNITSNSVVYNASVELNNVKF
                     EYKPFLEFLSNELIIENDNILDLNNWFIKDMSLGELHNMVRNKMKIILNDYLHFELLL
                     NKLKEALFNSNMKFDYDVNNRKLSWEENYHDVKSKDKLESLTNIVNYMNTELSELNSK
                     LIEKLSPLVANEFTKLVKGNISEIVQNENLSTTVLTLNESINNLKSFTQTASWYFDTA
                     VINDLLKSKEVYNNLILDQILESHLEQLRNIFKNKHSNTKWNELSECDIGKIAMKNNA
                     SIAKTEKSTKDIINLNKEDDWDWNDGNDGWDNEIDAGSLNSTPKIPNDNTWDEAWDVE
                     VDVEIDDEENTSANQATNLHSIFVTQLPSLFINIACSFQKEAEKISENITTEEYFKFK
                     FNVLQTALLAIAQVHYSGKWWQLFIDIRYIINSDQKFQRLEELNLRFIDNHLNMEKKQ
                     VYNIVTSLLSSLDSDENIKYASKEINHLLGMIKKNIFIPLCKIKGLEHDSNVLQFIHF
                     FYFECIVNTISKWKIISERNSHNLSELISMISTGLEVEQTIRDQPKFREMNEKFVITG
                     KILRSHLKEIMNMFYDGDFYLFSTDEIIQWIVLLFADTPLRRDAINDIRDIRNAQLDE
                     D"
     gap             1015649..1015668
                     /estimated_length=20
     gene            <1015893..>1016111
                     /gene="TPHA0B04340"
                     /locus_tag="TPHA_0B04340"
                     /db_xref="GeneID:11534810"
     mRNA            <1015893..>1016111
                     /gene="TPHA0B04340"
                     /locus_tag="TPHA_0B04340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684489.1"
                     /db_xref="GeneID:11534810"
     CDS             1015893..1016111
                     /gene="TPHA0B04340"
                     /locus_tag="TPHA_0B04340"
                     /inference="similar to DNA sequence:INSDC:YNL259C"
                     /note="similar to Saccharomyces cerevisiae ATX1 (YNL259C);
                     ancestral locus Anc_1.98"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684537.1"
                     /db_xref="GeneID:11534810"
                     /db_xref="GOA:G8BQ22"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR017969"
                     /db_xref="UniProtKB/TrEMBL:G8BQ22"
                     /translation="MSTNHYQFNVAMTCSACSGAIERVLNKLKPDVSKLDISLESQTV
                     DVYTTLPYETILEKIQKTGKEVKSGKTL"
     gene            <1016611..>1017105
                     /gene="TPHA0B04350"
                     /locus_tag="TPHA_0B04350"
                     /db_xref="GeneID:11534748"
     mRNA            <1016611..>1017105
                     /gene="TPHA0B04350"
                     /locus_tag="TPHA_0B04350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684490.1"
                     /db_xref="GeneID:11534748"
     CDS             1016611..1017105
                     /gene="TPHA0B04350"
                     /locus_tag="TPHA_0B04350"
                     /inference="similar to DNA sequence:INSDC:YNL260C"
                     /note="similar to Saccharomyces cerevisiae YNL260C;
                     ancestral locus Anc_1.97"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684538.1"
                     /db_xref="GeneID:11534748"
                     /db_xref="InterPro:IPR019191"
                     /db_xref="UniProtKB/TrEMBL:G8BQ23"
                     /translation="MDEFDEVLKLEERFYKEGFEEGRRENLQHNYIEGKQFGLQVGFQ
                     RFILIGQMLGICNVLTARYSTNAALMKSVESVRKLIESIKFDNDAENVENYEVTVVKL
                     KNKFRIILLALQRQLKGKKRTEVMNYDKVEEITRIIAGEVIGFNEDEDTTKQFLAQDK
                     KTEW"
     gene            complement(<1017141..>1018247)
                     /gene="TPHA0B04360"
                     /locus_tag="TPHA_0B04360"
                     /db_xref="GeneID:11535131"
     mRNA            complement(<1017141..>1018247)
                     /gene="TPHA0B04360"
                     /locus_tag="TPHA_0B04360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684491.1"
                     /db_xref="GeneID:11535131"
     CDS             complement(1017141..1018247)
                     /gene="TPHA0B04360"
                     /locus_tag="TPHA_0B04360"
                     /inference="similar to DNA sequence:INSDC:YHR156C"
                     /note="similar to Saccharomyces cerevisiae LIN1 (YHR156C);
                     ancestral locus Anc_1.96"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684539.1"
                     /db_xref="GeneID:11535131"
                     /db_xref="UniProtKB/TrEMBL:G8BQ24"
                     /translation="MQGYTFDKTDPLRIKRKHNEKSATNEDGDNINGEDLYDIRSKKP
                     RYSSNRNTLEIEGYSSDSSVFSVSDDDQLKKENQNDDAPDHNISESLSSKAHGTSNGI
                     AIMDMEAFERENIVEVPEEDRTKFTNLAGNEEGDNDNDNDVPIEAFNVDYEKENGVFD
                     ADGNYLEFSDRKKDELEEQDKWIDDFKNPEKTAKIKQEQMQRSKMKVAEMNKDKKRYL
                     LGDALQKLQYFLTKDDTLLETLSNLNSFKMKHKTEEIEKYIVNVIQFITEMVQQLENK
                     GVDDVYQLTRLKIESLIIDESVTQHDIINNYKNKIWGFKWLKKLMKSMTYTPLMKMQY
                     WKNTYFKNEYVIVKFHDERDVEENWFLIDCVNFM"
     gene            complement(<1018498..>1019940)
                     /gene="TPHA0B04370"
                     /locus_tag="TPHA_0B04370"
                     /db_xref="GeneID:11534793"
     mRNA            complement(<1018498..>1019940)
                     /gene="TPHA0B04370"
                     /locus_tag="TPHA_0B04370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684492.1"
                     /db_xref="GeneID:11534793"
     CDS             complement(1018498..1019940)
                     /gene="TPHA0B04370"
                     /locus_tag="TPHA_0B04370"
                     /inference="similar to DNA sequence:INSDC:YNL261W"
                     /note="similar to Saccharomyces cerevisiae ORC5 (YNL261W);
                     ancestral locus Anc_1.95"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684540.1"
                     /db_xref="GeneID:11534793"
                     /db_xref="GOA:G8BQ25"
                     /db_xref="InterPro:IPR020796"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BQ25"
                     /translation="MSETEEWSSGVFHRDYQISALSSFIQNDPDLTPPNLIIQGASST
                     GKTFVLEKFFNRFEYINGWLRPIELVSWKPLLQAVARTIQQKLRILLPKADIEEFDYL
                     EVEGPHQLQKFLEKIFMEYSKHTDKVNNIFLIIDGLDSLQDLDASIFLKMLALHELLP
                     PQSKFYLKIIYTVKESSFLERYATNLIPTIIFSRYTLKQVSDILEKIKIKELVNSDCY
                     LNVLKGNAITNISESQSNNLALNFIRLIIQAFQPYTGNDISVLSEMMDSKWEEYVSYI
                     TKENIFSPINLYRSSIKIFLHTNESLTDELEEEKKDEFTSTIATSYELSTISKYLLIS
                     AYFGSYLHFRYDGSNFSRKSHLRTGRNAYGRRKKMDVNPRYLNPSLFTLERLLAIFQS
                     IYPTENNSIENGTLETLRWRRPTSANIEVFQNLAELHTLKLISTTSNKNIDFLAHKLK
                     WKVNVTWETIKDISDSVGFEIGEYFSNIHD"
     gene            complement(<1020278..>1026925)
                     /gene="TPHA0B04380"
                     /locus_tag="TPHA_0B04380"
                     /db_xref="GeneID:11534963"
     mRNA            complement(<1020278..>1026925)
                     /gene="TPHA0B04380"
                     /locus_tag="TPHA_0B04380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684493.1"
                     /db_xref="GeneID:11534963"
     CDS             complement(1020278..1026925)
                     /gene="TPHA0B04380"
                     /locus_tag="TPHA_0B04380"
                     /inference="similar to DNA sequence:INSDC:YNL262W"
                     /note="similar to Saccharomyces cerevisiae POL2 (YNL262W);
                     ancestral locus Anc_1.94"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684541.1"
                     /db_xref="GeneID:11534963"
                     /db_xref="GOA:G8BQ26"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013697"
                     /db_xref="InterPro:IPR029703"
                     /db_xref="UniProtKB/TrEMBL:G8BQ26"
                     /translation="MSNSNNSSYKGSTTARFVKNPGGANSQRNGFALSAQQLLQSGKV
                     DEIDTMMGFERYIPPQFSGSIKNTKLQNIPGRVGWLVNMHPTVLSQDSIYSSSGSNSN
                     VGVAGVDFYFLDEEGGSFKSSVVYDPYFFITVTDDSRINDVEEFLKKYLESCLKNISV
                     LIKDDLAKDNHLIGLKKTLIKLSFVNSNQLFEARNLLRPILRDNANNRMQRNIYNQNN
                     NNTAVEAQKVIEDIREYDVPYHVRVSIDKDIRVGKWYKITSQGFFEHTDKVAFADPVV
                     LAFDIETTKPPLKFPDAQLDQIMMISYMIDGDGYLITNREIISEDIEDFEYTPKQEYQ
                     GLFTIFNEVDEVGLLNRFFEHIREAKPTVISTFNGDFFDWPFVETRSKIHGINMYDEI
                     GFAADAEGEYKSSYCAHMDCYRWVKRDSYLPQGSQGLKAVTQAKLGYNPIELDPELMT
                     PYAYEKPQILSEYSVSDAVATYYLYMKYVHPFIFSLCTIIPLNPDETLRKGTGTLCEM
                     LLMVQAYQNEIILPNKHTDPIERFYDGHLLESETYVGGHVESLEAGVFRSDIPNKFTI
                     DPNTVENLMEELTGAMKFSIEVECNSKIEDVTNFEEIKADIANKLTDMKLNPQRDELP
                     LIYHVDVASMYPNIMITNRLQPDSIKSERDCASCDFNRPSKKCDRRLKWAWRGNFFPT
                     KMDEYNMIKRALQNETFKNKNKMSKKPFLTFDELSYTEQVEQIKKRLTDYSKKVYHKT
                     KVSEIIERESIVCQRENPFYIDTVRSFRDRRYEFKGLAKTWKGKMSSLDKDDFHGKEE
                     AKKMIVLYDSLQLAHKVILNSFYGYVMRKGSRWYSMEMAGITCLTGATIIQMARSIVD
                     GIGRPLELDTDGIWCIIPKSFPENYTFTLRNGKKLFMSYPCSMLNYKVHQQFSNEQYQ
                     TLIDPIKKKYKVQKENSIFFEVDGPYKAMVLPTSKEEGKGIKKRYAVFNDDGSLAELK
                     GFELKRRGELQLIKNFQSDIFKVFLEGDTLENCYKSVADVANRWLDILDTRGSMLEDE
                     DLIELICENRSMSKTLKEYEGQKSTSITTAKRLGEFLGEEIVRDKGLQCKYIISSKPI
                     NAPVTERAIPVAIFSSDIQIKRTYLRRWLQDPTLENFDPRSIIDWDYYRERVASVVQK
                     IITIPAALQDVTNPVPRVEHPDWLKKKISTKTEKAKQSSLTRFFSKSNDNLEHRKVND
                     IEDMFKDTNDELIEKFKVGKVMSRKFGGKRKRIQDKNENTAEENMVLPAEFPAIEDNY
                     VGWLKYQKIKWKIQQKDRNRRNELFGNNNSSSGRNMLSSMIRKQAESYANSTWEIIQY
                     KKGDQPGELEVYVLINQKIQVLNFKIPKTLFIKFKNEEIPINKIKKCTVEKSNAMLPN
                     NHFLNEGKNGSLFKLTLPEKIYEAESEDPTSILNDEGVMGIFESTITSSERAIIELGS
                     TVSFSSNAMGALGRGLQKGFDMKSLSMSDNNRYLSSLPPGISYILHLVSDIGYEFFTV
                     YKSWDKTVRILTLKPSNHAQVLQPATIEQLYKTAYNKKKDDHYNHYRSINLTKDLNFE
                     QFSYTDITKVYKKLSQILSDIKDEKGLQFLMLIQSPYIMKLLNFVKYLNQVPLIELAS
                     NELSLPQLNWQTILSKIIVSNLVSSGSSLHTLITLSHYSNIPICNLKLHEMNFIIDVL
                     YARKLKNEGIVLWWNDKTPLPDYGGTQKEFDLNTSWIMNDLKFLEINNPDVYDNVTLE
                     LSINNLTVNTVLTSAVISSIDGSDLAEVNSLMINNNNENGTGSSFVQDSFSTGSLSVL
                     RSVLKSWWDQALKGDVSADLLVNSFVSWVQNPDSKLFDGTLRYHVNNLTKKSLLQLIN
                     EFVSLGSSVVYADRNKLFIKTSKTSPENCYAYGQYIVKAIRSSSSFCYLDLSVERYWD
                     ILIWMDKFNFSGLACNEITDSETQEMSAYSQWQIKDFLPAIYQPEFDDWIMIILDSMV
                     KSKDQYYESKAGTQRLTQLPIVKDRNNDDDETGPLENYTKMFYQTLLQRVQKLFRNQQ
                     EFILDPQYKNDYIFPVVPGSHLNMKNPLLEFVKFICQVMLLSTKTTLEVRELRKELLK
                     IFEIREFEKKSEFQNPSSSLVINCFLCEHCYHITDIDICKANIETVFSCERCEKPLAK
                     QLFEDHLIQMLVSDFEAYYTQDPRCVKCRRVKKDLMSEHCPCSGNWINTISQAELLQK
                     VKIYNQVANHYNFIRLTSAITEVVQ"
     gene            <1027575..>1028570
                     /gene="TPHA0B04390"
                     /locus_tag="TPHA_0B04390"
                     /db_xref="GeneID:11534718"
     mRNA            <1027575..>1028570
                     /gene="TPHA0B04390"
                     /locus_tag="TPHA_0B04390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684494.1"
                     /db_xref="GeneID:11534718"
     CDS             1027575..1028570
                     /gene="TPHA0B04390"
                     /locus_tag="TPHA_0B04390"
                     /inference="similar to DNA sequence:INSDC:YNL263C"
                     /note="similar to Saccharomyces cerevisiae YIF1 (YNL263C);
                     ancestral locus Anc_1.93"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684542.1"
                     /db_xref="GeneID:11534718"
                     /db_xref="InterPro:IPR005578"
                     /db_xref="UniProtKB/TrEMBL:G8BQ27"
                     /translation="MSYNPYQFSDQGRQNIHPTAFSQQQQQPHHQAQQQGSNQMGYNQ
                     WGNQSYQQVPQNPQGYQNQKVFDDPRQTMAFQLGQTAFSNLLGQQNFTQFQDTVNKAT
                     SVTSNSISHYFQVSTSYVLLKIKLIIFPFFNNNNWQRIPEPNNANTGNSDLGGVIKFM
                     TPMNDVNSPDMYIPIMGLVTYILIWNVQQGFNGDFNPENLYYKLSSTLAFVGLDLVIL
                     KLGLYLLVTTDVTNIQSVTSITELLCYVGYKFVPLTTILLLPNLYIPLWATLIFKIYL
                     FIALGVFLLRSIKFNLFNNPNEEFMNIKKTTVRKCNYFLFFYGFVWQSILMWLIG"
     gene            <1029196..>1030269
                     /gene="TPHA0B04400"
                     /locus_tag="TPHA_0B04400"
                     /db_xref="GeneID:11534883"
     mRNA            <1029196..>1030269
                     /gene="TPHA0B04400"
                     /locus_tag="TPHA_0B04400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684495.1"
                     /db_xref="GeneID:11534883"
     CDS             1029196..1030269
                     /gene="TPHA0B04400"
                     /locus_tag="TPHA_0B04400"
                     /inference="similar to DNA sequence:INSDC:YNL264C"
                     /note="similar to Saccharomyces cerevisiae PDR17
                     (YNL264C); ancestral locus Anc_1.91"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684543.1"
                     /db_xref="GeneID:11534883"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:G8BQ28"
                     /translation="MGLFSRKKPTKTDSKSVNANEHLIKVDTCFSEPPNEYGGAEPLE
                     NITSEQYDIYVKLLNHFNAEDFTLPVNTEVAKDDPALQKSLSEFEKFWLSRECLLRFL
                     RAAKWNFNDAVANLSETMTWRREVGITYSDSNFENKALDPDHVSIENETGKEVLLGFD
                     KHRRPLFYMKNGRQNTESSYRQVQQLIYMMECATTLCPQGVEKLTVLIDLKGYKEPGI
                     ISDKVPPLAITKLCLKVLQDYFPERMGKCLLTNIPWFAWAFLKIVYPFLDPATREKAI
                     FDEPYDKHVEKKQLDATYNGYLDFKYDHKVYWPDLVKKVDELREKRFERWVKFGSKIG
                     TAEWDYKGDHDEIKYPVDYRNVE"
     gene            <1030785..>1034459
                     /gene="TPHA0B04410"
                     /locus_tag="TPHA_0B04410"
                     /db_xref="GeneID:11532810"
     mRNA            <1030785..>1034459
                     /gene="TPHA0B04410"
                     /locus_tag="TPHA_0B04410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684496.1"
                     /db_xref="GeneID:11532810"
     CDS             1030785..1034459
                     /gene="TPHA0B04410"
                     /locus_tag="TPHA_0B04410"
                     /inference="similar to DNA sequence:INSDC:YGL140C"
                     /note="similar to Saccharomyces cerevisiae YGL140C;
                     ancestral locus Anc_1.90"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684544.1"
                     /db_xref="GeneID:11532810"
                     /db_xref="InterPro:IPR018823"
                     /db_xref="InterPro:IPR023244"
                     /db_xref="UniProtKB/TrEMBL:G8BQ29"
                     /translation="MPTESSPKSITPLRRAIKLWNRYFPCDRLLAQRIAKATCNSTTA
                     FIFVLIPQIRNRIGDSPSLLPLISVMVHPGRRVSGTIQGAIYCLTGLVFGLAYALFAR
                     FLATRCLGSDWNKLTDHEHWIAHPVRYESALGVLALFETLMLLFHGWMRSVNHTYFGI
                     VFPVFLVVHFTFLEPLYETPGFVAKSFTVPFYMGIAMSIVWNLILFPEFGSTYLGNAT
                     IDTLNEIQRAIDHSINFFISIDLTKEEAIYNKEPSPLPKLLNIKNIISKKVSGCNAVY
                     QECIYEISYSYVSPTQLNGIIKSFDPFVMYLKGIINACQLEFILLGKEQNENLNKGNG
                     SPSEDKWNPNIDKEIEYADAKKLLTILKKIRPEVYNLHKCISENMYMMKLVLAYAYDA
                     DLKKIKPCSMFKDGNYPIYRSSKDFPADFDFSTKITSLESAIINFDLGFREQLVSVSD
                     SLLTPNDEMFLLSSFLMNFKEVATSVQAMMKDVEEIYAFRKEREKKGWLRGKTVWFTF
                     LRSFDTLKAWLLNTYSNNNLLTENEAIKGTYNNEGQGAHTQAGRSLVQEEDLLRQNVE
                     GDINIYGSDNENNASLPISNNELLNPNRAHEMKSFITKCKRYFTSYLIWCNAFFKRSR
                     SHFRFAIQVATALQLSSFPMFMPSARDWYISYHGAWIGFVCILCMEPSVGGTFWVFFL
                     RAVGVISGSGWAYLSYVSAVSQTNPYLETVISVFGAIPGFYFLIGTPYVKAAIIQIIS
                     IYIVILAAVYPGDTQGGILVNFAKRCLAVGYGGGVSLMVQVFVFPIKSRDMLNQEIAF
                     VCGCISRMELLYASGLEGESLQTPLTEKRFNSYHTLSKAAKAALSRADAYKGLTRQEP
                     RLKGPYKEIEDIFTQIIFLQKQIIDRMDNVAMLRMKYGSAVIEELNSIVYPYRRQVVA
                     NISVLMRSLQEAFINKTPLPQFLPSARISHRRLINKVRETLQVKYRGQLNIFRNKKSS
                     SEKSSITSSSSLTSNSSDSLGELVINVDRANKKWNPSSVHEHIIKENFLSWNATTAAS
                     EEIIEYIEELINLTKILVGVNEFKYGFLSRPLYVDWAVQAVTGFDDFIQGKTQTQKPS
                     RSQTPFQAVSSLAQETIPESLGSELNEENNLYTENSVISVNADEPKPYTKDGNSAFPS
                     NVILARIASYKGSGSSAFRKRIYSIGSPSDTDYQATLLSRKKTIGDVDSEYYNTDNEY
                     SSDEDLPLALKKIMSNKSRK"
     gap             1034539..1034558
                     /estimated_length=20
     gene            complement(<1034668..>1035732)
                     /gene="TPHA0B04420"
                     /locus_tag="TPHA_0B04420"
                     /db_xref="GeneID:11535141"
     mRNA            complement(<1034668..>1035732)
                     /gene="TPHA0B04420"
                     /locus_tag="TPHA_0B04420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684497.1"
                     /db_xref="GeneID:11535141"
     CDS             complement(1034668..1035732)
                     /gene="TPHA0B04420"
                     /locus_tag="TPHA_0B04420"
                     /inference="similar to DNA sequence:INSDC:YGR048W"
                     /note="similar to Saccharomyces cerevisiae UFD1 (YGR048W);
                     ancestral locus Anc_1.89"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684545.1"
                     /db_xref="GeneID:11535141"
                     /db_xref="GOA:G8BQ30"
                     /db_xref="InterPro:IPR004854"
                     /db_xref="UniProtKB/TrEMBL:G8BQ30"
                     /translation="MFTGFGSFGGAGSASDFINLPQRFESFFRCYPISMMNDRIRKDD
                     ANFWGKIFLPPSALNKLTMLNIRYPMLFELTSNETGKVTHGGVLEFTAEEGRVYLPQW
                     MMETLSVKAGSLLTIATTDIPLGSYVNLEPQSTDFLDISDPKAVLENSLRNFSTLTKD
                     DIIEISYNNKIYRIKILEVKPESPLHGICVIETDLVTDFAPPVGYVEPDYKAMQKEKE
                     EKMASKVINLSGQTVGSMSRRINYTGIAQEHLNDRKSFAGIGSKLSGKATKKTEPEEI
                     DVSKISLDGEPRRLDLPEGQLFFGFPIVLPKAEQDDDNNIQESNNFIGNGQSLRKTNK
                     RKDKNTLEKNKQRHRDLLLK"
     gene            <1036315..>1039527
                     /gene="TPHA0B04430"
                     /locus_tag="TPHA_0B04430"
                     /db_xref="GeneID:11535164"
     mRNA            <1036315..>1039527
                     /gene="TPHA0B04430"
                     /locus_tag="TPHA_0B04430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684498.1"
                     /db_xref="GeneID:11535164"
     CDS             1036315..1039527
                     /gene="TPHA0B04430"
                     /locus_tag="TPHA_0B04430"
                     /inference="similar to DNA sequence:INSDC:YGR047C"
                     /note="similar to Saccharomyces cerevisiae TFC4 (YGR047C);
                     ancestral locus Anc_1.88"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684546.1"
                     /db_xref="GeneID:11535164"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G8BQ31"
                     /translation="MSKYNHSDIEERNDSDHEHLYENIDQLRHMVTSDSGNDDDIAVD
                     EDESEDNMVIDMSDDDYTYNDLRRDMHDDNEEGKQEGFYESDDGNSLLREFSDYGEVE
                     EDDDEEDFMNAIREANNFKVRRKKNKTKGKKTPSRPRREKIIDPELAQLISDANEAFV
                     RNDLLVAEKLYNDIIKKDARNFAAYETLGDIYQLQGRLNDCCNSWFLAAHLNSSDWQF
                     WKVVARLSADLGHKRQAIYCYSRVININADDWESLYNRSTMYKEIGQIGRALEGFQKI
                     YHHNPFDANILRELAVLYVDYERIPDSIDLYLKVFEKNVQKRKAILSASESALESSED
                     EETTSDKLENEGNEESDVDIEITDEMEEEMAEYPNINWKKIYKRYKCITFDWSALNIL
                     TELYLKLPVNQQSGIKTIKRCARWIQHRELQVFWDDVLDDSEFDDRRNKNGRFDALPE
                     VEKNKEYFLPIDIRIRLGLFRLHNDQLLEAMSHFQLLYDESFTEVADLYFEVAITLTK
                     NEKYKEAIDFFLPLLTLEDYNNIELFRPIGKCYKETEDYANARIYYEKVIKSNLCDLD
                     DKVALAEINYQLGNMDEFNNILLEVVELRKKETENLIKIATEDENIDIGTQNKESATN
                     RKPKGDDVSSKPLLEDSMFRQATFRKKKTPEDVEREKAERERKITSKVVEQYNKLKLF
                     KEDLDLGNKKQILLWVDAVSDLIDVFTSVKNFFMKSRSKRFVGIIRRTKKFNKAIDQK
                     IDRLVKLSEGGTIVDGFPLMEERVILTSTTKLRGLTYDQWFDLFMELSLTITKFQSIE
                     DGLSVIETAQEVNVFYQNPERVKMMRFVKLAIVLQMDNEEALTENLRSLLNQFQFNRK
                     VLQAFMYSLSRNQTSLEILSSTVQQKFFLRQLKAFDSLRYGIYVSGQAFITNKEVINP
                     NNKISPYLYYIYAILLYSSRGFLSALQYLNLLERELPNDPMVNLLSGLSHLHRSMQRL
                     TPNRHFQILHGLRYIFKYYDIRSESYTDLEKQEADYNLGRAFHLIGLFSIAVQYYHKV
                     MEAYPDPVLKKHAAYNCIIIYQESDNTELASYLMEKYLSV"
     gene            <1039933..>1040888
                     /gene="TPHA0B04440"
                     /locus_tag="TPHA_0B04440"
                     /db_xref="GeneID:11535071"
     mRNA            join(<1039933..1039959,1040034..>1040888)
                     /gene="TPHA0B04440"
                     /locus_tag="TPHA_0B04440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684499.1"
                     /db_xref="GeneID:11535071"
     CDS             join(1039933..1039959,1040034..1040888)
                     /gene="TPHA0B04440"
                     /locus_tag="TPHA_0B04440"
                     /inference="similar to DNA sequence:INSDC:YNL265C"
                     /note="similar to Saccharomyces cerevisiae IST1 (YNL265C);
                     ancestral locus Anc_1.87"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684547.1"
                     /db_xref="GeneID:11535071"
                     /db_xref="InterPro:IPR005061"
                     /db_xref="UniProtKB/TrEMBL:G8BQ32"
                     /translation="MSPPNIPYHIRLKTCLKMVIQRLRYAQEKQQALAKKGRRDVAQL
                     LSNSKEQKAHYRVETLINDDIHIELLELLELYSELLHARVMIVNSVQDEASLIENHME
                     DGINEAVRALVYATLYVPEVKELTQLRDLLGMKFGNEFLKLILEDHIGVPDKVVRKCS
                     PKLPCVDLVELYLKEIATTYGVPYSLLDNERLENEQFNEKSAMDNEESNDGEGDGNEK
                     PIVAGDNDDDTLIPDEKHPITIRRPRKSSETFKRDFKIPKEIENDVKIKHTVEPIKKT
                     SNDELEDLKKRFAALRR"
     gene            complement(<1041208..>1042389)
                     /gene="TPHA0B04450"
                     /locus_tag="TPHA_0B04450"
                     /db_xref="GeneID:11535140"
     mRNA            complement(<1041208..>1042389)
                     /gene="TPHA0B04450"
                     /locus_tag="TPHA_0B04450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684500.1"
                     /db_xref="GeneID:11535140"
     CDS             complement(1041208..1042389)
                     /gene="TPHA0B04450"
                     /locus_tag="TPHA_0B04450"
                     /inference="similar to DNA sequence:INSDC:YGR046W"
                     /note="similar to Saccharomyces cerevisiae TAM41
                     (YGR046W); ancestral locus Anc_1.86"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684548.1"
                     /db_xref="GeneID:11535140"
                     /db_xref="InterPro:IPR015222"
                     /db_xref="UniProtKB/TrEMBL:G8BQ33"
                     /translation="MLSTGKALFPKKSLRYLCVGHKAVKFRPLSSSSNTNGDDKDSSQ
                     RTDDVILQETPSRSKNHQSPKSVLKDPKDDLFFLEKGIKKSNELTSSFTNYMYKFNKL
                     PPNYGSNQFLTIDGGLQKELIGILNNFEAPVRYAFGYGSGVFQQSGYGLEDKKPQIDL
                     IFGVTHPIHFHSLNMRQNPDHYSSMRYFGSHFVSKFEDLGSGIYFNPYAKINGHDVKY
                     GIVSMEILLKDLATWNTFYLAGRLQKPVKILKNNLTVQYWNQLNLRASATLAKHLTMS
                     KNNGVFDETKFYEEIAGLSYLGDVRYMLGGENPNKVKNIVSKNLSNFKKYYEPIYKDV
                     VQNDSTYLPKGYTPENALAKLQKKIFLNSGIQTIKGIFTAGLTKSIQYAWAKKLKSLK
                     N"
     gene            complement(<1043064..>1046336)
                     /gene="TPHA0B04460"
                     /locus_tag="TPHA_0B04460"
                     /db_xref="GeneID:11534803"
     mRNA            complement(<1043064..>1046336)
                     /gene="TPHA0B04460"
                     /locus_tag="TPHA_0B04460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684501.1"
                     /db_xref="GeneID:11534803"
     CDS             complement(1043064..1046336)
                     /gene="TPHA0B04460"
                     /locus_tag="TPHA_0B04460"
                     /inference="similar to DNA sequence:INSDC:YNL267W"
                     /note="similar to Saccharomyces cerevisiae PIK1 (YNL267W);
                     ancestral locus Anc_1.85"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684549.1"
                     /db_xref="GeneID:11534803"
                     /db_xref="GOA:G8BQ34"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR001263"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015433"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR021601"
                     /db_xref="InterPro:IPR027003"
                     /db_xref="UniProtKB/TrEMBL:G8BQ34"
                     /translation="MPAIMNTVSGTESPATSSDISRSTPVPNDNQFILDAVNSPTFSL
                     YDCIRMIHKHSDNIGIHHFLCEKLLTFPHNELQFYIPQLVQILITVETASMALEDLLT
                     KLRNENPHFALLTFWQLQALLADLSTDPESYGFQVARRVLNDQQYALFNTSIDGKDDD
                     DDDFDRKVDPNTGVISRKSKMQENIAPAIMYSSLIFATIASPALAEYAEPLVESQGRR
                     QKAFVFKLAKSAMKDFRKNITLKNTLMNKKKHKHSKDVVVELNRDVGYNSYQRNATPP
                     TSPKVDLIPPKTFEDQMFKKQRDLELNLNFDMVDNIGQRVFEEKISNKIKLPKRRSKY
                     LDSSYVHRTYSEIEMAKSDENIDAIVNQNKDIPNPIVNDKCSTEMKISESISSQFTSS
                     MPDLHDIQKNDQSKEKNELKCRASTSHDDKGLLLRTASSSNLSSLQKAKLKGKNKEVD
                     IEKLSTTKKIKLLKTNYFKYETQFAIALETISQRLSSVPADARLSALRAELSLLNRDL
                     PAEVDIPTLLPASKKGKLHKLCTITANEAQVLNSAEKVPYLLLIEYLRNEFDFDPTTE
                     DNEEILRKKTNISNLSFDLNIIGNGDLNNDAIILNPTKSDSVMNLSNNANKEERVASQ
                     MSDLSLTPSNYSEFGPKEIDLSDLSMIGVRNQTDAEAYRESLVMRSTTKVPVIEEQVE
                     GRNPELNFAMNLDAVVKNGKGELSDRYDETNELADQMRISALMLSQLDKSPQELSDVA
                     NQIRAKIIASMKEGQDKFGFNDLDQIHGMAGERKLENDLMTGGIDTSYLGEDWAAKKE
                     RIRKTSEYGHLENWDLCSVIAKSGDDLRQEAFACQVIQAMAQIWTKEKVPVWVKKMKI
                     LITSANTGLVETITNAVSVHSIKKSLTKKMIEENTLDEKGGIASLNDHYLRAFGEPKG
                     FKYRRAQDNFASSLAAYSVICYLLQIKDRHNGNIMIDNEGHVCHIDFGFMLSNSPGSV
                     GFESAPFKLTYEYAEVLGGIDGEPYKKFVNLTKAAFKSVRKYSDQIISMCEIMQKDNM
                     QPCFNAGEQTSVQLKQRFHLELAEDEVDDFVENFLVAKSLGSIYTRLYDQFQLITQGI
                     YS"
     STS             1043260..1044901
                     /standard_name="ha3097"
                     /db_xref="UniSTS:515645"
     gene            complement(<1047097..>1048896)
                     /gene="TPHA0B04470"
                     /locus_tag="TPHA_0B04470"
                     /db_xref="GeneID:11534844"
     mRNA            complement(<1047097..>1048896)
                     /gene="TPHA0B04470"
                     /locus_tag="TPHA_0B04470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684502.1"
                     /db_xref="GeneID:11534844"
     CDS             complement(1047097..1048896)
                     /gene="TPHA0B04470"
                     /locus_tag="TPHA_0B04470"
                     /inference="similar to DNA sequence:INSDC:YNL268W"
                     /note="similar to Saccharomyces cerevisiae LYP1 (YNL268W);
                     ancestral locus Anc_1.84"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684550.1"
                     /db_xref="GeneID:11534844"
                     /db_xref="GOA:G8BQ35"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:G8BQ35"
                     /translation="MNSHYASQSEDIELIDNPEYTSNNLSTTASNTNKKYDSDTDMEP
                     SQRKKAAMAGKLFSDQLSYNVSVADNSSAANGDLDLSDTEEAGHVQDTRVKRALKQRH
                     IGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIYFITQSLGEMATFIPVT
                     SSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQYWTDAVPLAAWIAIF
                     WVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGGSSQGPIGFRYWRNP
                     GPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKV
                     VFRIALFYIMSLFFIGLLVPYNDHTLSSGDSYIASSPFVISIQNAGTYALPDIFNAVV
                     MLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVTASLGLLAFLV
                     VNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPFKAKLMPWG
                     AYYSAFFVFVIIFIQGFEAFTPWDTTTFFTSYISLILLVVVFIGCQLYYRCRFLLKVE
                     DIDIDTDRREIEAIIWEDDEPKNLWEKFWAWVA"
     gene            <1050173..>1051984
                     /gene="TPHA0B04480"
                     /locus_tag="TPHA_0B04480"
                     /db_xref="GeneID:11535060"
     mRNA            <1050173..>1051984
                     /gene="TPHA0B04480"
                     /locus_tag="TPHA_0B04480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684503.1"
                     /db_xref="GeneID:11535060"
     CDS             1050173..1051984
                     /gene="TPHA0B04480"
                     /locus_tag="TPHA_0B04480"
                     /inference="similar to DNA sequence:INSDC:YNL270C,YEL063C"
                     /note="similar to Saccharomyces cerevisiae ALP1 (YNL270C)
                     and CAN1 (YEL063C); ancestral locus Anc_1.83"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684551.1"
                     /db_xref="GeneID:11535060"
                     /db_xref="GOA:G8BQ36"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:G8BQ36"
                     /translation="MSQKDLSQYELQSYTSNNRSSASEMNKGSDAKEKVDVISSSGSL
                     SKRKRINRSRANSNSDLEGSAADGTARARDIDNADVDDDDYYMDEGVVKEAEVKRQLK
                     QRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQSLGEMATFI
                     PVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWTHAVPLSAWI
                     VIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVTGPVGFRYW
                     RNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAI
                     KKVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSYISASPFIIAIENSGTKILPHIFN
                     AVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGALA
                     FLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFM
                     PHLAYYSIFFMTIIIIIQGFTAFAPTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLL
                     WTVEEVDIDTDRRDVDAIIWEDSGPKTFWDKFWDVVA"
     gene            <1052780..>1058602
                     /gene="TPHA0B04490"
                     /locus_tag="TPHA_0B04490"
                     /db_xref="GeneID:11534738"
     mRNA            <1052780..>1058602
                     /gene="TPHA0B04490"
                     /locus_tag="TPHA_0B04490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684504.1"
                     /db_xref="GeneID:11534738"
     CDS             1052780..1058602
                     /gene="TPHA0B04490"
                     /locus_tag="TPHA_0B04490"
                     /inference="similar to DNA sequence:INSDC:YNL271C"
                     /note="similar to Saccharomyces cerevisiae BNI1 (YNL271C);
                     ancestral locus Anc_1.82"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684552.1"
                     /db_xref="GeneID:11534738"
                     /db_xref="GOA:G8BQ37"
                     /db_xref="InterPro:IPR010472"
                     /db_xref="InterPro:IPR010473"
                     /db_xref="InterPro:IPR014767"
                     /db_xref="InterPro:IPR014768"
                     /db_xref="InterPro:IPR015425"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BQ37"
                     /translation="MLRGSNSKSSSSSSSVGKDNSVGSGLLHNLKKLTNSSSTTSQNN
                     AINKSDISSPKSQLLTNKLSMDDLKPLNKRTSLNNQNLSQYINGKLPKSQSDSSHLGN
                     VKSNHKYEINENIQDGSSPNHNRSASVQSSAKYSYSRRSSNSTAATRLSRQSTNFSGS
                     TPSVFSQGSYANLSKYMDSNGRLNLDMPTDTHEIESLFEELMYKRNILQALSPDKQRD
                     IMNYDTKKKWMIVKQDLQNELKRIKLKNNNINNSDTTIIPSSMPSSNISERSSVNTMD
                     NNLRTIDTNASNPRIHRKGQKSMSSLSNATTTAPSGVNAEYSKIRSISESSDKTNIAP
                     IHYVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRCIYKTAPG
                     SNLSDELIEKEYGFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTRKMALE
                     ILVYIINKKNTQRFESVIMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKIFQA
                     FVISLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQR
                     VVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQ
                     DPTSLIGSLWEVCKGTENEKLLLSLMQHLFLSSSKLVDDKREPAKLSKQLKLMDSLMT
                     NITASEVDEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKL
                     SKAENGLVGQLELELEQRDNILTKSQRVTKQLQAELEDLKKKHLLEKHEHEVELRKIL
                     TIVNTNTDADASLNNSSDKKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRML
                     RLQMEDIEKEARELEMTNFSEHQKLSLESPAVLNKTKKETKKKSKKKSKSSKSKEENN
                     RKRANAIKKQKLLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEK
                     KYKSFEIDFDPNDFKQAQLDSNASYESLDPNFVTKKITDIDRIADELDAFSGDGTSSY
                     SSSSLSDSEKNYYESNAVPTIGPQKGLIDGSSFLESLSEKYGTAQNTEGTSLSPLSPQ
                     NRIASLGEKSFMNRFKRKPSSMQFLEELSQKVGGEALGKDNNETSDINNISSEEDNSS
                     NSESELNNEPEVEAIDADLTVSESKGAGAPPPPPPPPPEFPASLLPNATGGSTIPVPP
                     PPPPPPPPPALPASLSPNVTEGSSIPPPPPPQFMGLNKMYRSGDGSQILNESPSLYSK
                     YPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVLHNLEKAFAAREIKSLA
                     NKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEFLS
                     KPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMVNLQSY
                     WPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDS
                     SKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKI
                     SVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLL
                     TDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRK
                     YERHKQMVEEQQRKAKEQEKNYMETGVSDSESAEAKGDNRGHMDKLLAQLKNAGPARS
                     DPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSLGEDEMILK
                     SPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITDDGNSNGDGEDEVITD
                     RAKALLMELRGSQTPSKKNSHLDDQREKLRSRRNRRRQTFGEESNSTPSNRLTFVSDE
                     NSPTATEFVDADEDTLQENVPNTDTSSTLSKDDSEDTESQ"
     gene            <1059147..>1061348
                     /gene="TPHA0B04500"
                     /locus_tag="TPHA_0B04500"
                     /db_xref="GeneID:11534830"
     mRNA            <1059147..>1061348
                     /gene="TPHA0B04500"
                     /locus_tag="TPHA_0B04500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684505.1"
                     /db_xref="GeneID:11534830"
     CDS             1059147..1061348
                     /gene="TPHA0B04500"
                     /locus_tag="TPHA_0B04500"
                     /inference="similar to DNA sequence:INSDC:YNL272C"
                     /note="similar to Saccharomyces cerevisiae SEC2 (YNL272C);
                     ancestral locus Anc_1.81"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684553.1"
                     /db_xref="GeneID:11534830"
                     /db_xref="InterPro:IPR009449"
                     /db_xref="UniProtKB/TrEMBL:G8BQ38"
                     /translation="MSGNSDEDKRVSVQLTSLSTQLLESIEKQSSLEDKLRQSRKIIE
                     EQKTTITQYNELRIKYDQLDKNFSKKKVDLQRLEQQLQAEKLGKAEAERKVDELNKEV
                     EELTASLFDEANNMVADARKETDSIETKNKKLTEQLLEKDTILETLNLQLKNLKTVLQ
                     DLQTESSMSIINNGNISLKGDVPLSNENGGSSSHSLKKMSTTTSFQSQQEVVNYAIFT
                     PKITNIRYDTFLYNEFLKFVAVLPHCNSIKNTSAESKLLRRLISDEIHPVLRLDTSNG
                     LGWLTKRTLMNQIVEGLVVIEPLSGINETYRQSALYEVSISKSSIKSDQITKAKMFNF
                     PADSPPIAVRDPCAFCDESRSDCIGHARMYMLKTQTRNDDDTLSITNQYPLCQACLIK
                     VRQTCDIFAFLRSLKSGVWQLEKVTLSTISKGDTSSFLKVAENQFKQNEKATAQEKKQ
                     KRKSIISSLGKSHSSYVNAKLDCTVEPVGLPSTNIQRAWLQLCKLRSILHWSHIGISN
                     TEDCVTSTFAPVATNNKVVADKLEPSLSGTSGTNGSFIPQRDNNASEESFLSIPEDID
                     NDDDIFDFENEGNTTGNIENGNTTLEDRKEENETANLTDELDTANVRDIVDSTDGVEA
                     VDDIEATDEIGATDETEATVEDDILSVGDLVKIIDENTITHVNKEKLHIVEENLNLEV
                     IDSSPAKNTNKKSNKHKDFRKSILNDLDALEEQFESGLKLNNSNENVNTTK"
     gene            complement(<1061743..>1065480)
                     /gene="TPHA0B04510"
                     /locus_tag="TPHA_0B04510"
                     /db_xref="GeneID:11535181"
     mRNA            complement(<1061743..>1065480)
                     /gene="TPHA0B04510"
                     /locus_tag="TPHA_0B04510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684506.1"
                     /db_xref="GeneID:11535181"
     CDS             complement(1061743..1065480)
                     /gene="TPHA0B04510"
                     /locus_tag="TPHA_0B04510"
                     /inference="similar to DNA sequence:INSDC:YNL273W"
                     /note="similar to Saccharomyces cerevisiae TOF1 (YNL273W);
                     ancestral locus Anc_1.79"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684554.1"
                     /db_xref="GeneID:11535181"
                     /db_xref="InterPro:IPR006906"
                     /db_xref="UniProtKB/TrEMBL:G8BQ39"
                     /translation="MVTAGIDNGTSPHNILRARIALLATAIGGPDYTSTLDPPPYKQG
                     DDCLACLKDLKRWFKLVDDQQNRWDVAMAAAEYKVFSNDLIPLLIDWETKSSLASKLG
                     KNNLNSDNAASTSIKNKIYFDKIALNCLQLMVLMTWPLIITDQSSYEQVSGYSELKKH
                     QLMYKKDVLTIENGKVFKAVLRLAFNVIKIDRANRTARDNTILRLVLSFLRNIIAIEP
                     GELSITAKKRSAKGIGSTDTLPPNVSMDDISLSSVINCFHRNKVFKLILTLGSSLSTE
                     FDQDFINLPLLEVMFYLTKDVNQKKLFSRKKNREFHSSTDNGTPSNTPHLSNTGVQLT
                     TLLAKEKQLKTNVIKNTSSRHSRFGALLSIQTPDNGRLTISGTQGLTNDIDAMKKLDS
                     SKKWNKRIMGDKDDVIHEGLPSSLLNSQADVSSFDDSTLKKFKDFINNFIDSSFNVLL
                     KSVTNHFTTEQDQMVSLEQVEYLLFFAWFIKYQILRYQYNLVDNFNPIQSVFKETSFI
                     LMSSLLRTGVEQKNWIVAHAGMIAFNQLLSLTQVSEDDVNFDEIEYIISRLFSDDRIQ
                     LLANLPRIAEKHSIQFMKNAIELTHTILKTLQNYAGDRLLRIEGKKRGRKAMNVSLED
                     IRKLMERDNVGRDEAVEILSPVTTSIEINFGRVLGRYINDNTINTYLKFLERFRELED
                     DSIKKVISFFHRIFVDSKDEALLFRIDLMLLFRDMLASNGLPRSSSSRKYVDDFSKYY
                     LTRLKKKLKVSPAWFIGILFPTLHDNEVGYYQRFGEVRRSKVNNYDGVSVSYFKPIEN
                     ENRYTEQELLNLKFGILISSLLDDGKNELVDYLIEHLAESIDKFKLYATNNDNGSNPP
                     HEYLITENENIIESTVRDKDFRALLQLTGYKIPNNRDEKCYIPGDIDIGTLSTFLDYI
                     KFHKATPFETPNGKPSSTYLTRPNSKTSVDENEEEDGWNGNEEYDYTDASIINDNDYF
                     KELQGTNTDLSERSLSKGIAKSKKKSKQRKSKGKNTSNNLPTFDVDGNEIKTKKSGLQ
                     ISSKEFISDSEEDEELDPVFFENEMYMRLLLDKHNGQLPDDKYKQFTKFAEERMNNKG
                     HLINDYSALFDGQVLDVKDLSTIEYTNSHPDLSLKSRTEQITQQLNEDDSSQETKNTA
                     GILPETEIIQDSDAELDIPFTNNDTDLSDDDMNSSSDSDDGSHKLLTTKENVKKHNLE
                     EDNYDEQNGHHDREIKIDNELEEEEVISTRKRQHVFIDEDD"
     gene            complement(<1065861..>1067027)
                     /gene="TPHA0B04520"
                     /locus_tag="TPHA_0B04520"
                     /db_xref="GeneID:11534726"
     mRNA            complement(<1065861..>1067027)
                     /gene="TPHA0B04520"
                     /locus_tag="TPHA_0B04520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684507.1"
                     /db_xref="GeneID:11534726"
     CDS             complement(1065861..1067027)
                     /gene="TPHA0B04520"
                     /locus_tag="TPHA_0B04520"
                     /note="ancestral locus Anc_1.78"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684555.1"
                     /db_xref="GeneID:11534726"
                     /db_xref="GOA:G8BQ40"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR023827"
                     /db_xref="UniProtKB/TrEMBL:G8BQ40"
                     /translation="MGFNLLTIFLLIARLFDNVICTQYIIQLVENTQVNAFLKKHDID
                     VMDSNILPIEIGNSFIAFSGDLSKEQVSSVFEDNAAAAISTEKYLELQGYLKQTDAPK
                     HLGRLTKDSIKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNIHKLID
                     LTTSPIPSGDFNGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMSRVLSALS
                     LIEKHEQKTMRPSIIVLPFQTEKNTILESAIENISKKIPVIIPAGNKHQNACKLSPMG
                     IKKLSNVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLKTSSNGGKELIH
                     NVTGTSYSCGIVAGVVGYYMSKGMNGTDAVSKVLSSPLVATRSNTSIKELKLFI"
     gene            complement(<1067453..>1069630)
                     /gene="TPHA0B04530"
                     /locus_tag="TPHA_0B04530"
                     /db_xref="GeneID:11534831"
     mRNA            complement(<1067453..>1069630)
                     /gene="TPHA0B04530"
                     /locus_tag="TPHA_0B04530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684508.1"
                     /db_xref="GeneID:11534831"
     CDS             complement(1067453..1069630)
                     /gene="TPHA0B04530"
                     /locus_tag="TPHA_0B04530"
                     /inference="similar to DNA sequence:INSDC:YOR154W"
                     /note="similar to Saccharomyces cerevisiae SLP1 (YOR154W);
                     ancestral locus Anc_1.77"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684556.1"
                     /db_xref="GeneID:11534831"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR012919"
                     /db_xref="UniProtKB/TrEMBL:G8BQ41"
                     /translation="MAYFSYTLAIFLVIFNEFFYVQGSNASASLIENNVNSSCCIEKN
                     HRQEIFKIEAEILSCVASLTKSAGIEASTKYALSSTVFMPVLSTVAVDIALELTDDKS
                     EKEASNITNTIDLKNNTFKPFNEWKQQKLYNTLSDSKIRAQRTRSPVNQDLEEQDLIG
                     GEMEIDLGFFTEKEIDNELPEVKVYKNKFNYASLDCAATIMETNSDASGANSILIENK
                     DTYLLNPCSVASKYVIIELCQDILVEQIAMANFEFFSSTFKDVRFSVSDRYPITKDEW
                     KVIGNFKAQNSRNIQNFMIENPKIWARYLKIETISFFDNEYYCPISVVRVHGKTMMDE
                     YKMSNIDKHDREGIEYKYSEAVEDDEIEMVCDPINEISGHNFTNVMFMNNRLNFTESA
                     LQPLTFDDYLKEVNRTFCPPRPYKNSSATSSLSSSGSTEDSIFKNIMKRLTSLESNTN
                     LTFSYIEEQSRLLSESFEASERSHVKKLTFIIDAFNITVQRNIQSLSEFAGQLKEQSL
                     RILEEQKLNNDFFSTQNARKMERMEKEIAYQRRVIYFILFVLSALVLATILNKEFYFD
                     DYNQPDNWMESKPKPTENKSYSKNDFMMKIDAQKKEQFTLSPYSSGSAYSDIEYLQNS
                     FDNGNESDSKLNTNSNFINEEISNLKFTKSETFEKSNSSDFNNDTENHLTFSKSDAFE
                     NSFDRKYNNQHGNTLTLSKSDTYGDNFRSDDQGSINSDQEWEY"
     gene            complement(<1070244..>1074815)
                     /gene="TPHA0B04540"
                     /locus_tag="TPHA_0B04540"
                     /db_xref="GeneID:11534867"
     mRNA            complement(<1070244..>1074815)
                     /gene="TPHA0B04540"
                     /locus_tag="TPHA_0B04540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684509.1"
                     /db_xref="GeneID:11534867"
     CDS             complement(1070244..1074815)
                     /gene="TPHA0B04540"
                     /locus_tag="TPHA_0B04540"
                     /inference="similar to DNA sequence:INSDC:YCR042C"
                     /note="similar to Saccharomyces cerevisiae TAF2 (YCR042C);
                     ancestral locus Anc_1.76"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684557.1"
                     /db_xref="GeneID:11534867"
                     /db_xref="UniProtKB/TrEMBL:G8BQ42"
                     /translation="MSSYSKDATPKAPFTPQLLNTLESQMSFRTFKIAHQRVALDIDL
                     KRHCIKGVADIILIPLIQNLEYITLDCKNMNVTNVLIENRRSDSYIHDDPIRDAEEKY
                     KNKSFDALLEYNTIEQSQFLRGKFADLNERSEEQTKSQLIIKVPPSIKITLQDANFLT
                     NYTPITPSVRVTPAAEETVFTPLSIKVEYELMNPTTGVRFDTPSEQEPYLWNAYTANS
                     EICSTASYWMPCVNSLDEKSTWEIEISVPRKVKDIGVSKIIGQNEPATTEKSLPKIKI
                     VSSGNTHINGNNTDTLDNNTKSNKMDVDEIEQNESSNVKTDFNGPIGENKESHLRGGA
                     EEEEEEEEEEEEEEEEEEHDIENDTGNLINRDIKVCCSEFTTAKEVSHPTDLSKKLFT
                     FQLFNPVAPHHIGWAVGAFDIWELPRFSTRDENYDEDQDDHDETRKTSKQNNNDAEVP
                     EIEADIIPIQIYTLPTPDIDYETILNSNMVVQKAMDFYSKEFGSFPFTSYSLIYLPSS
                     IDETMNFASMTICNTRILYPPTILDQIHPTTDHLLWSLAMQWSSVNITPLHINDIWCS
                     LGMAGYMVFKLWEELYGSNEFQYRLSKCKETVIALDWEKPPIGSTFDGASRPVSFTSK
                     DLDFIKLKAPLVLYILDRRMIKTERSFGLSRILPKIFLQAMSGDLPNNSLSAAHFQHV
                     CERVNKSKLGKFFQQWVYSSGVPIFRVTQRFNKKRMVIEMGIRQVQEQKVSGSKNGVK
                     EGFSSRALNYIQDSTRETIPHFTGSMTIRIHEPDGTPYEHIVEIKDVFTKLDIQYNTK
                     YRRSRTKKQSSLKLDKDGKTELNEQPSQVVKFPNVNIQKFGTVLSTQSDCESWNLADP
                     SLSSEVLEIQRQNEAFQWIRIDSDLEWICELHINQSDYMFAAQLQQDADIEAQIQSIR
                     YYDDTIEQSQVTSLLYSSILTRTVMDSRYFYGVRLEACRALTKYIVRDLPNRVFPGGP
                     RHLIKIYQELFCYSESNIPLNNDFSDIRKYYLQKAIPVYLSEVVSETDESPEFVKNFL
                     LDILTYNENSGNNYNDIYFICYLIQALVECATKSANDRSFISKVLEQLQRYENLDKWT
                     PSYQLLLTKTILESKLTLHRYGLYEFEDLQEILMYTLSPVVFNVKENCVRFREGQDNI
                     VLECFKIMLIEGGLKSREALQYFFETLLFTPNVYIKDKLVDVFIEAVDYIAEHKLMDT
                     LNDDLNYLTKQLVPEYNEYDEEVNIDEVFGEDDDDHPIIQEDFGQEIQQRRELKLRSH
                     VGGVLSILRKLFENYSPLKQILWKTLHVPTLSLYQRKRLFDISRILYQLVDRFEIPLP
                     KPPMKKLIAEKISNSKIVIKREGSLKLVIAPKNTTITKPTVTINMKPTKLKINLTKGT
                     KIKKPTDDKKQKPLPKLKIKQKPVSKPKAKVKKGTTNRVGTLPIRFVKIFTGESKRVD
                     ISSVPFTKHVRIMKANSRSLSVKIILPKKASPQETQLDVQPPQEIQTTETSIKQEQTE
                     STEQHQQNEAELTPNIASISEVSSEGSQS"
     gene            <1075297..>1076334
                     /gene="TPHA0B04550"
                     /locus_tag="TPHA_0B04550"
                     /db_xref="GeneID:11534825"
     mRNA            <1075297..>1076334
                     /gene="TPHA0B04550"
                     /locus_tag="TPHA_0B04550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684510.1"
                     /db_xref="GeneID:11534825"
     CDS             1075297..1076334
                     /gene="TPHA0B04550"
                     /locus_tag="TPHA_0B04550"
                     /inference="similar to DNA sequence:INSDC:YNL274C"
                     /note="similar to Saccharomyces cerevisiae GOR1 (YNL274C);
                     ancestral locus Anc_1.75"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684558.1"
                     /db_xref="GeneID:11534825"
                     /db_xref="GOA:G8BQ43"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029752"
                     /db_xref="InterPro:IPR029753"
                     /db_xref="UniProtKB/TrEMBL:G8BQ43"
                     /translation="MGKPVVLRLGCIRFGQQKWEEFSKTVDLIVLDDSMTRAEFLKLL
                     QDPHSKLENVQIITRTFLSVNQTGRFDKEIAEALPASVKAIVHTGAGYDQVDVEHFNK
                     RGIQVANVPDIVTSATADNHVFLLLGALRNFSSGHRELINGNWEKKGAGCSVTFGHDP
                     VGKTVGVLGMGGIGRAVVSRLQPFGFEKFIYHNRNRLSPELEAGCQYVSFDELLKQAD
                     IISINVPLSKATRHIIDETAISKMKDGVVIVNTSRGAVIDEQALIRGLQSGKIRTAGL
                     DVFEFEPKVPQELIDMPQVLSLPHMGTYCVETWQKMEEFVVENAINMIEEGKVISLVP
                     EQKNEAWIKEL"
     gene            complement(<1076545..>1076964)
                     /gene="TPHA0B04560"
                     /locus_tag="TPHA_0B04560"
                     /db_xref="GeneID:11534949"
     mRNA            complement(<1076545..>1076964)
                     /gene="TPHA0B04560"
                     /locus_tag="TPHA_0B04560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684511.1"
                     /db_xref="GeneID:11534949"
     CDS             complement(1076545..1076964)
                     /gene="TPHA0B04560"
                     /locus_tag="TPHA_0B04560"
                     /inference="similar to DNA sequence:INSDC:YCR043C"
                     /note="similar to Saccharomyces cerevisiae YCR043C;
                     ancestral locus Anc_1.74"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684559.1"
                     /db_xref="GeneID:11534949"
                     /db_xref="UniProtKB/TrEMBL:G8BQ44"
                     /translation="MVPPPYDPILLREHAYYDTGDLTVVLDPDTFYQNGLKSSARYGL
                     GFLNYNFGLRDEIYEKSFWMLVRIHVYTHFTFYLTLFTGLLFAWVYMNFLRGNTQNLK
                     QLLFGKRKQQAIWKYKSIKNKNELLHDGDLEYQHVKD"
     gene            complement(<1077406..>1079121)
                     /gene="TPHA0B04570"
                     /locus_tag="TPHA_0B04570"
                     /db_xref="GeneID:11535175"
     mRNA            complement(<1077406..>1079121)
                     /gene="TPHA0B04570"
                     /locus_tag="TPHA_0B04570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684512.1"
                     /db_xref="GeneID:11535175"
     CDS             complement(1077406..1079121)
                     /gene="TPHA0B04570"
                     /locus_tag="TPHA_0B04570"
                     /inference="similar to DNA sequence:INSDC:YNL275W"
                     /note="similar to Saccharomyces cerevisiae BOR1 (YNL275W);
                     ancestral locus Anc_1.73"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684560.1"
                     /db_xref="GeneID:11535175"
                     /db_xref="GOA:G8BQ45"
                     /db_xref="InterPro:IPR003020"
                     /db_xref="InterPro:IPR011531"
                     /db_xref="UniProtKB/TrEMBL:G8BQ45"
                     /translation="MLEFRSTRNSFFSSEDEDKNNVSSHIQDVPDDESIEVKRRKRRF
                     PTLGKGIMMDIYDRLPYYWDDWKDGWDYRVIPSTLETYFNNLLPAIAFAQDMFDRTDN
                     SYGVNEVLLSSAMAGIVFGILSGQPLCIVGVTGPISIFNYTVYEIIKSQDINFFGFMF
                     WICIWSMILHFISAITNLVSLLQYVTTFPCDIFGLFINVVYIQKGIQILTRQFTNKHG
                     TPDISAGFSSITVALCMTIFGTGFKSFTKTKLLTPTLRTVISDYSTFLSVLFWSGFIH
                     FGGALNDIDFQSLPITKSFRPTSDIGRDRSTWLAYEWIPVKDVFLALPFGIILTLLFY
                     FDHNVSSLMAQRSEYKQVKPSAFHYDFFLLGITTGISGVLGIPAPNGLIPQAPLHSES
                     LLVMDKNMEVVRCVEQRVTNTVQGLMILATMARPFLVCLGQIPQAVLSGLFFMMGIQG
                     LLSNAIIDKISWLFTEERLKDHNSPMINVSKKSIIIYLCFALAGFTGEFAITNTIAAI
                     GFPLVLLATVAGCFIFPKVIPEEDLATLDGAVAEDFIIKNLKLENMLKPLEWKGKRKG
                     SQSDE"
     gene            complement(<1079414..>1080493)
                     /gene="TPHA0B04580"
                     /locus_tag="TPHA_0B04580"
                     /db_xref="GeneID:11535166"
     mRNA            complement(<1079414..>1080493)
                     /gene="TPHA0B04580"
                     /locus_tag="TPHA_0B04580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684513.1"
                     /db_xref="GeneID:11535166"
     CDS             complement(1079414..1080493)
                     /gene="TPHA0B04580"
                     /locus_tag="TPHA_0B04580"
                     /inference="similar to DNA sequence:INSDC:YCR044C"
                     /note="similar to Saccharomyces cerevisiae PER1 (YCR044C);
                     ancestral locus Anc_1.72"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684561.1"
                     /db_xref="GeneID:11535166"
                     /db_xref="InterPro:IPR007217"
                     /db_xref="UniProtKB/TrEMBL:G8BQ46"
                     /translation="MLKRSIICCLLLTAFASGSPGDNLEEFDQCLKACTNKNNCHGFD
                     MDFVSDNNKFKMIVYDEVPPVLKKFFFWDCDSDCDYRCQQLITRLRISDGEEIFQFHG
                     KWPFRRFLTMQEFFSTIFSIGNFFPHLFGFIKLRKAIRRYSSQNGMNSKNNVVVHLKN
                     YSYVAISGMFAWTASTIFHWRDLPVTENLDYFFAGMTVLMGFHAIFARIARLDRKPQY
                     LRGFFWLIVTIFGCHVLRLYLSWSYTYNMRFNIALGLTQYVLLLVLAFQNYQSLKVNR
                     KKLDDRLYNSSKEGQVYRLCVVPSILVISTALAMSLELFDFFSYTFQIDAHAIWHLST
                     IWPSWIMYGFFIDDFKYITTKNNRE"
     gene            complement(<1080849..>1081538)
                     /gene="TPHA0B04590"
                     /locus_tag="TPHA_0B04590"
                     /db_xref="GeneID:11532811"
     mRNA            complement(<1080849..>1081538)
                     /gene="TPHA0B04590"
                     /locus_tag="TPHA_0B04590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684514.1"
                     /db_xref="GeneID:11532811"
     CDS             complement(1080849..1081538)
                     /gene="TPHA0B04590"
                     /locus_tag="TPHA_0B04590"
                     /inference="similar to DNA sequence:INSDC:YER018C"
                     /note="similar to Saccharomyces cerevisiae SPC25
                     (YER018C); ancestral locus Anc_1.71"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684562.1"
                     /db_xref="GeneID:11532811"
                     /db_xref="InterPro:IPR013255"
                     /db_xref="UniProtKB/TrEMBL:G8BQ47"
                     /translation="MSSTMNDFELLKERMNNFTDTLDMYLDEKVSMAKDLTEDYRASI
                     DALNARSQELAASIQLTQTQIEEMTSQIEVLEAANDTRKTDLLLLQLKSTQLLKNREV
                     LLKETDDVDALLQDKMDKIKRLKEFYLKQNHQDNPEVSLYEKLLGLTIDTSEAGTLRF
                     NFHKLTETQSKVPAYVVLDVSKQEYQILNSVPAIDANSLASILGDLNKTNNIAQFLLS
                     TREQLQQSLTQ"
     gene            <1081921..>1083291
                     /gene="TPHA0B04600"
                     /locus_tag="TPHA_0B04600"
                     /db_xref="GeneID:11534982"
     mRNA            <1081921..>1083291
                     /gene="TPHA0B04600"
                     /locus_tag="TPHA_0B04600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684515.1"
                     /db_xref="GeneID:11534982"
     CDS             1081921..1083291
                     /gene="TPHA0B04600"
                     /locus_tag="TPHA_0B04600"
                     /inference="similar to DNA sequence:INSDC:YER019W"
                     /note="similar to Saccharomyces cerevisiae ISC1 (YER019W);
                     ancestral locus Anc_1.70"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684563.1"
                     /db_xref="GeneID:11534982"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:G8BQ48"
                     /translation="MSKKSNPRVSFLTFNTWGLKWVSKFREERLRAIADAICGHPGYV
                     ESLQGAATVFGDGSLSNEYDIIALQEIWCKSDWDYIVEKCGHLYPYNRIFYSGILTGP
                     GLAILSKIPIESTFLYRFPINGRPSAFLRGDWYVGKSIAITLLKPVVEGSTPLAIMNS
                     HMHAPYSLTGDANYHCHRACQAWDFSKLANLYKKAGYAVVIVGDLNSRPGSLQHRFLT
                     EETNLIDSWEQLKGKQDITEIASLPPLEQLKEGCCTCDSTLNTWRPKCKPTDACRLDY
                     ALIDGEKLRTIDAGVRFTERLPNIGSYSDHFAYSCTLEIAFQDSSIVGSSEETLDNYT
                     NTEMSTLKHRIANYNELVDVIDTYMNTARNQKFYRGLHFVLSIVALVFLLVKSFDKNS
                     LIRSNSSWLTFIWILLVIAISATGTIDGLISFLFGRKEIRALTEVKYEVLDAKCSLSK
                     ATKKQL"
     gene            complement(<1083416..>1084930)
                     /gene="TPHA0B04610"
                     /locus_tag="TPHA_0B04610"
                     /db_xref="GeneID:11535145"
     mRNA            complement(<1083416..>1084930)
                     /gene="TPHA0B04610"
                     /locus_tag="TPHA_0B04610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684516.1"
                     /db_xref="GeneID:11535145"
     CDS             complement(1083416..1084930)
                     /gene="TPHA0B04610"
                     /locus_tag="TPHA_0B04610"
                     /inference="similar to DNA sequence:INSDC:YNL277W"
                     /note="similar to Saccharomyces cerevisiae MET2 (YNL277W);
                     ancestral locus Anc_1.68"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684564.1"
                     /db_xref="GeneID:11535145"
                     /db_xref="GOA:G8BQ49"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR008220"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BQ49"
                     /translation="MTTLSGSHHIDNNLTAKSKTLRELDMLEQKRFNPLLNLVNNQRI
                     VEVPELTLESGATIRNFPIAYKTWGKLNETGDNCIVICHALTGSSDVSDWWAPLLGKD
                     KAFDPSRFFIVCLNSMGSPYGSFSPLSVNEDTGRPYGPEFPLCTIRDDVRAHRLVLDS
                     LGVKSLASVIGGSMGGMLALEWATLYDKQYVNNLVALATSARHSAWCISWSEAQRQAI
                     YSDPKYANGYYTPENPPVSGLSAARMSALLTYRSRNSFETKFSRRSPSLLQQQKSKNA
                     QAVASQLGQSSCPSINEHSLHIHNDGNKNLNNDNNDKNSSIVSPNTPRGSISSLSSMT
                     SAGSAAATVEGKLVKPAQTYFSAQSYLRYQGAKFINRFDANCYIAITRKLDTHDLARD
                     RFEYDEDITRVLNSISQPTLIIGIRSDGLFTFPEQEFLSEYIPNSTLKEIKSMEGHDA
                     FLLEFELINNYIVDFLKVNAKSFMDRAPVQWAEDIAGDGINNSVFGEAEEVTNW"
     gene            complement(<1085725..>1087887)
                     /gene="TPHA0B04620"
                     /locus_tag="TPHA_0B04620"
                     /db_xref="GeneID:11535174"
     mRNA            complement(<1085725..>1087887)
                     /gene="TPHA0B04620"
                     /locus_tag="TPHA_0B04620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684517.1"
                     /db_xref="GeneID:11535174"
     CDS             complement(1085725..1087887)
                     /gene="TPHA0B04620"
                     /locus_tag="TPHA_0B04620"
                     /inference="similar to DNA sequence:INSDC:YLR188W"
                     /note="similar to Saccharomyces cerevisiae MDL1 (YLR188W);
                     ancestral locus Anc_1.67"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684565.1"
                     /db_xref="GeneID:11535174"
                     /db_xref="GOA:G8BQ50"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BQ50"
                     /translation="MLRLVRVHPILKPSYTRSFHRYQHPLKAIQLIQTKNIINLHASF
                     NRSVSKSMILQQTRFNSTNESSKGINTKLTETQQKLEKLSSEESTNTGFKDVKRLFTL
                     AKPETAYIVLALVLILISSTVSMVVPSVIGKLLDLSSNTSNDDTGDAKSKEKVDNKED
                     RDNNTIYGFTHTQFFAGLGIVFVIGAIANTGRIVILKVTGEKLVARLRTRTMKAALDQ
                     DATFLDSNRVGDLISRLSSDASIVAKSVTMNVSDGTRAILQGFVGFSMMSYISFKLTS
                     VMVLLIPPLGIMALVYGKKIRNLSRQLQTAVGGLTKVAEEQLNATKTIQAYGGEKKEI
                     RRYASEVRDVFDVGLKEAITSGIFFGSTGLVGNAALLSLLLVGTNMISSGSLTVGDLS
                     SFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELDDRKPLIKPTIGKDPVTLKGKA
                     IIFQDVSFHYPTRPNHRVFNKISFKIEPGEHICFVGPSGSGKSTVSQLLLRYYDATEG
                     NILIGEDNIKSLSLRKYRKLLGVVQQEPMLFNGTIIDNILYNVPDEIASQKNKVDLAI
                     KKSNCTKFLANFPDGLNTIVGPRGTQLSGGQKQRIAIARSFLLDPSILLLDEATSALD
                     TQSEDIIAMTLKKREAEGLTTISIAHRLSTIKYSSRVVVLNKNGSVVETGKFTELIAN
                     PTSELNLLLSKEGQEPAYVAADVAAETPAEAPSTDNTP"
     gene            complement(<1088566..>1091637)
                     /gene="TPHA0B04630"
                     /locus_tag="TPHA_0B04630"
                     /db_xref="GeneID:11534893"
     mRNA            complement(<1088566..>1091637)
                     /gene="TPHA0B04630"
                     /locus_tag="TPHA_0B04630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684518.1"
                     /db_xref="GeneID:11534893"
     CDS             complement(1088566..1091637)
                     /gene="TPHA0B04630"
                     /locus_tag="TPHA_0B04630"
                     /inference="similar to DNA sequence:INSDC:YLR187W,YNL278W"
                     /note="similar to Saccharomyces cerevisiae SKG3 (YLR187W)
                     and CAF120 (YNL278W); ancestral locus Anc_1.66"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684566.1"
                     /db_xref="GeneID:11534893"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G8BQ51"
                     /translation="MRRLFSGSKTPEIPSPPRVFSRTSQSSDSPSPSLKKSWSSSNLN
                     SKLKKNAYLTNDSSADHELSLPTVSSTLSPELIPIVTLLAAQAHRRYQEGVFLILHDL
                     KNDGTQANRIWKEVYGVLIGTQLALWGANELAEVGNDLKDVASKPTYINFTDSIMKPL
                     NSSDSVVTESNQKLEHVLAVSTTLKNRYFLKFSDKDSFNKWNAAIRLSLFECTALQEA
                     YTAAFLSSRGSKLGDIKVVLADTKFDYEDWVSVRFGAGMPWKRCYAVISQSSGKKKQP
                     KGKISFFESEKKTKKVNAMATVLDARAVYTVYPSSTQLIDSSTIIKLEGSIAFSNGSS
                     KKSVDSQQDVDIFIMPEKHQAVPGYDTVIRFIIPTMNTFRLYGRPKKLIASKDDPSSL
                     LFGLPTLPHIYYLNAEDIYPIANSSTNMDWTNMMWRDAIKDILAKKISQGYAGTGSSS
                     SLTSDIATPVIGSSELFGNCNSPLPGSTQFFPNNPGSRKTSSNLNSPINTNFNESSKK
                     NKTATNRELNPARTDIKNSEKENLSPYNNDNTNFTKNLTSQQNENSLNMNVSNNQQKS
                     SNVPFEAASTGRKSVQDAEYNSNAKISHGVNNQSITSDLGDVYEKYSTSPFGRSQITL
                     DKTVPQSIQVPINGSNAGAYERYVGHSKSKTFEISDIDDSSSSVNSAQRGNNQTSRNP
                     YPMDDEEDNDLVELSRRISQIGGSTTSFQQDDYQNSLTASSVAKTDNIFDPDFVEQNN
                     IYASESNDKPTPNYMFNNKDGNNSSHSVNDYVMANEYPPNRSVESPVNVNNKQPLSQP
                     QYSTNISMSGGPMYQKLSLVENNQPQQVGRTDHAPPNFNQQLAPQQYNNRIRHPTNIS
                     PQKPYGNMPNMHTNPNMRNPNMHNPNVQQNLNMRNPNIHNPNMQNPNMHTAQNMNNGP
                     YYNRPSPSQPQNNGGRPYPMQQNYQTNGQFNKSRPPPQAQGQFNNRGNPPFNPMNQNG
                     NRQFRDPNSGNMPEQQRQMVNNGKVKPQPRGGFSQFMPSSGTTNNNNPYSQ"
     gene            complement(<1092893..>1093654)
                     /gene="TPHA0B04640"
                     /locus_tag="TPHA_0B04640"
                     /db_xref="GeneID:11535147"
     mRNA            complement(<1092893..>1093654)
                     /gene="TPHA0B04640"
                     /locus_tag="TPHA_0B04640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684519.1"
                     /db_xref="GeneID:11535147"
     CDS             complement(1092893..1093654)
                     /gene="TPHA0B04640"
                     /locus_tag="TPHA_0B04640"
                     /inference="similar to DNA sequence:INSDC:YLR186W"
                     /note="similar to Saccharomyces cerevisiae EMG1 (YLR186W);
                     ancestral locus Anc_1.64"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684567.1"
                     /db_xref="GeneID:11535147"
                     /db_xref="GOA:G8BQ52"
                     /db_xref="InterPro:IPR005304"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:G8BQ52"
                     /translation="MVEDSRVRDAIRAGEQEALPASLVPKAPSVLNSKDKNTQRLIVV
                     LSQASLETHKIPSSRPGGDKYVLLNCDDHQGLLKKMDRDISEARPDITHQCLLTLLDS
                     PINKAGKLQVYIQTSRGVLIEVNPTVRIPRTFKRFSGLMVQLLHKLSIRSVNSEEKLL
                     KVIKNPVTDHLPTKCRKVTLSYDAEVVRVQDYIEKNLEEDESICVFVGAMARGKDTFA
                     DEFVDEKIGLSNYPLSASVACSKFCHGAEDAWKIL"
     gene            <1094394..>1096664
                     /gene="TPHA0B04650"
                     /locus_tag="TPHA_0B04650"
                     /db_xref="GeneID:11534859"
     mRNA            <1094394..>1096664
                     /gene="TPHA0B04650"
                     /locus_tag="TPHA_0B04650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684520.1"
                     /db_xref="GeneID:11534859"
     CDS             1094394..1096664
                     /gene="TPHA0B04650"
                     /locus_tag="TPHA_0B04650"
                     /inference="similar to DNA sequence:INSDC:YDR499W"
                     /note="similar to Saccharomyces cerevisiae LCD1 (YDR499W);
                     ancestral locus Anc_1.63"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684568.1"
                     /db_xref="GeneID:11534859"
                     /db_xref="InterPro:IPR018622"
                     /db_xref="UniProtKB/TrEMBL:G8BQ53"
                     /translation="MSFDEGFSSDDDDLLLELKSKPPRATQIAANTQPTQIPIVNTND
                     PVGTELTNLQMQLTAAQGEASMLRDKIKLLNQEKDEDNKLRNITKQNLAEHHIGELRK
                     LQSEIQSLQDENKFLLIESKRLSSKNSHHTKNTERRQESSSSTASFNVHSNNVTAVND
                     SAGNTTVSSNSPILKKRKIEESLLLSPNDDVLKVNSTIVLPDEIGLYVDSLLAFKITG
                     IDLTVIEILNKIKLDYIDDYQFETFHKSRDESIGKSLVQLLLASKITMSLDIMIDNLL
                     ENLAILIKEITLNKRESKLAVPFLVALMYKAVSFRPSAVHNLALKDLFFFLCDLVKKY
                     QHVLKCSLHESPLDLNVQPAIFQYELIDSLVVLYSFDLLEMTFRILQLQSDEVLQDFF
                     DKDIIKNIELIYKLALPISFLPISNIVINAVEIINLLSTMCLTIKLNSKIELISSKWW
                     RDCTTRLYDILNKNVSNQNDNSLDNKSLYLSKYFNCFGLIRNIGDNSIARFISDLIDV
                     DSLRSVPRVISKDDILEISTDFTLNSELEKLFLQLKDEILSTIDDLMKVYDTSTDIIN
                     TELLIQLTKMMSEEQNLMISKYIVQISMNLDVRCNLIEHYLTLIYKLWACHEDKLNSM
                     QIKDKIQSELVTSLWRVVVSHVEKKRWGYELDSPEQLNSSKELEVYNQGDLVEQFAEL
                     ELEDDILLYQDVFEDMPNYVREEIMKDAAEHYPRIIQIKYGEIYQEMAKNILETKLEI
                     STSMEDIDSIYLTMGN"
     gene            complement(<1096855..>1097676)
                     /gene="TPHA0B04660"
                     /locus_tag="TPHA_0B04660"
                     /db_xref="GeneID:11535188"
     mRNA            complement(join(<1096855..1097111,1097670..>1097676))
                     /gene="TPHA0B04660"
                     /locus_tag="TPHA_0B04660"
                     /product="60S ribosomal protein L37"
                     /transcript_id="XM_003684521.1"
                     /db_xref="GeneID:11535188"
     CDS             complement(join(1096855..1097111,1097670..1097676))
                     /gene="TPHA0B04660"
                     /locus_tag="TPHA_0B04660"
                     /inference="similar to DNA sequence:INSDC:YDR500C,YLR185W"
                     /note="similar to Saccharomyces cerevisiae RPL37B
                     (YDR500C) and RPL37A (YLR185W); ancestral locus Anc_1.62"
                     /codon_start=1
                     /product="60S ribosomal protein L37"
                     /protein_id="XP_003684569.1"
                     /db_xref="GeneID:11535188"
                     /db_xref="GOA:G8BQ54"
                     /db_xref="InterPro:IPR001569"
                     /db_xref="InterPro:IPR011331"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR018267"
                     /db_xref="UniProtKB/TrEMBL:G8BQ54"
                     /translation="MGKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCAACGYPAAKT
                     RSYNWGSKAKRRHTTGTGRMQYLKYVSRRFKNGFQTGTASKSE"
     gene            <1098809..>1100185
                     /gene="TPHA0B04670"
                     /locus_tag="TPHA_0B04670"
                     /db_xref="GeneID:11535132"
     mRNA            <1098809..>1100185
                     /gene="TPHA0B04670"
                     /locus_tag="TPHA_0B04670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684522.1"
                     /db_xref="GeneID:11535132"
     CDS             1098809..1100185
                     /gene="TPHA0B04670"
                     /locus_tag="TPHA_0B04670"
                     /inference="similar to DNA sequence:INSDC:YDR501W,YLR183C"
                     /note="similar to Saccharomyces cerevisiae PLM2 (YDR501W)
                     and TOS4 (YLR183C); ancestral locus Anc_1.61"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684570.1"
                     /db_xref="GeneID:11535132"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:G8BQ55"
                     /translation="MSFLPSSPIANRPDDEAGRAFSADVFGEDTPGLHLKGLPIIDAN
                     DEYPTPNPSSTIGRSSPMRSNGNVLPTSPITAAVSLQGQDPVEIAEVHIKDVIPIRID
                     SQLENQKIVIGRQSKECNVVLPKRKNISRKHAVVSYNKDLDCVRIQCLGTNGLIVNFP
                     AKIQFNLVKRNPVAKIYELVPLKSQNKLEFTSELRDRPEIKELSNVTNLNSFVLLKDE
                     TVIIPYMKDIMLDFRTSKAVLSKTKKRDGKLKTSISQKASQLTTPEISHNIKTPSTPM
                     KEATSQYLPLSQETPINANHHTLNNKLNKQNDKHKIHKPEHFKKSPKLVEPSKKIADK
                     DILESLTKRGYDCADLRHILANHLAFSNVQQTPLTQLLTVNSKIGTLNKTELRYLLSV
                     ENCIGVIYRQGKDAAGKPLDEEYYYDLENDSDEERRSLVQSLKGGRTGLRSCRRTHKQ
                     YFWKKPTK"
     gene            <1100596..>1101927
                     /gene="TPHA0B04680"
                     /locus_tag="TPHA_0B04680"
                     /db_xref="GeneID:11535153"
     mRNA            <1100596..>1101927
                     /gene="TPHA0B04680"
                     /locus_tag="TPHA_0B04680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684523.1"
                     /db_xref="GeneID:11535153"
     CDS             1100596..1101927
                     /gene="TPHA0B04680"
                     /locus_tag="TPHA_0B04680"
                     /inference="similar to DNA sequence:INSDC:YLR181C"
                     /note="similar to Saccharomyces cerevisiae VTA1 (YLR181C);
                     ancestral locus Anc_1.59"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684571.1"
                     /db_xref="GeneID:11535153"
                     /db_xref="InterPro:IPR023175"
                     /db_xref="UniProtKB/TrEMBL:G8BQ56"
                     /translation="MLSPKDISRIHITAHDFDKAGLNILGYYLKLYIIEQVLNESERT
                     KEATKLVTDLLDYIEAFKNEIETEKDEELAALKLLISDQNKAMAYTLKFTMTLYNSKL
                     LQLKDGPWNNDLKRGLWCCIDLFNCILHLWGDKITDKEPVRKCTKLCKIYLSKLAKGE
                     IGASANDKLDNAIDMAPTQAPVGSTASKNSDHEEEHDYIKYNGEINQNIVTDLENIVD
                     TEEEKVEKSIEDNNREFSTDTYVTSDVSMNKKNNHQTEPETDNKEADNMSGISIPRDD
                     DIANMITEYKKLTDEANQGPAGLSYQKPPTEEEIKKMIKEVEEQDDDVFDDDNEIEKE
                     GTAEPELPQVPNFLPENVPIFIDEPTSEPEHTCDIKIDDSAVVRNTSPQGKSSSKKYS
                     KEEIITMMNKAETIEKIQKLAKYAISALNYDDVPTAKDTLANALDLLKLLE"
     gene            complement(<1102212..>1103360)
                     /gene="TPHA0B04690"
                     /locus_tag="TPHA_0B04690"
                     /db_xref="GeneID:11535162"
     mRNA            complement(<1102212..>1103360)
                     /gene="TPHA0B04690"
                     /locus_tag="TPHA_0B04690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684524.1"
                     /db_xref="GeneID:11535162"
     CDS             complement(1102212..1103360)
                     /gene="TPHA0B04690"
                     /locus_tag="TPHA_0B04690"
                     /inference="similar to DNA sequence:INSDC:YDR502C,YLR180W"
                     /note="similar to Saccharomyces cerevisiae SAM2 (YDR502C)
                     and SAM1 (YLR180W); ancestral locus Anc_1.58"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684572.1"
                     /db_xref="GeneID:11535162"
                     /db_xref="GOA:G8BQ57"
                     /db_xref="InterPro:IPR002133"
                     /db_xref="InterPro:IPR022628"
                     /db_xref="InterPro:IPR022629"
                     /db_xref="InterPro:IPR022630"
                     /db_xref="InterPro:IPR022631"
                     /db_xref="InterPro:IPR022636"
                     /db_xref="UniProtKB/TrEMBL:G8BQ57"
                     /translation="MAGTFLFTSESVGEGHPDKICDQVSDAILDACLAQDPMSKVACE
                     TAAKTGMIMVFGEITTKAVIDYQKVVRETIKNIGYDSSEKGFDYKTCNVLVAIEQQSP
                     DIAQGLHLEQKLEELGAGDQGIMFGYATDETPEGLPLTILLAHKLNMKMADARRDGSL
                     PWLRPDTKTQVTVEYREENGRWIPLRIDTVVVSAQHAEEISTEDLRKLIKSEIVEKVC
                     PAHMLDDKTKYYIQPSGRFVIGGPQGDAGLTGRKIIVDAYGGASAVGGGAFSGKDYSK
                     VDRSAAYAARWVAKSLLAAGLCKRVEVEFSYAIGVAEPLSLHVNTYGTATKSDDEIIA
                     IIKKNFDLRPGVLVRELDLARPIYLPTASYGHFTNQEYPWEKPKTLEF"
     gene            complement(<1104578..>1105417)
                     /gene="TPHA0B04700"
                     /locus_tag="TPHA_0B04700"
                     /db_xref="GeneID:11535096"
     mRNA            complement(<1104578..>1105417)
                     /gene="TPHA0B04700"
                     /locus_tag="TPHA_0B04700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684525.1"
                     /db_xref="GeneID:11535096"
     CDS             complement(1104578..1105417)
                     /gene="TPHA0B04700"
                     /locus_tag="TPHA_0B04700"
                     /inference="similar to DNA sequence:INSDC:YDR503C"
                     /note="similar to Saccharomyces cerevisiae LPP1 (YDR503C);
                     ancestral locus Anc_1.57"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684573.1"
                     /db_xref="GeneID:11535096"
                     /db_xref="GOA:G8BQ58"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:G8BQ58"
                     /translation="MKLNLQQVTSYLSVFILQYLYVLIGFVFFFYSEYGLVPRTTDMK
                     FNIKNGSIAKAHVADEVVSGVECLSIAFLLPTVVIIVHCLVGRISKKRLSVSEAGDKK
                     GNSYMLSRLSFIPPQLHVLQLSLLCLGLILTVNGTITNILKLSIGNARPDFLDRCQPD
                     IPAEMKDQEWFTLDICKQANHDFLYEGLKSTPSGHSSFISCSMAYLFWWQTYFLSTSK
                     SKHFWCLLLAAVVIVSRLTDHRHHWYDLLFGTVVGLASFFFARTLIFDNKKVDQLLPT
                     TKN"
     gene            <1106697..>1107353
                     /gene="TPHA0B04710"
                     /locus_tag="TPHA_0B04710"
                     /db_xref="GeneID:11534891"
     mRNA            <1106697..>1107353
                     /gene="TPHA0B04710"
                     /locus_tag="TPHA_0B04710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684526.1"
                     /db_xref="GeneID:11534891"
     CDS             1106697..1107353
                     /gene="TPHA0B04710"
                     /locus_tag="TPHA_0B04710"
                     /inference="similar to DNA sequence:INSDC:YLR178C"
                     /note="similar to Saccharomyces cerevisiae TFS1 (YLR178C);
                     ancestral locus Anc_1.56"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684574.1"
                     /db_xref="GeneID:11534891"
                     /db_xref="InterPro:IPR001858"
                     /db_xref="InterPro:IPR008914"
                     /db_xref="UniProtKB/TrEMBL:G8BQ59"
                     /translation="MNQSINAAKTISEALTKHELLQDVIKDSFTPKGFLLVEYPTKKI
                     SVTLGNTIAVEDSQEEPHFQFISSSNVAPGSSDGIASFDYNEDSDLFTLVMTDPDAPS
                     RTDKKWSEYCHFVKTDIQLKKSAGSASAGGFTTSHFENKGNVLHSYIGPGPPKGTGLH
                     RYIFLLYKQPHGVKGSSFSSIPDRPNWGTGIPATGAHQWVTANKLELIASNFFLAENV
                     "
     gene            complement(<1107735..>1110488)
                     /gene="TPHA0B04720"
                     /locus_tag="TPHA_0B04720"
                     /db_xref="GeneID:11534704"
     mRNA            complement(<1107735..>1110488)
                     /gene="TPHA0B04720"
                     /locus_tag="TPHA_0B04720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684527.1"
                     /db_xref="GeneID:11534704"
     CDS             complement(1107735..1110488)
                     /gene="TPHA0B04720"
                     /locus_tag="TPHA_0B04720"
                     /inference="similar to DNA sequence:INSDC:YDR505C,YLR177W"
                     /note="similar to Saccharomyces cerevisiae PSP1 (YDR505C)
                     and YLR177W; ancestral locus Anc_1.55"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684575.1"
                     /db_xref="GeneID:11534704"
                     /db_xref="InterPro:IPR007557"
                     /db_xref="UniProtKB/TrEMBL:G8BQ60"
                     /translation="MNNTTMTHQHNELPSVNSNTSLSDNLQLNNYYDKLLFKNNSGKS
                     LVDLPSKLNNSNNNSQNATNGSENNSLFRNYISKIDNANTLKNSSFDGNNNTNDIASS
                     NNVSIGNEFNEVSEEDPISGSKFNKSTFNDFDLSSSFRGISLNGSSHISNNMQNNNPD
                     INFRNNSISVLPGDFNSSSSNDALHNFPLVALEMTTPSNSEPFPMAYNNHHNMNNNGL
                     GDSNGIFGSQYNATSSIHPFSSSQSTSTHTNDNFYSNGNPASNLQGYSGLFNFKAQLG
                     SSNYRTNDIDKGNDNNDAMLNLNIENARRSSYISDSLIHGQTLQNNLESVIDHLNNNN
                     GLNQYNQFNGAPNDNNRYGSNYMNYSNDPNPNPNSNADRIQHRNSVFTIPTHQATSGI
                     MQARNYTMMESSNISNHMLQQSQQPHQTKQQQQPQPQPQNRYGYAQNYGRNQSFSNGS
                     TNMSMLNTTNNSTQHNRFSQYNQHSHQKNQNNNHNIHNKYQLSNPLSTSNASNNDNAD
                     IGLTVFNGRQLKPNDELKQIFKECGSNYFSSELVFEFTDHIKRLLDKSSEDSELKQNC
                     IKFLNFLKSCNSNYVTTTNTELEKTSSTKKNAQSDSSSYMNYEPLALVTLKNGKLELL
                     SIPNNSNLFMSRGDMVIIDGDRGKDLALMVEPAVSFDLALFVYFLKKKIHFDSLITAK
                     SQHYPNKDFVKALIESTRGQSDKLNSRLYDVVELTQLVVPSKQVIRFATPWEVSSNLN
                     NKLKDELKALHVAKMKLSSINNSHLDQDQASTEDMNSQNLDLNVSNTTSNANSKLNIT
                     ILNAEIQFDRKKLTFYYICDERNDFRDLIKELFKLYKTRIWLCAIPNNLEIYSKYYNS
                     EKKELHLYQQMMQNYTNEDMLEITNNNIHNNNNNILSPFKKIELDNFQIGVYIELVKK
                     LFE"
     gap             1111082..1111101
                     /estimated_length=20
     gene            complement(<1112364..>1114268)
                     /gene="TPHA0B04730"
                     /locus_tag="TPHA_0B04730"
                     /db_xref="GeneID:11534892"
     mRNA            complement(<1112364..>1114268)
                     /gene="TPHA0B04730"
                     /locus_tag="TPHA_0B04730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684528.1"
                     /db_xref="GeneID:11534892"
     CDS             complement(1112364..1114268)
                     /gene="TPHA0B04730"
                     /locus_tag="TPHA_0B04730"
                     /inference="similar to DNA sequence:INSDC:YDR506C"
                     /note="similar to Saccharomyces cerevisiae YDR506C;
                     ancestral locus Anc_1.54"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684576.1"
                     /db_xref="GeneID:11534892"
                     /db_xref="GOA:G8BQ61"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="UniProtKB/TrEMBL:G8BQ61"
                     /translation="MLLFKDTSMVFTFFFLVSLFFIVKVDATYESHSDKSPYIFDFTI
                     KRKKVLYNNDNEKIILSINNSNDTYGPTIKVKPNDEVRIRVTNLICNEQELAKGANGK
                     SKIWQDYCQASLHFHGLINIGNKVDGVPNLTQKPIENGESYWYNFTIPEDTCGTFWYH
                     SHSSVQYGDGVRGLIIVNCVEYDTLKNNIINHLEIFGTSTLQSKSLLFADKNVLSSTT
                     FIPKKFDDVTKEHNILLSDWYHERTIDILEKDVLVDDGTNDPRFESSLINGVVENNVQ
                     MKILESNTKYLILRLLNSGTSGTQVFHIPNKKLIIFETDGTLLNPYVTDTLTMAVGQR
                     YSVLIKIEDEDKNEGFPIVKGINGCNKMMGYVTKTFWFTPIENESTITQNVETYIQEN
                     QSNNIRISKLPNFNNDELYKEYDNAKDGEIWKSNNDHSLKRIELFYDNYKAENTYKVN
                     DKTFEEYLESPIIIDNSNNTILEIILNSKDHMRHPWHLHGFNFQIVSMGKGTLYKSAI
                     VNHRTDIDSVKQYFQDLKYWETSRKSPLIRDSINIKGHSFVVLRVNLTNLTKKQLGKW
                     LLHCHVEWHVSKGLGAVFQITNTSTATPNNGSNNKPISIDTMTTKIKVLTIYCILICL
                     INYYIYIKFI"
     gene            complement(1114567..1114685)
                     /gene="TPHA0Btrna14L"
                     /locus_tag="TPHA_0Btrna14L"
                     /db_xref="GeneID:11535029"
     tRNA            complement(join(1114567..1114611,1114647..1114685))
                     /gene="TPHA0Btrna14L"
                     /locus_tag="TPHA_0Btrna14L"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUG"
                     /db_xref="GeneID:11535029"
     gene            <1116411..>1117592
                     /gene="TPHA0B04740"
                     /locus_tag="TPHA_0B04740"
                     /db_xref="GeneID:11535061"
     mRNA            <1116411..>1117592
                     /gene="TPHA0B04740"
                     /locus_tag="TPHA_0B04740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684529.1"
                     /db_xref="GeneID:11535061"
     CDS             1116411..1117592
                     /gene="TPHA0B04740"
                     /locus_tag="TPHA_0B04740"
                     /note="ancestral locus Anc_1.53"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684577.1"
                     /db_xref="GeneID:11535061"
                     /db_xref="GOA:G8BQ62"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G8BQ62"
                     /translation="MSTLTVKPAPNCHFFTPEQPVLGQFVTYNDSLKGENLAPPKLFH
                     PLAIRDTVFPNRIGVSPMCTYSSNNHEPTEFHQVHYGAWASRGCGMIIVECTGVDEAG
                     MISSNDLGIWNKYLADKHYEKIVEFAHSQNCKIGVQLGHCGCKKEMTATGNEIDSLYK
                     PAELDKKSIKEIVRRWGHAANLAVNVAHYDFIEIQGGHGNLISEFLNKNTNHRTDEYG
                     GSSFANRCRLLNEVVTEVRKEIGNGVPLFLRLSGTMSSLENEKSEEWTIEDTINLSHH
                     LYKCGVDVVDVTGGGHHVNEMTAPMESLSNKIKLIKQKTSKLKVASPGGVHSAKEAEK
                     LINDEDLDILLVGRPFLENPGLVNQWSEEMGIKVSEAVQYTWGFYPANEHLTRDPGMQ
                     K"
     gene            <1119282..>1121201
                     /gene="TPHA0B04750"
                     /locus_tag="TPHA_0B04750"
                     /db_xref="GeneID:11534758"
     mRNA            <1119282..>1121201
                     /gene="TPHA0B04750"
                     /locus_tag="TPHA_0B04750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684530.1"
                     /db_xref="GeneID:11534758"
     CDS             1119282..1121201
                     /gene="TPHA0B04750"
                     /locus_tag="TPHA_0B04750"
                     /inference="similar to DNA sequence:INSDC:YCL025C,YDR508C"
                     /note="similar to Saccharomyces cerevisiae AGP1 (YCL025C)
                     and GNP1 (YDR508C); ancestral locus Anc_1.50"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684578.1"
                     /db_xref="GeneID:11534758"
                     /db_xref="GOA:G8BQ63"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:G8BQ63"
                     /translation="MSDPKSGYEMSDTKAEAHVFSSQENEVEYLDSQLNGDSSSNNSI
                     KEPTSTGAKGHFKSFVDSFRRGDHAKNALHDLENDITTSISHASLVHAVSKAREDDEI
                     MQSVASAEHRKVNNTESDDLQKTIKPRHVIMISLGTGIGTGLLVGNSSVLSAAGPAPL
                     VIGYSIMGSCLYCIIQAAGEMAVVYSDLNGGFNNYPSFLLDPALGFSVAWVYCLQWLC
                     VCPLELVTASLTIKYWTTKVDPDVFVIIFYVLIISINVFGARGYAEAEFFFNVCKVLM
                     MIGFFILGIIITAGGAGNDGYLGAKYWHEPGAFRGEHAVDRFKGVMDTFVAAAFAFGA
                     TEFIALTAAEQSNPRKAIPSAAKKVLYRIVLIFLVSIIMLGFLVPYDSDQLLGSSGSG
                     VKASPYVLAVSLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSQQGYAPKWF
                     DYVDRQGRPARAMLMSALFGVIAFCATSPKETDVFNWLLAISGLSQLFTWFAICMSHV
                     RFRYAMKVQGRSIGEVGFHSQTGVYGSLYAATMMILALMAQFWVAIAPLNEGKLDAQN
                     FFQSYLAMPILIALYFGYKLYYRDWKLYIKADKIDLISHRQIFDENILKQEDEEYKEK
                     LRNGPAWRRIADFWC"
     gene            <1122364..>1122942
                     /gene="TPHA0B04760"
                     /locus_tag="TPHA_0B04760"
                     /db_xref="GeneID:11534960"
     mRNA            <1122364..>1122942
                     /gene="TPHA0B04760"
                     /locus_tag="TPHA_0B04760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684531.1"
                     /db_xref="GeneID:11534960"
     CDS             1122364..1122942
                     /gene="TPHA0B04760"
                     /locus_tag="TPHA_0B04760"
                     /inference="similar to DNA sequence:INSDC:YCL026C-A"
                     /note="similar to Saccharomyces cerevisiae FRM2
                     (YCL026C-A); ancestral locus Anc_1.49"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684579.1"
                     /db_xref="GeneID: