GenomeNet

Database: RefSeq
Entry: NC_016522
LinkDB: NC_016522
Original site: NC_016522 
LOCUS       NC_016522            1096211 bp    DNA     linear   CON 02-JUN-2017
DEFINITION  Tetrapisispora phaffii CBS 4417 chromosome 3, complete genome.
ACCESSION   NC_016522
VERSION     NC_016522.1
DBLINK      BioProject: PRJNA79335
            BioSample: SAMEA2272094
            Assembly: GCF_000236905.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Tetrapisispora phaffii CBS 4417
  ORGANISM  Tetrapisispora phaffii CBS 4417
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Tetrapisispora.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 1096211)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1096211)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-NOV-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE612858.
            Accession numbers for all the chromosomes/scaffold in this genome
            project: HE612856-HE612872.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1096211
                     /organism="Tetrapisispora phaffii CBS 4417"
                     /mol_type="genomic DNA"
                     /strain="type strain:CBS 4417"
                     /db_xref="taxon:1071381"
                     /chromosome="3"
     gap             472..726
                     /estimated_length=255
     gene            <3813..>4766
                     /gene="TPHA0C00100"
                     /locus_tag="TPHA_0C00100"
                     /db_xref="GeneID:11533496"
     mRNA            <3813..>4766
                     /gene="TPHA0C00100"
                     /locus_tag="TPHA_0C00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684553.1"
                     /db_xref="GeneID:11533496"
     CDS             3813..4766
                     /gene="TPHA0C00100"
                     /locus_tag="TPHA_0C00100"
                     /inference="similar to DNA sequence:INSDC:YNR054C"
                     /note="similar to Saccharomyces cerevisiae ESF2 (YNR054C);
                     ancestral locus Anc_6.381"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684601.1"
                     /db_xref="GeneID:11533496"
                     /db_xref="GOA:G8BQZ1"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BQZ1"
                     /translation="MSNQVEEFDDFSSDGEDNGLLIQSKKNFSSKQHIEEDVESSDDR
                     DSNDDKESGTIKQNDDVANEKSDDDASIDDKLDEGKVEINSGTTENERKEALKKKMDA
                     FNTLKAQRKARHKTGVIYLSAIPPYMKPAKMRQILSRFGELDRLFLKRESDQKYKSRV
                     KGGGNKKTKYEEGWAEFVRKRDAKICAGALNGNTIGGSKGSFYHDDILNVKYLPGFKW
                     ADLTDQIARENDVRQSKLDLEISQANKMNAEFIRNVEKSKMLENIKKSNKRKNNDIAD
                     KEDNTIVRNFKQYKVSTRRADASDDIKAKQANMDQIINNLL"
     gene            <5408..>7378
                     /gene="TPHA0C00110"
                     /locus_tag="TPHA_0C00110"
                     /db_xref="GeneID:11533801"
     mRNA            join(<5408..6217,6689..>7378)
                     /gene="TPHA0C00110"
                     /locus_tag="TPHA_0C00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684554.1"
                     /db_xref="GeneID:11533801"
     CDS             join(5408..6217,6689..7378)
                     /gene="TPHA0C00110"
                     /locus_tag="TPHA_0C00110"
                     /inference="similar to DNA sequence:INSDC:YNR053C"
                     /note="similar to Saccharomyces cerevisiae NOG2 (YNR053C);
                     ancestral locus Anc_6.380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684602.1"
                     /db_xref="GeneID:11533801"
                     /db_xref="GOA:G8BQZ2"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012971"
                     /db_xref="InterPro:IPR023179"
                     /db_xref="InterPro:IPR024929"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BQZ2"
                     /translation="MGQAKKEKQRRIREGNVKDGNLRVKGENFYRDGKRVQFLNMYTG
                     GKAVRNAKGDIIKAADYQDSAVPDARVAPDRRWFGNTRVISQDALQNFRDALGETQKD
                     TYQVLLRRNKLPMSLLEEKDSTESPVAKILDTESFEKTFGPKSQRKKPRLAASSLEDI
                     VQSSESDHKVYEEKQELSTTLGLMGRQMDEEEGWTQAAKEHIFSKGQSKRIWNELYKV
                     IDSSDVVIHVLDARDPLGTRCKSVEEYMTKETPHKHLIFVLNKCDLVPTWVAAAWVKH
                     LSKDRPTLAFHASITNSFGKGSLIQLLRQFSQLHTDRKQISVGFIGYPNTGKSSIINT
                     LRKKKVCPVAPIPGETKVWQYITLMKRIFLIDCPGIVPPSAKDSEEDILFRGVVRVEH
                     VSHPEQFIAGVLKRCQKKYLERTYEISGWKDDVEFIEMLARKQGRLLKGGEPDESGVS
                     KQILNDFNRGKIPWFVPPPEKEQREETSGKKSEQSEVKIGDKRKASTEE"
     gene            complement(<8600..>9253)
                     /gene="TPHA0C00120"
                     /locus_tag="TPHA_0C00120"
                     /db_xref="GeneID:11535198"
     mRNA            complement(<8600..>9253)
                     /gene="TPHA0C00120"
                     /locus_tag="TPHA_0C00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684555.1"
                     /db_xref="GeneID:11535198"
     CDS             complement(8600..9253)
                     /gene="TPHA0C00120"
                     /locus_tag="TPHA_0C00120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684603.1"
                     /db_xref="GeneID:11535198"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:G8BQZ3"
                     /translation="MSNGTLYVKDFPRAILARSLVKYYKIDVKVEDAETSETYKRDCP
                     VGRIPAFVGPNDFILTEIAAINPFLVELISDEKVKKQLLGKDYKERALIAKWISLSNT
                     DFFMTLADIFYMYINRYPYHQDIVDRGFEQLEKVSETYENRLKDHKYLVNDDITLADL
                     LSVTQWAFAVQLCYGPEWRAKYPGIVRWVEAVVASPVLKDEYKDFKLCEKTFSPQKK"
     gene            complement(<12397..>13524)
                     /gene="TPHA0C00130"
                     /locus_tag="TPHA_0C00130"
                     /db_xref="GeneID:11535192"
     mRNA            complement(<12397..>13524)
                     /gene="TPHA0C00130"
                     /locus_tag="TPHA_0C00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684556.1"
                     /db_xref="GeneID:11535192"
     CDS             complement(12397..13524)
                     /gene="TPHA0C00130"
                     /locus_tag="TPHA_0C00130"
                     /inference="similar to DNA sequence:INSDC:YJR148W,YHR208W"
                     /note="similar to Saccharomyces cerevisiae BAT2 (YJR148W)
                     and BAT1 (YHR208W); ancestral locus Anc_4.389"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684604.1"
                     /db_xref="GeneID:11535192"
                     /db_xref="GOA:G8BQZ4"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="InterPro:IPR005786"
                     /db_xref="InterPro:IPR018300"
                     /db_xref="UniProtKB/TrEMBL:G8BQZ4"
                     /translation="MTVAPLDACYLKITSNPNPSVPKPNNELVFGKTFTDHMLTVEWD
                     IETGWGIPEIKPYGNLSLDPSCCVFHYAFELFEGMKAYRTKDNKISLFRPDMNMKRMN
                     KSAERICLPSFDEEELIKLIGKLIEQDKHLVPEGEGYSLYIRPTMIGSSNGLGVSIPT
                     KAMIFVILSPVGPYYKTGFKAVKLEATDYATRAWPGGCGDKKLGANYAPCILPQRQAA
                     SRGYQQNLWLFGPEKYVTEVGTMNVFFVFEDSKTGKKELVTAPLDGTILEGVTRASVL
                     ELARQNLNPSEWEVNERYCSIYEIAERSKKGELIEAFGSGTAAVVSPIKEIGWENEKI
                     DIPLLAGEQSGALTKSVAAWISDIQYGRVQHKNWVRVVAEL"
     gene            <14138..>14818
                     /gene="TPHA0C00140"
                     /locus_tag="TPHA_0C00140"
                     /db_xref="GeneID:11533486"
     mRNA            <14138..>14818
                     /gene="TPHA0C00140"
                     /locus_tag="TPHA_0C00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684557.1"
                     /db_xref="GeneID:11533486"
     CDS             14138..14818
                     /gene="TPHA0C00140"
                     /locus_tag="TPHA_0C00140"
                     /inference="similar to DNA sequence:INSDC:YER183C"
                     /note="similar to Saccharomyces cerevisiae FAU1 (YER183C);
                     ancestral locus Anc_4.388"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684605.1"
                     /db_xref="GeneID:11533486"
                     /db_xref="InterPro:IPR002698"
                     /db_xref="InterPro:IPR024185"
                     /db_xref="UniProtKB/TrEMBL:G8BQZ5"
                     /translation="MSAKNLLRKHVYSKVKILTDVDIQRQSVNITKVVETFIKPYNAI
                     ACFMSMEKGEVDTKHIIKNIYDQGKELYLPRCTHTLETGHSPFRSNGDKHHPHLTFHK
                     VESWEIAKNLKPQGKYNLREPEREDPAPLPPKLDVILVPGVAFELKNGARIGHGAGYY
                     DDFFLRYQHRHQQATQNMPLLVGLCLNEQIVNSIPEESHDYKMDAIICGDGKLYWFNN
                     KTNQYNTA"
     gene            complement(<15029..>16561)
                     /gene="TPHA0C00150"
                     /locus_tag="TPHA_0C00150"
                     /db_xref="GeneID:11533916"
     mRNA            complement(<15029..>16561)
                     /gene="TPHA0C00150"
                     /locus_tag="TPHA_0C00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684558.1"
                     /db_xref="GeneID:11533916"
     CDS             complement(15029..16561)
                     /gene="TPHA0C00150"
                     /locus_tag="TPHA_0C00150"
                     /inference="similar to DNA sequence:INSDC:YHR206W,YJR147W"
                     /note="similar to Saccharomyces cerevisiae SKN7 (YHR206W)
                     and HMS2 (YJR147W); ancestral locus Anc_4.385"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684606.1"
                     /db_xref="GeneID:11533916"
                     /db_xref="GOA:G8BQZ6"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014402"
                     /db_xref="InterPro:IPR027718"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:G8BQZ6"
                     /translation="MDSQFVGDRGSLDLNEILPSVKEETENIQNEKRLSNAQADKSAS
                     AKQQNEFVRKIYSILEGGEYPEIVTWTEAGDSFVVVDTGKFTSQILPNHFKHSNFASF
                     VRQLNKYDFHKVKRTQEERKVWQYGELSWEFKHPLFKRGQEENLDNIKRKIGTQKKPT
                     DRSLVLKNTEGQEYVLDTEASMNLLKKKTVSIDAFNKVKKKVDFLTRDLEDNNKRYSQ
                     LNGEFEKLNNKYYTVLESLLTFKTANDTLVNKFNTLCTSIADQGIKLPDMIQFSVNSP
                     QRELELTTSGISNPQSVHNEINLGENSDDPLPIHKANKTPSISDLPNPILENDENINT
                     IDGDLAQGDTILKKGFNVLLVEDDEVSIQLCSKFLIKYGCTVQVVTDGLAAISTLEKY
                     RFDLVLMDIVMPNLDGATATSIIRNFDNETPIIAMTGSIEHQDLITYLQHGMNDILAK
                     PFTRRDLYSMLTRYLKNRVPLSQQVNIPADVVHKQLKPGSSNLESPLILDDMPPLKKS
                     KI"
     gene            complement(<17339..>19603)
                     /gene="TPHA0C00160"
                     /locus_tag="TPHA_0C00160"
                     /db_xref="GeneID:11533469"
     mRNA            complement(<17339..>19603)
                     /gene="TPHA0C00160"
                     /locus_tag="TPHA_0C00160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684559.1"
                     /db_xref="GeneID:11533469"
     CDS             complement(17339..19603)
                     /gene="TPHA0C00160"
                     /locus_tag="TPHA_0C00160"
                     /inference="similar to DNA sequence:INSDC:YHR205W"
                     /note="similar to Saccharomyces cerevisiae SCH9 (YHR205W);
                     ancestral locus Anc_4.384"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684607.1"
                     /db_xref="GeneID:11533469"
                     /db_xref="GOA:G8BQZ7"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:G8BQZ7"
                     /translation="MNFFTSKSKDKYKNSDMANENKHNNTSGFFPMTSQAGTPTTAIS
                     SSSYAMGTTSAIPSQHVISPIRTVNKENVTATTTSANSTQDSNRSNIGRSISQLSNNI
                     NNLNLVQVQDMVNEEGQDSEGANFSAQASGPTTDIPRGKLEVTIIEARNLLTRSKDAE
                     PYVVCTFESSEFISDGPEKNVASNENEINASQENIDIHKHNPLPVIKENNKNLRSLYT
                     TRSSSQLEKLMHDNNNSNYHKTLSSNNQNLSCNNNARDGTNPIWHHTTIFDVLGAHSE
                     LDISVYDSNNDDMFLGQIKLRPNINSTNFAKNCQGYTLQKRVLDDNVSGEILVKWEYR
                     STKKRHYGPSDFEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEIAHTI
                     GERNILVHSASKTCPFIVSLKFSFQTPTDLYLVTDYMSGGELFWHLQKEGRFTEDRAK
                     FYIAQLVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKDRTNTFCGT
                     TEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFP
                     RDILSPEGRSFVKGLLNRNPNHRLGSIDDGRELRAHPFFADIEWDALREKKIVPPFKP
                     HLNSEIDTSNFDPEFTQASTSYMNKHQLMAATPLSPAMQAKFAGFTFVDESALDDLYH
                     NGYNNRKMLQNSYFMQPGSFIPGDPNLPADEDVIDEDDGSDHDMNHSGVNSPSQMSFD
                     QHHMDDEFGGRFEM"
     gene            <22449..>23829
                     /gene="TPHA0C00170"
                     /locus_tag="TPHA_0C00170"
                     /db_xref="GeneID:11535216"
     mRNA            join(<22449..22462,23058..>23829)
                     /gene="TPHA0C00170"
                     /locus_tag="TPHA_0C00170"
                     /product="40S ribosomal protein S4"
                     /transcript_id="XM_003684560.1"
                     /db_xref="GeneID:11535216"
     CDS             join(22449..22462,23058..23829)
                     /gene="TPHA0C00170"
                     /locus_tag="TPHA_0C00170"
                     /inference="similar to DNA sequence:INSDC:YHR203C,YJR145C"
                     /note="similar to Saccharomyces cerevisiae RPS4B (YHR203C)
                     and RPS4A (YJR145C); ancestral locus Anc_4.382"
                     /codon_start=1
                     /product="40S ribosomal protein S4"
                     /protein_id="XP_003684608.1"
                     /db_xref="GeneID:11535216"
                     /db_xref="GOA:G8BQZ8"
                     /db_xref="InterPro:IPR000876"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR013843"
                     /db_xref="InterPro:IPR013845"
                     /db_xref="InterPro:IPR018199"
                     /db_xref="UniProtKB/TrEMBL:G8BQZ8"
                     /translation="MARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPL
                     IVFLRNRLKYALNGREVKAIMMQRHVKVDGKVRTDATYPAGFMDVITLEATNENFRLV
                     YDVKGRFAVHRITDEEASYKLGKVKKVQLGKKGVPYVVTHDGRTIRYPDPNIKINDTV
                     KIDLASGKITDFIKFDAGKLVYVTGGRNLGRIGTIVHKERHDGGFDLVHIKDSLDNTF
                     VTRLNNVFVIGEPGKPFISLPKGKGIKLSISEERDRRRAQSGL"
     gene            complement(<24138..>25907)
                     /gene="TPHA0C00180"
                     /locus_tag="TPHA_0C00180"
                     /db_xref="GeneID:11533825"
     mRNA            complement(<24138..>25907)
                     /gene="TPHA0C00180"
                     /locus_tag="TPHA_0C00180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684561.1"
                     /db_xref="GeneID:11533825"
     CDS             complement(24138..25907)
                     /gene="TPHA0C00180"
                     /locus_tag="TPHA_0C00180"
                     /inference="similar to DNA sequence:INSDC:YKR069W"
                     /note="similar to Saccharomyces cerevisiae MET1 (YKR069W);
                     ancestral locus Anc_5.651"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684609.1"
                     /db_xref="GeneID:11533825"
                     /db_xref="GOA:G8BQZ9"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR003043"
                     /db_xref="InterPro:IPR006366"
                     /db_xref="InterPro:IPR012066"
                     /db_xref="InterPro:IPR014776"
                     /db_xref="InterPro:IPR014777"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8BQZ9"
                     /translation="MSYPHLPLIISSKIENEIHLIIGSNQTNTFKHRVKAIIESGATP
                     IIVESKQNQIKRIQLEFKQYFDKSQIKLKPKTFALTDLTTCGRTLVHKIVDKVFLFDE
                     DINIIEQVYDQCLKLRIPICSYQKPEYSTFNLISTFTDSKKSGLQISVTTNGQGCVLA
                     NRIKREIVNSLPENISDVVINMSRLRNLIIKEDKLNSIIALSASRDKTFVENSFINYG
                     LSADEDVWDSSNFNTHIKEFQMNVVDKRLKRSRWLSQIMEYYPLNKLSEVRLEDLSES
                     DFNNNQNISNLATTRKTQLNTEDYSADNKTVVKRLKLDNDTSAIVVDKPQKGSISLVG
                     SGPGSISMLTVGALQEIKSADLVLADKLVPQTIIDLIPKDTEIFFAKKFPGHAEKAQE
                     ELLQRGITALTEGKKVIRLKQGDPYIFGRGGEEFLYFKENGFTPTVLPGISSALAATV
                     VSKIPATQRGIADQILICTGTGRKGALPTIPEYVESRTTVFLMALHRADILTKALLEN
                     SWKPNTPIAIVERASCKDQRVTRTLLKYLPDVIKDIGSRPPGLLVAGNAVNALVESDL
                     DDNNKYSMIEGFREVQAELVGLI"
     gene            <28809..>29993
                     /gene="TPHA0C00190"
                     /locus_tag="TPHA_0C00190"
                     /db_xref="GeneID:11533475"
     mRNA            <28809..>29993
                     /gene="TPHA0C00190"
                     /locus_tag="TPHA_0C00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684562.1"
                     /db_xref="GeneID:11533475"
     CDS             28809..29993
                     /gene="TPHA0C00190"
                     /locus_tag="TPHA_0C00190"
                     /inference="similar to DNA sequence:INSDC:YOR049C"
                     /note="similar to Saccharomyces cerevisiae RSB1 (YOR049C);
                     ancestral locus Anc_5.647"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684610.1"
                     /db_xref="GeneID:11533475"
                     /db_xref="GOA:G8BR00"
                     /db_xref="InterPro:IPR007568"
                     /db_xref="UniProtKB/TrEMBL:G8BR00"
                     /translation="MSGYLPPAFLEDTLKSVSANVTHIYPNGTIEIIHRKSYYSGLVP
                     NLGFNIAMIVIWSIILGAETLSLYFKQYWFSITFICAALLEIVGYAGRVWSHFNLYAR
                     SAYLMQMICLTIAPVFTMAGMYYQLAKLIEIYSHKFSILPSPVLYSQIFIFCDIVSLV
                     VQAAGGGISGGAVKRDKSVKPGEHVFIAGLSIQVATMSIFLFLWCHFAYLVFYKSRMD
                     HLGLKGFKTHFKISQICSVSQEDIDYMYREKFAPLRNDTTSKARHLSFKWFAWAFTVS
                     VCCIFVRCAYRLAELVDGFKGFIITHEVYFIILDAVMISFATVIMLVIFPGIAFNGRE
                     VNIPITRGRTDPELDQSEDPEGQSSSSAMSEKSGGPEDKTTELEEKKSIFKKIFNNPF
                     KK"
     gene            complement(<30299..>31576)
                     /gene="TPHA0C00200"
                     /locus_tag="TPHA_0C00200"
                     /db_xref="GeneID:11535272"
     mRNA            complement(<30299..>31576)
                     /gene="TPHA0C00200"
                     /locus_tag="TPHA_0C00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684563.1"
                     /db_xref="GeneID:11535272"
     CDS             complement(30299..31576)
                     /gene="TPHA0C00200"
                     /locus_tag="TPHA_0C00200"
                     /inference="similar to DNA sequence:INSDC:YKL162C"
                     /note="similar to Saccharomyces cerevisiae YKL162C;
                     ancestral locus Anc_5.646"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684611.1"
                     /db_xref="GeneID:11535272"
                     /db_xref="UniProtKB/TrEMBL:G8BR01"
                     /translation="MYLQVVKAMVLVQMLSGLNKRTLISSANSLRTYSSKSIIPLRDH
                     YESLNAKNLKSNLNFYSYDPKKVKYDSNFFTNQYGNENLHLFENLNSFNPTLINAIAR
                     YFIINYKLNYYPYYDLNLINVYTDLEQSLHLITNLIEFYRRILSPDMFTKIKIYLLPL
                     HQYDKGNIKTLETLLRIKKTLPKNIVVLDGLPIFADNKDGDAINPAIQELIIENDPIY
                     ILLFNDIIKYLAHDTVTYSKSEGKWKQLYVDVDSLKTKDEKIFFEGEVDYWCEQAIQY
                     YFAGNVKNATPNQIYNIPTRLIQLFKLINRNFPEHKFFAIDNPVRIKKSFLEIVRDFI
                     IPFGKQHTAYNGSRLFVNNEKTISYNNNFQVLQRIYNKINEPTQFITVEELSVFIDQY
                     SNVKEDGQNYKELEKIITFMRCSTLATLYSSQI"
     gene            <32845..>34152
                     /gene="TPHA0C00210"
                     /locus_tag="TPHA_0C00210"
                     /db_xref="GeneID:11535241"
     mRNA            <32845..>34152
                     /gene="TPHA0C00210"
                     /locus_tag="TPHA_0C00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684564.1"
                     /db_xref="GeneID:11535241"
     CDS             32845..34152
                     /gene="TPHA0C00210"
                     /locus_tag="TPHA_0C00210"
                     /inference="similar to DNA sequence:INSDC:YDR277C,YOR047C"
                     /note="similar to Saccharomyces cerevisiae MTH1 (YDR277C)
                     and STD1 (YOR047C); ancestral locus Anc_5.644"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684612.1"
                     /db_xref="GeneID:11535241"
                     /db_xref="UniProtKB/TrEMBL:G8BR02"
                     /translation="MNGSYHNKTTMTTSNSTNFVNAPFEYSERARDTIKKKLLFSQKN
                     TNASNRKKSKILSRTCSDDVASAYSAISNQSSIFSNPLTVTTTSSHFSSSSVPTEKIV
                     TTITLEDALPKTFYDMYTPEILMSNPLNLFHNGRPKFTKRELMDWDLNDIRSLLIIDN
                     LKPEWGDNLPSITLPNNQPNASNINFRFQLLPLNSSDEFIIETLVTSDLYKEANLDYE
                     FRFTSARYTVALARRRHEQMLLQQGVPPNQINKKELHLSKPEWRNIIENFLLNIAVET
                     QCRADFKQQCSQFKKWKQEHHQQQMQNFSNLKKPHMPPPSGLPLYTIVEEDNSDENMS
                     SSKGRSSSSLLRKTLMKNLQSKTLKTSFNKNNTSSSNNTNTCNNNNNNIPDTHNINNL
                     NLNNKLGKITLAKEEKADIWAHCQSEVYQRLGLDWKPDRMSIG"
     gene            complement(<34296..>35954)
                     /gene="TPHA0C00220"
                     /locus_tag="TPHA_0C00220"
                     /db_xref="GeneID:11533933"
     mRNA            complement(<34296..>35954)
                     /gene="TPHA0C00220"
                     /locus_tag="TPHA_0C00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684565.1"
                     /db_xref="GeneID:11533933"
     CDS             complement(34296..35954)
                     /gene="TPHA0C00220"
                     /locus_tag="TPHA_0C00220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684613.1"
                     /db_xref="GeneID:11533933"
                     /db_xref="InterPro:IPR022703"
                     /db_xref="UniProtKB/TrEMBL:G8BR03"
                     /translation="MVTSEEWSSRLDNDDRASATSSTQSLKRPAEFPTNDCLAAVQEY
                     ASAMDINRTFSNTIQNIDAINRTITSEKSYNREASNDLENGKTNRGPPPKYGFLDPEM
                     AATRKIVAFAYVKILTILGLLCFTILLIYWGATYNRKAYYHKVNFLAVIQDDVAYPSD
                     NQVISTLNTNFTDTLNNILQSDSISGTWHVYNQSAFMDRFKVDNVSQIDDKVLSLLHE
                     EKYWVALDFKQNITSTIVDSFTNTNAADVFNSTDFINVYYESGRDPTNLKSAILPLVQ
                     QFEAIAVRLLNTQFLQQAVLPLLEQSNMIPSNITNAAYNAKVIGASDFAFNYIDYRPF
                     ADAVVLSPLQVGAIYVLIITVVQFALWGKTHGLVAQKMRPLPYLVYRFVIMSATLFIL
                     SLFFSTISAIYQVDFTKAFGKGGFVVYWMTTFLTMMALGGANENMVGLLVSIDAAYLA
                     MWIITFIIVNISSSFFPMVLSNNFYRFGYMTPVHQAIDLYKVIFLDLSKHKMGRNYGI
                     LVAWIGINTALMPIFIKFAGQNMKKAAEQQMTTAIKRAKELGEI"
     gene            <37364..>37531
                     /gene="TPHA0C00230"
                     /locus_tag="TPHA_0C00230"
                     /db_xref="GeneID:11535206"
     mRNA            <37364..>37531
                     /gene="TPHA0C00230"
                     /locus_tag="TPHA_0C00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684566.1"
                     /db_xref="GeneID:11535206"
     CDS             37364..37531
                     /gene="TPHA0C00230"
                     /locus_tag="TPHA_0C00230"
                     /inference="similar to DNA sequence:INSDC:YDR276C"
                     /note="similar to Saccharomyces cerevisiae PMP3 (YDR276C);
                     ancestral locus Anc_5.642"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684614.1"
                     /db_xref="GeneID:11535206"
                     /db_xref="GOA:G8BR04"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="UniProtKB/TrEMBL:G8BR04"
                     /translation="MDAAKIINIILALFLPPVSVFLVKGWGRECIIDIVLTICIWFPG
                     MLYALYIVLQD"
     gene            complement(<37748..>37918)
                     /gene="TPHA0C00240"
                     /locus_tag="TPHA_0C00240"
                     /db_xref="GeneID:11533451"
     mRNA            complement(<37748..>37918)
                     /gene="TPHA0C00240"
                     /locus_tag="TPHA_0C00240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684567.1"
                     /db_xref="GeneID:11533451"
     CDS             complement(37748..37918)
                     /gene="TPHA0C00240"
                     /locus_tag="TPHA_0C00240"
                     /inference="similar to DNA sequence:INSDC:YOR045W"
                     /note="similar to Saccharomyces cerevisiae TOM6 (YOR045W);
                     ancestral locus Anc_5.641"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684615.1"
                     /db_xref="GeneID:11533451"
                     /db_xref="GOA:G8BR05"
                     /db_xref="InterPro:IPR020266"
                     /db_xref="UniProtKB/TrEMBL:G8BR05"
                     /translation="MSGIFNVPGAAPTKPKSKFEEFKESPMFTVLVNSVFFVAGVAFI
                     QSPLMEMLAPEL"
     gene            complement(<38242..>39492)
                     /gene="TPHA0C00250"
                     /locus_tag="TPHA_0C00250"
                     /db_xref="GeneID:11534074"
     mRNA            complement(<38242..>39492)
                     /gene="TPHA0C00250"
                     /locus_tag="TPHA_0C00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684568.1"
                     /db_xref="GeneID:11534074"
     CDS             complement(38242..39492)
                     /gene="TPHA0C00250"
                     /locus_tag="TPHA_0C00250"
                     /inference="similar to DNA sequence:INSDC:YOR043W"
                     /note="similar to Saccharomyces cerevisiae WHI2 (YOR043W);
                     ancestral locus Anc_5.639"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684616.1"
                     /db_xref="GeneID:11534074"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="UniProtKB/TrEMBL:G8BR06"
                     /translation="MQNIVTQVSQGNEAATAFANASNDQYNDEENGNSLIHLNIQEHH
                     YFLTRDQLMSLSESLLLCLFPSGVFLDRMGQVISNLTPNDEVYISDFAPLCFEYMMDV
                     YLKAYDDLINYPVASCFNISPDKSMNNTNVNNAYMQPSEDELLHEKPVIIVLREDLDY
                     YCVPQVKFQFEIDPHLSQQITDGDLLHHLMSEIKIAAGNYLSSKTLIFDGLKSSNKTK
                     NILNSFNAADDSTLKQSENEEDKEEDAKLGAAEQHLMDMLCSSGFGIDSQWGNRTQEH
                     GKTIISSLSVCRLYNETTEDFRDKYNESIKQWEQSNAKEEKSPLHKPELYDLVEKPDL
                     NTKLLLFWRKPARKCWWGGESVNLNVEVYGNYIETSSDDGVKTIRLVAPLKDDGSELR
                     KITIPLKLHIRRVWTLELSLIGMQ"
     gene            complement(<40434..>41582)
                     /gene="TPHA0C00260"
                     /locus_tag="TPHA_0C00260"
                     /db_xref="GeneID:11535207"
     mRNA            complement(<40434..>41582)
                     /gene="TPHA0C00260"
                     /locus_tag="TPHA_0C00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684569.1"
                     /db_xref="GeneID:11535207"
     CDS             complement(40434..41582)
                     /gene="TPHA0C00260"
                     /locus_tag="TPHA_0C00260"
                     /inference="similar to DNA sequence:INSDC:YDR273W,YOR042W"
                     /note="similar to Saccharomyces cerevisiae DON1 (YDR273W)
                     and CUE5 (YOR042W); ancestral locus Anc_5.638"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684617.1"
                     /db_xref="GeneID:11535207"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="UniProtKB/TrEMBL:G8BR07"
                     /translation="MSEKELDINAIAEDVEDISLEEEKATPEEEVKLVNEQMEEEEVN
                     PETKNDAEEDSAPPLPARKPTPELASEVQDINPLFRQLKDAFPSIEDVYINTVLIASQ
                     GDMDKSFNAMLYLSDPKDSGITVPSTPLSKSSTRKDNRSAMSQYEQDELLARQLSEKF
                     NSSKTGRKYERDEQQRSDQRRRERQRRQNSQLTAAERREYYDEGDDSWSQFLEKDLPE
                     IKDMANKQIQETAQKLNNWFGGVKKNLSNMSDEYGNPDSYYDEDVRRTAGGNAQRPQS
                     KERFNSFGARVGDDSLERHGISLRTDDGYEDIPPQLPTRTRTKDSFENKGSVTPEPKK
                     NVVAQTTYIDTPENKKYQAITPEPIPGKIQMNVNPDDDDFLINSDDEI"
     gene            complement(<41978..>44974)
                     /gene="TPHA0C00270"
                     /locus_tag="TPHA_0C00270"
                     /db_xref="GeneID:11533617"
     mRNA            complement(<41978..>44974)
                     /gene="TPHA0C00270"
                     /locus_tag="TPHA_0C00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684570.1"
                     /db_xref="GeneID:11533617"
     CDS             complement(41978..44974)
                     /gene="TPHA0C00270"
                     /locus_tag="TPHA_0C00270"
                     /inference="similar to DNA sequence:INSDC:YDR270W"
                     /note="similar to Saccharomyces cerevisiae CCC2 (YDR270W);
                     ancestral locus Anc_5.636"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684618.1"
                     /db_xref="GeneID:11533617"
                     /db_xref="GOA:G8BR08"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR006122"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR017969"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="InterPro:IPR027256"
                     /db_xref="UniProtKB/TrEMBL:G8BR08"
                     /translation="MKEAVFHVGGMTCSACSNAIIKQVGKLEGVDTCEVSLMTDECRV
                     KFDEGQLTKDVVLECVEDCGFSCEFIKETSVTGVVGNETTVKAVLSVQGMTCSACSSA
                     IVKQAGQLAGVVSVEVSLVTEECHVVFDKSMIDAATVQECIEDCGFGAGIMSVNETMA
                     SDLSSGKIKTTTLKLVGLNENSDVSELESFYNDTDTNGKIYDVDVINATANIQYNTSV
                     IGIRKIIASLETFGYSVLLGNDLDNDDQLRMLSKVKEIQFWRLNLIKALSISIIVLSI
                     YMFVPMFSPSLVKNKVFPYKQVTFIPGLFYRDIIGLILTSYIQFGVGLFFYRSAWSAY
                     KHGSGTMDTLICISTTLAYTFSVYSILDNLGNNDEMQTLPNIQFGTSVMLVTFISFGK
                     LLENKAKSKTSTALSKLINLYPSSCEIVEEIDGTELFTTLPSEFLEEGDNIVVKAGMK
                     IPADGIITKGITEIDESFMTGEAILVTKTIGDQVIGGTVNGPGHFYFQATRVGNDTQL
                     SQVIKTMKDAQLSKAPIQRYSDYLASIFVPVILLLSIITFTFWVVVCLKSQHIPSVLG
                     ENTHGKFYICLQIAISVVVVACPCALGLAAPTAIMVGTGTAAENGILIKGGDKIEMYD
                     KVEVFLFDKTGTLTTGAMEVQKFVTASNILSDNKINAIAKVVSEMSDHPISKAIVRYC
                     DKILEDNSDKIYRPKVLDSEIIVGKGISCTVEIDNEKHSVAIGNRKMMPQDSELFMET
                     PDEIFSISYLLLDDKVVGKFTVADTVRSDAYETIQYLNNHGYECYMITGDISNSALHI
                     ASLVGIDFNNVFSEVTPGGKSDIVEQIKTKTGKYVAFVGDGINDSPALVLSDVGISIS
                     TGTDIAIEAADVVIIADEQNKLPAMKKVVYALDLSKKTFKRIKLNLFWALFYNTFMIP
                     IAMGLLLPWGITLHPMSAAFAMAMSSVSVVFSSLSLKQWKPFPLDSQGLQREDKESFI
                     KKCLRVFSFGSSRSRIEDLELQTNLV"
     gene            complement(<45624..>46391)
                     /gene="TPHA0C00280"
                     /locus_tag="TPHA_0C00280"
                     /db_xref="GeneID:11535191"
     mRNA            complement(<45624..>46391)
                     /gene="TPHA0C00280"
                     /locus_tag="TPHA_0C00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684571.1"
                     /db_xref="GeneID:11535191"
     CDS             complement(45624..46391)
                     /gene="TPHA0C00280"
                     /locus_tag="TPHA_0C00280"
                     /inference="similar to DNA sequence:INSDC:YOR039W"
                     /note="similar to Saccharomyces cerevisiae CKB2 (YOR039W);
                     ancestral locus Anc_5.635"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684619.1"
                     /db_xref="GeneID:11535191"
                     /db_xref="GOA:G8BR09"
                     /db_xref="InterPro:IPR000704"
                     /db_xref="InterPro:IPR016149"
                     /db_xref="InterPro:IPR016150"
                     /db_xref="UniProtKB/TrEMBL:G8BR09"
                     /translation="MADETVDVKMQDTSKPDVGEELERETDSSEYVEMWIDLFLSRKG
                     NEYFCDIDPDYITDRFNLMNLQKTVTKFTQVIQYIIDELDESILEKLSPTKLEQLEAD
                     ARKVYGLVHARYIITIKGLQSMLEKYKDADFGRCPRVYCNFQPLLPMGLYDVPGMDSV
                     KLYCPSCEDLYLPKSSRHNTVDGAYFGTSFAGMFLHTFPETVPKHPTKKYVPKIFGFE
                     LHKQAQLARWQELQRLKLEKHLQEIDVDLSKNGGFKN"
     gene            <46991..>49915
                     /gene="TPHA0C00290"
                     /locus_tag="TPHA_0C00290"
                     /db_xref="GeneID:11533474"
     mRNA            <46991..>49915
                     /gene="TPHA0C00290"
                     /locus_tag="TPHA_0C00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684572.1"
                     /db_xref="GeneID:11533474"
     CDS             46991..49915
                     /gene="TPHA0C00290"
                     /locus_tag="TPHA_0C00290"
                     /inference="similar to DNA sequence:INSDC:YOR038C"
                     /note="similar to Saccharomyces cerevisiae HIR2 (YOR038C);
                     ancestral locus Anc_5.634"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684620.1"
                     /db_xref="GeneID:11533474"
                     /db_xref="GOA:G8BR10"
                     /db_xref="InterPro:IPR011494"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BR10"
                     /translation="MKLLKYPIGISNTSSVNALDSIDGKLVLIRDDGNMVVWSQQKLI
                     DAAFDRIDIGELSEDFSLDLSEIITVKNTNHVGYNNLKYITHCENSKGTKTLIVGSYY
                     KLIYYEDWYNNCNPANKIKPKPKVLYQGKKLSSTVTDVKYDPKLNIIFILINNKNKVL
                     LFSSKTMKKLSEITFVDAIQPITGIVDPMGQIFTVLSLDQSVRFYQIKSDGNYKLIKT
                     LQKKVNIYPLNYKINMPPSANFYPLINYISAHSTDENATNNVKNNSTNNNSQTNAHLP
                     TSSDSTVFLDRNDTSKVITTLVTPPFLKNTVLKFSPIIYDKLNTKKNTRTRYNLLATS
                     GSKEGTIVVWNTKRVKPLFNALKVSDSPINDIIWADDGLTIFAVSNDNVLYNFAFQHA
                     DLGEALPASEVESLLNKNILLPELEDLVDKSAAAKIKVENNDSKNIKSENSGVLISDK
                     TDDSSTDLATKTLSTEVSSITKSQEENKSRADLSVEQNLVESSQTMPVNKIQENSNLP
                     KDQDAKKNVINNLSKKPQKKNDSQTVTLKNSSMDFNSPAYNVPKDLRRKPKEDANGEI
                     IKKRQKKDLESMDFLDNGLLLSNVSFSRVRLGTPKIRASFEYSPVSNKNLVLDVKNGT
                     GNEQKPTIITLNSKAKETSKQIFKDFIPKFVTICAAGDFFWACATEDGIIYVYSDSGK
                     RMLPPLVLGVPCSFLEASSKYLLCVTCIGELYCWDLEQLKLSFPCTTIYPLLNPSLRY
                     SDDILTRAENITVCCVTDKGIPLVTLSNGDGYMFDRDMETWALISDGWWAYGSQYWDM
                     TNQTNFSSLKTNKLDKTDNSGASEIMQLINNETDSIVNYMERKTNDELIRKGRIKNLQ
                     RFARTILMKEGFENIEEIVTLSHLENRILVTLKLEESKEFSRLLVLYCLRISELGYVD
                     RLNDVLQWLYNGGDIENSKLGGETRKTLLESVLAACSDIRQIQRITTSYASAIGIIKD
                     IV"
     gene            complement(<50015..>51142)
                     /gene="TPHA0C00300"
                     /locus_tag="TPHA_0C00300"
                     /db_xref="GeneID:11533978"
     mRNA            complement(<50015..>51142)
                     /gene="TPHA0C00300"
                     /locus_tag="TPHA_0C00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684573.1"
                     /db_xref="GeneID:11533978"
     CDS             complement(50015..51142)
                     /gene="TPHA0C00300"
                     /locus_tag="TPHA_0C00300"
                     /inference="similar to DNA sequence:INSDC:YDR268W"
                     /note="similar to Saccharomyces cerevisiae MSW1 (YDR268W);
                     ancestral locus Anc_5.633"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684621.1"
                     /db_xref="GeneID:11533978"
                     /db_xref="GOA:G8BR11"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002306"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G8BR11"
                     /translation="MLRRGLRINHFSRRFSSTVKEIDYKLNGQDIPDDATVFSMVQPT
                     GKFHLGNYLGATRAWKDLCDLKKDNQRLVFGVADLHAITIPKQDVTEFRLFREEALAS
                     ILSMGVDPEKAIVMHQSHIPQHSQLHWILSTFTSMGYLNRMTQWKSKSNIHKNNVSEA
                     DLGSVKLGLFSYPVLQAADILLYKSTHVPVGDDQTQHLELTRSLALLFNRTYKTNYFP
                     VPVTTLTPTKKILSLNNPEKKMSKSDPNQQGVIYVNDEPEQITVKINKALTDNISDRF
                     YYDNENRPGVSNLINIVSGIQRKEIPEIEKDISNINNYRDFKKYVSEIIIEELRTPRK
                     NFKRLMKEPDYLKSIVDSGNRRARAIAEKNINDIMKIMGLN"
     gene            complement(<51580..>52671)
                     /gene="TPHA0C00310"
                     /locus_tag="TPHA_0C00310"
                     /db_xref="GeneID:11533818"
     mRNA            complement(<51580..>52671)
                     /gene="TPHA0C00310"
                     /locus_tag="TPHA_0C00310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684574.1"
                     /db_xref="GeneID:11533818"
     CDS             complement(51580..52671)
                     /gene="TPHA0C00310"
                     /locus_tag="TPHA_0C00310"
                     /inference="similar to DNA sequence:INSDC:YOR037W"
                     /note="similar to Saccharomyces cerevisiae CYC2 (YOR037W);
                     ancestral locus Anc_5.632"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684622.1"
                     /db_xref="GeneID:11533818"
                     /db_xref="GOA:G8BR12"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:G8BR12"
                     /translation="MFLQKSFVRLYSLNALKSTSRFNWKRHKVIYGLSCGALSFSIYM
                     AYNSLSRFNDSPNLSTDHFTKYRISYKKDIDEEHFLLELTPILTQNQNLWQIIGSTKI
                     WSVEIKQPEIMVVRNYTPLPFYFDASAGQIQLLKDGENADGKLMFYLKQYKNGEVARW
                     IHGLGINDTVELRGPYIEYEFPNPNHEMKRDRNILKDLEKTTHATEQKQIFKYEPLNI
                     LMFTAGTGVVPALQLLLTESPFYGTMHLFHSCKTKSELGPLSKYLDVLDKQNRIKLHM
                     HESSKGGNIKDVNIKELLNQIPEPVPYKEMKSNGPHNNNTNPSLALVCGPDSFITTVA
                     GEKYDFSQGPVGGLLKEKGWDNQNVYKFP"
     gene            <53120..>54184
                     /gene="TPHA0C00320"
                     /locus_tag="TPHA_0C00320"
                     /db_xref="GeneID:11533641"
     mRNA            <53120..>54184
                     /gene="TPHA0C00320"
                     /locus_tag="TPHA_0C00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684575.1"
                     /db_xref="GeneID:11533641"
     CDS             53120..54184
                     /gene="TPHA0C00320"
                     /locus_tag="TPHA_0C00320"
                     /inference="similar to DNA sequence:INSDC:YDR267C"
                     /note="similar to Saccharomyces cerevisiae CIA1 (YDR267C);
                     ancestral locus Anc_5.631"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684623.1"
                     /db_xref="GeneID:11533641"
                     /db_xref="GOA:G8BR13"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR028608"
                     /db_xref="UniProtKB/TrEMBL:G8BR13"
                     /translation="MKLLRSFKLHNDKIWSIDYSSGLLATASSDLRIKILRIGDIGSD
                     DIDEKNKENDDDDNRLLDELDDSAHKKTIRSVAWRPNSNILAAGSFDSTISIWSKEDY
                     QEDEVAGNNFSMDLLAIIEGHENEVKSVAWSQDGYFLATCSRDKSVWIWEADEVGEEY
                     ECVSVLQEHSQDIKHVVWHPTQNVLASSSYDDTIRVWKEFDEDWECAAVLNGHEGTVW
                     CSDFEHSSVEKNDSMRLCSGSDDAKVKVWKFDGVNEDSEDIWICESTLPPVHSGPVYS
                     VCWNDDGLIASAGSDGVIAIYKEDETLKGKWNCIEKNEKSHTFFEINCIKWIKNNNDE
                     TLLLSASDDGHVNMWNVNKN"
     gene            complement(<54284..>55144)
                     /gene="TPHA0C00330"
                     /locus_tag="TPHA_0C00330"
                     /db_xref="GeneID:11535200"
     mRNA            complement(<54284..>55144)
                     /gene="TPHA0C00330"
                     /locus_tag="TPHA_0C00330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684576.1"
                     /db_xref="GeneID:11535200"
     CDS             complement(54284..55144)
                     /gene="TPHA0C00330"
                     /locus_tag="TPHA_0C00330"
                     /inference="similar to DNA sequence:INSDC:YOR036W"
                     /note="similar to Saccharomyces cerevisiae PEP12
                     (YOR036W); ancestral locus Anc_5.630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684624.1"
                     /db_xref="GeneID:11535200"
                     /db_xref="GOA:G8BR14"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:G8BR14"
                     /translation="MQPDFDSQDDSGVNKYSDSPEFDALKDRIIEQLFEINGQINTIN
                     QFSSTLEKFLNNEGDNSLNVKVIDNIDKKAIQNIEKIKGLISVINEEVCKVEKIEVAE
                     LNQLQIIAKDKIIRDIRSSIKEFQNLQKRYTALIKRINEKARLQLENKHALLVEEENE
                     ATQHVGQAPVQIQNKNIVIPRESINNEEFAYQQNLIRQRDEEIINIERGITEINDIFT
                     DLSNVIQDQGMIVDNIEANIYSTLDNTQLASNELNKAMRYQRKSSKWCLYLLMILTIM
                     LFFMMLVILI"
     gene            <56190..>58193
                     /gene="TPHA0C00340"
                     /locus_tag="TPHA_0C00340"
                     /db_xref="GeneID:11535301"
     mRNA            <56190..>58193
                     /gene="TPHA0C00340"
                     /locus_tag="TPHA_0C00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684577.1"
                     /db_xref="GeneID:11535301"
     CDS             56190..58193
                     /gene="TPHA0C00340"
                     /locus_tag="TPHA_0C00340"
                     /inference="similar to DNA sequence:INSDC:YDR266C"
                     /note="similar to Saccharomyces cerevisiae YDR266C;
                     ancestral locus Anc_5.629"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684625.1"
                     /db_xref="GeneID:11535301"
                     /db_xref="GOA:G8BR15"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BR15"
                     /translation="MSSIESGIEASNSSNLQNKSSGKQNRRKNFRKLQGPQTRAGTIS
                     ETSKTSLGNHNEEDDSELCLICAEPLEFISLSSCHHKTCYKCSFRQRALYDKKSCLIC
                     RTDNDVMKFTDNLDKKYEDLDKCFKINEKYGVAFENEKTHDITMNLLKFSCQLCDKDD
                     SGSSTPSVDYGSYKKLNDHLRNIHKKYFCMICAKNNHSFPSELPIYTQNQLKNHQVRG
                     DNKANNSGFVGHPLCAFCKDKRFYSDDELYAHMRNNHERCHICDKLKPNEPQYFKDYN
                     QLFQHFKNSHYICTIQSCLDNKFVVFGDELELQAHILQEHGDIVKGKPKLFQSELSTF
                     IATPARVIRDQRVFDDDLTGQSNSLRNMPDESPELSRARLEERAKHYLGNDLSKFATF
                     TNINEKYEKKKINSNDVLTSYTSLFTEKEADVYLLINNLASTFPKNSTKYKELNAIYD
                     AHEQKLARDSLPSLSSDPSLHTVGSAIWRGSSGATVSSGGSRNLNTSSLPTLQLRPAS
                     FDVFGQQNKQVKSYKTLTKPSKTSRPVVRSAAQTSAAQSEYKPTYLNKNIPDQQSSQQ
                     SLSSLTSSKSNVSLTSNRVVLGKGKSKLAAMSLESLPTPKPRVHIPPVREIKLPDSKN
                     WGKSNGRSNDIPDDDLSNLMIDNSNNKGKKKGKQKQLLFHIGI"
     gene            complement(<58374..>59210)
                     /gene="TPHA0C00350"
                     /locus_tag="TPHA_0C00350"
                     /db_xref="GeneID:11535238"
     mRNA            complement(<58374..>59210)
                     /gene="TPHA0C00350"
                     /locus_tag="TPHA_0C00350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684578.1"
                     /db_xref="GeneID:11535238"
     CDS             complement(58374..59210)
                     /gene="TPHA0C00350"
                     /locus_tag="TPHA_0C00350"
                     /inference="similar to DNA sequence:INSDC:YDR265W"
                     /note="similar to Saccharomyces cerevisiae PEX10
                     (YDR265W); ancestral locus Anc_5.628"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684626.1"
                     /db_xref="GeneID:11535238"
                     /db_xref="GOA:G8BR16"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR025654"
                     /db_xref="UniProtKB/TrEMBL:G8BR16"
                     /translation="MYPKEIVTAAKVLYFFFTTLLNKRTLGEEFTDLRYINRSGKSFV
                     QRYKKLIFVVSYIVGPYLLTNIWNIFNKRLKRDSSNNINSEEEMQNHIRYRDMLDNIV
                     NIHLLIFYLQGSYYDITKRILGMRYITGHTISKQEKELRETTTKGYKLLGYLLLFQNV
                     SSTYSTLKNVLNSFKFTSSIHNEKHVSKPLNLSETKLTKNITDEYHQNHIRLSDETQF
                     KFIPSESRDCALCLSKITDPSVGPCGHIFCWDCIVDWCRERPECPFCRKKCEIQQIIA
                     LK"
     gene            <59900..>62233
                     /gene="TPHA0C00360"
                     /locus_tag="TPHA_0C00360"
                     /db_xref="GeneID:11533616"
     mRNA            <59900..>62233
                     /gene="TPHA0C00360"
                     /locus_tag="TPHA_0C00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684579.1"
                     /db_xref="GeneID:11533616"
     CDS             59900..62233
                     /gene="TPHA0C00360"
                     /locus_tag="TPHA_0C00360"
                     /inference="similar to DNA sequence:INSDC:YOR035C"
                     /note="similar to Saccharomyces cerevisiae SHE4 (YOR035C);
                     ancestral locus Anc_5.627"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684627.1"
                     /db_xref="GeneID:11533616"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024660"
                     /db_xref="UniProtKB/TrEMBL:G8BR17"
                     /translation="MDTAYSITTISELSELLEKDLKISINTDRFTQALDELFCFSNTG
                     SEHLIDGTSNEKIETILTCSYQDHSESREYLNSLIVKDCSKAIDIFERLSINTVHILV
                     GSFVDANTTLPLVQELHSRIHLGEDANVTYLLSIILQLVIKFDYKFSQICFLIKELGM
                     RIKEREVRSISLVIFSQLENKYKEEFNKSFLKFIDALVIEVEADIGNDPLIIIITLLN
                     ELYPVLTTLCSELFLSEALKDLCQERVNERRDPEFSKALLQLLSTACIDENVRKMIAE
                     TYIEVLENTLNIPEYSILAALVLIKIWSFTKLHNTTIKSLNEILMKHIENDIIEEDDV
                     NTTEGDGLSNDDISNCLEGLAYLSLKTSVKVRLRANSKFCSALVKIIEFKKVNSKFYG
                     VLVVLANLGISPKDINNGGPDAKSLRDLKSYSDLKNPKTDDDTKVIETVEEVSSFNKK
                     YIIDTGVLAAIRSTEKELSMGSKEQYIRIIYNISREKKFIPDLVKHGCMTSVLEYLIN
                     DVGKKNESVRLLTLRSLTRMLIYSNPATIFNKYSSINALPFLFELLPMDQTPEEAASS
                     LFDRNLITNADSFESLLALTNLASAPGSEGEDICKRITGTIAYWTVLENLMLDDSAQL
                     QRCTLELLSNLMSHPLSIAVKFFNFENSQSVKNFNILVKLLELEDIESQRAVAAFFAN
                     AANSIPFIAQELLTQKEFIDTTIDVFHNQIDDKELRERFIILYYSLFAVVPEKDTKKL
                     DIITKNKKFEETLKLIQKLNSVDEEYMEVVPLLLSKC"
     gene            <62796..>65075
                     /gene="TPHA0C00370"
                     /locus_tag="TPHA_0C00370"
                     /db_xref="GeneID:11533609"
     mRNA            <62796..>65075
                     /gene="TPHA0C00370"
                     /locus_tag="TPHA_0C00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684580.1"
                     /db_xref="GeneID:11533609"
     CDS             62796..65075
                     /gene="TPHA0C00370"
                     /locus_tag="TPHA_0C00370"
                     /inference="similar to DNA sequence:INSDC:YDR264C,YOR034C"
                     /note="similar to Saccharomyces cerevisiae AKR1 (YDR264C)
                     and AKR2 (YOR034C); ancestral locus Anc_5.626"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684628.1"
                     /db_xref="GeneID:11533609"
                     /db_xref="GOA:G8BR18"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8BR18"
                     /translation="MNEANDVDSIKGDVSDQTELDDISVSSVKPLVSQDDEIVSQISD
                     STEHMTEREQDIQGQIPEDSIIGSYRVACQSNDIDTVKELIESGAVDIHHDYNDNDHI
                     TGLHWACVNNRFAISQYLIKKGADVNKKAGKLNATPLHWAASYGYVHIVDCLLKHGAD
                     PTIVDDQGFNLLHLSINSSNIMLVIYVLYFVVDKGIIEVDCQDPNGRTPLLWAAYQGD
                     SLSIKMLLSFGASTKIVDNTGFTPLHWGVVKGQPHVLKYLIKDGADFFAKTNDGKDCF
                     AIAEEMNTTYFLREALDHCGFTKDGFLKKKLFKKSFHAKILTFFLPWILLGSITFLFS
                     HIHPLFALIITLILLIITNQLLQRVLIPCYTVTTNNTISLIQTPLFAGLFAGSVFWLS
                     SVWITKVFLTTVTLKPFRNMSLLITISIICILFGKLITSDPGNIYEEKDHGLVREMVE
                     ELMKLGKYDTSNFCIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFL
                     FFILSMETGIGLFTSLCLEYFDQLEDLYDDDKLKCLLLGDDELCAGFTHDRFSFLIMA
                     WSAFQFLWVSLLIFVQVFQVTKGVTSYEFNKIVKHGKQVTNSLPFKETFNTTPDISVP
                     NNGSSSGGDDNGTTDGEIGDTTSSTIRHRRSNKIWGVCAAVLGIDQWIMVLKETIGLL
                     PKRQTSESDRPFIVTNYGIKNNCIDFFLTSDTSAPIWQRFIYEPTSLKALLNNNEVDY
                     ATLYSLPSIGTTDDVSTIV"
     gene            <65686..>68040
                     /gene="TPHA0C00380"
                     /locus_tag="TPHA_0C00380"
                     /db_xref="GeneID:11534104"
     mRNA            <65686..>68040
                     /gene="TPHA0C00380"
                     /locus_tag="TPHA_0C00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684581.1"
                     /db_xref="GeneID:11534104"
     CDS             65686..68040
                     /gene="TPHA0C00380"
                     /locus_tag="TPHA_0C00380"
                     /inference="similar to DNA sequence:INSDC:YDR263C,YOR033C"
                     /note="similar to Saccharomyces cerevisiae DIN7 (YDR263C)
                     and EXO1 (YOR033C); ancestral locus Anc_5.625"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684629.1"
                     /db_xref="GeneID:11534104"
                     /db_xref="GOA:G8BR19"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:G8BR19"
                     /translation="MGIQGLLPQLKNIQNPVSLNRYSGETLAIDGYAWLHRATFSCAH
                     DLVLGNPTDKYLQFFIKKFAMLKSYNIQPYLVFDGNSLPVKKQTEVKRKEKRTENRSI
                     AIKLWNSGERRNAMEYFQKSVDVTPEMAKCVIDYCKLHGIKYVVAPYEADPQLVYLEK
                     HKIVHGIISEDSDLLVFGCRKLITKLNDFGECIEICRDNFNQVPKKFPIYELTDDQIR
                     VMVCLSGCDYTDGILKIGLIRAIKLVRQHKTMDKIILALQREGKSVIPKTFLMEYYKA
                     CLAFQYQRVYCPNQKKIVSLNDLTDEVISKVSEKYEPKEMFVSIGLVINKHTKTWDCI
                     LNDTEVNHELHTKIARGELSPYDFNKNLVNREHKLQIQSKSDLSTASTSAVTTTSATV
                     SKSIGIENYFSKTTENTNKAISTNYKTEHKKPIIDKISQCVKRRKLISNVQNINYRVD
                     VRSKFFSGGSTITANTALLSATQSSNGWAKNSDSNQDSVDTDIPDSELPTQISSSYPI
                     LSSNQNISKPVAVSFSQTKPEASINVISVSNVIANDGEDTSEILSEVDDSLMKPMIDL
                     VELDDQDENTSIKSDERVLLKDMPSEKTERSLFSSQKSATADKSNTKSLTFFQQFKYS
                     PSQVATQTSNSISSRYTADCGSNLKSHSFNTIVNRNNSQALDDKENRLPSSSQLLQSE
                     EKRSLSNTIIRKPLSISNPNKLKISKTLSLSDHKLTQSLKSSQDSEFQPIKITNALDK
                     SNMSILHRNSIRFSSIGHLDDKNISKVDNRRSVSSLSKFIYKDK"
     gene            <70592..>71809
                     /gene="TPHA0C00390"
                     /locus_tag="TPHA_0C00390"
                     /db_xref="GeneID:11533447"
     mRNA            <70592..>71809
                     /gene="TPHA0C00390"
                     /locus_tag="TPHA_0C00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684582.1"
                     /db_xref="GeneID:11533447"
     CDS             70592..71809
                     /gene="TPHA0C00390"
                     /locus_tag="TPHA_0C00390"
                     /inference="similar to DNA sequence:INSDC:YOR032C"
                     /note="similar to Saccharomyces cerevisiae HMS1 (YOR032C);
                     ancestral locus Anc_5.624"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684630.1"
                     /db_xref="GeneID:11533447"
                     /db_xref="GOA:G8BR20"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:G8BR20"
                     /translation="MVYFVGNQPLEIGTLFQNSLGKNYRNPDNSVKKENIPFNLDVNY
                     IPIDYDYDAKLVKFNNNSYTNDQDEFSDVPQPTEDTNVSVAQQPDSMVETELPKSFNI
                     NNVSRMSEPSSNLLMDSSVNNNLFQDVISNASYNINSKETYKNRTGEIDRYYNDSMKG
                     EDDEESIKVDINDFLSNDGKIESFNEMMLPDRNKLHLQLLNTFDSYVPVDENIHSDSI
                     LDAPNLIKSAELTNLRRLSRSAKPVISNKSSTILYGQANNPRNTVGLKSQKIDPPLIQ
                     NKHDLVSNKMKGMNNTSEHKHKYKTIIKVQNSKNLKKSNNIVEKRYRSNINEKMTYLK
                     EIVPSLRVASKRENGIPIIKEDSIDLDGLQPAKKLNKASILLKTIEYIRHLENKCHNG
                     IQGNNNTNDRYRN"
     gene            complement(<71984..>72847)
                     /gene="TPHA0C00400"
                     /locus_tag="TPHA_0C00400"
                     /db_xref="GeneID:11534075"
     mRNA            complement(<71984..>72847)
                     /gene="TPHA0C00400"
                     /locus_tag="TPHA_0C00400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684583.1"
                     /db_xref="GeneID:11534075"
     CDS             complement(71984..72847)
                     /gene="TPHA0C00400"
                     /locus_tag="TPHA_0C00400"
                     /inference="similar to DNA sequence:INSDC:YDR262W"
                     /note="similar to Saccharomyces cerevisiae YDR262W;
                     ancestral locus Anc_5.623"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684631.1"
                     /db_xref="GeneID:11534075"
                     /db_xref="InterPro:IPR000782"
                     /db_xref="UniProtKB/TrEMBL:G8BR21"
                     /translation="MYKMYEKPILTFAVFFLYLSLALGKEVVDLITYKDANGRLHKRF
                     ADENIRFTNDKQLQRYGPVWNRNMDENQNQRVAQAEKITPLDLNKVLSELFPFHEDKD
                     FMNKYNNNLISDKYDTTPVQLNSTLASSKNINIFASYTRMDVALNNLLMDEDQDLIVI
                     SPINESMMRLSMKPWQFPKNIEAMEANKSSDQAIDKAIQDNIANFVRSHVVSYEDNKS
                     TYGRYKNNAIVLRSLANQTSGSGDVLLQRESNGDYFVASVNDKVFTPVLKIVTSVNGV
                     VLFVNDTLIKP"
     gene            complement(73020..73090)
                     /gene="TPHA0Ctrna1G"
                     /locus_tag="TPHA_0Ctrna1G"
                     /db_xref="GeneID:11534095"
     tRNA            complement(73020..73090)
                     /gene="TPHA0Ctrna1G"
                     /locus_tag="TPHA_0Ctrna1G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11534095"
     gene            <73743..>74384
                     /gene="TPHA0C00410"
                     /locus_tag="TPHA_0C00410"
                     /db_xref="GeneID:11533514"
     mRNA            <73743..>74384
                     /gene="TPHA0C00410"
                     /locus_tag="TPHA_0C00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684584.1"
                     /db_xref="GeneID:11533514"
     CDS             73743..74384
                     /gene="TPHA0C00410"
                     /locus_tag="TPHA_0C00410"
                     /inference="similar to DNA sequence:INSDC:YOR021C"
                     /note="similar to Saccharomyces cerevisiae YOR021C;
                     ancestral locus Anc_5.605"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684632.1"
                     /db_xref="GeneID:11533514"
                     /db_xref="InterPro:IPR007364"
                     /db_xref="UniProtKB/TrEMBL:G8BR22"
                     /translation="MKYIIEHMEEGFSEWVVLEYSQILKDVGSENLILSSLPKNTTEK
                     DIPERLLKLGLQWTTGDLKEITKKYPNLQQLENGRVCLLDPRASTDLQPEDVEKFDYF
                     VFGGILGDHPPRDRTTELAIAYPNLLIGRRLGDKQMTTDTAVRTTQIIVKDKKKFEDI
                     EFIDYPEFRFSKNEATEMPFRYVLDAQKKPILPEGMLELIKHDAEQSIDDLFM"
     gene            complement(<74524..>74742)
                     /gene="TPHA0C00420"
                     /locus_tag="TPHA_0C00420"
                     /db_xref="GeneID:11533811"
     mRNA            complement(<74524..>74742)
                     /gene="TPHA0C00420"
                     /locus_tag="TPHA_0C00420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684585.1"
                     /db_xref="GeneID:11533811"
     CDS             complement(74524..74742)
                     /gene="TPHA0C00420"
                     /locus_tag="TPHA_0C00420"
                     /inference="similar to DNA sequence:INSDC:YOR020W-A"
                     /note="similar to Saccharomyces cerevisiae YOR020W-A;
                     ancestral locus Anc_5.606"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684633.1"
                     /db_xref="GeneID:11533811"
                     /db_xref="InterPro:IPR021278"
                     /db_xref="UniProtKB/TrEMBL:G8BR23"
                     /translation="MGNAYVIFGRTVQSHVLAISTLVAVGGITAYCTTGRKQEPAKPA
                     MVDTSNKDDINIEELLTDFLKEESTTDK"
     gene            <75408..>75731
                     /gene="TPHA0C00430"
                     /locus_tag="TPHA_0C00430"
                     /db_xref="GeneID:11535300"
     mRNA            <75408..>75731
                     /gene="TPHA0C00430"
                     /locus_tag="TPHA_0C00430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684586.1"
                     /db_xref="GeneID:11535300"
     CDS             75408..75731
                     /gene="TPHA0C00430"
                     /locus_tag="TPHA_0C00430"
                     /inference="similar to DNA sequence:INSDC:YOR020C"
                     /note="similar to Saccharomyces cerevisiae HSP10
                     (YOR020C); ancestral locus Anc_5.607"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684634.1"
                     /db_xref="GeneID:11535300"
                     /db_xref="GOA:G8BR24"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR018369"
                     /db_xref="InterPro:IPR020818"
                     /db_xref="UniProtKB/TrEMBL:G8BR24"
                     /translation="MSSIIRSAKSIVPLMDRVLVQRVKAEAKTASGLYLPEKNVEKLN
                     QATVLAVGPGFTDATGNKIIPQVKVGDQVLIPQFGGSTIKLRNDDEVILFRDSEILAK
                     LKDEA"
     gene            complement(<76078..>77424)
                     /gene="TPHA0C00440"
                     /locus_tag="TPHA_0C00440"
                     /db_xref="GeneID:11533963"
     mRNA            complement(<76078..>77424)
                     /gene="TPHA0C00440"
                     /locus_tag="TPHA_0C00440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684587.1"
                     /db_xref="GeneID:11533963"
     CDS             complement(76078..77424)
                     /gene="TPHA0C00440"
                     /locus_tag="TPHA_0C00440"
                     /inference="similar to DNA sequence:INSDC:YDR473C"
                     /note="similar to Saccharomyces cerevisiae PRP3 (YDR473C);
                     ancestral locus Anc_5.608"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684635.1"
                     /db_xref="GeneID:11533963"
                     /db_xref="GOA:G8BR25"
                     /db_xref="InterPro:IPR010541"
                     /db_xref="InterPro:IPR013881"
                     /db_xref="InterPro:IPR027104"
                     /db_xref="UniProtKB/TrEMBL:G8BR25"
                     /translation="MRDQKSDETYKGSVVENQQTQKKGLKTEINPILFSSNLNLIRRQ
                     HKQENPYLNFHDAKGEANYKKVNDRLHRGLVFHKKGEITAEYEKQRLLNKKKKRKRIY
                     GEKTQEKLEKEKLNKIKEGLIPNHVIGEDKYFTAVEDIPDVEWWDRPYLDENNNILEK
                     YDKQFTVDDVSESESEVEDDERNSEIVSHPSIRYVQHPVPIKLGDRNRLVSKIYLTKT
                     ERKKLRRNRKKLEREEKETKIKLGILPKPEPKVKVSNMMNVYENNQNITDPTQWENTV
                     REQVEERKRKHEETNKIRHEEAVKRKRENLGIPNVKVPPRNNICKIFKFKKLVNPSIR
                     YKLKVNSKQLGLRGACARVKDDGPGIIIIYGDEKSCKFYEKLITSRLKWNESFIDKTT
                     NSEIDMSDNSVEKVWEGYINESKFPNWFMKVYQREEDIKDALERFNAGQLFQYVIE"
     gene            complement(<77790..>79862)
                     /gene="TPHA0C00450"
                     /locus_tag="TPHA_0C00450"
                     /db_xref="GeneID:11533674"
     mRNA            complement(<77790..>79862)
                     /gene="TPHA0C00450"
                     /locus_tag="TPHA_0C00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684588.1"
                     /db_xref="GeneID:11533674"
     CDS             complement(77790..79862)
                     /gene="TPHA0C00450"
                     /locus_tag="TPHA_0C00450"
                     /inference="similar to DNA sequence:INSDC:YDR475C,YOR019W"
                     /note="similar to Saccharomyces cerevisiae JIP4 (YDR475C)
                     and YOR019W; ancestral locus Anc_5.609"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684636.1"
                     /db_xref="GeneID:11533674"
                     /db_xref="UniProtKB/TrEMBL:G8BR26"
                     /translation="MGDSDAVKQMRDAYSQLKIYSDSLNDYSGSIDATQSVSSNDDGK
                     RMQTGGTESQQESRIPTLSPSVSFNTVPSFTDNSHFQTEEPEFLGVQIPDAYTMDEYY
                     DNESYQPESHLKQGQHDYTTHSSHNRSSSFPPGWISPKTRMAANNLSHHLKISENGKI
                     VRTDYPSRPSVSTDSVIINREQNMFKKAWRTRKNRIGHRRCNKSIYFKKPDILFPEEQ
                     YTMAVMGNDYTPITKQQRKKDKILQKKVGFTNGPRTIICHISGRKYTWVALDWILKEL
                     SNNDHLVVIANLPKIKLPGRNHGDKFNKFVGDITSDAASSSSRASSDNTKKDLFSLFS
                     SPLTNNATEWCYGYEKIDIENSIRNIFTYITSIISPSLSVKITVEINVDKTSSTLIDV
                     FKSYNPDFIVAGTKKWKLTEDLVCWKSRYVSDQLATRYIVPVFLVPSLRMHEFERSIQ
                     NENSGPVKNNSELNLLVESAVKKKQDKSNTDDSITNRIEHEITSKTMEQQLKLLSMDN
                     RNNMLENLKKCEINNHNDPLCKINIIFNASVSFAKSIAQIKVDCSVVSEFERWKKEIT
                     GGEVKPETTSKKSMLDVVNTTSKTKAPKLHHTHTHSGIVRTLSHQPRQPLTRQLSSSP
                     TRSNLDDLPSISHVLTYSGNSPGHTHDSHRKIKKDTEGPVLRKVVSNTESPPKKKSGG
                     FFSSLFKK"
     gene            complement(<80273..>80911)
                     /gene="TPHA0C00460"
                     /locus_tag="TPHA_0C00460"
                     /db_xref="GeneID:11533950"
     mRNA            complement(<80273..>80911)
                     /gene="TPHA0C00460"
                     /locus_tag="TPHA_0C00460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684589.1"
                     /db_xref="GeneID:11533950"
     CDS             complement(80273..80911)
                     /gene="TPHA0C00460"
                     /locus_tag="TPHA_0C00460"
                     /inference="similar to DNA sequence:INSDC:YDR476C"
                     /note="similar to Saccharomyces cerevisiae YDR476C;
                     ancestral locus Anc_5.610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684637.1"
                     /db_xref="GeneID:11533950"
                     /db_xref="InterPro:IPR019595"
                     /db_xref="UniProtKB/TrEMBL:G8BR27"
                     /translation="MTFDQQDAITAFNANHRLALTDILYFYGHVPITSKITAVRLLSY
                     DLQSMTIRFHHNEVEFDIDKLIVFETPLTQLSDFTVYIDKMVRKAAKERNYSHIQINE
                     VVYPNNIVEYIIIVAVFLPLMCYFYRPLLHLLPLPEFIKEFLDNDFILIAIEALAIIT
                     HILETYILLRPKLKFYRVPTDFLIEWYALGLLEGYAPAKRLEQLAMEKLKSE"
     gene            <81482..>83377
                     /gene="TPHA0C00470"
                     /locus_tag="TPHA_0C00470"
                     /db_xref="GeneID:11534106"
     mRNA            <81482..>83377
                     /gene="TPHA0C00470"
                     /locus_tag="TPHA_0C00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684590.1"
                     /db_xref="GeneID:11534106"
     CDS             81482..83377
                     /gene="TPHA0C00470"
                     /locus_tag="TPHA_0C00470"
                     /inference="similar to DNA sequence:INSDC:YDR477W"
                     /note="similar to Saccharomyces cerevisiae SNF1 (YDR477W);
                     ancestral locus Anc_5.611"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684638.1"
                     /db_xref="GeneID:11534106"
                     /db_xref="GOA:G8BR28"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR013896"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR028375"
                     /db_xref="UniProtKB/TrEMBL:G8BR28"
                     /translation="MMSSGDHKSRHGSRHHSSSLLSDGSKIGNYQIVKTLGEGSFGKV
                     KLAFHSTTRQKVALKIINKKVLSKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDE
                     IIMVIEYADHELFDYIVQREKMSENEGRRFFQQIISAVEYCHRHKIVHRDLKPENLLL
                     DEHYNVKITDFGLSNIITDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILY
                     VLLCRRLPFDDESIPTLFKNINNGVYTIPNFLSEGAASLIKKMLIVNPMNRITIGDII
                     QDPWFKVDLPEYLVPSEKDAIKINGTNNNAENLQNLTAADIDEEAIDILTKTMNYSKE
                     EIYESLQSGDVDTNPSHHEIKEAYLLIKENQNLINTLKKGDNIKQLDTFLSQSPPSFQ
                     KYNEQNGTTGMSISKPTHSGKDRRNLNNIPGISDAQRPVHVPSSKHQFIPEENNQQRT
                     YLPKTFPDEDKQADSTITILPSSLPQIHRTNMVSQGLVGTSNVTPLPVKKSKLKWHFG
                     IRSRSYPLDVMSEIYAALKTLGAHWAKPSEEELWTIRVSWRYNNNSTQNRENIPDLMK
                     MIVQLFQIETNNYLVDFKFDGWEFSDGRGVPQGNISEDEIGAFSAYPFLHLTTRLIME
                     LAVNSQG"
     gene            <84132..>85427
                     /gene="TPHA0C00480"
                     /locus_tag="TPHA_0C00480"
                     /db_xref="GeneID:11533607"
     mRNA            <84132..>85427
                     /gene="TPHA0C00480"
                     /locus_tag="TPHA_0C00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684591.1"
                     /db_xref="GeneID:11533607"
     CDS             84132..85427
                     /gene="TPHA0C00480"
                     /locus_tag="TPHA_0C00480"
                     /inference="similar to DNA sequence:INSDC:YOR025W"
                     /note="similar to Saccharomyces cerevisiae HST3 (YOR025W);
                     ancestral locus Anc_5.612"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684639.1"
                     /db_xref="GeneID:11533607"
                     /db_xref="GOA:G8BR29"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:G8BR29"
                     /translation="MMTTTSPEASRSSSFNFADKFSLQSERVVSIMELESSNETLQRI
                     NKALNRSRKIAVLTGAGISCNAGIPDFRSSTGLYDLVKSQYPELTIRTGQEMFDISLF
                     RDEMKIQVFATFMEKLYTSTRLAKPTKTHRFIAHLRNRNKLLRCYTQNIDGLEELLGL
                     EMSKKEMESKTNGFVNRWKNFDVVQLHGDLNSLACTRCFHTFEWNRFLARSFRRGELP
                     SCPECLANNAKRTQEGKRNLGLAGFLRPNIVLYGENHQSSEFISQGINYDISKGRPDF
                     LIIMGTSLKVDGVKRVVKTMSKQIHEKGGIVILVNKTILADSQWAGIIDYQIVSDCDS
                     WVSYLEKDIPELFKTQEQFDKLRQLKREASQLRKQKKLQNESKKEDATLMLKTPPTTP
                     QAKELQSIIIAKDETDNVKRKLLEEEIDVKVNLNKKIKV"
     gene            <85776..>86171
                     /gene="TPHA0C00490"
                     /locus_tag="TPHA_0C00490"
                     /db_xref="GeneID:11533783"
     mRNA            <85776..>86171
                     /gene="TPHA0C00490"
                     /locus_tag="TPHA_0C00490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684592.1"
                     /db_xref="GeneID:11533783"
     CDS             85776..86171
                     /gene="TPHA0C00490"
                     /locus_tag="TPHA_0C00490"
                     /inference="similar to DNA sequence:INSDC:YDR478W"
                     /note="similar to Saccharomyces cerevisiae SNM1 (YDR478W);
                     ancestral locus Anc_5.613"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684640.1"
                     /db_xref="GeneID:11533783"
                     /db_xref="InterPro:IPR007175"
                     /db_xref="UniProtKB/TrEMBL:G8BR30"
                     /translation="MNREAKENYRDIQLRKKYNSIHKLAELGLSELSGLYLTSFYNSS
                     KRYNVILPQQIVSDGSKFCGKCGCLRVPNHNVLISSEELNIRFTCLKCGDIKLFERRS
                     NRPVTKEEIEHDFVATWPSDKKNRYKFEC"
     gene            complement(<86444..>87349)
                     /gene="TPHA0C00500"
                     /locus_tag="TPHA_0C00500"
                     /db_xref="GeneID:11533634"
     mRNA            complement(<86444..>87349)
                     /gene="TPHA0C00500"
                     /locus_tag="TPHA_0C00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684593.1"
                     /db_xref="GeneID:11533634"
     CDS             complement(86444..87349)
                     /gene="TPHA0C00500"
                     /locus_tag="TPHA_0C00500"
                     /inference="similar to DNA sequence:INSDC:YDR259C,YOR028C"
                     /note="similar to Saccharomyces cerevisiae YAP6 (YDR259C)
                     and CIN5 (YOR028C); ancestral locus Anc_5.619"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684641.1"
                     /db_xref="GeneID:11533634"
                     /db_xref="GOA:G8BR31"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:G8BR31"
                     /translation="MNINHIKNENMSNTMVSTLNPMSPNNNVMQSPYYSLPKITPSLI
                     YNNNNSSNNATANNNASLNPKSFSRNEAYQVHAHPSQQQQQQQQHSMSITPPPQNQLQ
                     PNQHPHMQEKLAYMQQPNTYQQMALPSFYKTTNYTQSQPPPPPQQIQTQQIQTQQIQA
                     QQPQSQLQHTQAQPLSMVSPGQPLMQQNKPVVSTTPMYNMQTISRSTTPVSLSSKFNG
                     GEIINENGHLIGKSGKPLRNTKRAAQNRNAQKAFRQRKEKYIKKLEFKAKNFDQLALE
                     NESLKLEVVKLQEIIKKLQEAISNR"
     gene            complement(<90202..>90957)
                     /gene="TPHA0C00510"
                     /locus_tag="TPHA_0C00510"
                     /db_xref="GeneID:11533773"
     mRNA            complement(<90202..>90957)
                     /gene="TPHA0C00510"
                     /locus_tag="TPHA_0C00510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684594.1"
                     /db_xref="GeneID:11533773"
     CDS             complement(90202..90957)
                     /gene="TPHA0C00510"
                     /locus_tag="TPHA_0C00510"
                     /inference="similar to DNA sequence:INSDC:YDR260C"
                     /note="similar to Saccharomyces cerevisiae SWM1 (YDR260C);
                     ancestral locus Anc_5.620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684642.1"
                     /db_xref="GeneID:11533773"
                     /db_xref="UniProtKB/TrEMBL:G8BR32"
                     /translation="MSSYRDSYFQYQHYIESYHTLYVEWNDDKFPLIEEEFGNKAGLD
                     TDKAHLGNADRSISSNNVDNDTINRSGSGIDGVNNNMGYWDQFHDEEDWELFRSFHLG
                     SNGIVTFNIMNGNNDNGGGNGYIDNDNVTIDFDDIAGQVLIKGAKHLKDGLQPESRFH
                     TRNAGNNNIFDFENNNLVNNHDGTAEDQPSSQQDMNSNQEESDDSKSPQNTKYIQIRN
                     DAVPETVSGIIFSQQRGALQIARKRCNNWNDWV"
     gene            91679..91751
                     /gene="TPHA0Ctrna5A"
                     /locus_tag="TPHA_0Ctrna5A"
                     /db_xref="GeneID:11533600"
     tRNA            91679..91751
                     /gene="TPHA0Ctrna5A"
                     /locus_tag="TPHA_0Ctrna5A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:11533600"
     gene            <91969..>93894
                     /gene="TPHA0C00520"
                     /locus_tag="TPHA_0C00520"
                     /db_xref="GeneID:11535295"
     mRNA            <91969..>93894
                     /gene="TPHA0C00520"
                     /locus_tag="TPHA_0C00520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684595.1"
                     /db_xref="GeneID:11535295"
     CDS             91969..93894
                     /gene="TPHA0C00520"
                     /locus_tag="TPHA_0C00520"
                     /inference="similar to DNA sequence:INSDC:YOR030W"
                     /note="similar to Saccharomyces cerevisiae DFG16
                     (YOR030W); ancestral locus Anc_5.622"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684643.1"
                     /db_xref="GeneID:11535295"
                     /db_xref="InterPro:IPR014844"
                     /db_xref="UniProtKB/TrEMBL:G8BR33"
                     /translation="MDLSFSHDLISSTLKSLEDVNKEVYIKTQDVDNVQEYIKFIREL
                     LIDPFSGICSIRLISPGLLNATANGTTVLKDFYTRHPAFLVQCRDIKFEGHSSGTHNV
                     YELERISTLINENLNWNVFVDLDKFDVFTNSNIFTIFIMALICMSTWMLLFLLVLLPS
                     KSHFTKRKLIHFYVLLSGAHETGLLIYSLKHIFHKQHKNNYQDSLEFYKLLVNTDAFK
                     VFELLTNFAFLFNCIEIVYYIYRDSKPIPDKYHYIPEYFRKNRNYTIVFLGLLVLILD
                     QIFFALILWFNFNSVVHIFYLITEAALYFSFGFILCRYVYKNFGYMFHPKHIIDNAPL
                     RLQDKLYLIWRDYYQTILILVHNILFYILLFFILCYLISSHLNNYLWKYGLLRLFKLI
                     ISVNAWGLINTMERQEDMINAETMLGKRIDNEDKLFNNPSLQYPIAKRSDVDFTDDLN
                     STNSYFELDSTGNTTAPLRSGNNFKIAKTEMNDNSVVQSNLNNPIKMIMKHPGLPIFS
                     NINNKKTNERKFDRTSKDSRIRASNRHRIISMLLNTKNEEISDINGVSENLEMEATST
                     KNRRKTVFSNKVKNLFKAHKDESYTMLPADGNIQNDNGAANSTLHLKNENSKADVNEA
                     SSIETELTRNFIFDHDE"
     gene            <94676..>100456
                     /gene="TPHA0C00530"
                     /locus_tag="TPHA_0C00530"
                     /db_xref="GeneID:11533619"
     mRNA            <94676..>100456
                     /gene="TPHA0C00530"
                     /locus_tag="TPHA_0C00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684596.1"
                     /db_xref="GeneID:11533619"
     CDS             94676..100456
                     /gene="TPHA0C00530"
                     /locus_tag="TPHA_0C00530"
                     /inference="similar to DNA sequence:INSDC:YDR170C"
                     /note="similar to Saccharomyces cerevisiae SEC7 (YDR170C);
                     ancestral locus Anc_8.368"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684644.1"
                     /db_xref="GeneID:11533619"
                     /db_xref="GOA:G8BR34"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR015403"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR023394"
                     /db_xref="UniProtKB/TrEMBL:G8BR34"
                     /translation="MSDLEDIPVDSSNKNDVERSLDHTEEQGSVQDGGASDSAESVEI
                     SESESDSEVEDLNSVVATEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE
                     EEEEEEEDSAIDAAVEAAVKEERAIEDDVEEVQRAAEAAAAAGVEAAIEKSIYASTQT
                     ATTANIKSTYTLVIDTLKNILENRDIKKYPNTQKDVERVLSKLEDTLKQTNNDPKVLD
                     SIQVFESLRSCCRTESDKIQLSALDCLSKLYSFKALDESILVNPPDCQAANDQEQNAE
                     SNGITPPPKQRLIDASIDAISDCFQGESTDEKIELQIVRALSSCVLSETSESLCHGAS
                     LLKAVRTIYNIFIFSLSSSNQVIAQATLIQIVGSIFDKIDLTELKADGTEYSNSLRND
                     VDMDSLRKDKEENTESLTISNMDHLNEEADQAADDQDDEASVSNIALLDIEELAIKDA
                     FLVFRAMAKISAKPLVSDLDMRSHAVRSKLLSLHIIHSIINDHIDIFLSTTTYLPGRD
                     HVLLVDAIRQYLCLSIARNAASPISPVFEITLEIMWLLISHLRAQFKREIPVFLIEIY
                     FPISELITSTNHQKRYFLYVVQRICNDPRTLIEFYLNYDCNQGMPNLMELMLEYLSKL
                     AITRVDITSTQRGYYQEQLAKPLATYDLNQLPLLSISNISSTPDDTQASLGYPIEYAL
                     KIAALNSIVFVLKSLSTWAHRALKPMSSLLNKNSTRDDHSSSVASSIHERRTSALPSS
                     NSISSSLNDNLQDIDDPTQFENLKQRKIQLSDCIRIFNSKPKRAIPALLDKGFIDNNS
                     PSCIAKWLLNTEGLDLAKVGEFLGEGDDENIAIMHAFVDEFEFTGLSIVDALREFLQK
                     FRLPGEGQKIDRFMLKFAERYVDQNPEVFSKADTAYVLSYSLIMLNTDLHSAQVKNRM
                     TLKEFLENNEGIDNGNDLPEEFMVGLFNEIANNEIKLLSEQHQALLSDDSTLIPQQPS
                     AFNFFSSRDLVREAYIEVSKEISSKTELAFKNLNKSKSGDDVFDVYYAASHVEHVKSI
                     FENLWMSFLASLTPPFRDYDDLETTNKCLEGLKLSIKISSIFGIEFAKKSFIGALVQF
                     CNLQNLREIKLKNVNAIIILLEEALAEGTFLKESWKDVLFVVSQVERLQLISKGIDRD
                     TLPDVAQARYTNHRSSMESTRSVTTTSIFDMWSKKASPAEIAQEKHHKQKLSNEISKY
                     ISSSELVVLMDNIFTKSADLPGDAIIDFIKALTDVSLEEIESSQDASTPRMFSLQKMV
                     DVCYYNMDRIKVEWTPIWAVMGRAFNKIATNANLAVVFFAIDSLRQLSMRFLNIDELS
                     GFEFQSDFLKPFEYIIQNSGNIEVQEMIIECFRNFILTKSEKIKSGWKPILESLQYTS
                     QSPHEIIVKKTYLLVSNDIVANNFESIFSQDESFSELNNVFREISKHKRFQKLSLHAL
                     EALKETTKKVATICFAAPDDPNYEHYQQILRGKDTFQDIWFPMLFCFNDTIMTAEDLE
                     VRSRALNYLFDCLVTYGKNFDDVFWEKICTKLLFPIFGVLSKHWEVNQFNSHDDLSVW
                     LSTTLIQALRNLVALFNHYFEALNKMLDGFLGLLVSCICQENDTIARIGRSCLQELIL
                     QNVSKFQDSHWTEIGDVFDKLFGLTTANELFEYDPLKRGRKPSSANIKTEGNITDTIQ
                     RANEEEASEDVGNDMLENEDDSKNETQLTKTTDDQSSQYSQKPLSTARSAEDVRGRLF
                     VKNSIVVKCVLQLLMIELISDLFDNEDLINHIPLKQSMKLATILEKSYEFARDFNADY
                     ELRTRLVEARVVDKIPNLLKQETSAAAVLINIFFMLYLNDDEKKPELISRLISISTDV
                     LKNYVELDDRTMERSIKSWRPVIVEILQGYYEFDDEDFHKYCSSIYTLVIQILDKTVP
                     SDLRSAVKLFLIRVGELYLNQEVNQN"
     gene            <100765..>101811
                     /gene="TPHA0C00540"
                     /locus_tag="TPHA_0C00540"
                     /db_xref="GeneID:11535285"
     mRNA            <100765..>101811
                     /gene="TPHA0C00540"
                     /locus_tag="TPHA_0C00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684597.1"
                     /db_xref="GeneID:11535285"
     CDS             100765..101811
                     /gene="TPHA0C00540"
                     /locus_tag="TPHA_0C00540"
                     /inference="similar to DNA sequence:INSDC:YLR151C"
                     /note="similar to Saccharomyces cerevisiae PCD1 (YLR151C);
                     ancestral locus Anc_8.365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684645.1"
                     /db_xref="GeneID:11535285"
                     /db_xref="GOA:G8BR35"
                     /db_xref="InterPro:IPR000059"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:G8BR35"
                     /translation="MFKPLTLLSRIIKYKYRSPYPIQSISPPHRRSVVLIILFIGQRG
                     ELRVLLTKRSRGLRSFSGHVSFPGGKADDTDQSFIDTGRREVEEEIGIPQDDELLNKE
                     YLLSLEQLNVNLPCYLSTTFLSVKPLVFFLYNSNLRDENLLKYSTPIDGSKFKAKLNP
                     GETSSIFSIPLSDLTYFMFYDSYDHLTNKYKPEYTKRTKITKAWGGLRWNVSHYYYPT
                     LNAQDESWLNNVLDMSSDEEKLGNSDDNLTYKDVWGLTAKILYDLSRIAHGYISNNTD
                     DKQNPSLNIKIGDEDLIYALHEFGKQMQSKSRTDWELAMLKGSKTTNYSDVLPKFCLE
                     KLEAPSDYESGDQH"
     gene            complement(<101949..>102773)
                     /gene="TPHA0C00550"
                     /locus_tag="TPHA_0C00550"
                     /db_xref="GeneID:11533676"
     mRNA            complement(<101949..>102773)
                     /gene="TPHA0C00550"
                     /locus_tag="TPHA_0C00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684598.1"
                     /db_xref="GeneID:11533676"
     CDS             complement(101949..102773)
                     /gene="TPHA0C00550"
                     /locus_tag="TPHA_0C00550"
                     /inference="similar to DNA sequence:INSDC:YLR150W"
                     /note="similar to Saccharomyces cerevisiae STM1 (YLR150W);
                     ancestral locus Anc_8.364"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684646.1"
                     /db_xref="GeneID:11533676"
                     /db_xref="UniProtKB/TrEMBL:G8BR36"
                     /translation="MSDDRFDKLGNSIENESIDKTQSDKLPIEIVKTNNRTSKKSKEE
                     QLPPTRIPKKTASGNEAFYRDKNIGRYTNVEEHVPKQAIKSNNVRYKTELKKVDKHSR
                     TGKVDTMKKINNGWGNDLNEWEFEQYAEEDVKKDKQNDLGMGFDGGPEVSSFPLPMTT
                     LSFQEYLEEQNDFNRINKVPSINNKNINSLDDELIIDNEPEILSYPTHAKSYTSHHHI
                     FRDDKKFLNYQASEMTTPRTDVVNEGWDTTLNSSNTPTKNFAIKKKGINLEKLPSL"
     gene            <103781..>104935
                     /gene="TPHA0C00560"
                     /locus_tag="TPHA_0C00560"
                     /db_xref="GeneID:11535196"
     mRNA            <103781..>104935
                     /gene="TPHA0C00560"
                     /locus_tag="TPHA_0C00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684599.1"
                     /db_xref="GeneID:11535196"
     CDS             103781..104935
                     /gene="TPHA0C00560"
                     /locus_tag="TPHA_0C00560"
                     /inference="similar to DNA sequence:INSDC:YDR169C"
                     /note="similar to Saccharomyces cerevisiae STB3 (YDR169C);
                     ancestral locus Anc_8.363"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684647.1"
                     /db_xref="GeneID:11535196"
                     /db_xref="InterPro:IPR018818"
                     /db_xref="UniProtKB/TrEMBL:G8BR37"
                     /translation="MSDALEQTSPVTPFVSELLLGRGPLQIRFINTFIAKKYPVFNEY
                     SNSKKRRVLMQILEKGDFSKRIVFKKVGWGEWYAKQLGDVSESEFNRIRDEENKKSNS
                     ITASSHLLSPSPTAKAKKLQQKQKSVMNTLYIDENAIVSDDDEDENIMNSSEDENPYI
                     YHHRKPSLNYDILSQKLKSSIKPNNSQIVSKKNSRTWSATATTNSNSKSIRNRRRSSN
                     VIAYNPSATNNNRTESDVEDVAELAPNEKREARMSISKESGIRSTLLSPTPGLINFST
                     TTNTSVPNSIFSINSPTVSKEQISDTVPRLNERVVLTPKSGSVSGTDTDEEDWANIGA
                     ETLRNTYYTQLHSNEASPKPNNELELEIKSNGQRLKNDSDAAILLMSLKS"
     gene            <105539..>107740
                     /gene="TPHA0C00570"
                     /locus_tag="TPHA_0C00570"
                     /db_xref="GeneID:11533802"
     mRNA            <105539..>107740
                     /gene="TPHA0C00570"
                     /locus_tag="TPHA_0C00570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684600.1"
                     /db_xref="GeneID:11533802"
     CDS             105539..107740
                     /gene="TPHA0C00570"
                     /locus_tag="TPHA_0C00570"
                     /inference="similar to DNA sequence:INSDC:YLR149C"
                     /note="similar to Saccharomyces cerevisiae YLR149C;
                     ancestral locus Anc_8.362"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684648.1"
                     /db_xref="GeneID:11533802"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019417"
                     /db_xref="UniProtKB/TrEMBL:G8BR38"
                     /translation="MTIENHKYHWNPTFRHRDLEKYKNKDEDYIDFYFNNTGYNKIYQ
                     NYLLPNIRLYDNKISINHWQLRDSIKASSNYKVNNNIYYIFDHSIRKINSKDTSFDTE
                     DAEKDSFTKSSTVVNFNFKPRCFTEKQGLIACGGLIGPDDRGYPSNWNNSDRESLGVN
                     HAGNGDDTAAEADIPCKPVEVLNDNVLNDNTNYSNPSLWKGIIQLHDTNTNISQSLVL
                     GQFITNCVALLPISSNQYDMFSCNNDNHMYQCNINNSRVVLTKRYSDLKFALNYVALS
                     NDSRTMVVSGDTNKFAIYRKNEFDNLFTLNYDTQPSWGNSTIIKNERIPRYALPDHTS
                     KLDLEDMTASNNSSCANLSSNLNGRHIYEAPNSDHGFYTSFSNNDLQFATIFQNGVCL
                     IYDTRNMYKPMIEINSTRPYSHSGSFRVCKYSNSIDDLLFITEHQSRIHVVDTRNFTN
                     HQVISIPSKVETTSAGNIFSDDNSNPNASDLPNDVTTARTVPLDKLIPSIAPYPELCS
                     KTTNEYNSLQEKGLYLINQDPPNYSNRDDNQIRDRNNINPDFIYDYYHNESEFDSSGI
                     IMENGNTSRNRKIKSHHPGSDPYNFDFRLQRIRTNSYENNNWNNSPNSKTSSVNNTNQ
                     LLNDQNNNYPSMGSNNPTRDVYNASQLSGFPLSRRGGTSLWSAYTDDFTRDTITSYVT
                     LESADESNICGLDCMQDSNGNDSLIVGYDYGLLQWNINSWARRSFSSYEFT"
     gene            complement(<107936..>110866)
                     /gene="TPHA0C00580"
                     /locus_tag="TPHA_0C00580"
                     /db_xref="GeneID:11533459"
     mRNA            complement(<107936..>110866)
                     /gene="TPHA0C00580"
                     /locus_tag="TPHA_0C00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684601.1"
                     /db_xref="GeneID:11533459"
     CDS             complement(107936..110866)
                     /gene="TPHA0C00580"
                     /locus_tag="TPHA_0C00580"
                     /inference="similar to DNA sequence:INSDC:YLR148W"
                     /note="similar to Saccharomyces cerevisiae PEP3 (YLR148W);
                     ancestral locus Anc_8.359"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684649.1"
                     /db_xref="GeneID:11533459"
                     /db_xref="GOA:G8BR39"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR007810"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019453"
                     /db_xref="UniProtKB/TrEMBL:G8BR39"
                     /translation="MGADPNYKADISQLGVDIEEVRLSFINELDKSHISSLQVKSNIM
                     CFVLQSGILFVIDLDKPSKVHKYPIPLLNGGGKKPIELLIRIWLSPNGSLLFLKTNLS
                     NYYVCDVNTLLEENDQKPTRALLFQVASLSKNNYDINSLEWCNDASFLCGSKDGHVSF
                     VDVPNGDLLKLSNLSVTTVLKLINKLMVYCGINKKNKPYIECIIVSDSNIMYWGNIDS
                     DNPIRSLKNRKVPEEKEQFDKLSANTTNKFSTYEDRFSWVTANGVVFGRTGDDIDQEY
                     KTFTNSNRKILLDANLFLNVELTERQKIINDIIMTDFYLILQRDTLITVINRLTNEIV
                     YEEELLLNESENIIGLTADHSQEVPTYWCYSNLHVYEITISNKSHSVWKILCKQNKFN
                     TAQSLLDINNMEKDMIMHNKGDFLFENGNFFDAATSYGNSSYSSFGSIALKFLESDDD
                     IDPLQEYLSVKLKKIPSTKESQKLLLTSWILWTYLKKLNIVDEKIASEKSSVLLTKLK
                     EDKEIIKSELNTFLSEYAFSLDKKIVLQLLLSQNRQDELLFYAKLISDFEFILNYWIK
                     KEKWYEAQKSLLNITDVKQIYEHASLLLLKIPDSLIKTWMKIDKIDYVKLIPSLLTYY
                     SHYMKTPVIDNTTNQQKENYALTYLLWCIKNYTVTKTIVYNTAIYMMISTFNDDILDN
                     SYQETIINFMTEHENRFDINFVLRLSLKFKTIIVSIYLYSKLKLYEAAVNLALENNLI
                     EFAKDVVNNIGSENDMTELETSSNDKLCQKLYLKIAKKVLFDETNNHDLKTNINNILR
                     ETNGILTIKELLPLFKEFTTIANLKDQIIKSLELHGKSMSQITQNIKSSMIMKEELLQ
                     DMEYFQERYMTLEPGVSCDVCQKILQDQRFYVFPCSHNFHERCIKDSILDSNEIILKS
                     KIENIERKLNRENNKVRKMTLNKEMNKLLSTKCCLCSDININKIESYVLDMNNTEESM
                     KWII"
     gene            <111269..>111571
                     /gene="TPHA0C00590"
                     /locus_tag="TPHA_0C00590"
                     /db_xref="GeneID:11533948"
     mRNA            <111269..>111571
                     /gene="TPHA0C00590"
                     /locus_tag="TPHA_0C00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684602.1"
                     /db_xref="GeneID:11533948"
     CDS             111269..111571
                     /gene="TPHA0C00590"
                     /locus_tag="TPHA_0C00590"
                     /inference="similar to DNA sequence:INSDC:YLR147C"
                     /note="similar to Saccharomyces cerevisiae SMD3 (YLR147C);
                     ancestral locus Anc_8.358"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684650.1"
                     /db_xref="GeneID:11533948"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:G8BR40"
                     /translation="MSNIPIKLLSEAQGHVVSLELSTGETYRGKLVDSEDNMNVQLRD
                     VTHTGVNSEVTRMDDVFIRGSQIRFFALPDMLKHAPLFKTGPQSKPPPPIRGPRRR"
     gene            complement(<111752..>112075)
                     /gene="TPHA0C00600"
                     /locus_tag="TPHA_0C00600"
                     /db_xref="GeneID:11533972"
     mRNA            complement(<111752..>112075)
                     /gene="TPHA0C00600"
                     /locus_tag="TPHA_0C00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684603.1"
                     /db_xref="GeneID:11533972"
     CDS             complement(111752..112075)
                     /gene="TPHA0C00600"
                     /locus_tag="TPHA_0C00600"
                     /inference="similar to DNA sequence:INSDC:YLR146W-A"
                     /note="similar to Saccharomyces cerevisiae YLR146W-A;
                     ancestral locus Anc_8.356"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684651.1"
                     /db_xref="GeneID:11533972"
                     /db_xref="UniProtKB/TrEMBL:G8BR41"
                     /translation="MSGRNDTKSNGYTNDSKDDRNNTTVFDAESTYLLRNRSENLISQ
                     NKERIPKKEDINALIEEAMNLQDEINISFAELSDLNRQVRIDVEEFCKIRNMDVSNIS
                     KDDIF"
     gene            complement(<112452..>113798)
                     /gene="TPHA0C00610"
                     /locus_tag="TPHA_0C00610"
                     /db_xref="GeneID:11533649"
     mRNA            complement(<112452..>113798)
                     /gene="TPHA0C00610"
                     /locus_tag="TPHA_0C00610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684604.1"
                     /db_xref="GeneID:11533649"
     CDS             complement(112452..113798)
                     /gene="TPHA0C00610"
                     /locus_tag="TPHA_0C00610"
                     /inference="similar to DNA sequence:INSDC:YDR165W"
                     /note="similar to Saccharomyces cerevisiae TRM82
                     (YDR165W); ancestral locus Anc_8.355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684652.1"
                     /db_xref="GeneID:11533649"
                     /db_xref="GOA:G8BR42"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR028884"
                     /db_xref="UniProtKB/TrEMBL:G8BR42"
                     /translation="MSLIHPIQDIVSSEDGSLIFGIIKNEVVVFRVEEGKSQLVGKWV
                     DELDRNEVIREKVEKEQARQIAENITKKRKTNDESAKTIESENKTAKIPTPGLGAPTV
                     YSHLRNVTLSHGEKLLIICADSDKSVIIFDIDNDNKENVLQLKKRQPYPKRPNAIAIS
                     DDDKLIVIADKFGDVYTMSVDSDVKKIDGNVEPVLGHVSMLTSIVVVKDSENKKYIIT
                     ADRDEHIKVTHYPQTYIVKHWLFGHNEFISSLSVPQWNKTNDLLLSAGGDRYLYLWNW
                     GKNELLSKFNYEKLIDKYITDAHLASERFQNEENNLREYCVSKIVSLPSNRLVAFFVE
                     ATPLLIILKYSPEDNTLKLFQTMEFAFNIITMNVNNNQLLITLDNHESQNKDFIKILD
                     FNENTDRFSTNESLSNNLDTTIASTLIEDKTSHIGSTGIYPLYTTINLKKHGESYS"
     gene            <114740..>117262
                     /gene="TPHA0C00620"
                     /locus_tag="TPHA_0C00620"
                     /db_xref="GeneID:11533767"
     mRNA            <114740..>117262
                     /gene="TPHA0C00620"
                     /locus_tag="TPHA_0C00620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684605.1"
                     /db_xref="GeneID:11533767"
     CDS             114740..117262
                     /gene="TPHA0C00620"
                     /locus_tag="TPHA_0C00620"
                     /inference="similar to DNA sequence:INSDC:YLR144C"
                     /note="similar to Saccharomyces cerevisiae ACF2 (YLR144C);
                     ancestral locus Anc_8.352"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684653.1"
                     /db_xref="GeneID:11533767"
                     /db_xref="GOA:G8BR43"
                     /db_xref="InterPro:IPR005200"
                     /db_xref="UniProtKB/TrEMBL:G8BR43"
                     /translation="MTIIGDYIKFEDLFNRKTFINKPPLSAFTKGKNEINLSKRIYNN
                     CMPIQTNKFYSNLLINDQQNPVWVYPYSINYHKLENDNDFFGLGINCNYSSNDNKKSN
                     SNKFINKNCVTIQNTDIKPFIFSSIDFHTKNEMFMTLSNMKQMSLQIYLKKNQSQFIW
                     FPVVQGMGMITAVYYNLIPKLQSEIGFKSIKQIPIYFNSHLSSTNKKKLIKKYSIVLQ
                     DNSKWLLYTTERYLVNSPENVINCLRIKDYHTIVGNLYSKGTIFQLIPDIFTNLKDVE
                     EVDYSIGCYPIDCVLKFSNNDDYKDDNDYITTEKNNDINSKCVNNISDAKQNESYLMY
                     DYQLGGHNNSEIPLIFILPHHQKLIDHNSMSKFKINSFVNSPVLGSMIGYLSSKIILK
                     LTLPKENPFESQLGGYFNLQSNIKGSSQKLLTETINEVKEIANEEAITLIETFKDIGT
                     MKDIREIGKQFYKYSWFLYCSYFILNDIELTIKLLPLIKDVFNKFINDTLFNDILQYD
                     TKCGGLITSSQYTDNYYYNEHNYDYSYFIISSAIIGKIELLLLNDTKVNNNDLVKDYF
                     NNTAYLWLDNKVVVEWCENLIRDYNNPSDTDEYYPSFRTFDWYHGHSWSIGLIEGMNG
                     KEYYSSGEDLNSLYAVNLWGLVTENKNLINISRVQLSLLKCSINSYVQYYDIEQDKIQ
                     RYYNKDNIESIPRLFASNQVCGMLSDNKLLYKKLKGLEISSQSKIHLQHILPINPLTN
                     WVRNNEFIENEYNTVIKELVSSLSKIDKRELHGYQYSMNKTFKTSFMINISSIRSKEA
                     FQYLLKTMPKINELDKSQSLTWALLYAMSFRDADSELNIHHD"
     gene            <117798..>119963
                     /gene="TPHA0C00630"
                     /locus_tag="TPHA_0C00630"
                     /db_xref="GeneID:11533800"
     mRNA            <117798..>119963
                     /gene="TPHA0C00630"
                     /locus_tag="TPHA_0C00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684606.1"
                     /db_xref="GeneID:11533800"
     CDS             117798..119963
                     /gene="TPHA0C00630"
                     /locus_tag="TPHA_0C00630"
                     /inference="similar to DNA sequence:INSDC:YDR164C"
                     /note="similar to Saccharomyces cerevisiae SEC1 (YDR164C);
                     ancestral locus Anc_8.351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684654.1"
                     /db_xref="GeneID:11533800"
                     /db_xref="GOA:G8BR44"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:G8BR44"
                     /translation="MSDLIQLQREYLIKILNDIQSENNLKFLIIDNEIEHLFNYIFKS
                     PSELLNYVTAIDKIDSQKRKGQPGVDAIYILAPTRFNINCIEADFQSIPQKYKKAHIR
                     FLPGFKGQLVDFFQYKRHINKNLASLAEAKFGFIPKESQFFQTLGIDRPLQIFFNNEC
                     QDLIQQNIDRTISSLLNLCIITGEYPIVRYSEPLPSQVEICQPTRLVKKLAIEFQEAL
                     DNYARNNQDFPPVDNPRPRAVFIITDRTLDLFSPFLHDFSYQALSYDVVDDINLITDV
                     YSYEAENEAGEKERKSSKLLDLVDPDWVELKHQHIADANEYLEGKIKEIIAQNPLLVD
                     RSNVKNTTDLLSVVAHLKDFDEDRRRLVLHRTLIEACLTSNHERKLALLAEMEQIACG
                     YGLDLEGEKVKNLIVQALPILQEKGPQLTDKVRLIIIYALYRGGLIKEDFVKLLSFIG
                     VTTDHEHFPSFMILIENFNKIGFKLLKDSPRSKPFEKEWLHDTIIKDTSVYQTSRFIP
                     ALGSILSKVITNPLLLSEEAFPYVKDKPIELLDEEEMAAVGASASANSSASLRNPRHK
                     ASWTKNNNLKSASRNPRQRFFYYILGGITHAEIKSAYDQSALKNKDVFIGSDGITTPL
                     GFMQSVESLSRGRGELNLKDDKKLNETPPQFMTVNVEEPISHVHRRYELQTPIVNNSR
                     LGQPANEGQKYVITSNDQSTEKEDKKKKQGKFSKLFKKK"
     gene            complement(<120261..>122636)
                     /gene="TPHA0C00640"
                     /locus_tag="TPHA_0C00640"
                     /db_xref="GeneID:11533976"
     mRNA            complement(<120261..>122636)
                     /gene="TPHA0C00640"
                     /locus_tag="TPHA_0C00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684607.1"
                     /db_xref="GeneID:11533976"
     CDS             complement(120261..122636)
                     /gene="TPHA0C00640"
                     /locus_tag="TPHA_0C00640"
                     /note="ancestral locus Anc_8.350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684655.1"
                     /db_xref="GeneID:11533976"
                     /db_xref="UniProtKB/TrEMBL:G8BR45"
                     /translation="MEEDGYNFDEEARKLFKFTELVLERSKHNNEYERALLESKFREN
                     YKSDFYNIKNLLINRMDLIPLDVMSNYVTEYSALKNINFKKECSMKDEVQTLNVPRTK
                     NDHIIISTKDFKNTLKESSPNSTMAVSSQKVDQRDIRTKQKKTHVDTEEKQRKPLDGS
                     FKDDAMLAESIIDDRKDINIIKLNAFLPESNILSNDPNNKQEKQAISTNGKMTPSATE
                     NSDISSISKDFTNRKDKIESVKMNSPKKDNSKVVDSLKAIQNNKEKETVNCLNDNSNK
                     ADFIHKNSTVSVNNSSSIQSTQLQPNITKDVTSNLEEQTSSIISYSISSPPEKQSQSD
                     QVKDNENPIFGTSTVPKPISEGHKVHLDAPYNKAYSSAYKQGETSEQQLLNKSFDILS
                     NSSQHQLTNTSIHSFSEPVNEQLPNSGSNNEFRSFKPSIENIISRPSKVLNTGKSTIA
                     TSVAAQDTGSLQVQDSKKEKASNQLPENGQRKEISNPCPVTNLPRSSEPLEVTQENKE
                     IETPKASQLSKNLETFQATETPKVTQGSRDTEMHEVSQSVPQAIGLPKTTKLLKDIET
                     SRVAQPLKSVEISKSLGTSKSAEVSRAIRAHKVTKKLKAIRKSKALQQPKSSHTYQRN
                     QLLETIPIPNTTNLHETTKATPATKASTTKKENPTPINLLTVKQSSIDVASGANTNNA
                     GTTTSGEVKILQQLMNIADNKLNLSDETRAQGKADKIEKNNGINFPIYNFNNYSKQNL
                     ESQSSKQMEHMDTPKHLFPTHANQSLESSGSSTNIKQIKKLYSLQVHLNLK"
     gene            complement(<123052..>125187)
                     /gene="TPHA0C00650"
                     /locus_tag="TPHA_0C00650"
                     /db_xref="GeneID:11533777"
     mRNA            complement(<123052..>125187)
                     /gene="TPHA0C00650"
                     /locus_tag="TPHA_0C00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684608.1"
                     /db_xref="GeneID:11533777"
     CDS             complement(123052..125187)
                     /gene="TPHA0C00650"
                     /locus_tag="TPHA_0C00650"
                     /inference="similar to DNA sequence:INSDC:YLR143W"
                     /note="similar to Saccharomyces cerevisiae YLR143W;
                     ancestral locus Anc_8.349"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684656.1"
                     /db_xref="GeneID:11533777"
                     /db_xref="InterPro:IPR002761"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR013813"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G8BR46"
                     /translation="MKFVALVSGGKDSCYNILHCLKNGHELIALGNLHPLDIDEQELN
                     SYMFQTVGHDIVSLYEKTTDVPLYKHYIRPHSSKYQKLNYVSTKDDEIENLFELLSKI
                     KTQHPDLEAVSVGAILSSYQRTRVENVSNRLGLTVLSYLWQRDQSDLMSEMCEVSKQS
                     ENEKSSKMDARLIKVAAIGLNDTHINMSLPVIYPIMMKLNKMYEVHICGEGGEFETMV
                     LDAPFFKKGHLKIISSELDTSDKNNGVYSTKLNTEFVEREISKEEFEENILLVKQPLL
                     LNEKWQSLITALENETCNTKVVRKRNEQVDPKSLEFHYNLSVNKVNNLMYISNILPTT
                     QDTSIEVQIKSLFQHLDKILIENNIKPSQILSSTLYLSNIRDFANVNKVYNDFFDIEK
                     NGPLPPSRACVETREFLPTGNLLQLSVIVDTEAELKEFSSRDNETMMINESKDGLHVQ
                     GISYWAPCNIGPYSQAIWKNNDRNMVSYISGQIALIPQSMTIVGSDEKILQSILSLKH
                     FNTIKETIVAEKSLQMKCFISDIDMVPIVSRTWDLYCSKMSYESELWSDKEDDNLECL
                     IIIKVSNLPRDALCEWGGVAYKVETLTDDLDCDSDSEDMSELAQKFRSTVTFDNSELL
                     LKTINIKHNESVRAYSTIFIDSLHNLSAMIRELTEKGSQIELYYELSTINFEFLDIVK
                     NSGNIAFNPVESIFDYNGNMHRFAVHATS"
     gene            complement(<125545..>127035)
                     /gene="TPHA0C00660"
                     /locus_tag="TPHA_0C00660"
                     /db_xref="GeneID:11533917"
     mRNA            complement(<125545..>127035)
                     /gene="TPHA0C00660"
                     /locus_tag="TPHA_0C00660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684609.1"
                     /db_xref="GeneID:11533917"
     CDS             complement(125545..127035)
                     /gene="TPHA0C00660"
                     /locus_tag="TPHA_0C00660"
                     /inference="similar to DNA sequence:INSDC:YLR142W"
                     /note="similar to Saccharomyces cerevisiae PUT1 (YLR142W);
                     ancestral locus Anc_8.348"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684657.1"
                     /db_xref="GeneID:11533917"
                     /db_xref="GOA:G8BR47"
                     /db_xref="InterPro:IPR002872"
                     /db_xref="InterPro:IPR015659"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="UniProtKB/TrEMBL:G8BR47"
                     /translation="MHQIPKSFPHYLAASATFNRTLFRYKHIAQHIRLVSKTSTNTNT
                     NTPYLNPMNFNPHNSTFTDNSTSSSNPNDTDVADIANQVQYLKTLPKSQLFSLFCIGL
                     VTTRSSFLNLVIKIFPYLPMWVIKFFVSKLYVGGNTINEVKKTALELRERGISNMMLS
                     LTIEDSEGLNASINVNKIIDQTIKSIHEVLKVNIVEQIEDCKSSGKNINDIAPGYIAL
                     KASALVPNSNDILFHFNNPMYKEKRQELIKNVDTITNEVFMLNQKLGKLYPQRKAPFL
                     VSTIDAEKYDLQKNGVYELQRIMFQKYNKAEYRLTSVVGTWQLYLKDSASDILKEEEL
                     ARKGNYKLGLKLVRGAYIHSEPNRNVIFDTKSDTDKNYDRVTLSVMDDMIKNSSNSAY
                     GHLMIASHNQKSQLAATELLQKPNTNEFTKTNVIMGQLLGMADMLTYELIKKHNVQNI
                     IKYVPWGPPVETKDYLLRRLQENGDAVRTENGWPLVKAIVKTVFSP"
     gene            complement(<128269..>130368)
                     /gene="TPHA0C00680"
                     /locus_tag="TPHA_0C00680"
                     /db_xref="GeneID:11533934"
     mRNA            complement(<128269..>130368)
                     /gene="TPHA0C00680"
                     /locus_tag="TPHA_0C00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684610.1"
                     /db_xref="GeneID:11533934"
     CDS             complement(128269..130368)
                     /gene="TPHA0C00680"
                     /locus_tag="TPHA_0C00680"
                     /inference="similar to DNA sequence:INSDC:YLR141W"
                     /note="similar to Saccharomyces cerevisiae RRN5 (YLR141W);
                     ancestral locus Anc_8.347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684658.1"
                     /db_xref="GeneID:11533934"
                     /db_xref="UniProtKB/TrEMBL:G8BR48"
                     /translation="MMKTRVKDEKLIESYIEIFNNSAIDFFNSPLRSEDQLRPSRVHF
                     KSEQGCSYSDYFKDVYKKSKDSEAPNNRKAILEKHKRTQKIELGTLWNSYEKTIFFHC
                     LERYSIHRLDDWHYKLPEKSKYEILTYYDLLKKNLDEMLKENKTALIKREDIPIAYEM
                     DEFYIKVEERITRIIPDRIGHAKKVVVNPFVEKPKRKLRRERRYQEDEEDDDDDEEEE
                     EEEEEEEEEEEEGASSVKEERNTTNKIQSEINTPEDEEEFINFENWNKKWLQIYSRSG
                     DEDITDLLIQKHNNTKPLEFTEKMYDYFKKIIYNHVKRLLYFIIIFKFDKRSISVREP
                     EDQNTDEDDADEDSVVVTYKDGKYPIVIEQQDVEKCLMLMLFNKREKKMTSIGENVLN
                     SLSKFNIELLKEPNKKLFIHNSILRTMLPSLVYNSLKPLPIPLNTVQEITQLKMKMRE
                     ERNVRSIEYGLNNLNKRILKRKLRKVPINKESQEHQDEEENEENEDEVRDENGETNDD
                     KVAFYFEIVDEEIDEKNLESYMNGKSKNIHKRNKKEPFVVDDKYDRINNPLEYVMCDW
                     ENHVLNEKDKAVSRMYQSALLNYLYSCIDPQQLNNTQYFTDDSEDSDTDEFRNEQDGN
                     NIINTGPYEIIATEEPENEETTDSNSTEDLEFAYDATTDNYGYHKFTTACPLPITSHQ
                     LKFFYHAICRCRQQIVK"
     gene            <130792..>133077
                     /gene="TPHA0C00690"
                     /locus_tag="TPHA_0C00690"
                     /db_xref="GeneID:11533823"
     mRNA            <130792..>133077
                     /gene="TPHA0C00690"
                     /locus_tag="TPHA_0C00690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684611.1"
                     /db_xref="GeneID:11533823"
     CDS             130792..133077
                     /gene="TPHA0C00690"
                     /locus_tag="TPHA_0C00690"
                     /inference="similar to DNA sequence:INSDC:YLR139C"
                     /note="similar to Saccharomyces cerevisiae SLS1 (YLR139C);
                     ancestral locus Anc_8.346"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684659.1"
                     /db_xref="GeneID:11533823"
                     /db_xref="UniProtKB/TrEMBL:G8BR49"
                     /translation="MIIKNIRRTLISRPLIDSQLSLSKKLYNRLHNVCYYSTIIDNEI
                     LQKEEGEEKNSEPKQEKDELEWEDNEITSSLERKVRKLQPNKANFVVLNPKQAGLLKQ
                     RKIPNYFNTLNSNSKISILEGVDIDKPFMRMNKDDVTDIQSINNETNREIESQTRKLL
                     VFKSKVSDEQILKSINYQKPYSNKMSQKRYDQIEQVLDSAYTLPQLRAYTKKYYNFGN
                     SRITKKKLIKTILNEYWKCEIVSSIIESDDLIKEKIIDISTRDMYLLLLTNNGKILQN
                     LTRIGAILAVALDENKIIVRATSPIIKYLEVSLNKILSNVSNEIIPVNEIIKNHTSYG
                     AKLITYEKTKDLISLIQKETGCFFEKQYEDALDDKSNDNTEKNVKDYLVSSLGPKRIT
                     EAKNLLLWVIDYKPQLSESVQNVSNPSMVYKQYPFSNFECLDWMNRNKKWYRLQTETL
                     ILPKGKTEYSEKNHHPKQILSISNEKLNDCFNSIKDNKENSMGMANLEIPDSNIFNNI
                     SLTLGHLLREKNNDKNYFFEPKVPNITKEVLKLELDHAITPSDSFYNIDQHDYYVQLK
                     FVPNLKDLAQYVGISKLDLPPLDLWFELDENDNALTDTLQSFLRLSEKRLYLESSNLH
                     HDYRIDNDRVASITKQYDENPDGWLNDQPGIKEFITNGNLSFGSKGKLVIPQTLPVTL
                     IVSTEDGIKKVDVNYEFISTSYHRILKLRYLDKYLVQLSHVNSGTRGGRYTQVDFIGD
                     GTELDNITKFKDFIENVSKWY"
     gene            complement(<133265..>134410)
                     /gene="TPHA0C00700"
                     /locus_tag="TPHA_0C00700"
                     /db_xref="GeneID:11535209"
     mRNA            complement(<133265..>134410)
                     /gene="TPHA0C00700"
                     /locus_tag="TPHA_0C00700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684612.1"
                     /db_xref="GeneID:11535209"
     CDS             complement(133265..134410)
                     /gene="TPHA0C00700"
                     /locus_tag="TPHA_0C00700"
                     /inference="similar to DNA sequence:INSDC:YDR161W"
                     /note="similar to Saccharomyces cerevisiae YDR161W;
                     ancestral locus Anc_8.343"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684660.1"
                     /db_xref="GeneID:11535209"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G8BR50"
                     /translation="MSDMQDVIEKARELLGENNAKEALSVLKPLKKKLKNPNDSILPL
                     MQIFIDVYLEKGDVEKAYPILSDACELDPTGSKGGSEKFFTFGQVTGGEDGIKIIYQG
                     IENISQEAGESISEEQLNKIVGGLLSMIEIWMTDLCMEPNAESQCEELIQKAMEISEN
                     RSPETWSMLGSIRISQQRFSDASNAFIQAWEYFEIKKQNIEKSLASNAIASHREYIEL
                     LQPLLALAKMCIEMGLYEIALKIISAVKDIEEDNLENYYLEGFVHYLLCKVTQFKATK
                     KDIEITAENIYEFNEHFEDIRIEINNPTLSDLINDSRIALTFVVKLGENVDKEDNVSQ
                     ELVAGANKLLKELGGAVDINTLMRSKKGENVEEADLELDLEVEEDEN"
     gene            complement(<135151..>137955)
                     /gene="TPHA0C00710"
                     /locus_tag="TPHA_0C00710"
                     /db_xref="GeneID:11533987"
     mRNA            complement(<135151..>137955)
                     /gene="TPHA0C00710"
                     /locus_tag="TPHA_0C00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684613.1"
                     /db_xref="GeneID:11533987"
     CDS             complement(135151..137955)
                     /gene="TPHA0C00710"
                     /locus_tag="TPHA_0C00710"
                     /inference="similar to DNA sequence:INSDC:YLR138W"
                     /note="similar to Saccharomyces cerevisiae NHA1 (YLR138W);
                     ancestral locus Anc_8.341"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684661.1"
                     /db_xref="GeneID:11533987"
                     /db_xref="GOA:G8BR51"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="InterPro:IPR013928"
                     /db_xref="UniProtKB/TrEMBL:G8BR51"
                     /translation="MAVWETLEPTKPHVAYAIVGIFSILFSLVSLFIKEKLYIGESTL
                     AAIYGLIVGPHCLKWFSPTTWGNTDSITLEITRIVLCLQIFAVAVELPRKYMLKHWRS
                     ITMLLLPVMTAGWLIIGLFIWIIIPGLNFPAGLLVSACITATDPILAQSVVSGKFAQR
                     VPGHLRNLLSAESGCNDGMAFPFIFLSLNLILHPGEGGEIVKNWICITILYECVFGCI
                     LGTFIGYVGRRAIRFGKEKNLVDRESFLAFYIFLSFCCAGFGSTLGVDDLLVSFAAGT
                     AFAWDGWFTDATAESKISTVIEVLLNYSYFIYFGAIIPWEQFNNGEIGTEVWRLIILA
                     IIVLFLRRIPAVVVLTKLIPDIKTWREALFVGHFGPIGVGAIFAAILARSELESSVSD
                     EETPLRQIPPKGTKHWQLISCVWPITCFFVVTSILVHGSSVALITLSRHLNTITLTKS
                     FSTHTTFGGKASWMSRLPQLENSGRSFSLQRVDTDAPEKSGKMSEMSRSSTVETSGIP
                     VRHAGGMRRLNKDQRKHKHIKKKRENFFSKHHKHFPDDELNDLGRERLQLEKEAAAGT
                     FALGGIRNHAPPSPVKGETVESTPSEENEKSYESQIDNGDKSSHTNSYQNSSSVRDYE
                     EKFDQDEDYQIKPIRIEGIDDQTSQSTDERVAQLSQVECKPVTAYVDEDNVIIENREG
                     EVLDHISLARSPDDEEAIKNYHGNEQTSIYSNQNLNKLTRIVSNASSKSFGAIKTAFS
                     PPPPDEKRNDNNKSRYYAYKVGDIVMIENADGEVLRRYRIKTKTDSSGQNENVLHKTL
                     SKLGLKNRREAISDQNLNKEQNDIAHSEDPFTKKMRRNLTPAPKNVSISREGSLIDED
                     LEETSIEEPDLQNFDTQSYNGSGYEMSINGEANDHNHSSDDNDDSYSSGEESETSIQK
                     IRRLAALGAVEDNGSNNNEK"
     gene            complement(<138826..>142920)
                     /gene="TPHA0C00720"
                     /locus_tag="TPHA_0C00720"
                     /db_xref="GeneID:11533629"
     mRNA            complement(<138826..>142920)
                     /gene="TPHA0C00720"
                     /locus_tag="TPHA_0C00720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684614.1"
                     /db_xref="GeneID:11533629"
     CDS             complement(138826..142920)
                     /gene="TPHA0C00720"
                     /locus_tag="TPHA_0C00720"
                     /inference="similar to DNA sequence:INSDC:YDR159W"
                     /note="similar to Saccharomyces cerevisiae SAC3 (YDR159W);
                     ancestral locus Anc_8.340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684662.1"
                     /db_xref="GeneID:11533629"
                     /db_xref="InterPro:IPR005062"
                     /db_xref="InterPro:IPR017173"
                     /db_xref="InterPro:IPR024293"
                     /db_xref="UniProtKB/TrEMBL:G8BR52"
                     /translation="MSSGFMNNLQDGRSTDFSKSGSQLKNKPMHKRKQSHESEFSKNN
                     GNTQKKNGPKKLMMVQNDAVKDKVIGSIMSNPSNFGFQKRNYKRRELPRFLLGQNPQL
                     KPRPFKQDPWDKLNQDKMTELENSIEDLTELYETLKKMRDNERKVMEKKGLVDKADFA
                     KDLNDAIVFQGTCQDMCPIFERARRNVEYTVYSYEKDDPNSKKASVSKALKVFARPAA
                     AAAPPLPSDVRPPHILVKTLDYLIDNLLPTLPASEGFIWDRMRSIRQDFTYQNYLGPE
                     AIDCNERIVRIHLLIIHIMVKSGNEFSLQQELEQLHKSLITLSEIYDDVRNAGGACPN
                     EAEFRAYGLLSKIRDPEYEKNIQELPDEIFKNELVQIALCFRKFISNSGFSERGFIRT
                     ESCLNFYTSYFQLMKSGNVPFLMNSFLEIYLNEVRFYAMKSLSHTLNKKSKPLSLDYI
                     KENLSFNSNEEIISFCDYYSIDVVNDGIDLKTLSHHSHRIPESKPLKQSYLNFVDNQL
                     QQQKYQHIINSGLPNIDSLPNVVSPLTVSVSENEFENDEEMELEDATMNQQVKSFTNS
                     KPFFGKAEDKNEVISSAPKKNSLLEEKLKALRKQGGNKFNLPNLKQSNVVDKDEVKLE
                     KIEEAKFSTSDIPIEAKFISETTPAISKPAIEFNLNSAFSGDSKKGPDESSTMMSSIF
                     NNNIANETLTPRPAIKESIKKLDSLENKTEGSSLKANSFQGLFKKDVQPKGNRFNETK
                     IEPSPISLHTKKSTTESELKKTQTIARKNLEDEKKSMIDSLSRKLYYAFIHEQCYLIC
                     NESKAEAHYINNKKKNYLNKWKRLLKNKQKEEEENKKRKEELLSVNKQLGVPIIRKVS
                     LLSTPTTRNVSSSSFRIPSSTMKRTVLSPVNNEKSSFNHNNQKGNTNDIWEQFDIEQI
                     YSNPIMKKCNKENIKSHSILLYSNNYSCVSTKWMLHKFGLFGDMNSRVIKGKDSSLTI
                     KKVGLQEPPSSLEESQLLVFNTGVTAANIFDLELKLKQDGEDLVKLASKISISTNIKF
                     SILIVYWESLETTFSENDITKFLKLPRISKSFESVLADIVVTRISNNFPEESLRRGLC
                     EISSKYSFQYTEKGLQSSEKGLSARSIAGIASNGGSNTSLNSKNIDAKMKKMLEYEKQ
                     KYNSERSKNNTYAHLQIHLAASPKMRKRKLPILFSEVQNGKFRTPSAISIDAISSSPS
                     VSSHLANKFRKTQQRIISAPDMVAPGTPSYINNLPRANLQLPLRLPSLEVTPVISRKV
                     TPNSHILATTMISGDTSNGALNHSVTSSATRWNTSNVITATPVVQTSTMHVPVTHKRS
                     TTPRHETFHGSIRTPSGGKTNSTRVSSLNNLRTLIDSVKKRAHD"
     gene            complement(<143513..>143956)
                     /gene="TPHA0C00730"
                     /locus_tag="TPHA_0C00730"
                     /db_xref="GeneID:11533938"
     mRNA            complement(<143513..>143956)
                     /gene="TPHA0C00730"
                     /locus_tag="TPHA_0C00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684615.1"
                     /db_xref="GeneID:11533938"
     CDS             complement(143513..143956)
                     /gene="TPHA0C00730"
                     /locus_tag="TPHA_0C00730"
                     /inference="similar to DNA sequence:INSDC:YDR156W"
                     /note="similar to Saccharomyces cerevisiae RPA14
                     (YDR156W); ancestral locus Anc_8.337"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684663.1"
                     /db_xref="GeneID:11533938"
                     /db_xref="InterPro:IPR013239"
                     /db_xref="UniProtKB/TrEMBL:G8BR53"
                     /translation="MMKPGRRFNISSTLNSPVVIHKRGRSQHLNKEEVLAFLDNFISE
                     KENLLENEFSLSAAQEGGDETAAGTGNKFDNNLTVSLAQLKRLQRDFKGLPPSIVIKT
                     PVNASTNAAPVEEEQEEQEESKDASGNIVTKSASGGSKMKFTDDD"
     gene            <144476..>145633
                     /gene="TPHA0C00740"
                     /locus_tag="TPHA_0C00740"
                     /db_xref="GeneID:11535265"
     mRNA            <144476..>145633
                     /gene="TPHA0C00740"
                     /locus_tag="TPHA_0C00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684616.1"
                     /db_xref="GeneID:11535265"
     CDS             144476..145633
                     /gene="TPHA0C00740"
                     /locus_tag="TPHA_0C00740"
                     /inference="similar to DNA sequence:INSDC:YDR153C"
                     /note="similar to Saccharomyces cerevisiae ENT5 (YDR153C);
                     ancestral locus Anc_8.335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684664.1"
                     /db_xref="GeneID:11535265"
                     /db_xref="InterPro:IPR001026"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:G8BR54"
                     /translation="MDSLSKKIQNLGMHDLRNAGRFMQNMIVQYEPYQIDVRRASNTD
                     AWGPTSKHLQKVLRHKYSVPLYLITEYTLKRLIDHIATNSKNVYEKARKEYVNFGSEW
                     RVVFKCLVILDFLLLNVNDGDELQQITSCLKKHKHILNKETMNYKIQFSNDGKMEIHE
                     QSIRTKCEVILSYLSEPEILNVERLKHKKNQMKIQRSNESAIMTNNINFDTNEIANNI
                     ANNNLEVEDSNDDEDEELQARVNYEHRRHTSTKIDEERRKRRELLKERIKNNEEQRRK
                     LSQSSMSANEVPDLLDFGDFDTTVSNSTNNNDFVDNLSNKEVNKDDDDEFGEFQSEMI
                     MNNTTLKIEDNKNNEDLLSGLSNDNAPEADTASVKKNDVFMDLFTNSKSLI"
     gene            complement(<145816..>146607)
                     /gene="TPHA0C00750"
                     /locus_tag="TPHA_0C00750"
                     /db_xref="GeneID:11533932"
     mRNA            complement(<145816..>146607)
                     /gene="TPHA0C00750"
                     /locus_tag="TPHA_0C00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684617.1"
                     /db_xref="GeneID:11533932"
     CDS             complement(145816..146607)
                     /gene="TPHA0C00750"
                     /locus_tag="TPHA_0C00750"
                     /inference="similar to DNA sequence:INSDC:YDR152W"
                     /note="similar to Saccharomyces cerevisiae GIR2 (YDR152W);
                     ancestral locus Anc_8.334"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684665.1"
                     /db_xref="GeneID:11533932"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:G8BR55"
                     /translation="MDYKEEQQQEIEVLESIYPDELTIINDNYPNIQFEVTLKLDVEI
                     GLGSLSKEHIITVHFQLPENYPDEPPIIRLKAQEISLKDDEEEEEEEEEREFDEHGNI
                     IVSKLENLPDKISFQKYMPVLESQIESQIESDMLIGMQMCFTLLSTTKDSCETWFRDE
                     LKTLEQEYEKKREEKEKEEQVKFNGTKVTKESYLAWREKFRNELKMDRKDHERREEAH
                     NGKLTGKMMFERNVAGTNDDIDEAEGEVENNDNEVNDIASSLKKI"
     gene            complement(<147219..>149531)
                     /gene="TPHA0C00760"
                     /locus_tag="TPHA_0C00760"
                     /db_xref="GeneID:11533958"
     mRNA            complement(<147219..>149531)
                     /gene="TPHA0C00760"
                     /locus_tag="TPHA_0C00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684618.1"
                     /db_xref="GeneID:11533958"
     CDS             complement(147219..149531)
                     /gene="TPHA0C00760"
                     /locus_tag="TPHA_0C00760"
                     /note="ancestral locus Anc_8.332"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684666.1"
                     /db_xref="GeneID:11533958"
                     /db_xref="InterPro:IPR003137"
                     /db_xref="InterPro:IPR007365"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="UniProtKB/TrEMBL:G8BR56"
                     /translation="MQLKAKEKPFDDSDMEKQNAIPKDKNMPRKSSRSLSILIFVVYF
                     FCLKVLSYSVHYLTTISSPCSDENIFDDNEAYFLEKLNQKNLAGNWSQVYTSIPHLAG
                     QGEVLVNFTISKFEEYGLKVEKESYDVLLNYPVDNGLKLVYDEKVVTFEATLKEDELA
                     DDPTTNGDDLVQSFHGYSASGNVTAQYVYANYGTKEDFEMLNKLKVDIKDKIVIVRYG
                     RIFRGLKVKFAQENGASGVLIYSDPGDDFYQEKDGYKAYPEGPARNPSSVQRGSVQFL
                     SQMPGDPTTPGYASIPGVNRKDPYNSIPKIPSLPVSFKEIEPILKKLNGFGVNAKDIK
                     GENWVGGLSEFKYFTGPNPEYTLNLYNKQSYDIRSITNVYGKLEGVLKDKYIIVGNHR
                     DAWIKGGASDPNSGTASMLETIRGLKSLTKAGWKPERTIIFASWDGEEYALLGSTEYG
                     ENHGKELMKNCLAYINVDVSVGGTNLQVSASPSLNKVLDSSMARVDYPGADKKTSLFE
                     HFYDTPDKKIGILGSGSDYTVFLEHLGIPSVDLGFESGENDPVYHYHSNYDSYHWMSE
                     VMDPGFKYHKSIAQFLGVIILKLSDQRVIQFGIHDYAVELSGYFTNLVEKIPKHWLSK
                     PLNKRQRCHAKGNAEDEMTVHDLVLKAVDNLSSLIANCYEFDLYAEDLNQQWKQAKRL
                     PIWKRVLLALRIEKVNLKYYYWERLFIVKEGLNNRPWFRHLVFASGRDTGYEGFALPG
                     MKEALDDKDFSEFSKWLQITAKKIELLNKH"
     gene            complement(<149987..>152203)
                     /gene="TPHA0C00770"
                     /locus_tag="TPHA_0C00770"
                     /db_xref="GeneID:11535237"
     mRNA            complement(<149987..>152203)
                     /gene="TPHA0C00770"
                     /locus_tag="TPHA_0C00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684619.1"
                     /db_xref="GeneID:11535237"
     CDS             complement(149987..152203)
                     /gene="TPHA0C00770"
                     /locus_tag="TPHA_0C00770"
                     /inference="similar to DNA sequence:INSDC:YLR135W"
                     /note="similar to Saccharomyces cerevisiae SLX4 (YLR135W);
                     ancestral locus Anc_8.330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684667.1"
                     /db_xref="GeneID:11535237"
                     /db_xref="GOA:G8BR57"
                     /db_xref="InterPro:IPR018574"
                     /db_xref="UniProtKB/TrEMBL:G8BR57"
                     /translation="MDFRTAQRNLELVNQNAEKDDLDDLEANVNTSIEMDEEIIGTQV
                     PLAMFSDDDIDPMDSANSSQHSQVFSQKLASNNEIRFDEVQLQTTDLALDNKNTAMTT
                     KIIDQVKDNLNLELSKGNDSDQNSIIIIPDGLHKAGSDPTDDNMDNLMNNNMNNNMDN
                     NMDKNIDSNMDNNMDSNMDDNMNDDTGDNIGDNRDEIFMNTQIQGRLDDFEKEKLLKS
                     SLKSTLNHFKYPRFDSPSIGNSKENIGELKKSPAKSRQSKLKLQKSNNDKKVSRAERV
                     LKLLSGKHSKVRDIISIQRNIEAKKTKASKTSQNSMKFDIYNEQEWKQITQLIFEAFP
                     KVKEFEMKEVYHYIYGEEQEVASGNMWEASQTPLLSLHEERKGDEYNYDKYIHRLPIY
                     SQPSNVDVVSLSQVMNDKSFSEFKFQSQSDEYVEVQDSTDDEVFEIIPMRSPSKSVIN
                     EVETENEMLKFPPILRPPSQKGDQPILDATTLIPNTNFFNGVIDLTQESFKAVNSLIS
                     PVKTDYIEATEITQVQVPASRNITLQRENQSNLDLNETHYNTVNLTQDNSITYQFYGD
                     RKKVLDNNFNIELIEKYQIEVGDSEDENNDDLIEPSIIEIKVRPNTPTSSPNKSVKEI
                     ITSQSMKKLRENMKTIGLKPLKSKEKMIEALTVASQVFDADDIGLHTQREEVYRHLTL
                     LVKQIPSLLEKIYTFEPVFIEDLVSQLADSSPFVEHIDEVTIREWADKQGICLRKN"
     gene            complement(<152599..>154395)
                     /gene="TPHA0C00780"
                     /locus_tag="TPHA_0C00780"
                     /db_xref="GeneID:11533798"
     mRNA            complement(<152599..>154395)
                     /gene="TPHA0C00780"
                     /locus_tag="TPHA_0C00780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684620.1"
                     /db_xref="GeneID:11533798"
     CDS             complement(152599..154395)
                     /gene="TPHA0C00780"
                     /locus_tag="TPHA_0C00780"
                     /inference="similar to DNA sequence:INSDC:YDR147W,YLR133W"
                     /note="similar to Saccharomyces cerevisiae EKI1 (YDR147W)
                     and CKI1 (YLR133W); ancestral locus Anc_8.328"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684668.1"
                     /db_xref="GeneID:11533798"
                     /db_xref="GOA:G8BR58"
                     /db_xref="InterPro:IPR007521"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR026712"
                     /db_xref="UniProtKB/TrEMBL:G8BR58"
                     /translation="MPKDTNEREPRTRSIGNVARSYRGASRSRSQSGNKSRRDSLTIL
                     SGPTRSIRTINIESDDDYSSTASPSTYSNHSDNETENPDSRDSMGSLSSKLQYLKLQG
                     DSGSSGASEALEVPFVKVTLDPTLPRDYLKKDILTIIDSLRIPKWHLRGSLGKNTIDV
                     DNLKLTQITGAMTNMIFKVAYPRLPSLLLRVYGSNNDTIIDREYELQKLARLSQHHIG
                     PSLYGCFENGRFEQFLENSQTLKKNDVRSWRISQRIARRMKELHTGVPLLRSERGSRP
                     VSLKLIDKWISVIEDVGATWLTEKSNVTDIIQAKDWDTFKKVVSRYEMWLLDPNYSKT
                     SEKLVFCHNDTQYGNLLFSSPMCETPDSGDYTPVAQNSSSSISSLFPSASNISLHEII
                     NPSKEDKIEDNKLIVIDFEYAGANPAAFDLANHLSEWMHNYNCDTPHKCEPQEYPSKE
                     QVLNFLYSYVSHLRGGAKTSIDEDVKNLYNSIIRWRAAAQLFWSIWAVIQSGKLVKEN
                     TTIVNKEEIGPGGEKYIIKTEELDDGLVKEESIQSEEIESLTGVDIGSFDYLSFCRHK
                     IALFWSDMIQLGLANKEDCTIQEAISLDTKFL"
     gene            <154961..>155779
                     /gene="TPHA0C00790"
                     /locus_tag="TPHA_0C00790"
                     /db_xref="GeneID:11533495"
     mRNA            <154961..>155779
                     /gene="TPHA0C00790"
                     /locus_tag="TPHA_0C00790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684621.1"
                     /db_xref="GeneID:11533495"
     CDS             154961..155779
                     /gene="TPHA0C00790"
                     /locus_tag="TPHA_0C00790"
                     /inference="similar to DNA sequence:INSDC:YLR132C"
                     /note="similar to Saccharomyces cerevisiae YLR132C;
                     ancestral locus Anc_8.327"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684669.1"
                     /db_xref="GeneID:11533495"
                     /db_xref="GOA:G8BR59"
                     /db_xref="InterPro:IPR027521"
                     /db_xref="UniProtKB/TrEMBL:G8BR59"
                     /translation="MDLLRDNYSDSDRDSDDEEKRAQDSDVVVPELSEAVLDKYNIAP
                     SVSRLYSRRDSQGMFNGFINIQYRTSTEMRMKLLHNIVKINSKCNTKLEPLFFTELGS
                     PAVLHISLSQNLFFQSQEQRNSFYRLLEQKIHTAEIRPFDVKFDARPIWFAPLDTKRK
                     TLFLVYKVEDLILESKFKPLQNCINRSLREIFPDKRIKEFEVSLNNLHMSIAKMLDTP
                     DTLIRKYNKKTMDPFLDPDEHAEEFMVLPSFTVKQIKCDVNRKVINIKLLHPQT"
     gene            <156349..>158391
                     /gene="TPHA0C00800"
                     /locus_tag="TPHA_0C00800"
                     /db_xref="GeneID:11533614"
     mRNA            <156349..>158391
                     /gene="TPHA0C00800"
                     /locus_tag="TPHA_0C00800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684622.1"
                     /db_xref="GeneID:11533614"
     CDS             156349..158391
                     /gene="TPHA0C00800"
                     /locus_tag="TPHA_0C00800"
                     /inference="similar to DNA sequence:INSDC:YDR146C,YLR131C"
                     /note="similar to Saccharomyces cerevisiae SWI5 (YDR146C)
                     and ACE2 (YLR131C); ancestral locus Anc_8.326"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684670.1"
                     /db_xref="GeneID:11533614"
                     /db_xref="GOA:G8BR60"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="UniProtKB/TrEMBL:G8BR60"
                     /translation="MEFGAFSDNWVNNQSELFGLGNYCVPKGNDSQQSKPKTKKKYPS
                     SLSAANMDNDLGNGMLSPSLDEFNVLMAPTPKDSERDLNDINWDQLNLDFSPFQKTLK
                     DFSVNQHPQQGKRVISGTAIFGFQNHDKSFQLPHSDFNAEEANDMQMDDDANLDPTDV
                     NTLLKQQRELRLALEQQKEANMELEKQLDSMKRQQSLSNSPELQQNQFTFNTLKVINT
                     LDEVEQMFNSGGDELLESPTKKQKKNINKNSMEHIPEHYRKSSSTLRKMGNLFEELNF
                     GMKDSSDDSLGVLHKTDSNIITYHNQLISPAFSTNFSPRNSNMDLSESITGDLNDGLK
                     LTNISAGSMVLGLGLHSDKKASVNVMSSIPGSTTNSPRKVSSPKRKSETSNAMDSNFV
                     NKFSSTSKLIFTSNKNNRESKKGTSEAVSNEEIDEVVNEASSPVLKSQAQLKSKIPQF
                     QLNLINSNGPDNLSPVKITRKLTTLPRGSIDIYVKELEGKMFECLYPDCGKTFKRRYN
                     VRSHIQTHLQDRPYKCDMPGCDKGFVRNHDLLRHKKCHEEKTFECPCGKKFNREDALI
                     VHRCRMICIGGKQYENIVIKRSPRKRGRPRKNESLTGTADKDNLDGNSSTKQGDLLQK
                     DVMGKLNLDTEKNVFLNKTSNFNMENPSLLLLSQESVKLEETEMAEFDNSNVNFDM"
     gap             158466..158485
                     /estimated_length=20
     gene            complement(<158582..>161395)
                     /gene="TPHA0C00810"
                     /locus_tag="TPHA_0C00810"
                     /db_xref="GeneID:11533670"
     mRNA            complement(<158582..>161395)
                     /gene="TPHA0C00810"
                     /locus_tag="TPHA_0C00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684623.1"
                     /db_xref="GeneID:11533670"
     CDS             complement(158582..161395)
                     /gene="TPHA0C00810"
                     /locus_tag="TPHA_0C00810"
                     /inference="similar to DNA sequence:INSDC:YLR129W"
                     /note="similar to Saccharomyces cerevisiae DIP2 (YLR129W);
                     ancestral locus Anc_8.324"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684671.1"
                     /db_xref="GeneID:11533670"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8BR61"
                     /translation="MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGAL
                     ENINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIK
                     IWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSH
                     KDAITGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTT
                     GTDSQIKIWNLDTSKENGSKIVEKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKT
                     VEIFRIRKQDEISRALKKREKRMKEKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKI
                     KAVSWTVAANSKIELVVTTSSNTIEYYSIPYEKRLPKNPSPSKLYTIEQKGHRTDIRS
                     IDISDDNKLLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFLPSGTLCVIGTREGQI
                     QLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGT
                     TDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLY
                     GHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESH
                     NFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWKE
                     TDDQVFLEEEREKELEEQYEDTLLTSLEEGSGDSAFKADIEDGMDESTSVRNQTMESL
                     KSGERLMEALELGFSEIEALEKYNKDYKQWEKKKAGEPPVKPQGNAILLAINRRPDQY
                     IMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMDDPEILKNRLALICKNLFIIVK
                     ANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFNIQGLKFIKQQWNLKHNYEF
                     IDEEDQKKQEEKNSKKRIFGTLA"
     gene            complement(<162176..>163107)
                     /gene="TPHA0C00820"
                     /locus_tag="TPHA_0C00820"
                     /db_xref="GeneID:11533454"
     mRNA            complement(join(<162176..162973,163105..>163107))
                     /gene="TPHA0C00820"
                     /locus_tag="TPHA_0C00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684624.1"
                     /db_xref="GeneID:11533454"
     CDS             complement(join(162176..162973,163105..163107))
                     /gene="TPHA0C00820"
                     /locus_tag="TPHA_0C00820"
                     /inference="similar to DNA sequence:INSDC:YLR128W"
                     /note="similar to Saccharomyces cerevisiae DCN1 (YLR128W);
                     ancestral locus Anc_8.322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684672.1"
                     /db_xref="GeneID:11533454"
                     /db_xref="InterPro:IPR005176"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR014764"
                     /db_xref="UniProtKB/TrEMBL:G8BR62"
                     /translation="MDSIVREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGG
                     FVHDVPREYPAELIELFERYNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLT
                     TLCLANVMGCNNLTDCITRNQFLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYI
                     YNYSFGLITEENMKSIQIDTAKEYWKLFFGDGTPLHIEKEQLDNWNKFLTISGKKTIT
                     KDEWKMILEFFKKFPTVTEFKDEYDPMDPWPYIMDEYHEYLEENGKLN"
     gene            <163528..>166056
                     /gene="TPHA0C00830"
                     /locus_tag="TPHA_0C00830"
                     /db_xref="GeneID:11535316"
     mRNA            <163528..>166056
                     /gene="TPHA0C00830"
                     /locus_tag="TPHA_0C00830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684625.1"
                     /db_xref="GeneID:11535316"
     CDS             163528..166056
                     /gene="TPHA0C00830"
                     /locus_tag="TPHA_0C00830"
                     /inference="similar to DNA sequence:INSDC:YLR127C"
                     /note="similar to Saccharomyces cerevisiae APC2 (YLR127C);
                     ancestral locus Anc_8.321"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684673.1"
                     /db_xref="GeneID:11535316"
                     /db_xref="GOA:G8BR63"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014786"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="UniProtKB/TrEMBL:G8BR63"
                     /translation="MQYTEVDSIVGNIYELVDSKSCGSSDDIDSLLDWLNPNDPKSNH
                     QLKPPTIRLKKVIKKILLDVNTLGDYDSIETLNSLLRYYYIFQVRLNFFSNLQSITYF
                     KDIIKLEKYYEFPILHVPIFLNNNYIWETELNKIRHYLLRTNLTFRSNLINRLKKLVK
                     EDDFDLAQEIIKWSNEANFSLLSSKQIILNALLDKITMYADKQFTNAWSQRFIIMETY
                     NKFINKYWSNFAVLLNCAEDDHEITKVLYKYFEKQFLRIRSEEIFDICVISYPDSKPT
                     IMELRGLLTQSKISTNILIRLLSEFQLKVLNLSIPTCTILIAYIKTVKSLLILDPTSR
                     YLQSFTSFTNPYLQQKSDIIYILLFAILDLRTDDIKTNPIVKVDQNLLKLLSEELRES
                     HFGINLNFSDVDISDNLENGNNNKNISQLDYAGQESSQLLYSQILNRALTWLPESKLV
                     SPNKSIKMMRKKNLLDILFAIFDDHELFLKRFVELLKQKLFVIKGYNLEESWVQCLRL
                     FKTKFSPNSLDDAPTSTNLETLTGNNDSMYMTNIDVMLWDMRGSKKLTEQMHLIDELD
                     NRINLKIISSLYWQYDMKNEKRKTYYGLLNKMDQTLFNQLDKYSKLYSRLKPGRVLNL
                     LTDQSTIEIDFNFEDNRTVTCECTFENYMSICPFLENEGTSSYTLEELSIITSFGLED
                     LKISLKFWLDQKILYFDGKTYRPLEYLDRSEIIIESPESNNVNSVMSITNNPLNGFAI
                     LGKGNDTIDRPSQENITKCTPDHDKTFNATSQEVSKIKEYVLSILTNLGEQNIEKLYN
                     VLQTTSHDTAIKKVSSVTLENIVTELVENGQILCLPNGLYQLPE"
     gene            <173318..>176320
                     /gene="TPHA0C00840"
                     /locus_tag="TPHA_0C00840"
                     /db_xref="GeneID:11535201"
     mRNA            <173318..>176320
                     /gene="TPHA0C00840"
                     /locus_tag="TPHA_0C00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684626.1"
                     /db_xref="GeneID:11535201"
     CDS             173318..176320
                     /gene="TPHA0C00840"
                     /locus_tag="TPHA_0C00840"
                     /inference="similar to DNA sequence:INSDC:YDR144C,YLR120C"
                     /note="similar to Saccharomyces cerevisiae MKC7 (YDR144C)
                     and YPS1 (YLR120C); ancestral locus Anc_8.318"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684674.1"
                     /db_xref="GeneID:11535201"
                     /db_xref="GOA:G8BR64"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:G8BR64"
                     /translation="MVAPILFALLFTQLTNVSAELIQFYDKKAAVIPFRKYYADSLEE
                     LDYNTSTSETKLVKRDGEDIVLTNRNTFYSAEIEVGTPAQTMNVIVDTGSSDLWVIGH
                     DNLTCPLASDGSFNCERFGSFSISKSSTFTKNSTEFAITYVSGNNCIGVWGQDNLIIG
                     GVNATGLSFGVVHTTTSSAGILGIGLPDTETTAVGQYGHYKYDNFPMVLKNKGIISHQ
                     GYSIYLDSSSSTYGEFLLGGVDTSKYTGTLYKLPLVNWYNTYFSSPGDFHVTLQGLGL
                     ITNSGSAVTLTETKMAVILDTGSTVTGIPATLYNALLSSLGGYYSSTHGAYVFTCPTE
                     TSKLVFNFGGINYKLPMSSFINTLGDNVCSLKVSSRSDSNFILGDDFLRNVYAAFDLE
                     NKEIGLAMADFDSSSNNKREDTVIAMESGIPDAVQAPEYSATWVTYEAVVTGGSMFET
                     LAENASSSEATSSSTSSEATSSSTSTEATSTSTSTEATSSSTSTSTEATSTSTEATSS
                     STSTSTEATSSSTSSEATSTSTSTEATSSSTSTSTEATSTSTSTEATSSSTSTSSEAT
                     SSSTSTEATSSSTSTSSSTSTSTSTEATSTSTEATSSSTSTSTEATSSSTSSEATSTS
                     TSTEATSSSTSTSTEATSSSTSTEATSSSTSTSTEATSSSTSSEATSTSTSTEATSSS
                     TSTEATSSSTSTSTEATSTSTEATSTSTEATSSSTSTSSEATSSSTSTEATSSSTSTS
                     TSTEATSTSTEATSSSTSTSTEATSSSTSSEATSTSTEATSSSTSIEATSSSTSTEAT
                     SPSTSIEATSSSTSTSAEASSSSEVNQSASLLPAEEIASISTVSSVSATSTAVISIEA
                     SSSEISSSKVTSTSTPASSTTPIASEVALFSNSTSTSTVTESNTLVTLTTTNAAASTD
                     AATTTAAATFVASESYYSEDAANASVASASSASRRHSIDALARTSTSAASGSSSTLSI
                     VEQHNGAMNMKTTSFFTVSFFFVAQLLF"
     gene            <177213..>179558
                     /gene="TPHA0C00850"
                     /locus_tag="TPHA_0C00850"
                     /db_xref="GeneID:11534112"
     mRNA            <177213..>179558
                     /gene="TPHA0C00850"
                     /locus_tag="TPHA_0C00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684627.1"
                     /db_xref="GeneID:11534112"
     CDS             177213..179558
                     /gene="TPHA0C00850"
                     /locus_tag="TPHA_0C00850"
                     /inference="similar to DNA sequence:INSDC:YDR143C"
                     /note="similar to Saccharomyces cerevisiae SAN1 (YDR143C);
                     ancestral locus Anc_8.317"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684675.1"
                     /db_xref="GeneID:11534112"
                     /db_xref="GOA:G8BR65"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G8BR65"
                     /translation="MSNENRDNRSGPADSNEPDGNSANRDTLPPTRNITVSIQYSYLF
                     PNGSRLNQSNMVNTNNMVQNNVTSTTATGTRHTATENETTTTSTDTPHLNDASFNPFA
                     MGVNLRQRSPDGAVILSFRDVPASTSQERLDNIISIAAEFAIRRFSDLQVPTRAITKE
                     QFETLPVLKLSDIVNENDKTCSICYDDLVDEDQVEEGADNKRKYSVDEEDDIKDQKKV
                     KTGPNNNRERPTEQLLDAVRSSTSAQNNTESETQTSRPASGVDTIQSEEDSPTYLHSP
                     TELPCKHIFGRECLYKWTRVQNTCPLCRHIIAESPVNAPPNAPDGNNGGTVDAFERIR
                     QLIYNTNPNDSVNPASSNRDTMSANDEQSNTTNNDNTNNSNDNNTNENLGNISAPPTA
                     ANTSTNTPGNSWFPAASGAAPFPFGNLNSFDTSVSRPGVVYLNGNNNPSSLPGFLPFD
                     FLNRQRSTAEASLNRTNATSSSNENPISSSNEAPATSSAENPNTTSTNSSAPGSSTDN
                     NTQRISWVPIPITFIQLENTGNTPLGTTPLASQTPAGGANNPTLDPNSTPSSSQQPVN
                     GDNTNPELTQSDRLRNILDHIFNVTASGRPIAPSLNGTQPFFSSTISGSPGLATSTAA
                     STSTARPTVPASTEANTNPPTSGITNNNQSRAQQAQSFLTDFLRFAVLPRRRTNPNEP
                     QTGTNEGSANSQTNNRPVSAETQPFFNTGVASYRNRDGEVSTYNISGSELPNPPSRNG
                     TENSAENASSSHGTSSNENASTSDNPNREPNEEPNSTENDN"
     gene            <180116..>181252
                     /gene="TPHA0C00860"
                     /locus_tag="TPHA_0C00860"
                     /db_xref="GeneID:11533458"
     mRNA            <180116..>181252
                     /gene="TPHA0C00860"
                     /locus_tag="TPHA_0C00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684628.1"
                     /db_xref="GeneID:11533458"
     CDS             180116..181252
                     /gene="TPHA0C00860"
                     /locus_tag="TPHA_0C00860"
                     /inference="similar to DNA sequence:INSDC:YDR142C"
                     /note="similar to Saccharomyces cerevisiae PEX7 (YDR142C);
                     ancestral locus Anc_8.316"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684676.1"
                     /db_xref="GeneID:11533458"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8BR66"
                     /translation="MILQYNIGGNSGYSIQYSPFFDNRLAVASGSNYGLVGNGKLFIL
                     DIDERGKIKENNIFITQDCLFDLSWNELHENQVLVAQGDGSLRLFDTTLQKYPIGIFK
                     EHKKEVLSCNWNLITKGTFVSSSWDGAVKMWSPLREQSLLTLLPKSSEQSSKINHNQI
                     AKIPPHVNNNQSTPILQNKDCVYQAQFSPHDNNLIACCSGNSYITLFDTREQNNRFNN
                     NSFIAHSGLETLTLDFNKYRPTVLASSGADNSIKIWDMRMIRNNNSNNTVMPTSNPIC
                     MNEIRKAHDLAVRRVVWSPHQSNLLLSTSYDMTSKVWKDFSFDGSKITGKTNSIDPGS
                     GLIKTFHHHTEFVFGADWSLWGQPGFIATTGWDSKVYIWNCFYP"
     gene            <181654..>186714
                     /gene="TPHA0C00870"
                     /locus_tag="TPHA_0C00870"
                     /db_xref="GeneID:11533784"
     mRNA            <181654..>186714
                     /gene="TPHA0C00870"
                     /locus_tag="TPHA_0C00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684629.1"
                     /db_xref="GeneID:11533784"
     CDS             181654..186714
                     /gene="TPHA0C00870"
                     /locus_tag="TPHA_0C00870"
                     /inference="similar to DNA sequence:INSDC:YDR141C"
                     /note="similar to Saccharomyces cerevisiae DOP1 (YDR141C);
                     ancestral locus Anc_8.313"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684677.1"
                     /db_xref="GeneID:11533784"
                     /db_xref="InterPro:IPR007249"
                     /db_xref="UniProtKB/TrEMBL:G8BR67"
                     /translation="MSQYLKPLSVDSKSTVVDAKQKKFEANVEYALQYFDTVAEWADY
                     IANLGKLLKVLQSWTPQFHNVKYYVPLPYQVSRRLTSSLLPSLPAGVHKKTLEVYTYI
                     FSKIGIEALSAECNIWVPGILPLMTYASMSVKSQLIELYDTYLTQVNITALQIIIKPL
                     LASLLTGIDDDSSEFQPLVFRLIETVRGRLNNDSLFWKSFFLILITNKEHRLGGIALL
                     TKKLPSLNAIPHKKATIAKSDEEKNIDETVLTKQKLMERGLSTLLPGTEDLVKEEPGL
                     LIRAFVSCMKQENDILIKRGILDLMVQRVHLDSPVIQIIISKENKELLLIECCKIMLS
                     RDMSLNRRIWNWLLGPNNYLSSNSSSKITNNSSEAGDGMKEQETSNSYFVKFGLDPIL
                     NSLRELMVRETTLPVCFNICTSMLDKYELSSLIIPKLFLPLMLATMRFQSNDQIMDLS
                     NSFLNSIDTDIIWTESYQYIINSDNFEYLDFLLSNLNFKNYEELTIRHLPLIFLTLFE
                     IQKNKKDRFLYDGKFINILMRLIELIPSKAFTPIDNIDILSESKNKADDVLTKLTEYY
                     KPTFFSNGENNIKDLTKSCFDLNTLTLLIYNDSYQLLSTCLNSNINTKKCFELYMAIL
                     DNLQGDTSIGKSEEYNYHTIKVCSLINQYLDNSNIDDETIYIINKFFIKHLASKISVI
                     ESNKLLKKIMQYLWNCLLMAPTKLDAVKCIDALADNIPPGYIEEQLAYSFIQETDIAN
                     KIFVLDLLWNHLDKDVIVLGRTVDLLLDYLFDKQSTFYLYASQWLQEIKNNNTIDKLY
                     DFILTKLLKFEFLNRNSLHELDDLEMFTYKIQSLINILETNEGEILEDLFTKQTKTYL
                     FDKNKETNTYSSLIINILIQLLKMSNNHHVESVRSSLILLDLLLNGEESNCKEIVIFL
                     LEMSSNYGSKGDFESESIAVSLINIVSKVLHESYANNVKLDIFEDNTIHLKYLDYLVT
                     SVPKMEGTLIISAYVKLLLESFAYFENSIFRIIVPLTGSIIECIQTLCSKTKESDKFI
                     MPIILLLNGLEKLLMNAYKKLEPTTEDSFFSATSVGSDFLQSMVSNVFISEGSSSSKN
                     SQGQYNVLFQSFKQILHCCLEVWESLSSLPGFSKSSGSKQLITYNSKRLNDKIIHLIY
                     SLFNLEPIETIECISTLQKDSIYSLLSSLMNTYEIDFGPFILYDITIICNKGSELHFS
                     INSDSTTINKISRNVNNHNSKISTKFLVKFLLEYILEVSDFKKDIFLKDLSIFFKHIS
                     NNYLKFEDISLELLQMYSIVAQEVGSGKIENNAVFKKDLSDTFIKYLPNAINLRTSDT
                     EEQLKMKFKTIKLVVSNIHLILDEKKESDKFQNCLSTIISIALQPIYKKLDFDSLPDE
                     FYELSLAVTINSNGDSLWNTIINNTYNNDKIFKSLELMHKLSPIFLIWSNYSTNKTNL
                     IATLLLGSDPMPLAIRPSVISFNSWNYSELDIKFIRILKISYLILINKNDNYLLSFKE
                     LIEYVCQSLLSHETKLKTASWILLRSLLFKYSESHFHEYWPLISYCLQTNLQDFYEKL
                     KLQVPIDANNVLQMAKSLDLLLLFNFEDFSATNEWLFIIDSINCISKEGPYMSLSDII
                     GESKEYETLSSTISPIKLSGPVNSLLLLGINNIDSHFRLKDFFKNISYFHYEYVYSLE
                     KVDMKPIEKDLIEDIFWA"
     gene            complement(<186826..>187494)
                     /gene="TPHA0C00880"
                     /locus_tag="TPHA_0C00880"
                     /db_xref="GeneID:11534085"
     mRNA            complement(<186826..>187494)
                     /gene="TPHA0C00880"
                     /locus_tag="TPHA_0C00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684630.1"
                     /db_xref="GeneID:11534085"
     CDS             complement(186826..187494)
                     /gene="TPHA0C00880"
                     /locus_tag="TPHA_0C00880"
                     /inference="similar to DNA sequence:INSDC:YDR140W"
                     /note="similar to Saccharomyces cerevisiae MTQ2 (YDR140W);
                     ancestral locus Anc_8.312"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684678.1"
                     /db_xref="GeneID:11534085"
                     /db_xref="GOA:G8BR68"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR004557"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BR68"
                     /translation="MLPTPYVTCDYEKVYEPSEDSFLLLDSLEDEQLFLKDRFKNKLT
                     VVSEFGPGTGIVLTFMMQNHIPTMGNSLYFGLDISPWAVKTTLETAKKNDCDKSYLDC
                     IQTDLGSNLRNNQVDVLVFNPPYVPAEKVPLVPADEKDIHTWLDLALEGGKNGMVVTQ
                     RVLDNLGNILSPDGVAYILFCAQNRPEEIVKDMIDNYSWKVELVKQRKAGWEVLSVYR
                     FSRR"
     gene            <187882..>188187
                     /gene="TPHA0C00890"
                     /locus_tag="TPHA_0C00890"
                     /db_xref="GeneID:11535208"
     mRNA            join(<187882..188030,188103..>188187)
                     /gene="TPHA0C00890"
                     /locus_tag="TPHA_0C00890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684631.1"
                     /db_xref="GeneID:11535208"
     CDS             join(187882..188030,188103..188187)
                     /gene="TPHA0C00890"
                     /locus_tag="TPHA_0C00890"
                     /inference="similar to DNA sequence:INSDC:YDR139C"
                     /note="similar to Saccharomyces cerevisiae RUB1 (YDR139C);
                     ancestral locus Anc_8.311"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684679.1"
                     /db_xref="GeneID:11535208"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8BR69"
                     /translation="MQIKVKTLTGKEIAIEVQGSDKVFHIKDLLEEKEGIPPSQQRLI
                     FQGKQIDDEQTVESANLIDGMQLHLVLTLRGGN"
     gene            <188665..>190770
                     /gene="TPHA0C00900"
                     /locus_tag="TPHA_0C00900"
                     /db_xref="GeneID:11534091"
     mRNA            <188665..>190770
                     /gene="TPHA0C00900"
                     /locus_tag="TPHA_0C00900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684632.1"
                     /db_xref="GeneID:11534091"
     CDS             188665..190770
                     /gene="TPHA0C00900"
                     /locus_tag="TPHA_0C00900"
                     /inference="similar to DNA sequence:INSDC:YLR117C"
                     /note="similar to Saccharomyces cerevisiae CLF1 (YLR117C);
                     ancestral locus Anc_8.310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684680.1"
                     /db_xref="GeneID:11534091"
                     /db_xref="GOA:G8BR70"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="UniProtKB/TrEMBL:G8BR70"
                     /translation="MEPDYQISSEQIVKDVLDKRKQKSQATKSNVDINIQDLEELKDL
                     QGRKRTEYETYLKRNRLDMGQWLRYADFEIQQHDIRRARSIFERAMLVDSSYIPLWIR
                     YIDTEIKNEFINHARNLLNRAVNILPRVDKLWYKYLILEESIGNIDITRSLFNKWISL
                     EPNVNAWDSFIDFEIRQKKWNEVRNIYSKYVLVHPQYRTWDNWFLFEKKYGTIELVRK
                     TYVFALDTLQSYLDVTNKDNEQIFDNLLGDIISIVIHFSSWEASQAEYERSRALIRFA
                     LEQWPEQKVLRDYQVDFEKSFGKDFENIESNIIRKRKQSYEHYLINNPRDYDTWWIYL
                     DLIEKYFVVELLDIYNQCVINSKPETMKKTIEFERYICIWIRYLIFVEKTGNDTELCR
                     TLYNDLISNIIPHKEFTYPLIWIMYANFEIRQDNISNARKIMGRAIGICPSDELFRSY
                     ISIEIKLKEFDRVRKLYEKYIEFKPNSEELWIQYAELESNLGDEVRARGILESALNSS
                     MNCFNKDSKNKLFKSLIEIETESGNYDKVRVAYQKYLRNSDFDKSIWIEYATFVLSTP
                     TEDQLKLLTNNSSNADSDEELEFSITEENINNARKIFEQGLMHTKLHNKESDRVFLFN
                     AYEQFEETYGDSLSKQALSSRLPVKSKIKFYENGIEKETFQYLFPDDNDTLEKEEEKK
                     PDISKMFKLAKEWESSQTG"
     gene            complement(<190926..>192425)
                     /gene="TPHA0C00910"
                     /locus_tag="TPHA_0C00910"
                     /db_xref="GeneID:11534093"
     mRNA            complement(<190926..>192425)
                     /gene="TPHA0C00910"
                     /locus_tag="TPHA_0C00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684633.1"
                     /db_xref="GeneID:11534093"
     CDS             complement(190926..192425)
                     /gene="TPHA0C00910"
                     /locus_tag="TPHA_0C00910"
                     /inference="similar to DNA sequence:INSDC:YLR116W"
                     /note="similar to Saccharomyces cerevisiae MSL5 (YLR116W);
                     ancestral locus Anc_8.309"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684681.1"
                     /db_xref="GeneID:11534093"
                     /db_xref="GOA:G8BR71"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:G8BR71"
                     /translation="MEEERGRLQYKNANPKLWGPSAVKNNETKVNNLPVNIEGNLTFE
                     QANIYQVMFRISEITTKIQNKEFVMPESRNRGVSPPPAYDNQGKRTNTREQRYKRKLE
                     EERHRLIEIAIKTIPHYIAPDNYKRPQNFQDKYFIPVAQYPGINFVGLLLGPRGRTLR
                     ELQESSKCKIAIRGRGSVKEGKNSNDLPQGAMNFSDPLHCLIISDTEEKVQNGIKACQ
                     NIVIKAVTSPEGQNDLKREQLRKLAELNGTLREDTRPCQLCGLLGHQRNECPSREDFT
                     VKVICNRCNMPGHVYRDCPNAQQYINVHQNSHYEGRYKREYDVEQGIDNMPYKRRYNN
                     EVHNEYRSRNSRIDDESNTYDNSQNISQDIYNPIGSVRNYTEDRSNSVYNSHNGIVND
                     HNRYTVSHSSQSLNRTSQIFLNKDEDNMQTYLSGISTPPGVSAPPGVSAPPGVSAPPG
                     VSAPPGVSAPPGVSAPPGISAPPDVSAPPGVSAPPGVSAPPGVSAPPGI"
     gene            complement(<192829..>195297)
                     /gene="TPHA0C00920"
                     /locus_tag="TPHA_0C00920"
                     /db_xref="GeneID:11535281"
     mRNA            complement(<192829..>195297)
                     /gene="TPHA0C00920"
                     /locus_tag="TPHA_0C00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684634.1"
                     /db_xref="GeneID:11535281"
     CDS             complement(192829..195297)
                     /gene="TPHA0C00920"
                     /locus_tag="TPHA_0C00920"
                     /inference="similar to DNA sequence:INSDC:YLR115W"
                     /note="similar to Saccharomyces cerevisiae CFT2 (YLR115W);
                     ancestral locus Anc_8.308"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684682.1"
                     /db_xref="GeneID:11535281"
                     /db_xref="GOA:G8BR72"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR022712"
                     /db_xref="InterPro:IPR025069"
                     /db_xref="InterPro:IPR027075"
                     /db_xref="UniProtKB/TrEMBL:G8BR72"
                     /translation="MAYSVTCCDDGSGTTVGTLLKFDNVTILIDPAWYSNSVSYSDSV
                     KYWSTIIPEVDLILLSQPTVRSLGAFALIYYNFYSHFISQIEVYSTLPVSNLGRTSTI
                     ELYVARGITGPYDSNEIDLEDIEKAFDMIQTIKYSQLVDLKSKFDGLTFVAHNSGVNV
                     GGSIFCLMTYTEKLIYAPKWNHTRDMILSGASLLDSAGKPISALLGATALITDFSNFA
                     STKSFKRKSKAFKDMLREGLYLNGSIVIPVEISSKFIDLLVQVQNYILDAKSQGQKTE
                     PHILLVSYSRGRILTYAKSMLEWFSSTLTKSWESKDTASPFDLGNLLHVVTPKELKNY
                     PGAKICFVSEVDLLINDVICRLSKLERTSVFLTSTNFEDSSVVSDMYSKWKLEKQNKK
                     VEEGQSIIYSESISIRTSEEKVLKKKDLEAFTKEIETRREKRKDLIVALVNESKKNKG
                     LTDMFRKNSALANTDIVEEGDDDDDDNDDDNDEVVPLHAIKTAVVYPVDTVISKTSLP
                     KNKMFQFQPSRTKTDDYGIMVDYKMFLPEEDITESYNKKRAVESGNGEDDPYDVSESL
                     KSYKRRRNGYSNDNVEPKISIDNIEYLETEKNPSKRKIIVPKVSVKCTFVFLNLESLV
                     DQRSASVIWPSFKIRTMVLFGPPENQNKTLENIFKKKDIDMTLMPLNDVIYFSTTIKS
                     LDISIDPELDELLKWQNIRDGHTVAHFTGRLIKEKAQNVKKLGKVTQDSLRTKLTLKP
                     LENRSRVNTGISLSIGDIRLAEIKRKLTKEKYLAEFKGEGTLVVDNTVAVRKLNDGET
                     IIEGPPSELYDVVKKSITEMLAKI"
     gene            complement(<195734..>198067)
                     /gene="TPHA0C00930"
                     /locus_tag="TPHA_0C00930"
                     /db_xref="GeneID:11533663"
     mRNA            complement(<195734..>198067)
                     /gene="TPHA0C00930"
                     /locus_tag="TPHA_0C00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684635.1"
                     /db_xref="GeneID:11533663"
     CDS             complement(195734..198067)
                     /gene="TPHA0C00930"
                     /locus_tag="TPHA_0C00930"
                     /inference="similar to DNA sequence:INSDC:YDR138W"
                     /note="similar to Saccharomyces cerevisiae HPR1 (YDR138W);
                     ancestral locus Anc_8.306"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684683.1"
                     /db_xref="GeneID:11533663"
                     /db_xref="InterPro:IPR021861"
                     /db_xref="UniProtKB/TrEMBL:G8BR73"
                     /translation="MFSSIDKIIQNNSKYLIESFRRILESKKDTVFCGPLRVEDFDKK
                     LLSIDWKFPDEFQFYGVENKDQYIDYCLSLAITDLITDDDESDDKRENETETIGILMV
                     LLDYRFLAKESWSDPKTWATSYFNLFSKILDLLNWPYQVSEFWPYVESRITWFKIGNN
                     LINENEFGSNTNLISYRLPLSTSLRKWNTKLNSILNDNNKIYNAQSYIMKFKFDKFLS
                     ELLPINEESNFNRSGSLYYENVNSRRDVAFNNNGSKLAPKDKFAQDYHLVKNKIFDNP
                     INLYFNLLETKGSLNNYLMPLLNDLLRVEDLFYNYKQKETKKLFLMNFQSNKNYPSNF
                     DIKNSNGMKTPSYLKLQTHGTKIRLKEWKNFMNQFSSSKLMISPSFLELSKLDTNFLY
                     YQMIKKNNDFFRKQFILQLCFVIGIFLQISESPEVRSFYVNSLQKDNPSKRISNMNEE
                     SNIQKSLVAFFKNLYETRIKAFYEEKDPKFMNILNLLINSDSQYLKAKIDGFKEFQLD
                     ETNAFQFHSIVVDRSFKKFGFIKLGNKDINTVWKIETGIDVIKENYVDPTKIYNELEN
                     KYESGGFEEETKTENDTIVKEWQTLRLLRSKYVFKFDSFDEDKGIKSLFDKSKKVESN
                     KKIEDIIDEMNTEIKEPHVKKLQEARLFMKKLNEKKRKLEEEHQESLGKKLKPDDGSA
                     SSQKDQSEKKRVTPEEEGEINKNKEAKEASDCDASNGEKNTNVTESTDKTSADEEIIS
                     TENDNDHLIVNPEEANQTREESASNNERGENQFYFKT"
     gene            <199183..>201468
                     /gene="TPHA0C00940"
                     /locus_tag="TPHA_0C00940"
                     /db_xref="GeneID:11535214"
     mRNA            <199183..>201468
                     /gene="TPHA0C00940"
                     /locus_tag="TPHA_0C00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684636.1"
                     /db_xref="GeneID:11535214"
     CDS             199183..201468
                     /gene="TPHA0C00940"
                     /locus_tag="TPHA_0C00940"
                     /inference="similar to DNA sequence:INSDC:YLR114C"
                     /note="similar to Saccharomyces cerevisiae AVL9 (YLR114C);
                     ancestral locus Anc_8.305"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684684.1"
                     /db_xref="GeneID:11535214"
                     /db_xref="InterPro:IPR018307"
                     /db_xref="UniProtKB/TrEMBL:G8BR74"
                     /translation="MSNNGNSIIGVCVVDFHHTRGPEVEYWCGLEDKVDSKLLWPNLP
                     FQALPDGSHSFQETFTYFTLLFNTKTNSSPESAVALGSEESSSKECTTLFAISCSQQL
                     KSNELINKDEDVVRSTVQKAIVVISYQPIYGQIKDKLSIVTNVFFSQKNFHDRKIIDS
                     LLDNLKLLFDYNNNNDSNKQEIKTSSNGTILNKKETSLYVGLNLRKIILDFKSNILLI
                     LKAILLEKKIIFYGNNVENLCNLQFGLISLIPNLISHLQNSGSPLLYDDNKDIAIVDS
                     FKSSDRDSVLKFLGFPLNVFEKGGLFSPYTPLQQLNDITDPRTNFFVIGTSNSLLSER
                     KSELCQIYVDTNDNSITMVDKSLQSLLQLSNNDKRWMEHLTSVVTETKNENDEEATKN
                     LQFQGSEDFIRWQFEEYLIGLLSSVKLSEFIKLNKNNERQLSSLNSELISSNPISLFN
                     ISWVNEWKKTQNYEIFFSSTDDRIFDLFQPKHIYNGPDPFKAFQQKLSATFQNLKKHN
                     NSSSSLLESKYSKTEPNNEITNVSEKENDKKSDSLSRVSSKSTQDSNKPFKDLPNRWA
                     AFKELFNKKKQSDNSSDECGGSQEDADDQSSSSSSSSSSTMSSSESSDTGNDSNIVPI
                     GLGIRNENEEEIKPEDIRESMNKLKLENDKHAIYSTEASDVNSENEEDNEDDKQIEVE
                     DNEDEEENNDNEVDVKSSNEKTDISKENIEDEDSLEAATESHDKEIKLNREPSKLINS
                     DAENQSDILIMTDDELKDEEH"
     gene            complement(201593..201665)
                     /gene="TPHA0Ctrna6R"
                     /locus_tag="TPHA_0Ctrna6R"
                     /db_xref="GeneID:11534116"
     tRNA            complement(201593..201665)
                     /gene="TPHA0Ctrna6R"
                     /locus_tag="TPHA_0Ctrna6R"
                     /product="tRNA-Arg"
                     /note="codon recognized: CGU"
                     /db_xref="GeneID:11534116"
     gene            <203282..>203581
                     /gene="TPHA0C00950"
                     /locus_tag="TPHA_0C00950"
                     /db_xref="GeneID:11533819"
     mRNA            <203282..>203581
                     /gene="TPHA0C00950"
                     /locus_tag="TPHA_0C00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684637.1"
                     /db_xref="GeneID:11533819"
     CDS             203282..203581
                     /gene="TPHA0C00950"
                     /locus_tag="TPHA_0C00950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684685.1"
                     /db_xref="GeneID:11533819"
                     /db_xref="InterPro:IPR005545"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="UniProtKB/TrEMBL:G8BR75"
                     /translation="MSEYVVVIKDHAGAEKLREQHGPEHFGNIPPLVDAGIVVCGGAM
                     FNEEGSPVGSHIQIVADSREQVLEMLKKDVFARENVWDLESAIIYKFDCAVRKPM"
     gene            <204061..>208632
                     /gene="TPHA0C00960"
                     /locus_tag="TPHA_0C00960"
                     /db_xref="GeneID:11533463"
     mRNA            <204061..>208632
                     /gene="TPHA0C00960"
                     /locus_tag="TPHA_0C00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684638.1"
                     /db_xref="GeneID:11533463"
     CDS             204061..208632
                     /gene="TPHA0C00960"
                     /locus_tag="TPHA_0C00960"
                     /inference="similar to DNA sequence:INSDC:YDR135C"
                     /note="similar to Saccharomyces cerevisiae YCF1 (YDR135C);
                     ancestral locus Anc_8.303"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684686.1"
                     /db_xref="GeneID:11533463"
                     /db_xref="GOA:G8BR76"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BR76"
                     /translation="MSSLLSDICQFCHSKEGWGPISKYGDFTQCFIDGVLLNLASLFM
                     IIFGTVELVKLIRKKHPGIKYRQDWLIFCRITLVLLQIVLTGIASLSLPHHKTKDMTI
                     ITQYSLSLMSLFVVLALHWIEFHRSKIANGVVLFYWLFEVIGNGVKVVNFWIRYEYEN
                     KFYFGERLFILVIFQTIVALSILLLEAIPQKKLKSYQAIQENLNKRKENPYDSANIFS
                     RISFSWMTSLMKTGYEVYLTESDLYKLPSEFNSEVLSTRFNGAWQDEVKHKAKPSIVG
                     ALAKTFGPKLLLAASLKFVHDILAFVQPQLLRILIQFVNAYSDSENEGSYSLPIIKGF
                     MIAIAMFSVSLIQTSFLHQYFLNSFNSGMNIRSALTSVIYQKALLLSNEATEVSTTGD
                     IVNLMSVDVQRLQDLSQWINILWSGPFQLTLCLISLYNLLGHSMWIGVFILGIMIPIN
                     SYIMRIQKKLQKDQMKYKDERTGLVNEILNNIKSLKLYAWEKPFQEKLEFVRNEKELK
                     NLKKIGVFNAMIAFQFNIVPFLVSCCTFAIFVWVEDKPLTTDLVFPALTLFNLLNFPL
                     VAVPITISAFIEASVSISRLYSYLTNEELQKDAIQRLPFVKQNGETTVKIGDNATFLW
                     KRKPEYKVALKNINFEARKGELACIVGKVGSGKSAFIQSILGDLFRVKGFASIHGNVA
                     YVSQLAWIMNGTVKDNIIFGHRYDPEFYEKTIKACALTIDLSILPDGDQTLVGEKGIS
                     LSGGQKARLSLARAVYARADIYLLDDPLAAVDEHVSKHLIQNVLGAKGLLKSKTRILT
                     TNKIPVLSIADSITLLENGEITEQGTYFDVMATEGSSLSKLITEYGKKKDSSESEAAK
                     DNVNSESDESSVNRELTVPIEDELRELDKLNDLKFIDEGKSLRRASFDTLGSMDFNDD
                     ENSDRREFREQGKVKWSVYIDYARSCNPRNVLIFISFIIIAMFFSVMGNVWLKHWSEV
                     NTVNNDNSHAAYYLFIYFTLGFASSLANLIQTIILWIFCTIQGSKQLHSSMTSSIFRA
                     PMSFFETTPIGRILNRFSNDVYKIDEILGRSFSQFFQNTIRVSFTIVVICSTTWQFIF
                     LIIPMAFLYIYYQQYFLRTSRELRRLDSTTRSPLYAHFQETLCGVSTIRGFAQQDRFI
                     HINQSRVDSNMMAYYPSINSNRWLAFRLEFLGSLIILGAATLSIFRLKNGSLTAGMIG
                     LSMSYALQVTQSLNWIVRMTVDVESNIVSVERIEEYSHLPSEAPLIIENNRPSEEWPS
                     KGAIEFKNYSTRYRPELDLVLKNINLKILPKEKVGIVGRTGAGKSSLTLALFRIIEAS
                     SGSIEIDGVNINELGLYDLRHKLSIIPQDSQVFEGSIRENIDPTQQFSEQEIWNALEM
                     AHLKPHILKMNEISPESENSDTNQSSNPLDAKITEGGSNLSVGQRQLICLARALLVPS
                     NVLILDEATAAVDVETDELIQHTIRTAFKDRTILTIAHRINTIMDSDKIIVLDNGEVA
                     EFDKPEILLTNKNSLFYSLCYESGVLKPN"
     gene            <209476..>210882
                     /gene="TPHA0C00970"
                     /locus_tag="TPHA_0C00970"
                     /db_xref="GeneID:11533662"
     mRNA            <209476..>210882
                     /gene="TPHA0C00970"
                     /locus_tag="TPHA_0C00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684639.1"
                     /db_xref="GeneID:11533662"
     CDS             209476..210882
                     /gene="TPHA0C00970"
                     /locus_tag="TPHA_0C00970"
                     /inference="similar to DNA sequence:INSDC:YDR132C,YLR108C"
                     /note="similar to Saccharomyces cerevisiae YDR132C and
                     YLR108C; ancestral locus Anc_8.299"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684687.1"
                     /db_xref="GeneID:11533662"
                     /db_xref="GOA:G8BR77"
                     /db_xref="InterPro:IPR003131"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="UniProtKB/TrEMBL:G8BR77"
                     /translation="MLEEGTQDLLPVDNIYNIQIGTQTFKISGLSLNSDAPSFFTDYF
                     IGKADKADQVMFVDRSANVFEKIYLHLQGYAIRVDNEMEYSLLFSDAVYYHLPKLLNF
                     LIESDSFFTNISGESFRIPKNLFSRKGDSPNYFHMTSIVDNINYKNYYERSVAERRPL
                     IIPAHFVSRSPEYFKDLLSLLTGASIKMNDERRESLIKECRYYMLLNLEQRLIKSKII
                     FNPLTNCEDIILNLSDLKKNGVELDAIQTSKVNSESTTPTTENEHDRCSDERSLKRAR
                     LNKNAETEKLWHIIEYKRPYLDDDKRSLIFQINTSETSIYINLDKKVIHLVMVGETKK
                     QFEQVFGPALDKAGVPLTDYKMRVPFSKFKTPEILALPACFTMCKLLVNDSDCPCIST
                     LITDLGKNQDIPWDKKRERIVDLTNMNELSCSNGLRVSCNKSLWKLGVNKDKLIVLGV
                     RAQVYSNNKEFCKSIDFL"
     gene            <211443..>212237
                     /gene="TPHA0C00980"
                     /locus_tag="TPHA_0C00980"
                     /db_xref="GeneID:11533957"
     mRNA            <211443..>212237
                     /gene="TPHA0C00980"
                     /locus_tag="TPHA_0C00980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684640.1"
                     /db_xref="GeneID:11533957"
     CDS             211443..212237
                     /gene="TPHA0C00980"
                     /locus_tag="TPHA_0C00980"
                     /inference="similar to DNA sequence:INSDC:YDR130C"
                     /note="similar to Saccharomyces cerevisiae FIN1 (YDR130C);
                     ancestral locus Anc_8.297"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684688.1"
                     /db_xref="GeneID:11533957"
                     /db_xref="UniProtKB/TrEMBL:G8BR78"
                     /translation="MLTDISNTVNSSTSKRSESLNHAGKGITDFKKNSLQKDPVRSIL
                     KSSRLFKSPEKLNNCKVSKKSTLHITPKKLASPECLRDYIPKVTRSVDYSDFRKMHEP
                     IIETNGTVTNVLFPTSPLKIRFSDSIKPIGGDGSLNRIRAKFKNGLMSPEKLIQRKGT
                     SIITSKARRNLFEEIQRESTSTTIDTNKIKTIQKSLNNGILKKEIQKGESPHKSVKFH
                     IPDNESDIRQQLNDINNLLNAILTRQDVLEKEISEIKRNNPNRLRE"
     gene            complement(<212339..>213577)
                     /gene="TPHA0C00990"
                     /locus_tag="TPHA_0C00990"
                     /db_xref="GeneID:11534117"
     mRNA            complement(<212339..>213577)
                     /gene="TPHA0C00990"
                     /locus_tag="TPHA_0C00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684641.1"
                     /db_xref="GeneID:11534117"
     CDS             complement(212339..213577)
                     /gene="TPHA0C00990"
                     /locus_tag="TPHA_0C00990"
                     /inference="similar to DNA sequence:INSDC:YLR107W"
                     /note="similar to Saccharomyces cerevisiae REX3 (YLR107W);
                     ancestral locus Anc_8.296"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684689.1"
                     /db_xref="GeneID:11534117"
                     /db_xref="GOA:G8BR79"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:G8BR79"
                     /translation="MVEETILGKSGGLRPLDMVNQPAMYTERYKMVKKLFSILKKVNP
                     NTKQALEGLSVQLESLVAKLSRSGQSYRFNMSVLIRDLLKFKGDLLDIKIAGKLLYGE
                     IDEKFLPKSKVVKEVINITKDEALKLLNSVLVPSEVLVKNNYIMDIYSDKKEFNVTGY
                     IPCSRCNTKFQKKDIMRKTICKYHPLKKQRSDKDREEIYPCCGKSSSSTCELRLGCKT
                     SDNHVFRYTNYNELSTITEFNHTKYVDGEKNVLALDCEMAFTSLGYEMIRLTIVDFFT
                     SQILFDEIVQPIGDIIDLNTQFSGVHEIDRSKHLTYNEVISKVIIKELINKNSILIGH
                     GLENDLNVLRIIHDNIIDTAILYSKGRYKTSLKNLSFEVLNRTIQTGEHDSSEDAIAA
                     MDVLKKKLGIPIVKKNWERS"
     gene            <214320..>229025
                     /gene="TPHA0C01000"
                     /locus_tag="TPHA_0C01000"
                     /db_xref="GeneID:11535210"
     mRNA            <214320..>229025
                     /gene="TPHA0C01000"
                     /locus_tag="TPHA_0C01000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684642.1"
                     /db_xref="GeneID:11535210"
     CDS             214320..229025
                     /gene="TPHA0C01000"
                     /locus_tag="TPHA_0C01000"
                     /inference="similar to DNA sequence:INSDC:YLR106C"
                     /note="similar to Saccharomyces cerevisiae MDN1 (YLR106C);
                     ancestral locus Anc_8.295"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684690.1"
                     /db_xref="GeneID:11535210"
                     /db_xref="GOA:G8BR80"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR012099"
                     /db_xref="InterPro:IPR025662"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BR80"
                     /translation="MMLKNQILLDIEDVKERYQIYVSTFPDLKLNSFYFIEENLPVTE
                     NLNNIAKSALQEENTVASMFVYYPIFLDIASRWLSEAFKDDKTLILGAYANIVTSLTL
                     ITPLLDEFLSKNNEHFVIILQNPSSQDPQIIQDILLAYYRILYYDRDTFIKYINSEII
                     YALLNSHSCESNGILKILSVQILSILLEMSEYSHVELLNQHLQESDSTIGVFNSKDNV
                     NYNYFSFNESNRLSEISSLPKVHEKYEITKGKKYITIEPEFLDSNVVSVFGKLIIKNG
                     KKETKNIKEEESNAANLFVPIERSIKALRQIATLVQDSEPVMLLGASGSGKTFIVNEL
                     AKFTGRSDSIIKIHLGEQTDAKLLIGTYTSGEKPGTFEWRSGILTNAVKEGSWVLIED
                     IDKAPTEVLSILLTLLEKRELIIPSRGEVIKAGTGFQLISTVCITEENNTAYNLKENI
                     PNIIGISKWKTINFEAPNNDELNTILVAKFSVLRNLIPKIILSYNSVKSIYTDPRFIS
                     LNKGAHARIVSVRDIVKLCHRLDAYFKQNNIIDPNQLIESSIYDNIFSEAIDCFVGAI
                     SEPKALEPFINVIGETLDIPPSRISLYLTNHVPIFENLDDKIHIGRSILPKTSISLQK
                     KSGNATSFATTNHSLRLMEQIGVAIQMTEPVLLVGETGTGKTTIVQQMAKLLRKPITI
                     INVSQQTESGDLLGGYKPVNSKSIAIPIQETFETLFSATFSMKKNERFYNLVHKCFNK
                     GHWKNLARLWKEAHKLSLSVLKVDNDSENEKEKNVKKRKLNQHDLSILSEKWQQFQDM
                     VEKFEAQSSSLESSFVFNFVEGSLVKAVRNGEWLLLDELNLALADTLENITELLNDSS
                     SRSLLLSEKGDTEPIKVHPDFRIFGCMNPATDVGKRDLPSGIRSKFTEIYVHSPDKDI
                     TDLLSIIDRYIGKYSASDEWVGNDIAELYLKAKHLSEENKIVDGANQRPHFSIRTLTR
                     TLLYVSDIVQVYGLRRSLYDGFCMSFLTLLDLKSENLLKPIIEQYTLGRLKNVKSVLS
                     HIPSAPGPGYVTFKHFLLKTGAYEIREQPHYIITPFVEKNMLNLVRASSSKRFPILIQ
                     GPTSAGKTSMIKYLADITGHKFVRINNHEHTDLQEYLGTYTTDDSGKLSFKEGVLVEA
                     LRNGHWIVLDELNLAPTDVLEALNRLLDDNRELFIPETQEVIHPHPDFMLFATQNPPG
                     LYGGRKILSRAFRNRFLELHFDDIPEDELEIIIRERCQIAPTYAKKIVEVYRQLSIER
                     SASRVFEQKNGFATLRDLFRWALRDAVGYEQLAANGYMLLAERCRTTQDKQIVKKVLE
                     KVLKVKLNMDQYYQDLEDEKLIQAPTSVVWTNALRRLAVLVNSCMKNNEPILLVGETG
                     CGKTTIFQILSKYLEKELIILNAHQNTETGDILGSQRPFRNRSEIQAKLVNLLNPYFT
                     NHNNSDFERMLLTFDKMDKSSIPEDVLKEVELLKVSANKLFEWCDGPLVHALKDGDFF
                     LLDEISLADDSVLERLNSVLEPERSILLTEKGSSDSFITANNGFQFFATMNPGGDYGK
                     KELSPALRNRFTEIWVPSMGDFSDVELIVESKLDNKLKELTKPIVKFSEWFGIRFGGG
                     NVSSGIISLRDILAWVEFINSTFIHIKDMLASLVHGASMVFVDSIGTNNTAYLAENEE
                     KLKIIKKECIEKLSKLVNKDLKSYLDTTPVLKISEDNVQIDLFNIKCNSSFSNSNSFN
                     TTAPTTAANLMRVVRAMQVNKPILLEGSPGVGKTSLVTALSELTGNKLTRINLSEQTD
                     LIDLFGSDVPGENAGEFVWRDAPFLRAMQKGEWVLLDEMNLASQSVLEGLNACLDHRG
                     EAYIPELDKSFVRHPGFLVFAAQNPQYQGSGRKGLPKSFINRFSVVYVDMLTADDLLI
                     IAQHLFPNIEQETCAKMIKLMSRLELEVCKQKLWGLSGTPWEFNLRDTLRWLKLMNKN
                     SITENTDAAYFVNMIITQRFRTHEDREQSRMICNEIFGEFTKKDSLLKLYPNYIQINN
                     TITERNPVYRSHVNKRLFSMQCNTDIYESVVQCVNNNWPLILVGPSNSGKTEIIRYLA
                     SIMGAKVDMFSLNSDIDSMDILGGYEQVDMVKKMTSVINDLVSMLKEIVVVNMTSLEK
                     DVMAISICFRILNYSKEKISKDMFTNIATLLEKLLNYNIIDEGLLIIKEKINNLLITL
                     NDQESVKFEWFDGLLVSAVEKGQWLILDNANLCSSSVLDRLNSLLEINGSLIINECSD
                     EDGQPRFIKPHPNFRLFLTVDPKFGELSRAMRNRGLEIYLDDLNNRMTTFDKKSLGKS
                     VRQLPLKAFTPCYLSNEIMYAQIYDTVSSFQDINIETLVTLTSLSLVYDIDKFSKNIT
                     NSDFRFKDEVKLYCDYIRFIREEQVPELMNSLVHNVKEETSNILGKKIFSLGNKDLFP
                     IINTYLEQFLNNNETNVYSKELIYMFTCYKMLYDNFLRLKYANEKSQNGKINELNYLE
                     LSAAHFNNRNIKRPPSIPIYEFLLSMNNLILSTIKNEKQITNSNMCYQLWNLLIILDS
                     IYASTEIKDEARLRVYKDQISSWIDKSNKKGINTESFRSLLDSFKNSMSLKQGQSINL
                     LWDAYRKVYPNSKVNWKIWNQLINLSKKFDKVVDLQFSESYSFIVELRKIFTLAAKDI
                     LDDNTSDTSVMLSELEEGIESLSDISSSFLRERSHYFRENFDSLSYFIFNEEVNIESI
                     QNIAPLTSLTTEQLIKLELKLYTYQPIFEILWRKKNDTYNSATRYLFTTDFIRSSVNK
                     SLLLESFSGNQLPQTLSDAKLLLQSSISSSELLLENKSERFGFYLSDWILSVINLHLK
                     SKLLSIKEPFIDDLIISEAERHFQECYKNYLKPAINILKTQYLLEELGEAWIMFGIGL
                     LVIYAPDFSYDPAVHDYVSYDIFERLKTTTLNISKSLEIVRHVTIGDSRIYAENLIEE
                     VPIEEKPNLPRVYRPRSSIDDLLDEWSFFIESTVSPEQVLKLRGALGTWSNTTSNRVD
                     MFNQNTSHFLHRLSSRYQIYGDINDIFSGYIFSIKFGIDLLAQSKKLNNKNLKISPLW
                     SVKPDVLIDNSSLSTIYQMFMNKAKNVTENNLDVEKILTFFMSLFNLHEKNISLLPTF
                     NDVLYLLYTRWTLRRIKSEQEQQEKSSMFKYQDKSFDVEAEFKQMFPTYDGDMDLDTV
                     TLLLPNDDLSDIQYSLAKSYMMLFTDGNSDISKIVRSGASINEAYNTILSIDSTSGIN
                     SGSLASMILLLGQEINKFKIENNEKSLDFYRNSSVSESQKAISVINGLWTSVNELLKQ
                     WPDHATLNELDRICKEFLEFPSNTPLARQIQKIEQIYTFVVEWEKYAASKVSLSNHST
                     NITNLIVSWRRLELSTWNGLFETENEKLEKNIGKWWFYLFEIIIVSGYNQNENGDDSY
                     VSLLTSLNTFFTKTTYGEFSIRIQLTKAFLNHLKMLSPLNPQLIQALSNSIRYYEQFE
                     SLISEHILKARKILDKEMKEIILLASWKDVNIDALKQSSRRSHNSLYKIVHKYRNVIS
                     GDVQTLIEAGIPFTQKVKAFNKEFKVPKFADIDIEACNSIVVNLPSWNERSGILKDMD
                     LVNKNMASYVGKISKLSFPNFKDLVKSYFHEAELLKSETPSTLTKENKKLIATLRNQK
                     AKLFSDVLKELRRIGLKTNFRKDIHSVQSSATAILSNSVSFEGTDLENCDKYYFRIID
                     LLPRLRSAVSSPSEDIPIANIERGMAISENLVFSLLTIRSRGAQLSTEYRNFKTLYSD
                     IETIHFSSGSLKHNIISHNLSTYKNICKWLPVLIDYSIATLKSTPSVFSVEHEIEYLK
                     DVKSEILSNFYDKINANRVCDDHVASLLEEFKVYLLNVNKKLNAMKVKDHGFIYDIIT
                     NWLVSSLISDTIVESSQLSINLIDNDFRKLHTSIMVSIQKIMSLELMPITEDDDKWLQ
                     ISLQRLMKLMQTLNFSKVTANMNIIVERLKSASLSNTESILLKSLIGFTMPLIRQYYK
                     TYTSLLKLFATFYDELAYCSFTLATMLYNLAKNGFCSPDLPSEEKDDNNLQEGTGLGD
                     GSGAQNNSKDIDQDEDLTEDAQTANGDKDNKDDDDKNDDDDAVDMEGDMAGDLEDLSD
                     QQNSDMDDEEDDEELELDEEIDDLNDDDPNAIDEKMWDEEASENSKEKNSEQNAGPEG
                     DDDDVEANEKPEDNNKNNESSSKDEDNIKEEASDSETNEDVDDPTNDNDGDDDSAEED
                     VGEQEDEVRDDEKKGLETNAPEVETMDLPEDINLDSDLDEENESATEESGNELGDTSN
                     EEEDIGDDDNNENVETEIKEEGADSDIDEENVNSDIEEENNVAENDDNNVSDMDVDDA
                     EEETNQNSESEDDLIDKDTKGDEENKEMAGENTSEGLDGLEEEIKAEDVDTEAAVQQQ
                     SGSKGEGSDSKNEEEQENIGSFGESKEQQQESEKNEDTNEASREEAKETLKQLGDSLK
                     EFHRRRQEIKENTNNGEDINDNNSKNENINELEHVDGANTNDDTQAMGAANQEDVQPF
                     NDDLAIDQGDEDNVKEDVDMKQEEELLEDHDTEMRHNDDSVDTNEQNNENLESKGGFI
                     GEKKDFGMNDPFVSNHLIDEEKDDLDILLDAVDKEVKSLELVETPLRSIEESRDLWRK
                     SEINTAELVARLGEQLRLILEPTLATKLRGDYKTGKRLNMKRIIPYIASQFRKDKIWL
                     RRTKPSKRKYQIMIALDDSKSMSESKCVNLAFDSLCLVSKTLTQLESGGLSIVKFGET
                     TREVHSFGQQFSNESGIKTFQWFGFQEGKTDIKKLVSESIKIFEKNASFDGGDEWKLQ
                     IVISDGICEDHETVQRLVRRARERKIMLVFVIIDGISSNESIMDMGQVNYVPDKFGNT
                     KLEITKYLDTFPFEFYVVVHDVTELPEMLSTILRQYFSDLASS"
     gene            complement(<229195..>229614)
                     /gene="TPHA0C01010"
                     /locus_tag="TPHA_0C01010"
                     /db_xref="GeneID:11535195"
     mRNA            complement(<229195..>229614)
                     /gene="TPHA0C01010"
                     /locus_tag="TPHA_0C01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684643.1"
                     /db_xref="GeneID:11535195"
     CDS             complement(229195..229614)
                     /gene="TPHA0C01010"
                     /locus_tag="TPHA_0C01010"
                     /inference="similar to DNA sequence:INSDC:YLR104W"
                     /note="similar to Saccharomyces cerevisiae YLR104W;
                     ancestral locus Anc_8.293"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684691.1"
                     /db_xref="GeneID:11535195"
                     /db_xref="UniProtKB/TrEMBL:G8BR81"
                     /translation="MRLTTFIYSLVAYSLIFIPFTNAFFNFGGGHNAGHGQRNRENTA
                     AQGSYEDRYLANNCQGYLCPDTLECVSYPSDCPCPFPASQLKCGLPDGNYICISKPAS
                     KDDAVNNIYDNPNQNSQFKMEGMRDCGWVLDEYYGKL"
     gene            <230555..>232594
                     /gene="TPHA0C01020"
                     /locus_tag="TPHA_0C01020"
                     /db_xref="GeneID:11533621"
     mRNA            <230555..>232594
                     /gene="TPHA0C01020"
                     /locus_tag="TPHA_0C01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684644.1"
                     /db_xref="GeneID:11533621"
     CDS             230555..232594
                     /gene="TPHA0C01020"
                     /locus_tag="TPHA_0C01020"
                     /inference="similar to DNA sequence:INSDC:YLR103C"
                     /note="similar to Saccharomyces cerevisiae CDC45
                     (YLR103C); ancestral locus Anc_8.292"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684692.1"
                     /db_xref="GeneID:11533621"
                     /db_xref="GOA:G8BR82"
                     /db_xref="InterPro:IPR003874"
                     /db_xref="UniProtKB/TrEMBL:G8BR82"
                     /translation="MYYNTDQLKDAYNKILRNSSSHSSCQLVIFVSCLNIDSLCAAKI
                     LSLLFKKQLVQLQLVPVFGYSELKSHYNKLDLNINSVIFIGCGGGIDLEEFLEIDTEA
                     FVMDSSESPDMLARYSRNLYVLDTKRPWNLENIFGSKMINCFDDGTIDEQLGEQKDAY
                     YKLLELDNNILQEEVDNNGELSEDEVATDNDGDGNANDNSNNNDDEKETDDGEQNDDE
                     DDDIGLSFNASKDISSLSKKQKRKLTNDLSLVLEEYYSQGTTTVNSLSMQIYSLLSAL
                     GETNLQYLWLTILGATSLNVSYPQVYNRLFPILKDEVNRLSLNTQEHSSLKKTADKLT
                     IDIQPDYYLFLLRYSSLYDSFFYSNYVNAKLSLWNENGKKRLHKMFARMGIPLKTAQE
                     SWTYMDNSIKRQLRDIFDKNLVRYGLQDIVKDGFVRTYGYRGSISASEYVEAITSLLE
                     VGRSIQPSKPKTSDVTPYMGGEYDDNTNTDDEGNSPGHNSNVSSTSTNEKVWVSNFWL
                     SWDTLDDRNTQLFKRGIKHSKILQKSVFNTGITILEKKLLKNLRIYRLCVLQDGPDLE
                     LYSNPLTLLRLGNWLIECCAELEDKQLLPMVLASLNESTDTYLVAGLAPRYPRGLDNL
                     QSKKPLLNNFTMAFSQITRDTGAMIKIDNFESSIIEIHREDLSPFLEKLTLSGLV"
     gene            <233002..>233859
                     /gene="TPHA0C01030"
                     /locus_tag="TPHA_0C01030"
                     /db_xref="GeneID:11535258"
     mRNA            <233002..>233859
                     /gene="TPHA0C01030"
                     /locus_tag="TPHA_0C01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684645.1"
                     /db_xref="GeneID:11535258"
     CDS             233002..233859
                     /gene="TPHA0C01030"
                     /locus_tag="TPHA_0C01030"
                     /inference="similar to DNA sequence:INSDC:YLR102C"
                     /note="similar to Saccharomyces cerevisiae APC9 (YLR102C);
                     ancestral locus Anc_8.291"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684693.1"
                     /db_xref="GeneID:11535258"
                     /db_xref="InterPro:IPR024274"
                     /db_xref="UniProtKB/TrEMBL:G8BR83"
                     /translation="MYNTNSEGDSSKHNTGRHTFQLPSLPPWKTPQYRKLKESGSSTL
                     STPLNRVDKKITRKGYNLESDMNNELGIEIDGSNQEHQSQKNRRYINSSGFGISNNSE
                     ANSTEYDFQTFSLKFQLQETKKNNILRSERAAHCLVFHKSAHNYNKNEYRPDLYFDCG
                     ENLDKSSNLLHMKSSQETYDESNALLLESLPGYTNSEIKKGSIKKLSLERPNVRRIEE
                     ILNHETNALNKFWDNSQLTESFERNQLHEHYLILKQEQEELKKIKEDITKKMNPTQES
                     WLRKIVSQK"
     gene            complement(<233960..>235000)
                     /gene="TPHA0C01040"
                     /locus_tag="TPHA_0C01040"
                     /db_xref="GeneID:11535322"
     mRNA            complement(<233960..>235000)
                     /gene="TPHA0C01040"
                     /locus_tag="TPHA_0C01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684646.1"
                     /db_xref="GeneID:11535322"
     CDS             complement(233960..235000)
                     /gene="TPHA0C01040"
                     /locus_tag="TPHA_0C01040"
                     /inference="similar to DNA sequence:INSDC:YLR100W"
                     /note="similar to Saccharomyces cerevisiae ERG27
                     (YLR100W); ancestral locus Anc_8.289"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684694.1"
                     /db_xref="GeneID:11535322"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8BR84"
                     /translation="MSGERKIAVVTGTNSNLGLNIVYRLIEKEDPNINLTIVVTSRTL
                     PRVRETIDEIKKFVEKLNRPADVDYDYLLVDFTNMISVLNAYNDLKKYKAIHYFFANS
                     ALALNEGIDWVAATKQSLTAPLEAVTSPNYRIQKVGVKSKDGMGMVFQANVFGPYYLI
                     QKILPQLSAGKAKIVWISSLLSKPEYLSFEDMQMIKSDITYEGSKRLVDLLHSATYKD
                     LASRSITQYLVQPGIFQSNSFNQFLNVFTYYGMLLMFYLARYLGSVWHNIDGYRAANS
                     PVYVATLSDDTIKDQMLKYGSATSWDGNGFIKTQEIDTTGAEDVRKYIEDLKLEWDEK
                     LKDQIVNTRIPI"
     gene            complement(<235500..>238874)
                     /gene="TPHA0C01050"
                     /locus_tag="TPHA_0C01050"
                     /db_xref="GeneID:11534103"
     mRNA            complement(<235500..>238874)
                     /gene="TPHA0C01050"
                     /locus_tag="TPHA_0C01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684647.1"
                     /db_xref="GeneID:11534103"
     CDS             complement(235500..238874)
                     /gene="TPHA0C01050"
                     /locus_tag="TPHA_0C01050"
                     /inference="similar to DNA sequence:INSDC:YDR128W"
                     /note="similar to Saccharomyces cerevisiae YDR128W;
                     ancestral locus Anc_8.288"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684695.1"
                     /db_xref="GeneID:11534103"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR025651"
                     /db_xref="UniProtKB/TrEMBL:G8BR85"
                     /translation="MTGYVDDNSYSSPTFGQYLSLRVDGGFNAISINPSGRDIVLAGR
                     QGLYIVDLDDPFSQPRYLQHRTPWQVADVQWSPHPAKPNWVVSTSNQKAIIWNLERNS
                     SNAIEYSLHGHFRAITDINFNREHPDILATCSLDTYVHAWDLRSPSRPFYTTSDWISA
                     ASQVKWNFKDSNILASSHGNNVCIWDLRNGSVPLKTLKGHTGGVNSVDFNRNKKTELM
                     TCSNDGYVKFWDYSKQNDPCIKSVAANFPIWRGRYLPFGDGYCIMPMVGGDNSVYLMK
                     LSSETDDSDNSDQIEPVSILKGHNDTVLDFIWRSRYHSDSVTDDREFQMVTWSKDNDL
                     RLWPMSNYIYDKVNFVRGKRLEEKLPNYEYVSYNKEPDSIQEVYIKNKRLLKEHFTSR
                     IKENNDQKHINWIAGVRMNDLGISDSLYKDRKFQNFGEEVSAIGHKFPKLGFEKISVS
                     TGDLVITLRGPWVEEDPNEYIFIRLIITIPPEYPSPSKYPKFTIEENSKLTKTKMYEL
                     NSMLKEICKKYTNLNFYCLEPCIRFVLGETINLDSIEELEAPLLNYAISDHIGQDDIS
                     SLTSDSGFSDYFDESEESDQELGDKENLTNRIDKLNSFQNLNTLDSTPIPNQCGMTWS
                     PDGQLICFFSDHVYSGNNKLVTNKYKTLALAEDNNIVNDDLNLENDAQRPEAPKRYVD
                     TIVTNTSTTNDKIVTDDESDSADSINSISHDWDNILRNDSILRTHIPNFESGFYKVFG
                     SPSASEADPGATSKTQNTIIFQDYSHLIPDKRQLALEYRFIDGTGEEMTMHNASVAGK
                     YGYDAISHCWQILSDYIISQKLNDPYSVSWDSNPLGLKWFIKELLTYFEKEKNLQMLA
                     LISCIVASQNNSSKVLKSDKSSGEPLPANVESIISFNNNSYENLSKLDRYSQYSDARG
                     DNPSEFHFRTKRYDNIDNMSIQSDDYFNFRTHSEKLKRKGMWGNDSSAATLAQSITPT
                     LTTSQKIPEIKVELLNDDILDAIDNRQAPLFDDADVIKMKSYIFQYSKLLFHWGLTIE
                     HARILKVNIDNKAIPSTKELQYDGFDTCWINDTETKKNCLHNCNFCDLKVTRNIFICG
                     SCQHLMHTTCAQEWWLMEDECPSGCGCRCPEVFDAT"
     gene            complement(<239272..>244008)
                     /gene="TPHA0C01060"
                     /locus_tag="TPHA_0C01060"
                     /db_xref="GeneID:11535313"
     mRNA            complement(<239272..>244008)
                     /gene="TPHA0C01060"
                     /locus_tag="TPHA_0C01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684648.1"
                     /db_xref="GeneID:11535313"
     CDS             complement(239272..244008)
                     /gene="TPHA0C01060"
                     /locus_tag="TPHA_0C01060"
                     /inference="similar to DNA sequence:INSDC:YDR127W"
                     /note="similar to Saccharomyces cerevisiae ARO1 (YDR127W);
                     ancestral locus Anc_8.287"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684696.1"
                     /db_xref="GeneID:11535313"
                     /db_xref="GOA:G8BR86"
                     /db_xref="InterPro:IPR000623"
                     /db_xref="InterPro:IPR001381"
                     /db_xref="InterPro:IPR001986"
                     /db_xref="InterPro:IPR006151"
                     /db_xref="InterPro:IPR006264"
                     /db_xref="InterPro:IPR008289"
                     /db_xref="InterPro:IPR010110"
                     /db_xref="InterPro:IPR013708"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013792"
                     /db_xref="InterPro:IPR016037"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018508"
                     /db_xref="InterPro:IPR023000"
                     /db_xref="InterPro:IPR023193"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BR86"
                     /translation="MVPLVKVPILGKESIHVGYNISGNIISTIINHCKSSTYVIVNDD
                     NILKVPYFQEFSENFESSLPDDARVLKYVVTPGEASKNRHTKEEIEDYLLNEGCTRDT
                     VIIAVGGGVIGDMLGFVASTFMRGVRVVQVPTTLLSMVDSSIGGKTAVDTELGKNFIG
                     AFWQPEFVLVDIKWLESLPKREFINGIAEVIKTACIWNADEFQRLENNANAFLDVVNN
                     QKKIKVENKNTGKIDEISNTNIELILEHTYKLVLESIKVKAEVVSADERESSLRNLLN
                     FGHTIGHAYEAILTPQALHGECVSIGMIKEAELSRYWGILSPTQVVRLTKILSAYGLP
                     ISPDEKWFKELTINKETPLDTLLSKMSIDKKNDGSKKKSVILESIGKCYGKSAHVVSD
                     EDLRFILTDEALVYPFTASENKKDLVITPPGSKSISNRALILASLGEGTCRIKNLLHS
                     DDTKHMLKAVEDLKGAKISYEDNGDTVVVQGFGGSLEACEEPLYLGNAGTAARFLTTL
                     AALVNPTSKNDYVVLTGNARMQQRPIGPLVDSLRTNGSEIEYLKNEGCLPLKIDSKTS
                     FKGGRIELAATVSSQYVSSILMCAPYAQEPVTLALMGGKPISQLYVDMTIKMMEKFGI
                     KVTKSETEPFTYLIPKGKYVNPEEYVIESDASSATYPLAFAAMTGITVTVPNIGSESL
                     QGDARFAIDVLKPMGCTVVQTATSTRVTGPAVGSLKPLNHVDMEPMTDAFLTACVVAA
                     IAHDNDPNSENKTVIEGIANQRVKECNRIEAMATQLAKFGVNTKELPDGIEVYGLDNI
                     EDLQLPKSVHSYDDHRVAMSFSLLAGMVNYNAKETSSPVKILERHCTGKTWPGWWDIL
                     HTELGAKLDGSVPSSSTTVDSKKSVVIIGMRAAGKTTISKWCASALGYKLIDLDDYFE
                     EIHGNQTVKEFVNQNSWEDFRKEETRIFKDLISKHGNDGYVFSSGGGLVESPEAREAL
                     KIFAADDGIVLHLHRDIEETIVFLQSDPTRPAYVEEIRDVWNKREGWYNECSNFEFFA
                     PHCSSETEFQNLRRIFDKYINKIMGNVVLGIPKQRSSFVCLTFEDLFEEVDNLALITA
                     GCDAVEVRIDHLANYEPAFISKQLSILRIATDGLPIIFTIRTKKQGGKFPDEVYESMR
                     HLFTLALKSGIDFIDMELTLPTDVQYHILNRKGHTKIIGSHHDFSGEYSWDDSEWETR
                     YNQALSLDVDIIKFVGSALKFEDNLLLETFRNNHKAKPLIAINMRELGKISRVLNPIL
                     TPITSELLPNAAAPGQLTLREINKIYSTLGGFSPLNFYVVGSPIGHSRSPILHNTGYE
                     ILGLPHKFDKFETDSIEKVKSELLDGESNLGGLAVTIPLKLEIMKYLNDLTPAASTIG
                     AINTIIPLGNGKFLGDNTDWLGIKNAFASNGVPENVNGAAGLVIGAGGTSRAAIYALH
                     IMGCSKIYLLNRTATKLPSLKASFPENFNIIILNSVSDIEKEAKNIGVAVSCIPADKP
                     IDIDLLGRLERFLSNGIHASFKPTLLEAAYKPAITPIMRLSKDKYKWETIPGSHLLVH
                     QGVAQFERWTGFRAPFDPIFRAVTKD"
     gene            complement(<244556..>245557)
                     /gene="TPHA0C01070"
                     /locus_tag="TPHA_0C01070"
                     /db_xref="GeneID:11535306"
     mRNA            complement(<244556..>245557)
                     /gene="TPHA0C01070"
                     /locus_tag="TPHA_0C01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684649.1"
                     /db_xref="GeneID:11535306"
     CDS             complement(244556..245557)
                     /gene="TPHA0C01070"
                     /locus_tag="TPHA_0C01070"
                     /inference="similar to DNA sequence:INSDC:YDR126W"
                     /note="similar to Saccharomyces cerevisiae SWF1 (YDR126W);
                     ancestral locus Anc_8.286"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684697.1"
                     /db_xref="GeneID:11535306"
                     /db_xref="GOA:G8BR87"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:G8BR87"
                     /translation="MWFQVICLVVLQVTLLLLSPFLKNRWPFSVYYRRLYVPYLKDVN
                     SYKWKYHVVPGFYFSIYLYLVYCYYAKVEYLIVNHLNLFERGILLPLLIVLTPSFGIL
                     TMVTKPINIHGNGISQHDKLKNKFPFDNIIYHSGNVCSTCNIEKPARSKHCNICGTCI
                     LLQDHHCIWVNNCIGLGNYKYFFMFLLLNTISLSYAFLRLLHITLSKPDVPKSKNILA
                     LCILTGSFSVICGVFFYLQMKQVNNGMTTNETDKWYAVQELMREGKLIKSEDNNWFAL
                     STEDAPDSPSQVYSTNFYDNKTYKISNDYHIVKDASEIPNVYDRGTFLDNLKGFCNE"
     gene            <246019..>247794
                     /gene="TPHA0C01080"
                     /locus_tag="TPHA_0C01080"
                     /db_xref="GeneID:11534072"
     mRNA            <246019..>247794
                     /gene="TPHA0C01080"
                     /locus_tag="TPHA_0C01080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684650.1"
                     /db_xref="GeneID:11534072"
     CDS             246019..247794
                     /gene="TPHA0C01080"
                     /locus_tag="TPHA_0C01080"
                     /inference="similar to DNA sequence:INSDC:YLR098C"
                     /note="similar to Saccharomyces cerevisiae CHA4 (YLR098C);
                     ancestral locus Anc_8.283"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684698.1"
                     /db_xref="GeneID:11534072"
                     /db_xref="GOA:G8BR88"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G8BR88"
                     /translation="MSPEGFRVTKTPRKLACQNCRKRRRKCNFLIPCSNCIKFQTDCV
                     AVNEDLRKTRYTASYVKSLEEKIAYLESNLTESDTKEKTIDDIKLLNSSISLATASSA
                     SLLNVPKRDKKEVKNEYNLVENPLRSSSIYPMHSLSISKPFTSIEFKQTQTNLKNLTR
                     STAIMRSLSFFFKWLYPAHYFFIHRETFLSSFFGDTNTKSYYCSEELVFAMSALGAKL
                     VKSDDELYGRSTEFYQTSKSIVLKKVFQLEDSSFADSTPSSKLAIIQTLLCLAFYDIG
                     NGENPMAWYLSGLAFRIAHEIGLQLDPDAWSNVYENDLSKIDFEVRSRIYWGCYIADH
                     MISILFGRTTTLKLSNSTVPETDELPEIETGIEDYIYDPTKILSMAYPLRKLIVLSRI
                     TEIFASKIFSHTNSMIQKSQYLSKFNLEMYNWKSDLSPEMVWTKQKIIESEKFNPTIA
                     YMWYHYHLVLISYNKPYIFDFPHSRHLIEESIEELYHSLTLWKKSFGTFEKCNLYMIY
                     TAILALQCMNTELIKGDHRMEFKSFLGSDTLHYDLAKKVLDKEVNTDELLGTLSHGTN
                     FALEYNFDFTLLNEIDTLIGSTDTG"
     gene            complement(<247987..>249144)
                     /gene="TPHA0C01090"
                     /locus_tag="TPHA_0C01090"
                     /db_xref="GeneID:11535312"
     mRNA            complement(<247987..>249144)
                     /gene="TPHA0C01090"
                     /locus_tag="TPHA_0C01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684651.1"
                     /db_xref="GeneID:11535312"
     CDS             complement(247987..249144)
                     /gene="TPHA0C01090"
                     /locus_tag="TPHA_0C01090"
                     /inference="similar to DNA sequence:INSDC:YER059W,YIL050W"
                     /note="similar to Saccharomyces cerevisiae PCL6 (YER059W)
                     and PCL7 (YIL050W); ancestral locus Anc_7.240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684699.1"
                     /db_xref="GeneID:11535312"
                     /db_xref="GOA:G8BR89"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:G8BR89"
                     /translation="MVHNEMESSIRSPANDHMVTNPIKIPKSPNVNNINESGVDVYEN
                     SEGSYNNAVASGIRFNTCDVPTDNSVNSSPNEEYYNNVQVPDSTEVPEGSIKELGPIS
                     NSNDKETHPQLSDTQYIDNDNVNKQTTATNNGPPEKNTQDKKVVALADFAATPENIAE
                     FQTDKLLDMLSTLLDKIVLSNDRLHINTMDNTIDEHIDSTIIKPVSCFRGKHVPQISL
                     EQYFQRIQKYCPITNDVFLSLLVYFDRISKKCNNINLEKENVISNDADESQNNVKQMK
                     DENNSSIVKPQVFVMDSFNIHRLIITAVTVSTKFFSDLFYSNSRYARVGGISLQELNH
                     LELQFLILCDFQLMISVEELQRYAGLLTKFWCNNNTGNDNNNGNETNNDRK"
     gene            <250318..>250746
                     /gene="TPHA0C01100"
                     /locus_tag="TPHA_0C01100"
                     /db_xref="GeneID:11533610"
     mRNA            <250318..>250746
                     /gene="TPHA0C01100"
                     /locus_tag="TPHA_0C01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684652.1"
                     /db_xref="GeneID:11533610"
     CDS             250318..250746
                     /gene="TPHA0C01100"
                     /locus_tag="TPHA_0C01100"
                     /inference="similar to DNA sequence:INSDC:YER057C,YIL051C"
                     /note="similar to Saccharomyces cerevisiae HMF1 (YER057C)
                     and MMF1 (YIL051C); ancestral locus Anc_7.238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684700.1"
                     /db_xref="GeneID:11533610"
                     /db_xref="GOA:G8BR90"
                     /db_xref="InterPro:IPR006056"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR013813"
                     /db_xref="InterPro:IPR019897"
                     /db_xref="UniProtKB/TrEMBL:G8BR90"
                     /translation="MLKNTFFKSPLSRTLTTLTPVATKLSPPAAASYSQAMKANNLVF
                     VSGQIPYTKDNVPVKGSISDKTEQVFQNVKNILDASNSSFDKVIKVNVFLADINNFKE
                     FNEVYAKYFNTHKPARSCVAVAALPLGCDLEMEVIAAEND"
     gene            <251838..>253493
                     /gene="TPHA0C01110"
                     /locus_tag="TPHA_0C01110"
                     /db_xref="GeneID:11533765"
     mRNA            <251838..>253493
                     /gene="TPHA0C01110"
                     /locus_tag="TPHA_0C01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684653.1"
                     /db_xref="GeneID:11533765"
     CDS             251838..253493
                     /gene="TPHA0C01110"
                     /locus_tag="TPHA_0C01110"
                     /inference="similar to DNA sequence:INSDC:YER056C"
                     /note="similar to Saccharomyces cerevisiae FCY2 (YER056C);
                     ancestral locus Anc_7.236"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684701.1"
                     /db_xref="GeneID:11533765"
                     /db_xref="GOA:G8BR91"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR026030"
                     /db_xref="UniProtKB/TrEMBL:G8BR91"
                     /translation="MTDQISETSKVLENNLYSAELSSQDKDINDVHFQYEKEHDLENS
                     DFNSDKEKISVTSIDGFEEDTTEFGKVERKTNWIIKLYSLLNAEQKGVEPITDEEKND
                     DSIFGATTMWFSANMVVSSYALGVIGPVTFGLNFGTSILTIIFFTLLGIVWVAFFSIF
                     GAEFGLRQMILSRFLVGNVTARVFSLINMVACAGWGIVNTIAAAQLISAVNPGPHSCP
                     PWAGCIIITIGVICITFFGYKVIHTYEKWSWVPNFAVFLVLIAQLSRSGSVTSGDWGG
                     GANTAAGVLSFGTSIFGYAAGWTTYAADYTVYMPRNTNKYKIFLSLCFGLAVPLWFTL
                     ILGAASAVGTFNNPVWNDYYQKNSVGGLTFAILAVDSLGGFGQFCCVLLAMSTIANQI
                     PNMYSIALSAQALWDPLAKVPRPIWTLVGNCVVLGISIPAYYQFSGFLSDFMDSIGYY
                     LSIYIAIAISEHFFWRRGFKGYNIDDWNKWDKLPIGIAGMSAFVVGVVGTALGMSQTY
                     WTGEIGRLIGNEGGGDIGFELAFSWSFIVYNLVRPLELKYFGR"
     gene            <253879..>257310
                     /gene="TPHA0C01120"
                     /locus_tag="TPHA_0C01120"
                     /db_xref="GeneID:11534111"
     mRNA            <253879..>257310
                     /gene="TPHA0C01120"
                     /locus_tag="TPHA_0C01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684654.1"
                     /db_xref="GeneID:11534111"
     CDS             253879..257310
                     /gene="TPHA0C01120"
                     /locus_tag="TPHA_0C01120"
                     /inference="similar to DNA sequence:INSDC:YIL048W"
                     /note="similar to Saccharomyces cerevisiae NEO1 (YIL048W);
                     ancestral locus Anc_7.234"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684702.1"
                     /db_xref="GeneID:11534111"
                     /db_xref="GOA:G8BR92"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:G8BR92"
                     /translation="MSFTIPAGPNKNKSIRYNLGRNSSADSFDLNLDDSLDQVLDNLQ
                     ISSENRNTSYGQTATNSINNERENFELKSVEDVSKFGRLGKNSSKSEPLLMERNYSEF
                     STRTEETWSNIIPKSKSMFERISSLLRKSMNEVTSEMQNKSNRIKINKDNVERIIKPD
                     QTQSLKNVYPSNEISNAKYNPITFVPILLYEQFKFFYNLYFLVVALSQAVPALRIGYL
                     SSYIVPLAFVLTVTMLKEAIDDIQRRRRDRESNGELYEILQSKDMIQSKDLKVGDLIK
                     LNKGERVPADAILLQTSDNSGEEFIKTDQLDGETDWKLRIAPQISQTMTEEELFTKLT
                     LSATPPEKSIHSFLGKISSEDGTSVALSIDNTLWANTVVASNGSCIACVIYTGKHTRQ
                     SMNTTSKSVKTGLLEIEINSISKLLCISVFALSVILVVFAGKDNKDWYIDILRYLILF
                     STIIPVSLRVNLDLAKSVYAYQIEHDQMIPETIVRTSTIPEDLGRIEYLLSDKTGTLT
                     QNDMQLRKIHLGSLSYSMESMDIVSGYVDNYFNTNTNNLSAARKDAATNVCDLLITLA
                     LCHNVTPSFVDNELTYQAASPDEIAIVKFTEEVGLSLFKRDRHSITLLHRQTGEQLVY
                     EISHIFPFNSVSKRMGIIVFDKKQKSYWFLQKGADTVMSKIVQKNSWLEEEVDNMARE
                     GLRTLVIGRKKLPTKVYEQFIAEYNEASVAMTDREIKVSQVISKFLEYDVELLGLTGV
                     EDILQKDVKSSIELLRNAGIKIWMLTGDKVETAKCVSISAKLISRGQYVHTITKVNKT
                     YDALNHLEFIKINKNACLIIDGESLAVYLKDYKKEFLEAVLQLPTVVACRCSPQQKAD
                     VALLIREFTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLT
                     ELLLWHGRNSYKRSAKLSQFIMHRGLVIAICQVVFSICSGFEPIALYQGWLMVGYATC
                     YTMAPVFSLTLDTDIPETLTKLYPELYQDLIEGKSLSHKTFFVWVVLSIFQGCIIQLF
                     SQFFTGVSESLFTKMVAISFTSLVLNELVMVALEIYTWNKVMVVTELVTLSIYVISVP
                     FLSEYFDLSYFKTLNFFAELLLILSISVFPVWASKAIYRKLHPPSYAKVQQYSIV"
     gene            complement(<257491..>260127)
                     /gene="TPHA0C01130"
                     /locus_tag="TPHA_0C01130"
                     /db_xref="GeneID:11533794"
     mRNA            complement(<257491..>260127)
                     /gene="TPHA0C01130"
                     /locus_tag="TPHA_0C01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684655.1"
                     /db_xref="GeneID:11533794"
     CDS             complement(257491..260127)
                     /gene="TPHA0C01130"
                     /locus_tag="TPHA_0C01130"
                     /inference="similar to DNA sequence:INSDC:YIL047C"
                     /note="similar to Saccharomyces cerevisiae SYG1 (YIL047C);
                     ancestral locus Anc_7.233"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684703.1"
                     /db_xref="GeneID:11533794"
                     /db_xref="GOA:G8BR93"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR004342"
                     /db_xref="UniProtKB/TrEMBL:G8BR93"
                     /translation="MKFGNYLNESAIPEWKNKYVDYNKGKSKIHIYKHELNNNKHLVL
                     NSFYDHIQNERDIEHNKYSILQRQFITEFIDHWINSYEINKSNNFYLWLLEQCHEKYR
                     ALSHQMSLYNQQVKSELHFSNDETPLLFDMNFNNSSNHDSLQQPKIFKNSYDSLCSLL
                     QTKNDKYQDHANIESPIDGHSSTYSQTKSKKKTLPELLKAFLKRNDLYPSYPRSLVNY
                     KNKQEDSTVKVSIKRARRMLDHVLLEFYIYIQLVRAFRDLNATGFRKIVKKFDKVCKT
                     NELPQFLINSRNKYSIFEHADMNVQTNSSNTIKDFSLKNTTSSNNHSALSTDPLLIWE
                     RTINKWYLSDLTHSVKEKKERTERIKKLSLKHAVNEQTIHRSNRAILQMFIGGMGIGI
                     CLPIIYYITIRLIDSPTNSYLYKFILPLWGSWFLFFVLVFFFLFDCYIWHRNGINYRF
                     IMFGEIHQRNGTQLFNNDFATSMISLHIYFAAWFAVPCAIIATISVYYNAIIPYTYIM
                     PVWSAILMILPFNIIPYWDKLVETRKWLIVGIIRLIFSGFFPVQFGDFFLGVLFCSLT
                     YSLAEIAIMSCISLKSIDCPCSTDALKYVILLSCAPNFWRFCQCLRRLADSGNPLPHL
                     PNAFKYAFGVAFNATFCIYRASNHDPTAMKWFIFCATINAICTSVWDLVMDWSLLQRN
                     SKNRLLRDDLYLAGTRDWKTGTYSLGGRSVYYICMVIDVIIRFQWIVFIVPPIPIQDN
                     PITAFTVAFTELVRRIIWIIFRVENEHVANVQLFKISGETDLPYTIPLPDWRLLEETS
                     VNEDEDSEIQDYMDETSSGPALTSNNHLDVIKPRNRRKSILDNISRNISTAHTSDFQR
                     PRVYSTILTRADDDRDVNTDDR"
     gene            <261760..>262659
                     /gene="TPHA0C01140"
                     /locus_tag="TPHA_0C01140"
                     /db_xref="GeneID:11533816"
     mRNA            <261760..>262659
                     /gene="TPHA0C01140"
                     /locus_tag="TPHA_0C01140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684656.1"
                     /db_xref="GeneID:11533816"
     CDS             261760..262659
                     /gene="TPHA0C01140"
                     /locus_tag="TPHA_0C01140"
                     /inference="similar to DNA sequence:INSDC:YER055C"
                     /note="similar to Saccharomyces cerevisiae HIS1 (YER055C);
                     ancestral locus Anc_7.232"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684704.1"
                     /db_xref="GeneID:11533816"
                     /db_xref="GOA:G8BR94"
                     /db_xref="InterPro:IPR001348"
                     /db_xref="InterPro:IPR011322"
                     /db_xref="InterPro:IPR013115"
                     /db_xref="InterPro:IPR013820"
                     /db_xref="InterPro:IPR015867"
                     /db_xref="InterPro:IPR018198"
                     /db_xref="InterPro:IPR020621"
                     /db_xref="UniProtKB/TrEMBL:G8BR94"
                     /translation="MDLVNHLNDRLLFAIPKKGRLYQKCVDILKGSDIKFNRSQRLDI
                     ALSTNLPVALIFLPAADIPRFVGEGKCDLGITGVDQVRESQVDVNVAIDLRFGSCKLQ
                     VQVPANGDVTEPKQLIGKTIVSSFTKLTEDYFAKLENTTVDKMTTKVKYVSGSVEASC
                     ALGVADAIVDLVESGETMRAAGLIDIDTVLETSASLIESKQPKSDPELIQTIKARIEG
                     VMAAQAFVYCTYNALESKLPEFFKITPGRKAPTVSKISDAENKWVSVSVMIERNSKGN
                     ILDKLKANGATDIMVFEIQNCRI"
     gene            <263944..>266007
                     /gene="TPHA0C01150"
                     /locus_tag="TPHA_0C01150"
                     /db_xref="GeneID:11533953"
     mRNA            <263944..>266007
                     /gene="TPHA0C01150"
                     /locus_tag="TPHA_0C01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684657.1"
                     /db_xref="GeneID:11533953"
     CDS             263944..266007
                     /gene="TPHA0C01150"
                     /locus_tag="TPHA_0C01150"
                     /inference="similar to DNA sequence:INSDC:YIL046W"
                     /note="similar to Saccharomyces cerevisiae MET30
                     (YIL046W); ancestral locus Anc_7.231"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684705.1"
                     /db_xref="GeneID:11533953"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8BR95"
                     /translation="MWQFQKKNTNVNVKNISKKSPTSGNIKSKAVKSSDDINEKQKYI
                     MNLDSSIPPFESHSDNKRGIDIVEENDVQSDNDNTNKKKVKVYHGTDFTEDTKNNDIV
                     QSSLPEYNFTKFCYRHNPENKLSTTKNMCYNQDLKRFSEINKNISKLPTNEQSELHHM
                     MSYFSNSNAKTRKLILDGLLASCCFPQLSYVMSQVSSMIKIDFISTLPREISCKILNY
                     LDCQSLCNAAAVCKSWHELADDDKVWYHMCEQHIDRKCPNCGWGLPLLHMKRARFSSE
                     KENKVLVTTYKGTNANSQNPKNESQHTTNNQIAKPWKVIYRERYKVESNWRRGKFKVQ
                     EFKGHMDSVLTLQFTHRLLFTGSYDSTVAAWDLYTGKLIRRFVGSFDGVKTLHFDGQK
                     LVTGSLDKTIKVWNYLTGECISTYRGHTDSVMSVDSFKKIIVSGSADKTVKVWHVESR
                     SCYTLRGHTEWVNSVKLHPKSFCLFSCSDDTTIRMWDIRTNVCLKVFRGHVGQVQKVI
                     PLTIIDIENLVVDPKIIVDEENNNENNENNENNENREGNESITLDSSLSYPTHLLSCS
                     LDNTIKLWDVQTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHT
                     FQGMSLYTGAGANVANNNGDDSTRTNGQDNKTQASPIACVGIGDSEFFCGDETGCVKM
                     CTFDI"
     gene            <267944..>269431
                     /gene="TPHA0C01160"
                     /locus_tag="TPHA_0C01160"
                     /db_xref="GeneID:11533512"
     mRNA            <267944..>269431
                     /gene="TPHA0C01160"
                     /locus_tag="TPHA_0C01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684658.1"
                     /db_xref="GeneID:11533512"
     CDS             267944..269431
                     /gene="TPHA0C01160"
                     /locus_tag="TPHA_0C01160"
                     /inference="similar to DNA sequence:INSDC:YER054C,YIL045W"
                     /note="similar to Saccharomyces cerevisiae GIP2 (YER054C)
                     and PIG2 (YIL045W); ancestral locus Anc_7.230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684706.1"
                     /db_xref="GeneID:11533512"
                     /db_xref="InterPro:IPR005036"
                     /db_xref="UniProtKB/TrEMBL:G8BR96"
                     /translation="MYIKASTKKEFPFFNDDDFNSRVLRDRFKDGNTVDDKGAVNYNG
                     GGGPTDLELPKSLSFLNKPQRNRESSESTRVRESELLRNTNINKRLDAYSIDHQKGPK
                     AGQQAGVVDDDDVHKEFYNSINKRIAKVSSMSINTDVEPTGLEISPVYKKSGELVRSS
                     LKYRSKSLPCTPNGEAIKDEDNFLLTKNPRRNLIRSKSVHFEQTTPIAYFNKDESPLD
                     ISLQFKEFLKLNGDNHNNLTLNAVDDKNYTYGNTHVNGFGSKDYDNFAFGGTADDEQG
                     LSTCHIQGEKTAQAGKNLRWSKLQNEFFNKIRNEKKNRINLNHSRDVSYEASDGMDLV
                     LENENFPVLSRMKRKDILKINLYVKLVESNNVFLEELVIKKNVGGGMDDRTNMLSSVN
                     FLSGKIFVKNLNFKKSIKVRYTWNKWITYHETEALYNSNADSILPSTNMDIFRFIIDC
                     NNVRSNCKNALELCIHYISGDEKDNSYKEYWDNNNGKNYKIAIYK"
     gene            <271138..>271251
                     /gene="TPHA0C01170"
                     /locus_tag="TPHA_0C01170"
                     /db_xref="GeneID:11533980"
     mRNA            <271138..>271251
                     /gene="TPHA0C01170"
                     /locus_tag="TPHA_0C01170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684659.1"
                     /db_xref="GeneID:11533980"
     CDS             271138..271251
                     /gene="TPHA0C01170"
                     /locus_tag="TPHA_0C01170"
                     /inference="similar to DNA sequence:INSDC:YER053C-A"
                     /note="similar to Saccharomyces cerevisiae YER053C-A;
                     ancestral locus Anc_7.229"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684707.1"
                     /db_xref="GeneID:11533980"
                     /db_xref="UniProtKB/TrEMBL:G8BR97"
                     /translation="MQDFQVFLSIFATLFLFYYSAHRNVMNRYKIDVPNLQ"
     gene            <272119..>273048
                     /gene="TPHA0C01180"
                     /locus_tag="TPHA_0C01180"
                     /db_xref="GeneID:11533652"
     mRNA            <272119..>273048
                     /gene="TPHA0C01180"
                     /locus_tag="TPHA_0C01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684660.1"
                     /db_xref="GeneID:11533652"
     CDS             272119..273048
                     /gene="TPHA0C01180"
                     /locus_tag="TPHA_0C01180"
                     /inference="similar to DNA sequence:INSDC:YER053C"
                     /note="similar to Saccharomyces cerevisiae PIC2 (YER053C);
                     ancestral locus Anc_7.228"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684708.1"
                     /db_xref="GeneID:11533652"
                     /db_xref="GOA:G8BR98"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8BR98"
                     /translation="MSITSQKRNNIELYTNKFYATCTLGGIIACGPTHSSVTPLDLVK
                     CRLQVDPTLYKSNLQGWKTIVSTEGGFSKVFTGVGATFIGYSLQGAGKYGGYEFFKHY
                     YSTLSFVTPEFVQNHSVWIYLGASATAEFLADIMLCPLEAIKVKQQTTMPPFCNNVFQ
                     GFSKIYTQEGLKAFYKGIVPLWFRQIPYTMVKFTSFEKIVEAIYAKLPVKKSELSPLQ
                     QISVSFTGGYLAGILCAIVSHPADVMVSKINNGRKATESMSQATNRIYKQIGFKGLWN
                     GLPVRIVMIGTLTSFQWLIYDSFKAYVGLPTSG"
     gene            complement(<273207..>274193)
                     /gene="TPHA0C01190"
                     /locus_tag="TPHA_0C01190"
                     /db_xref="GeneID:11534081"
     mRNA            complement(<273207..>274193)
                     /gene="TPHA0C01190"
                     /locus_tag="TPHA_0C01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684661.1"
                     /db_xref="GeneID:11534081"
     CDS             complement(273207..274193)
                     /gene="TPHA0C01190"
                     /locus_tag="TPHA_0C01190"
                     /inference="similar to DNA sequence:INSDC:YIL044C"
                     /note="similar to Saccharomyces cerevisiae AGE2 (YIL044C);
                     ancestral locus Anc_7.227"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684709.1"
                     /db_xref="GeneID:11534081"
                     /db_xref="GOA:G8BR99"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:G8BR99"
                     /translation="MSTSPQIKKALAALLRDPGNSTCADCKTQTHPRWASWSLGVFIC
                     IKCAGFHRSLGTHISKVKSVDLDTWKEENIIMLIKFKNNDMANKYYESKLLNENNEPV
                     KININDTNKLQTFIKNKYEYKKWMGDSGKLEELTSNSLQNNDLLNSSQKSQLQSQSPK
                     EEPVVKKNSMNLSNSRSSSILDLQNLSKSPSNNNNNRLNSSTPQLSRGNSNGLLNTVG
                     NSATSLNIQNPNVNRTQPQGGAQRQDLKKSILSLYAKPTNSASNLSNNNLSSSSISLA
                     SASSFNNNGNNNNSNVVNINNNINKINNFNNNSKSSSTYNIEDDELMKNVWS"
     gene            <275584..>277170
                     /gene="TPHA0C01200"
                     /locus_tag="TPHA_0C01200"
                     /db_xref="GeneID:11534114"
     mRNA            <275584..>277170
                     /gene="TPHA0C01200"
                     /locus_tag="TPHA_0C01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684662.1"
                     /db_xref="GeneID:11534114"
     CDS             275584..277170
                     /gene="TPHA0C01200"
                     /locus_tag="TPHA_0C01200"
                     /inference="similar to DNA sequence:INSDC:YER052C"
                     /note="similar to Saccharomyces cerevisiae HOM3 (YER052C);
                     ancestral locus Anc_7.226"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684710.1"
                     /db_xref="GeneID:11534114"
                     /db_xref="GOA:G8BRA0"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001341"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR018042"
                     /db_xref="UniProtKB/TrEMBL:G8BRA0"
                     /translation="MTIVKMFNDPNASTNWVIQKFGGTSVGKFSVQIVDDIIKYYSSP
                     DGINKNVAVVCSARSSYTKAEGTTSRLLKCCDLASQELKFSDIIEVIRQDHISNAENL
                     INDPVIQTRLVADTNKELDLVVKYLEASKVLGEVSTRTMDLVMSCGEKLSCLFIASLC
                     NDRKCKAKYVDLSNVIPSDYQTTNLDNTFYTFLVKSLKEKLQPFIDSKERIVPVLTGF
                     FGLIPMGLLNGVGRGYTDLCAALVSVALNADELQVWKEVDGIFTADPRKVPNARLLSS
                     VTPEEASELTYYGSEVIHPFTMEQVIRAKIPIRIKNVQNPKNDGTVIYPDNVAKKGEA
                     TPPHPPEALSSSFFETKRRGATAITTKNDIVVVNIHSNKKTLSHGFLAQIFTVLDRYK
                     LVVDLISTSEVHVSMALPIPDSDSLKSLRLAVEKLNSLGSIDIIRGMCIVSLVGKQMK
                     QYIGIAGTMFSTLAEQGINIEMISQGANEINISCVIDEDDSLKALQSIHKTLLDETAE
                     RPSFEHAVDERLQHIKNLTI"
     gene            complement(<277366..>278214)
                     /gene="TPHA0C01210"
                     /locus_tag="TPHA_0C01210"
                     /db_xref="GeneID:11533646"
     mRNA            complement(<277366..>278214)
                     /gene="TPHA0C01210"
                     /locus_tag="TPHA_0C01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684663.1"
                     /db_xref="GeneID:11533646"
     CDS             complement(277366..278214)
                     /gene="TPHA0C01210"
                     /locus_tag="TPHA_0C01210"
                     /inference="similar to DNA sequence:INSDC:YIL043C"
                     /note="similar to Saccharomyces cerevisiae CBR1 (YIL043C);
                     ancestral locus Anc_7.225"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684711.1"
                     /db_xref="GeneID:11533646"
                     /db_xref="GOA:G8BRA1"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:G8BRA1"
                     /translation="MEESAIKIVLAVLLLAVGTYYSLQLGKQFKPKATLVKGQYKKFP
                     LIRKTILSHNSAVYRFKLPTEDSILGLPVGQHITVKAVINEKTIIRSYTPTSLDTDSR
                     GFFELLIKSYENGNMSKNFAELELNDTIELSGPKGFYNYSPNCRKELGMVAGGSGITP
                     MYQIIKAIAQNPNDKTKVSLIYGNVAEKEILLKKQLDDLVATKPEQFRVYYVVDNPSE
                     DWTGGVGYITADVMKEYLPAPGHGVQLLVCGPLPMVSSVKRCAVALGFAKAKPVPKME
                     DEVFVF"
     gene            complement(<278757..>279980)
                     /gene="TPHA0C01220"
                     /locus_tag="TPHA_0C01220"
                     /db_xref="GeneID:11535286"
     mRNA            complement(<278757..>279980)
                     /gene="TPHA0C01220"
                     /locus_tag="TPHA_0C01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684664.1"
                     /db_xref="GeneID:11535286"
     CDS             complement(278757..279980)
                     /gene="TPHA0C01220"
                     /locus_tag="TPHA_0C01220"
                     /inference="similar to DNA sequence:INSDC:YER051W"
                     /note="similar to Saccharomyces cerevisiae JHD1 (YER051W);
                     ancestral locus Anc_7.224"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684712.1"
                     /db_xref="GeneID:11535286"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="UniProtKB/TrEMBL:G8BRA2"
                     /translation="MVVNRKRKSVEKGDTASLITKKKYNLRTSNNQIDYISLNEGDGV
                     KRKNEPPHLKSFNDCFNRYVGNAQDKRIPYKTFVDTFDDIKVPYLIIDPENSGMEVPD
                     QLTVEEITKRLGGDCKINVMDVLTQENEKWTLSKWNEYFTNTSYLQRDRLKNVISFEV
                     SDFAKRDNFVVKRPTVVSENDLVDIVWDRYCNCDGENGVYGPRPKVTKYVLMSVRNAY
                     TDFHLDFAGTPVYYKLLQGSKKFILFPPTSHNIEQYLQWCNKPDQTSIFLGDHLQDGI
                     AMELKASDLFLIPAGYIHVVYTPEDSLIVGGNFLTFRDILTHLKIVEVEKESKVPKTF
                     TFPKFEAVMYKTAEWLIDEIESGSKFSNDGDLPTIIKQLSSIITSSKLKYSSSSFNSK
                     KEMIAKLNSLRKESP"
     gene            <280944..>281861
                     /gene="TPHA0C01230"
                     /locus_tag="TPHA_0C01230"
                     /db_xref="GeneID:11534109"
     mRNA            <280944..>281861
                     /gene="TPHA0C01230"
                     /locus_tag="TPHA_0C01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684665.1"
                     /db_xref="GeneID:11534109"
     CDS             280944..281861
                     /gene="TPHA0C01230"
                     /locus_tag="TPHA_0C01230"
                     /inference="similar to DNA sequence:INSDC:YIL041W"
                     /note="similar to Saccharomyces cerevisiae GVP36
                     (YIL041W); ancestral locus Anc_7.221"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684713.1"
                     /db_xref="GeneID:11534109"
                     /db_xref="InterPro:IPR018859"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:G8BRA3"
                     /translation="MSFNDFASSLTQKFQELSTVVSERTQDLGTSIPSIASSTQRLVQ
                     EKLGNVTDISQLPQEYLELEKEIDTIKLVYEHFLKITSIYDNESYDYPKYVSDSVNDY
                     SKLFQSKIEDLSRATSAEEAQNILVTPGPITEPRTLNYALSKVALTSSESLNQLQDPN
                     VSAVASTLLKFSDMQTKIAQQRLQQDTLIQTKVNKVIKEKLSSLIEKATKSRRDVQYK
                     RLQYDVARSKLAQAKPEKEAALRVEMESLEEQFAQATESATVTMQDVISQSKFLDTLK
                     NLVEAQLSYFENSANLLKELLPEFESSSA"
     gene            complement(<282061..>283950)
                     /gene="TPHA0C01240"
                     /locus_tag="TPHA_0C01240"
                     /db_xref="GeneID:11534113"
     mRNA            complement(<282061..>283950)
                     /gene="TPHA0C01240"
                     /locus_tag="TPHA_0C01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684666.1"
                     /db_xref="GeneID:11534113"
     CDS             complement(282061..283950)
                     /gene="TPHA0C01240"
                     /locus_tag="TPHA_0C01240"
                     /inference="similar to DNA sequence:INSDC:YER049W"
                     /note="similar to Saccharomyces cerevisiae TPA1 (YER049W);
                     ancestral locus Anc_7.220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684714.1"
                     /db_xref="GeneID:11534113"
                     /db_xref="GOA:G8BRA4"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR006620"
                     /db_xref="InterPro:IPR019601"
                     /db_xref="UniProtKB/TrEMBL:G8BRA4"
                     /translation="MKRKAPSNPVTQTQKQLSLEDDKVKALFNQKIWDPKFQDELKDE
                     IANAKPYNWGTIHDLVDDDLLRAVRKEIETEIHFTKKETDIYKVNQSGDLANLSGLDW
                     NDLSRLPNMYKLRQILYSEKYRDFFGYVTGAGKLSASKTDMSVNTYTKGCHLLTHDDV
                     IGSRRISFILYLPDPDRKWKSHYGGGLRLFPSIKENIPYTDPCAKLVPQFNQIAFFKV
                     QPGFSFHDVEEVRVDKHRLSIQGWYHIPQKGEDGYIPGEEEAWIDQNISTLAQLESRT
                     LQDFEFPNAEREILPFHQTKHYERLLTGEEDNNKDCKFLSEALKLTEREIQYLSQYIS
                     PEHLTAEGITKLQKSFEDNSSLQIESFLNDPKSDLLKKLIKHDELNKECPMEAKDVKA
                     PWKTATPSHKWRYLYMDGKSHEYFATEEDMLENLNNEEPSNFKWLKETLINAKTSNND
                     NELEIALVDLAQFLKSLIFKKYIATLTLLCPLAEKVIIRRFRPGKDFTLATKCNLSEV
                     LKGVEGFVDAVLEATLCLTPSNGWTSGEVGGYELYMADETIDEEEKDDTQYERDVEDA
                     TVYRRDDAGDSVLINKPASWNSLNLVLRDESVMEFVKYISWGAESSRWDVRIQWDVKS
                     MESDV"
     gene            complement(<284737..>285015)
                     /gene="TPHA0C01250"
                     /locus_tag="TPHA_0C01250"
                     /db_xref="GeneID:11533599"
     mRNA            complement(<284737..>285015)
                     /gene="TPHA0C01250"
                     /locus_tag="TPHA_0C01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684667.1"
                     /db_xref="GeneID:11533599"
     CDS             complement(284737..285015)
                     /gene="TPHA0C01250"
                     /locus_tag="TPHA_0C01250"
                     /inference="similar to DNA sequence:INSDC:YER048W-A"
                     /note="similar to Saccharomyces cerevisiae ISD11
                     (YER048W-A); ancestral locus Anc_7.219"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684715.1"
                     /db_xref="GeneID:11533599"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:G8BRA5"
                     /translation="MGAVGPTRIEVLHLYKQLIKNSRLFNDYNFREFFLRRSRESFKA
                     NKHLNDSQAIIDCYNRGLEDLSVLKRQSIISQLYTFDKLVVEPLKGSR"
     gap             285798..285839
                     /estimated_length=42
     gene            286840..286911
                     /gene="TPHA0Ctrna3Q"
                     /locus_tag="TPHA_0Ctrna3Q"
                     /db_xref="GeneID:11533467"
     tRNA            286840..286911
                     /gene="TPHA0Ctrna3Q"
                     /locus_tag="TPHA_0Ctrna3Q"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAA"
                     /db_xref="GeneID:11533467"
     gene            <287466..>288608
                     /gene="TPHA0C01260"
                     /locus_tag="TPHA_0C01260"
                     /db_xref="GeneID:11533804"
     mRNA            <287466..>288608
                     /gene="TPHA0C01260"
                     /locus_tag="TPHA_0C01260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684668.1"
                     /db_xref="GeneID:11533804"
     CDS             287466..288608
                     /gene="TPHA0C01260"
                     /locus_tag="TPHA_0C01260"
                     /inference="similar to DNA sequence:INSDC:YER048C"
                     /note="similar to Saccharomyces cerevisiae CAJ1 (YER048C);
                     ancestral locus Anc_7.217"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684716.1"
                     /db_xref="GeneID:11533804"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR026894"
                     /db_xref="UniProtKB/TrEMBL:G8BRA6"
                     /translation="MVKDTEYYDVLGVTPEATPTDIKKAYRKKAMQTHPDKHPDDPEA
                     QSKFQAVGEAYQVLSDPGLRSKYDQFGKDDAVPNAGFEDAQEFFSTIFGGDGFKDWIG
                     EFSLFKELNEVAGDYDENGNPIAPKTEEESAAGGTAADGTVANHDRKKKMSKEQREKL
                     FEMEKKRREEVAKQVDELSQKLTVKIDDYLLAVKENHVDEFTSKLDQEIEELKLESFG
                     MELLHVLAKVYKTKANNYIMSKKTYGFSKLFTGTLDNARTVKDTYNLLSTGLEAQKAM
                     NQMSEVNAEELDEYERAKFENMMAGKALGVMWAMSKFELERKLKEVCNKILSNKSVPS
                     KERLLKAKALIFIANKFESAKRSPEEAEEARVFEEMILGEQKKKQK"
     gene            <289150..>290577
                     /gene="TPHA0C01270"
                     /locus_tag="TPHA_0C01270"
                     /db_xref="GeneID:11535308"
     mRNA            <289150..>290577
                     /gene="TPHA0C01270"
                     /locus_tag="TPHA_0C01270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684669.1"
                     /db_xref="GeneID:11535308"
     CDS             289150..290577
                     /gene="TPHA0C01270"
                     /locus_tag="TPHA_0C01270"
                     /inference="similar to DNA sequence:INSDC:YIL039W"
                     /note="similar to Saccharomyces cerevisiae YIL039W;
                     ancestral locus Anc_7.216"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684717.1"
                     /db_xref="GeneID:11535308"
                     /db_xref="GOA:G8BRA7"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8BRA7"
                     /translation="MVSAWFKYFTYLVTISAVLTNVYLYTFPSFHVKNCTWKCFDQED
                     DEPAFEEMSIMERMIYKINQYKDDVQEQVYSTKNYTSAEGEHQVRMLAFGDPQIRGIW
                     KKSSYLAMLDVYANDCYLGHIYSMMKERLSPTHVATLGDLFSSQWISDSEFYNRTTRY
                     VTRLYNRDTTNLVRLKKESEDEKGQYRVDWQSWGDDYNKRRLSDPPAFDYGYSDVYSW
                     DPEHEDFLFINVTGNHDIGYSGDVTYQHMSRFSHLFGKDNYWVEYDAGTDHAWRLVVL
                     NSLLLDGPALQPEFVEGTWAFLRALENRNFTGSTVLLTHVPFYKEAGLCADGPMFSYY
                     PDVYEREPYKVNLLRAQNHLSKNTTDKVLSSIFNNDRPGIILTGHDHVGCETVFNRQE
                     ETKTWNCTTDMVNSGYNIREVTVRSMMGEFGGNTGVFTGHFNKTSNNWEWNFTLCPFA
                     LQQVWWLAKTTIGLSLLLWPIYILF"
     gene            <291235..>293799
                     /gene="TPHA0C01280"
                     /locus_tag="TPHA_0C01280"
                     /db_xref="GeneID:11533986"
     mRNA            <291235..>293799
                     /gene="TPHA0C01280"
                     /locus_tag="TPHA_0C01280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684670.1"
                     /db_xref="GeneID:11533986"
     CDS             291235..293799
                     /gene="TPHA0C01280"
                     /locus_tag="TPHA_0C01280"
                     /inference="similar to DNA sequence:INSDC:YER047C"
                     /note="similar to Saccharomyces cerevisiae SAP1 (YER047C);
                     ancestral locus Anc_7.215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684718.1"
                     /db_xref="GeneID:11533986"
                     /db_xref="GOA:G8BRA8"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR015415"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BRA8"
                     /translation="MDGSNYNSILSKWSRNRKKPQPLTDLTSLYSKVANESIYYLKLE
                     EHNDLQKALQGWKALNTDVLYQLTIIDHTYPNTQNYTKDELSLKSGVRELYHKASSHL
                     ERVQNKVNEMNKDKRSSFDARASTSQGTQTHADRSNSIKSSHSLSPASSLVKKPYVLS
                     APNLHNHSNNMARTLRNGKEKYHKNPIQHTSYKISAPILPRSSSPSNGNVKISKPLEL
                     QNQLYSNISNNSISSADNENEINQPILSRTNRIQSGSEKVLIDLTSESSEEENTTTDD
                     SQNDTSFEIESYYDSYLSFEKRDIERLKTLEQLSSTEESLSKLSLNSTPLIPSNTFKQ
                     EKPLRKPLDKPKLTTTTGQVKKTIKKSNMVKEKVNKSTSVLPDKPKKITNSKLPVSTS
                     VDSLPNKQLSVTKIKDLNKPVTSTRQKLVGKINVASARPSIPSVKSQNSPLLSSQSIA
                     KDRSNSVDIKTVKSRSKAPRTKRLKSPINKMPKGSNTQTTSDLSKKNSSKVASPPSNI
                     VKKNIKKNVSNESLHITEEIPDEVELTKEKLEDDIIDSLQGVDKGAAKQIFSEIVVKG
                     DEVHWQDVIGLEAAKASLKEAVVYPFLRPDLFRGLREPVRGMLLFGPPGTGKTMIARA
                     VATESNSTFFSISASSLTSKYLGESEKLVRALFAVAKKLAPSIIFIDEIDSIMGSRDG
                     DGENESSRRIKNEFLVQWSSLSSAAANRDSQSDDERVLLLAATNLPWSIDEAARRRFV
                     RRQYIPLPEDETRKAHLKKLLSHQRFEMSDEDFDNLVCLTEGFSGSDITSLAKDAAMG
                     PLRELGEKLLDTPRDRIRAITIKDFTASLEYIKPSVSQEGLQRYAEWSTKFGSSGV"
     gene            complement(<294072..>296432)
                     /gene="TPHA0C01290"
                     /locus_tag="TPHA_0C01290"
                     /db_xref="GeneID:11534077"
     mRNA            complement(<294072..>296432)
                     /gene="TPHA0C01290"
                     /locus_tag="TPHA_0C01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684671.1"
                     /db_xref="GeneID:11534077"
     CDS             complement(294072..296432)
                     /gene="TPHA0C01290"
                     /locus_tag="TPHA_0C01290"
                     /inference="similar to DNA sequence:INSDC:YIL038C"
                     /note="similar to Saccharomyces cerevisiae NOT3 (YIL038C);
                     ancestral locus Anc_7.214"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684719.1"
                     /db_xref="GeneID:11534077"
                     /db_xref="GOA:G8BRA9"
                     /db_xref="InterPro:IPR007207"
                     /db_xref="InterPro:IPR007282"
                     /db_xref="InterPro:IPR012270"
                     /db_xref="UniProtKB/TrEMBL:G8BRA9"
                     /translation="MAHRKLQQEVDKIFKKINEGLEIFDTYYERRENCTNNPSQKEKL
                     ESDLKREVKKLQRLREQIKSWQSSPDIKDKDSLLDYRRSVEIAMEKYKAVEKASKEKA
                     YSNNSLKKSDNLDPEELERREVSDYLSQQIDELERQHEILQTEVDKLLLLQKKKKTAT
                     TPNAEKKEALKAFQNRYRWHQQQMELALRLLANEELDPQDVIDIKDDINYFVESNQDP
                     DFLEDESIYDNLNLQSNEAIAHEVAQSFAAQRADERDTEEDSFSKDAGGISKKDQRKL
                     EREARKAAREAAKEPSTSTQSGEESEQSSSVRNGNDNVVTIERVPSNAKSNSTSPSPS
                     LDNFNSPELSPANITAPSTAKSSGTPKLPYLKTTPLAATKPNTPASDGQRHQHIQIHN
                     GVTTTTTLKPATIPIRPAGELKWAAAASQAMEKTKKPSLPSLSPVPTTPTQATSKLGQ
                     TLKPNSSTPVLSNNIFNQPVKKTGMVSSLINTSDTAINQLSEPSDDVVVDNSDLKQLD
                     NQNQSTLSKNGYFIYDDYVSDVSDDEISVDKQFKLPSTQTLIERENKINEIKTKYAQH
                     YELITLPNGIQQYILGRILHDNNLNVLNGKLGGYRKSLDTISIPRLDSVPIGVNPPTP
                     LDAFKSTHQWDMVRTSLSGSLSSEGSVLLMDSILEKFRNLDSFTLFYNFYFSVTSMER
                     DIAAKILVERNWIQLSNGVMWFLRQGNIKFANENSEVADYKIFKADDWTVVEKLNFKL
                     DYDSIMDPVPKTVLNESVNSENNNDADSLSHGKQLLQQLNRGKIAT"
     gene            complement(<297109..>298758)
                     /gene="TPHA0C01300"
                     /locus_tag="TPHA_0C01300"
                     /db_xref="GeneID:11533785"
     mRNA            complement(<297109..>298758)
                     /gene="TPHA0C01300"
                     /locus_tag="TPHA_0C01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684672.1"
                     /db_xref="GeneID:11533785"
     CDS             complement(297109..298758)
                     /gene="TPHA0C01300"
                     /locus_tag="TPHA_0C01300"
                     /inference="similar to DNA sequence:INSDC:YIL037C"
                     /note="similar to Saccharomyces cerevisiae PRM2 (YIL037C);
                     ancestral locus Anc_7.213"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684720.1"
                     /db_xref="GeneID:11533785"
                     /db_xref="UniProtKB/TrEMBL:G8BRB0"
                     /translation="MIPNSFLQDVILENWFRELNEHLNEWNDNSVNNINSQISYFNSL
                     KIYNESIYSHLKSTNIIINETVNTLLSNKYELSTDGTNNNFEIIRDNLTIHTDFLDDI
                     FGNITNSLHNLNEVLQTIGFANQSNNISYTMTSNNIQVSSLTENFKTDVMGLLESLKL
                     NNISNSYNEVNFTNAINNISTNGKYTTTIASELKLVNKRMLNVISIIIYIGILLTTFI
                     TMVINYYLLKYEKSLFNNLFANIADVGGDKDTLIPLITERDNIIEIVDTMKYSLCHAL
                     ENIMINTIRFLANFRTKLFYLNMTLFYNNKIWITFFSSIIIVEVFLHSMILNINTFNN
                     NSTYISTIDKFIQTNFQVSNDAIYTNNTGFNFTTNNIYSLNSENEFANFEKSLIKIDN
                     AYRRNLFFILNNDINNSLLSDVNGILINKLDTISSTIKFLNKNLKEQKLQLLGEINFT
                     SMKENVTLPISIFSKLDASKLLVSSSINEYTINDFNIETINSNYLDKSLNESSINTYN
                     ITTQVIKNGNSNTSVKLWSILPVLIVALLYSLLYNGSLNFT"
     gene            complement(<299126..>299563)
                     /gene="TPHA0C01310"
                     /locus_tag="TPHA_0C01310"
                     /db_xref="GeneID:11533757"
     mRNA            complement(<299126..>299563)
                     /gene="TPHA0C01310"
                     /locus_tag="TPHA_0C01310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684673.1"
                     /db_xref="GeneID:11533757"
     CDS             complement(299126..299563)
                     /gene="TPHA0C01310"
                     /locus_tag="TPHA_0C01310"
                     /inference="similar to DNA sequence:INSDC:YER046W"
                     /note="similar to Saccharomyces cerevisiae SPO73
                     (YER046W); ancestral locus Anc_7.212"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684721.1"
                     /db_xref="GeneID:11533757"
                     /db_xref="UniProtKB/TrEMBL:G8BRB1"
                     /translation="MFKLLTRLDSLPEEVIIENERGFTMLGHTVYSSKMLVPKLDPPR
                     FQLYNKFTKKIISILVNRTNLSKTIENIFPIKLVENLDSNTKNGGAYPFEWYVLVDND
                     GKLDNDDQGWFYSWNFRNEHWKNKNGIVRRRIWIRLKDNEVEN"
     gap             299886..299991
                     /estimated_length=106
     gene            <301696..>303615
                     /gene="TPHA0C01320"
                     /locus_tag="TPHA_0C01320"
                     /db_xref="GeneID:11535309"
     mRNA            <301696..>303615
                     /gene="TPHA0C01320"
                     /locus_tag="TPHA_0C01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684674.1"
                     /db_xref="GeneID:11535309"
     CDS             301696..303615
                     /gene="TPHA0C01320"
                     /locus_tag="TPHA_0C01320"
                     /inference="similar to DNA sequence:INSDC:YER045C,YIL036W"
                     /note="similar to Saccharomyces cerevisiae ACA1 (YER045C)
                     and CST6 (YIL036W); ancestral locus Anc_7.211"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684722.1"
                     /db_xref="GeneID:11535309"
                     /db_xref="GOA:G8BRB2"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:G8BRB2"
                     /translation="MKATVEENIGYSNSTRAYDEQLINNYPKMKNPNFKDNDNNSFFY
                     RMNNIGNFNGNINNNIIDTDNRKNLGSFTTANHKLKSKREPSCGETDNTNTTINNNST
                     NTTANTNTNSYSDINRLRMPKSKSSNKSKIDNNIPSTNEIMDDHLMMNNGDDYTESKS
                     AMDDNKIGSSNKHININNANVNAMTNKQILFNNSVYSNRHTINDLSIQEALSPFFQPF
                     GVDVSHLPMTNPPIFQTSSMMYDDPGRRRRISISNGQISQLGEDLETLDNLYDSQPPP
                     MPHKFDMHNRQQVQLDHQPIPQQLQEQMQQQLQQQLLQQNYPVNMIPQGQYPHQFQDF
                     PNNRNNFENNNNTNTNNNDIPNGSNGSHSSADSNASQFNSIKRSDSGTSPLTTAEENN
                     MPRDIYYKNIKVNSTNENRKDYSGNDLGLQKPINDGQNVLANKNYTTHIKRGEQDFEV
                     PDEQMKVSLSQQYQIQHQQMEQLALSNQQQHHQQQQQQMPMQVPPSLNMGAKQQMYMS
                     NHDNDMHMNYHQGQLKNSSQLDSMSPGTASWKRTRLLERNRIAASKCRQRKKFAQLQL
                     QKDYDEIRNENRVMKRKLEYYEKLVSKFKKFSEAHLRKCDSNKESLKIIEEMLMIDSG
                     IAEVNETGIVVKIEK"
     gene            <303967..>305213
                     /gene="TPHA0C01330"
                     /locus_tag="TPHA_0C01330"
                     /db_xref="GeneID:11534105"
     mRNA            join(<303967..303999,304095..>305213)
                     /gene="TPHA0C01330"
                     /locus_tag="TPHA_0C01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684675.1"
                     /db_xref="GeneID:11534105"
     CDS             join(303967..303999,304095..305213)
                     /gene="TPHA0C01330"
                     /locus_tag="TPHA_0C01330"
                     /inference="similar to DNA sequence:INSDC:YER044C-A"
                     /note="similar to Saccharomyces cerevisiae MEI4
                     (YER044C-A); ancestral locus Anc_7.210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684723.1"
                     /db_xref="GeneID:11534105"
                     /db_xref="UniProtKB/TrEMBL:G8BRB3"
                     /translation="MNFNKEKDLIIGLAIIKNRRPELWKQVQNFRKQKINSLLIDGYN
                     VYHQYDTRESLRDSLDLPPLEYLKKTSMFCELEPIHHYLSYKTHSKLSNELKTINSFS
                     EGLNHNDIIRWILPLYKSFLCCLCYSQSSSNEYEQIERILECVQLMMISYCSKIENFT
                     NFRFIIETLFYKLLSFEISQNLKTDELKGLKLTLYTFLKKQGKLNDSFGKNLYFKFHL
                     STIVKTINLLLTNCKKSLIKLQEEQINMIVTNVRKIVETLTSLLSLFNEIKPRKPNLK
                     QASKYAYCTMYKNRNMVISRRHYRRFENVFLSLKMTVKEQIQFLKYLCCEMVSSLSRL
                     NWKIINIYLTEEHRNKLLRTKYEILALALMAQDPDMIVKIRTEKYIVLD"
     gene            <305664..>306110
                     /gene="TPHA0C01340"
                     /locus_tag="TPHA_0C01340"
                     /db_xref="GeneID:11533805"
     mRNA            <305664..>306110
                     /gene="TPHA0C01340"
                     /locus_tag="TPHA_0C01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684676.1"
                     /db_xref="GeneID:11533805"
     CDS             305664..306110
                     /gene="TPHA0C01340"
                     /locus_tag="TPHA_0C01340"
                     /inference="similar to DNA sequence:INSDC:YER044C"
                     /note="similar to Saccharomyces cerevisiae ERG28
                     (YER044C); ancestral locus Anc_7.207"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684724.1"
                     /db_xref="GeneID:11533805"
                     /db_xref="GOA:G8BRB4"
                     /db_xref="InterPro:IPR005352"
                     /db_xref="UniProtKB/TrEMBL:G8BRB4"
                     /translation="MLSVKDVIDFTTARLAQLPPGYLPKWLLFISVVSVFNSIQTYIS
                     GLELTRRVYERQPTQTTELSARTFGTWTFVSCVIRFYGAFFINEEHIFQLTFISYLIA
                     ITHFGSEWLIFGTCKFGKGLLGPLVVATTSLTWMYNQKEYYTGLPW"
     gene            complement(<306428..>307807)
                     /gene="TPHA0C01350"
                     /locus_tag="TPHA_0C01350"
                     /db_xref="GeneID:11535292"
     mRNA            complement(<306428..>307807)
                     /gene="TPHA0C01350"
                     /locus_tag="TPHA_0C01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684677.1"
                     /db_xref="GeneID:11535292"
     CDS             complement(306428..307807)
                     /gene="TPHA0C01350"
                     /locus_tag="TPHA_0C01350"
                     /inference="similar to DNA sequence:INSDC:YIL033C"
                     /note="similar to Saccharomyces cerevisiae BCY1 (YIL033C);
                     ancestral locus Anc_7.206"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684725.1"
                     /db_xref="GeneID:11535292"
                     /db_xref="GOA:G8BRB5"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR002373"
                     /db_xref="InterPro:IPR012198"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018488"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:G8BRB5"
                     /translation="MPFSKEQEHFLNEFKEFILSNNPKGDLLQFGFNYFNEKLANERK
                     LFLRNTYDEEHDETRNSIFKSPFAASQSRSTSVISNQRNSIVNRSTVVGTASTKGQRQ
                     GGDADSESDNPFKSDFSVCQSNDIKKSDSPLDPSTKRNSIQQPHPSSIQQPHHSNNNQ
                     QDINNSIHISSEIPRNFNALRRTSVSAESFEPRSFEQDWKPEHYSEKSPEQMRRLENS
                     IGKNFLFNSLDFDSKKLVINSLEEKKVPNGSEIIKQGDDGDYFYVVEEGNVDFFVNDE
                     KVGSSSVGSNFGELALMYNSPRAATVIATSDCILWALDRLTFRKILLGHSFKKRIMYE
                     DFLKSVPILSSLTDYNRAKIADALEIETYSNGQVIIREGDTGENFYFIENGTASVTKE
                     KEGVVAQLKSHDYFGEVALINDLPRQATVTATSDLKLATLSKSAFQRLLGPVVDVLKL
                     NDPTRTHQH"
     gene            <309327..>310937
                     /gene="TPHA0C01360"
                     /locus_tag="TPHA_0C01360"
                     /db_xref="GeneID:11535298"
     mRNA            <309327..>310937
                     /gene="TPHA0C01360"
                     /locus_tag="TPHA_0C01360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684678.1"
                     /db_xref="GeneID:11535298"
     CDS             309327..310937
                     /gene="TPHA0C01360"
                     /locus_tag="TPHA_0C01360"
                     /inference="similar to DNA sequence:INSDC:YFR037C"
                     /note="similar to Saccharomyces cerevisiae RSC8 (YFR037C);
                     ancestral locus Anc_7.204"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684726.1"
                     /db_xref="GeneID:11535298"
                     /db_xref="GOA:G8BRB6"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:G8BRB6"
                     /translation="MAEQESATTPMSKADSVENMTSINLDTATAVQSQASTEEKKMDY
                     DNEAQKLEDKALVFLIKQSRPVMIPDFAKWFDINKIHEIEKKSLPEFFNETSRFKTEK
                     AYKDTRNFIINTYRLSPFEYLTMTSVRRNIAMDISSIYKIFKFVEKWGLINYRIDPRS
                     KSSIMGPSFTGHFKVLLDTPDGLKPHVPMASEVSKKRTRDDIEYLDSLTNNNLAIRKN
                     IYDELQDFNSFKSADKSSTQIHRTFICHVCSNDSIDVYYHNLRLREANLCVNCYEINH
                     FTDNFNKEDYVKLDINAQPDTNWSDQEVVLLLEGLEMYENDWDKIIKHIANNKTIEQC
                     IEKYISLPIDDKDLKEFVRRMKAKQIAQNEKLDTKKTPLDDEKLRLITKTINSLKLSL
                     EKNIDEKSARDDEKTNELIKESQPVIEELKNTALSKIDTEFKKLYELERKLKMSLDSY
                     TKEHENLTNDRMMLSKQILSINKELSNSNVEKKIILTSSSSNGIQIKLLNKQNEINEN
                     KQKLEKLKATEIESISHSDIKKYAVVSL"
     gene            <311362..>312597
                     /gene="TPHA0C01370"
                     /locus_tag="TPHA_0C01370"
                     /db_xref="GeneID:11533444"
     mRNA            <311362..>312597
                     /gene="TPHA0C01370"
                     /locus_tag="TPHA_0C01370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684679.1"
                     /db_xref="GeneID:11533444"
     CDS             311362..312597
                     /gene="TPHA0C01370"
                     /locus_tag="TPHA_0C01370"
                     /inference="similar to DNA sequence:INSDC:YIL023C"
                     /note="similar to Saccharomyces cerevisiae YKE4 (YIL023C);
                     ancestral locus Anc_7.203"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684727.1"
                     /db_xref="GeneID:11533444"
                     /db_xref="GOA:G8BRB7"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="UniProtKB/TrEMBL:G8BRB7"
                     /translation="MSLCKLLAAIATIGFTVAHSDSNVENVNGSTNITLLKEINHKHV
                     HSHDHIQGTFNGLGLFGVNIVKHIEEYIFRYSTRCNALLATFFLQIAPFIILGVIPTF
                     RNMKEDSLLLHISSSFAVGTLFGDLFLHLIPETLSETNDETKMQSSMLAIFVGFMMFF
                     FLDKIIRIITFDPNNPEESKNDSHSHSHSSSSLEPELINTQSSATSTGLKENDDSKII
                     NRKVSQKKRTTDDQIVEKNDTKINSKKNNVTVFLNVFSGFVHNITDGIALSSAFYSSK
                     HTGVVTTIAVLFHEFPHELGDFAILMSNGLTFVQAIKSQIFTSIGAITGAVIGCAINE
                     LSKSNSSGPDNALHNDNNTIFDDMMPITTGWFLYIATVGTIPSLVVISRETQFQELKM
                     FFLQLACISVGFYLMSQIS"
     gene            <313036..>313725
                     /gene="TPHA0C01380"
                     /locus_tag="TPHA_0C01380"
                     /db_xref="GeneID:11533759"
     mRNA            <313036..>313725
                     /gene="TPHA0C01380"
                     /locus_tag="TPHA_0C01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684680.1"
                     /db_xref="GeneID:11533759"
     CDS             313036..313725
                     /gene="TPHA0C01380"
                     /locus_tag="TPHA_0C01380"
                     /inference="similar to DNA sequence:INSDC:YIL024C"
                     /note="similar to Saccharomyces cerevisiae YIL024C;
                     ancestral locus Anc_7.202"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684728.1"
                     /db_xref="GeneID:11533759"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:G8BRB8"
                     /translation="MITIVDSKFIEFAIPHPLIEKEINFTIEDIIITGDFDNWTAKDY
                     HLRLDDKGYYRVRIPVAESKKDTIFKFQINGYIWTTFEFFNITHDFEGHTNNIIQCGD
                     CKNLDKNGKLTRTRLNDSIRFNEVTDYMAITNSANYNKNISNGLETSENSDAYINISS
                     TSELSSIEDINLDFQEYDEENIDSTLVLDNNIPPSNINVFPNNYETLYFNTENKFNFD
                     MITKRVRTLFK"
     gene            <314359..>317730
                     /gene="TPHA0C01390"
                     /locus_tag="TPHA_0C01390"
                     /db_xref="GeneID:11533770"
     mRNA            <314359..>317730
                     /gene="TPHA0C01390"
                     /locus_tag="TPHA_0C01390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684681.1"
                     /db_xref="GeneID:11533770"
     CDS             314359..317730
                     /gene="TPHA0C01390"
                     /locus_tag="TPHA_0C01390"
                     /inference="similar to DNA sequence:INSDC:YIL026C"
                     /note="similar to Saccharomyces cerevisiae IRR1 (YIL026C);
                     ancestral locus Anc_7.201"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684729.1"
                     /db_xref="GeneID:11533770"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013721"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR020839"
                     /db_xref="UniProtKB/TrEMBL:G8BRB9"
                     /translation="MSTLRRSTRTRSKPSTITDLGSDDDSSNESGVLSTVQQDDRTVM
                     TDLSDEESSSDVDNNDDDDYEDPSTAKKSKKRKAPVRTKTSRSNIRPVKKAKKQAETN
                     LTVNKPPSNTGTRKEQEEYLEVIKDFEPTELFDILANDENVSIEEIIRNYLDGYIENR
                     ATFIAEFINFLLCCCGAVVRVEEHDVSNNETANETISELQMMFQQQKIHEAFLLVSKN
                     NKRRSKYKPLYQNFVEFMSKLIQIANDMQLLFTESEDSDSEIGPNQFVIDLLTWLSSL
                     SVSKIRCLRQIATSCLYLLQDSLTEYIVEIEKNYLSKLTKQLTQEKKRKRPSEKTIER
                     LEESVTELQANQQVIEGVIDNIIKLCFLHRFKDVDENIRGESVLHLSVWINNYPEFFL
                     KVTYLKYFGWLLSDSSVYVRQQVLKTLPQLIASQNNKTNSNSSIRQFFERFKEKILSI
                     ALHDVDLEVRLYSINVFVEVSSLGYLEDLEILQISSLIYYDEEVKVQSHAKSSRFLAA
                     VAKFFGRVLIEKNSEFSSNYVLEDEIFGLNSESLVKAGNLVGLLNKSLSYHFQNNENP
                     SSKLKLKKLFQAAEFLHPYFGTLIEDICKLLTYKDDISYDFLNIEDEEEDTIIKKEFI
                     LPVDTKSIVLYSTTLNGLCHGVSVQQGQAKFRVAEEVLPFFETLLSQLPIHIADILIP
                     LLSIFNLFKFEEWIHSGCEKNMSNILSKVMRTFNEMDISLKHDDLVTKWFAKTFELVK
                     EMDITNLNDILINEVSSLMLHLQKFLTDKLDPSDYDSDFNELTTILYETYLNKLVLLG
                     RSYSIELDSDFLKLFMENFISRLPIIFEYLNQETISVINFKFLTQFVTWNLQTWTDTI
                     KNSLSTSHNTVGVPKDKIMMIASIIERLNTILVSSGHTRSGEIEESVKKFLLHWNICN
                     ALADIVSTLKVFEYSLPDNLKLWKEAFEDNFPYFLQEGASKCFTDVYIFLESITAKSL
                     DIYIDRLAGEDININEVSLENVISLPESEFLLFTIKLKGLIKLKLISNQVEERLQINK
                     EKFGSLYEKIVDNSIFERDQQNDIIHEENATHQTKATLVSSSSAGDEFDPIENPTQEE
                     EVANAIVTNTNDDDIADDVDDISMMDNDHIETSEI"
     gene            <318129..>318542
                     /gene="TPHA0C01400"
                     /locus_tag="TPHA_0C01400"
                     /db_xref="GeneID:11533943"
     mRNA            <318129..>318542
                     /gene="TPHA0C01400"
                     /locus_tag="TPHA_0C01400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684682.1"
                     /db_xref="GeneID:11533943"
     CDS             318129..318542
                     /gene="TPHA0C01400"
                     /locus_tag="TPHA_0C01400"
                     /inference="similar to DNA sequence:INSDC:YIL027C"
                     /note="similar to Saccharomyces cerevisiae KRE27
                     (YIL027C); ancestral locus Anc_7.200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684730.1"
                     /db_xref="GeneID:11533943"
                     /db_xref="InterPro:IPR018937"
                     /db_xref="UniProtKB/TrEMBL:G8BRC0"
                     /translation="MGSLSKGLIVVSLLQLFHAGFSSSEFQQLLKTQQLHKYLNEAGL
                     PLDIKLEVFMGLIIFVIGIFLSFEKLQFQPIELTRPTVITGEYLSDIRYRKATNVENL
                     TGSNLEGQIIYTSNLTDVHQKRKECRDWMNENTAK"
     gene            complement(<318641..>319015)
                     /gene="TPHA0C01410"
                     /locus_tag="TPHA_0C01410"
                     /db_xref="GeneID:11533919"
     mRNA            complement(<318641..>319015)
                     /gene="TPHA0C01410"
                     /locus_tag="TPHA_0C01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684683.1"
                     /db_xref="GeneID:11533919"
     CDS             complement(318641..319015)
                     /gene="TPHA0C01410"
                     /locus_tag="TPHA_0C01410"
                     /inference="similar to DNA sequence:INSDC:YFR036W"
                     /note="similar to Saccharomyces cerevisiae CDC26
                     (YFR036W); ancestral locus Anc_7.199"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684731.1"
                     /db_xref="GeneID:11533919"
                     /db_xref="GOA:G8BRC1"
                     /db_xref="InterPro:IPR018860"
                     /db_xref="UniProtKB/TrEMBL:G8BRC1"
                     /translation="MLRKAATTLQLEEHDVTELIAELEEEKLQVQLQSQRKNLLRTST
                     ENNYNGLADSSINSINQEVQTSQLRNGEMSNQTASLFQTSPIDNTKHYPSIPERSVDT
                     KNSNNNQNHNNEYNPFYNQRNE"
     gene            319615..319687
                     /gene="TPHA0Ctrna2K"
                     /locus_tag="TPHA_0Ctrna2K"
                     /db_xref="GeneID:11533613"
     tRNA            319615..319687
                     /gene="TPHA0Ctrna2K"
                     /locus_tag="TPHA_0Ctrna2K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:11533613"
     gene            <320497..>324510
                     /gene="TPHA0C01420"
                     /locus_tag="TPHA_0C01420"
                     /db_xref="GeneID:11535304"
     mRNA            <320497..>324510
                     /gene="TPHA0C01420"
                     /locus_tag="TPHA_0C01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684684.1"
                     /db_xref="GeneID:11535304"
     CDS             320497..324510
                     /gene="TPHA0C01420"
                     /locus_tag="TPHA_0C01420"
                     /inference="similar to DNA sequence:INSDC:YIL030C"
                     /note="similar to Saccharomyces cerevisiae SSM4 (YIL030C);
                     ancestral locus Anc_7.198"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684732.1"
                     /db_xref="GeneID:11535304"
                     /db_xref="GOA:G8BRC2"
                     /db_xref="InterPro:IPR011016"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G8BRC2"
                     /translation="MNTDQPIFMRSEKSIDTDSFSKKKATDDYNTIPHEATCRICKDE
                     GSFENPLFHPCKCKGSIKYIHESCLKEWVASKSVNINIPGATINCDICHHPMQFKTIY
                     ADNMPEKIPILLLLKRSLMLFLQQIKISVLMAFGVLLFIVGLPLSWNFFGKLLTFLLD
                     GELPFEGQLWHSLLIGYVNYEEFPEKITLTNFHDYLFQILKSIKFSALQIVLVMIIHI
                     ALYFQYDMIVRENVFSKMVFHKIGPQYSKDELFKKQLKERFPLMDDETIEHAVQLMRL
                     RNDREEQEKIRQGNEAAQAEIDEENRMNNNNDRDNFQRDEQENDDDNDDELDSDYVDD
                     GEEINSDVHSSDTDISDENDEVNEADEVNDIDEFMGYEEPFHERLMNRRAQHRFNNLL
                     DEHLERRNNRVENEDDVFVVERPEEVRQAQGEANLDDESNIPAPHNNHDNNNNNNNNG
                     IVPPVVELPQPQDAPVVIDINEEDNLNAPLLINIKFNIYNILVYFVIGFVTTFAYLGV
                     SYFIPSVVGFILIRLYLAIAHILILGATSLMNVCKVPAFHEYLLTNFSYFNILNEWIS
                     IKLLQVYYQYYHGFRTGSMPHSVIVRSIPALTTYLTVICITCALPNIISRGYSTENGM
                     KNSTKRLLFQIFFAIKCTFKVFTLFFIEIVGFPISAGLMLDISLLCPLFGQQDTWVVV
                     PKLIRYWQILLLFVYWCVGTLYMYWFAKYIGMIRHHIIRPGVLFFIRSPDDPNIKILH
                     DSLIHPMSIQLSRLCLSIFIYALFIIVGFGFHERFLFPLVLNSRLISARSDLTDHPME
                     VALIIIFSLLAKRIVESKIAVKHYVRKYWEKVFEISSSKLRLTSFIIGKDAPTERGYI
                     VYRNIFYKIFMSGKAKWSNPDLFSNPKTLQQAQTLFMENKTIHAYFVPDGSLIRVPSS
                     DIISRNYVQTLFVPVTKNDKLIMPLDLNRIVERNKKNAGEFGYLDEQSTEFDEYTIVY
                     VPPNFTSRYITLIFMLWIFASILLIMSAVTSELALYIILKLAILPFSKLSFMKNSYII
                     EFLNYHFIWDYSELNLMYVTIGAIILSVLVDKYYLYDLYKTKLQEHIIPIENEEDDVA
                     RQNEVNQQLANDIEFNFFDFSETINAVIESFLFKYLAFSCFTLVTAAIEYKSIEFIYK
                     QLIINGFNYLLINQPNLVYSLFGRFMEIKHISDDSIQNNVYLLYAMRTHSAIITGRGI
                     RLFLLVKDRPFRSMMSALFSELKANLGITIHCTIPIILLWLNVSTVEYYLHPENYASF
                     TAVFMFLWHLRLSPNISSEWTVIQHACFIVPILIILFYTIWKTISHSRKWLGTAVQNV
                     KDEIYARGRLLENFDQN"
     gene            complement(<324934..>326811)
                     /gene="TPHA0C01430"
                     /locus_tag="TPHA_0C01430"
                     /db_xref="GeneID:11533807"
     mRNA            complement(<324934..>326811)
                     /gene="TPHA0C01430"
                     /locus_tag="TPHA_0C01430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684685.1"
                     /db_xref="GeneID:11533807"
     CDS             complement(324934..326811)
                     /gene="TPHA0C01430"
                     /locus_tag="TPHA_0C01430"
                     /inference="similar to DNA sequence:INSDC:YIL031W"
                     /note="similar to Saccharomyces cerevisiae ULP2 (YIL031W);
                     ancestral locus Anc_7.197"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684733.1"
                     /db_xref="GeneID:11533807"
                     /db_xref="GOA:G8BRC3"
                     /db_xref="InterPro:IPR003653"
                     /db_xref="UniProtKB/TrEMBL:G8BRC3"
                     /translation="MSRRLTKINSIAPIDNLTTTNKTLHRVKKNNYQQPAHTSSKRYQ
                     DFRNDAKKKIRSSRDFIPDVVNIKNKNSLSRDELIDKKSQNGIKQRVEVSGSIELIEG
                     KTNKILSDPFSKSCVMSFIYDDNGLRCDFKFKQLPIAGLQFNIKDDCDEIATEDTNVY
                     MGFRFTHLKEVKIGKNESINMKGLIFITTAIYRQKLIKIRRLAASCPAQYRPKICMYS
                     NKTELKFKLISNNRTDHMKNKPSFLEKGFNSLVKNTNTKKRTIDSMVTSAVKIKILKK
                     APEEEVKNIAIENAEPNNQVQSLLGNSKRVSRSSLQSTVVNEKETISDEVQINFQPSL
                     NYHFKDGVSYTINNQDFKSLYNNDWVNDTIIDFFIKYYLETNLIDSKLKDDIYVMSSF
                     FYTKLVSNGIDDVYTKVKKWVEHSKLFSKSYVIIPINSNYHWFVCIITGMVEYLKYWE
                     NKSTIENEDKKSNPPIIQIGLLDSLKQVHNKDIEYIKQFIMAYAKDKYSLNIDKNNIK
                     KKTCLVPRQPNMNDCGVHLIDNIKKFSEKPDETIELWSRLKADNSYNLKQVNDFFDKS
                     ERKYSRQTLRKILIELQKEQIKSTPKNTPRRTEDEDDEDIEIIENFEEPDKQSLNKVK
                     L"
     gene            <328204..>329448
                     /gene="TPHA0C01440"
                     /locus_tag="TPHA_0C01440"
                     /db_xref="GeneID:11533650"
     mRNA            join(<328204..328207,328688..>329448)
                     /gene="TPHA0C01440"
                     /locus_tag="TPHA_0C01440"
                     /product="60S ribosomal protein L2"
                     /transcript_id="XM_003684686.1"
                     /db_xref="GeneID:11533650"
     CDS             join(328204..328207,328688..329448)
                     /gene="TPHA0C01440"
                     /locus_tag="TPHA_0C01440"
                     /inference="similar to DNA
                     sequence:INSDC:YFR031C-A,YIL018W"
                     /note="similar to Saccharomyces cerevisiae RPL2A
                     (YFR031C-A) and RPL2B (YIL018W); ancestral locus
                     Anc_7.187"
                     /codon_start=1
                     /product="60S ribosomal protein L2"
                     /protein_id="XP_003684734.1"
                     /db_xref="GeneID:11533650"
                     /db_xref="GOA:G8BRC4"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR014726"
                     /db_xref="InterPro:IPR022666"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="InterPro:IPR022671"
                     /db_xref="UniProtKB/TrEMBL:G8BRC4"
                     /translation="MGRVIRNQRKGAGSIFTSHTRLRQGAAKLRSLDYAERHGYIRGV
                     VKQIIHDAGRGAPLAKVVFRDPYKYKLREEIFIANEGVHTGQFIYAGKKASLNVGNVL
                     PLGSVPEGTIISNVEERPGDRGAIARASGNYVIVIGHNTDDNKTRVRLPSGAKKVISS
                     DARGVIGVIAGGGRVDKPLLKAGRAFHKYKVKRNSWPKTRGVAMNPVDHPHGGGNHQH
                     IGKASTISRGAVAGQKAGLIAARRTGLLRGSQKTQD"
     gene            complement(<329744..>332848)
                     /gene="TPHA0C01450"
                     /locus_tag="TPHA_0C01450"
                     /db_xref="GeneID:11535248"
     mRNA            complement(<329744..>332848)
                     /gene="TPHA0C01450"
                     /locus_tag="TPHA_0C01450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684687.1"
                     /db_xref="GeneID:11535248"
     CDS             complement(329744..332848)
                     /gene="TPHA0C01450"
                     /locus_tag="TPHA_0C01450"
                     /inference="similar to DNA sequence:INSDC:YFR030W"
                     /note="similar to Saccharomyces cerevisiae MET10
                     (YFR030W); ancestral locus Anc_7.185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684735.1"
                     /db_xref="GeneID:11535248"
                     /db_xref="GOA:G8BRC5"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR002869"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR019752"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G8BRC5"
                     /translation="MVSEFVSNPFYSPENPKALPTYGTPISAILSVLHQHAGAIFSYK
                     AISDSDLFDKSLKKWVTRDINDVYFNEVDLTVNAGAAPLGYAKTSDKITGIITPGFGL
                     PYFIDSFKKNVNNSRFVFNVGTLDYDKKSCSLINDYTVPLAAAERLGFPVISPININE
                     VQATSLFAIIAAKYSTSNNVIHLFDGINLSKTVLKIQEKLTIDEQAIKEIESHLSVNP
                     TFEDVLDEFNETTGQKLHNFEYFGDRHAETVFVTYGVIENQLFKDSIEGSLSKVGLLS
                     IRIPLPFSKDRFVAHVPSTTKKIVIITQYSDNTNPCFLKSQISHALFTSNRRSISVSD
                     YLYEPTFAWTPSAVSQIVSIFVPNFESKQKFSDGKNFIFWASDKSTNLNLASRIIYGV
                     SLGDTTSISLRTKFNNIVNGGIFQAQFSANQKDSTVSISNIDNSDVTIVEDHSLLKSV
                     DVVATAKLGSTLIVLSKKTFAEKDLNNSDFFTKDLDIPENVLVKFVEKKLNLIFIDAE
                     VIGNIKNASGDELSFVTQFLFWKHAYQYDTDKAVRYIWESSCPDKELPASFIEKTILD
                     LIDSTVIEIKLDVFENVIIDKDIDQKSQLIAYLQDSSFTPNPSTVESERDITIDSSLD
                     ISKLLTFKEAYKTSSSLRPDLPVKNFVVKVKENRRITPTTYDRNIFHIEFDISGTGLT
                     YGIGEALGIHARNNETLVNEFIETYGLNGNDIISVPNKDNNRLYESRTVLQAFIENLD
                     IFGKPPKRFYESLVEFATDENEKKRLQDLIEPAGAVDLKRYQDVEFFTYADILELFPS
                     ARPPLEKLVEVIAPLKRREYSIASSQKVHPNEVHLLIVVVDWVDNKGRNRFGQASKYI
                     SDLQVGTELVVSVKPSVMKLPPNPEQPVIMSGLGTGLAPFKAIIEEKVWQKQQGYNIG
                     EVYLYLGSRHKKEEYLYGELWEAYKDAGVITHIGAAFSRDQPEKIYIQDRIRENLKEL
                     KSAMIDKQGYFYLCGPTWPVPDITAVLQDIISADAKDRGVKIDLNAAIEDLKDSSRYI
                     LEVY"
     gene            complement(<333541..>336498)
                     /gene="TPHA0C01460"
                     /locus_tag="TPHA_0C01460"
                     /db_xref="GeneID:11535302"
     mRNA            complement(<333541..>336498)
                     /gene="TPHA0C01460"
                     /locus_tag="TPHA_0C01460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684688.1"
                     /db_xref="GeneID:11535302"
     CDS             complement(333541..336498)
                     /gene="TPHA0C01460"
                     /locus_tag="TPHA_0C01460"
                     /inference="similar to DNA sequence:INSDC:YIL017C"
                     /note="similar to Saccharomyces cerevisiae VID28
                     (YIL017C); ancestral locus Anc_7.184"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684736.1"
                     /db_xref="GeneID:11535302"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BRC6"
                     /translation="MMSADYSVLVELRNKIVGDDLFKRDVILNEALTKEILDIRIEDG
                     LVEESSLKLDIIYSILFINKNVRASVLQGYKIFTTTYIENIRVNIFMNRNTLDNIDQV
                     LFYKLFKIYTVLLNDHYLDIHNLYKLNMILQDELEKYVDKCYIGNNPKEIDFCILKEI
                     LSIFEAFFRGIDPREEGVTDHFDRYRLQSSLVKSLVSLFDKYSSKINLKYSLIRESIG
                     QKNRKVEFLFDESVLKYNINQNINTFNFTADFMRISDTLDRELLILGLKLYSGLFDDN
                     IDHSIKPLGLFRSVDFTIFIRTLLSNNDIELKCASLNYLLRPFILSSEYRKDFNNIKL
                     LLPHIFATLDFNYLPCWCDPLELLYSLITKYNSNSMNNPIITYLGELHLFEGILQTFE
                     NCLKLERQTESSYKTLISILKIMASVSLNNSSYRTLIMKIDNLLLYVESALDTHYELT
                     TEFINNKGDIQKMVDHISSSSQIGNHKTSLPRIKDIEFSLACLELLKSISRSTITVRT
                     NLKRNELAILLLKLVQNSHILIKSCSFVGRNMLIDELNIMIATLGIIANLVVEFCSLQ
                     TCIMKNGILDIVNKILTNPTFTENNAWLEVNGSQLPINLRENIKENSLWILKNLIYNA
                     KNQAKLRLLNIISTETILNYVNDPSMAVQQQCFELIKNLTCNSRKIINILLNHFKEDE
                     IQTENGSVNSEGSIYFFEFLSYKLRQLNVKDQHQSKIFESILYIIVNISAVHENKKEL
                     IINEDDLLQIICEILRETEDDKEKYNNNSGFKLASLWILNNLLWNSSISQYTAYILQD
                     DHNLEKSNTEINEGVTSVANDSVSQISMVSRDLYNEREGHSESETNSASRNNSSPSSL
                     SNTNHETSYSERYESRFDGTNEEDREIDEDIEMSTSRNSTNEGSRRTLKTPDESEMVD
                     DHNDEFVRTGDSSDFPSNQLKQDMLTKRCKKLISLGLYSLVKQNIFDKSISVKEKSKS
                     LLYHMDFLLMENS"
     gene            <337155..>337862
                     /gene="TPHA0C01470"
                     /locus_tag="TPHA_0C01470"
                     /db_xref="GeneID:11534110"
     mRNA            <337155..>337862
                     /gene="TPHA0C01470"
                     /locus_tag="TPHA_0C01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684689.1"
                     /db_xref="GeneID:11534110"
     CDS             337155..337862
                     /gene="TPHA0C01470"
                     /locus_tag="TPHA_0C01470"
                     /inference="similar to DNA sequence:INSDC:YBR256C"
                     /note="similar to Saccharomyces cerevisiae RIB5 (YBR256C);
                     ancestral locus Anc_7.181"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684737.1"
                     /db_xref="GeneID:11534110"
                     /db_xref="GOA:G8BRC7"
                     /db_xref="InterPro:IPR001783"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023366"
                     /db_xref="InterPro:IPR026017"
                     /db_xref="UniProtKB/TrEMBL:G8BRC7"
                     /translation="MFTGIVEIMGIIDSYKEYDDSAAGGHGISLKIKDASKILGDCHI
                     GDSISVNGICLTVTEFDNDSFKVGISPETVRRTNVGSWKNCQKVNLERAVSVDVRFGG
                     HYVQGHIDTTAKITCIEKEGNSKIFGFKLRDDEYNKFIVEKGFICIDGASLTIIRIDN
                     DGTFYISMIKHTQDIVSMPLKNIGDEVNIEVDLTGKVIEKQITSVLEAEIEKENSIFK
                     AFVEKIVEAKMKEILQK"
     gene            complement(<338034..>339353)
                     /gene="TPHA0C01480"
                     /locus_tag="TPHA_0C01480"
                     /db_xref="GeneID:11533931"
     mRNA            complement(<338034..>339353)
                     /gene="TPHA0C01480"
                     /locus_tag="TPHA_0C01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684690.1"
                     /db_xref="GeneID:11533931"
     CDS             complement(338034..339353)
                     /gene="TPHA0C01480"
                     /locus_tag="TPHA_0C01480"
                     /inference="similar to DNA sequence:INSDC:YIR012W"
                     /note="similar to Saccharomyces cerevisiae SQT1 (YIR012W);
                     ancestral locus Anc_7.180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684738.1"
                     /db_xref="GeneID:11533931"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BRC8"
                     /translation="MESNNPEQLNPEIENAPEEEFIANNEVDQEVVVDDEAHMEEDDE
                     NDEEQLDTEENRNREDETIEIDMSNNSISYFDKHTDSIFTVFHHPTLPLVVSGGGDNV
                     ANLWTSHSHPPKFAGALTDHTESVISGGFTSDGKYLVTGDMNGKILIHASTKGGAQWK
                     LTSVLQEVEEIIWLKCHTVIPGIFAFGATNGSVWVYQINEVDGSVEPIMSGFVHTEEC
                     TMGEFINIDQGENVLELVTCSVNGTVVGWNCYTGQQTFKISQSDTKGVVAPWVSIASA
                     PTNKKNTTPIVAVGSNNGVLAIINCANGSVLHLSTVIELKEDQEELDASIESISWSTD
                     FPLLAIGLVCGDILLYDINTWRVRRKFTLEDSVTRLTFDKTDLFVSCVNGKVYQYDAR
                     TGSEKFVCCGHNMGVLDFVLLQGKDNNLRRIITAGDEGVSLIFEVPN"
     gene            complement(<341068..>342714)
                     /gene="TPHA0C01490"
                     /locus_tag="TPHA_0C01490"
                     /db_xref="GeneID:11535223"
     mRNA            complement(<341068..>342714)
                     /gene="TPHA0C01490"
                     /locus_tag="TPHA_0C01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684691.1"
                     /db_xref="GeneID:11535223"
     CDS             complement(341068..342714)
                     /gene="TPHA0C01490"
                     /locus_tag="TPHA_0C01490"
                     /inference="similar to DNA sequence:INSDC:YIR010W"
                     /note="similar to Saccharomyces cerevisiae DSN1 (YIR010W);
                     ancestral locus Anc_7.175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684739.1"
                     /db_xref="GeneID:11535223"
                     /db_xref="GOA:G8BRC9"
                     /db_xref="InterPro:IPR013218"
                     /db_xref="UniProtKB/TrEMBL:G8BRC9"
                     /translation="MPKSRSLDLKPIYPLRMETIPLSDKVKELSGSSQSATNVNIFNE
                     GEAHSSENRAKTYESDDSFKFKRHKSNQKSGVPTLGERLDNFQDIQKAKWMENFNSSM
                     PEYQNNRDDTNSDNGVDKRSSQNFKGAHTPSQQPYVPYVYYYPVPSSSYPMLPYNSPQ
                     MHENVENPQMRNGASVPMYYAPQPGYYPEQPYMFSQDSNVQNRLMPAPQLFPQYHSMN
                     PNSQLSQKSKDRRKSIADQRGRRVSRIFTQDEHLGIISPHKDVPAQDFYRHIGNSSFG
                     RDLQIRQLFNWCSIRSLHNLEKEADPKYDSDKRNRNGMKNEIRNYDDSKIIAISILKE
                     FVNDLRKDKININWDDTMQDNSDDDYSAIEGDDIDSTFDEHIFDDTEDIIKTGNNAKK
                     EIKKSAKRRSRKDKKEKVKIANIKNIENQRNLNLLDSKIDKYKLEMDNWSDTLKSQDW
                     EAEWDALEKEVELMANDENMMSDAENLPFQIFEDKFFSQIDKLSSHAILLEATTKALS
                     ELTMSKTEMLSHEFNKHNSFDKTELNSKALLMELSNALNK"
     gene            complement(<343316..>343678)
                     /gene="TPHA0C01500"
                     /locus_tag="TPHA_0C01500"
                     /db_xref="GeneID:11533477"
     mRNA            complement(<343316..>343678)
                     /gene="TPHA0C01500"
                     /locus_tag="TPHA_0C01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684692.1"
                     /db_xref="GeneID:11533477"
     CDS             complement(343316..343678)
                     /gene="TPHA0C01500"
                     /locus_tag="TPHA_0C01500"
                     /inference="similar to DNA sequence:INSDC:YBR253W"
                     /note="similar to Saccharomyces cerevisiae SRB6 (YBR253W);
                     ancestral locus Anc_7.174"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684740.1"
                     /db_xref="GeneID:11533477"
                     /db_xref="GOA:G8BRD0"
                     /db_xref="InterPro:IPR009332"
                     /db_xref="InterPro:IPR016530"
                     /db_xref="UniProtKB/TrEMBL:G8BRD0"
                     /translation="MSNQVLYERLGQSTELISTKLIELIKYSSVDETLEENEDKFQEN
                     SKITSATTSILMVNNQTTQLIKGIQDLLVLSRTIREKWLLNQIPEETTEQEGIDKQEL
                     DNLKELLKKTMNEIVGQE"
     gene            complement(<344320..>345504)
                     /gene="TPHA0C01510"
                     /locus_tag="TPHA_0C01510"
                     /db_xref="GeneID:11535325"
     mRNA            complement(<344320..>345504)
                     /gene="TPHA0C01510"
                     /locus_tag="TPHA_0C01510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684693.1"
                     /db_xref="GeneID:11535325"
     CDS             complement(344320..345504)
                     /gene="TPHA0C01510"
                     /locus_tag="TPHA_0C01510"
                     /note="ancestral locus Anc_7.169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684741.1"
                     /db_xref="GeneID:11535325"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:G8BRD1"
                     /translation="METNMNLPPIRDLLFTTTEPLTSFTERQTSNPTLQQNGIHHQMA
                     YSSNYGMSPRYLNPSYNSTLMDPTYKILIPPLTSPEIHAFNPSSTPFVRSYSSLSSGF
                     SEASLLKLRQSSISGQANIKKDYVTTKQTYEMEPLSIQRPLIKSSMEFSSFPNKNEGL
                     PSPLLDNSQLSVKLETPLVESPKKSDTLNKSNQLDHLNSVLLKRCRCRNYTKAGKHIP
                     RPRNAFILFRQQMHGEMFGKYKNLLVSHGSFKTNSIISKEIGQKWRALSDKEKERWHE
                     LAKKEKEEHKLKYTDYKYIPRRTETFKNATITENFPSVEFNNYKNKIKSKVDELGNIK
                     TNDNDKGRDRKLEEGRELCEYCTLRKKDLVSNNNINASKKKKVIKKSQIKEVKTIEEI
                     QA"
     gene            <349034..>351388
                     /gene="TPHA0C01520"
                     /locus_tag="TPHA_0C01520"
                     /db_xref="GeneID:11533982"
     mRNA            <349034..>351388
                     /gene="TPHA0C01520"
                     /locus_tag="TPHA_0C01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684694.1"
                     /db_xref="GeneID:11533982"
     CDS             349034..351388
                     /gene="TPHA0C01520"
                     /locus_tag="TPHA_0C01520"
                     /inference="similar to DNA sequence:INSDC:YER017C"
                     /note="similar to Saccharomyces cerevisiae AFG3 (YER017C);
                     ancestral locus Anc_7.168"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684742.1"
                     /db_xref="GeneID:11533982"
                     /db_xref="GOA:G8BRD2"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR011546"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BRD2"
                     /translation="MIHMYRKEGLLLSRNLSNIAFKRGISSSIQSQFTSLTLIKTTKL
                     PNLTNRASVINILNHSRSFHVSSYTNFKNTQYALKQDNSNDNSNGDKKKDQQDNKGKN
                     SKKSGQNEDEPPNIMNYFKSREFLNTMLLSIGFSFMFAMTSSSGDNNLNEPLTFQDFK
                     IKYLEKGLVKKIYVINKYLVEAELISALSTGNNPTIVSFTIGSVPVFEEEMEAVQNKL
                     NISAKDRIPIIFTDRYSLFHYLFPFVPTLILLGGLYYITKKMNPGGANPNMGGSGGIF
                     GVGKSKAKLFNKETDIKVAFKDVAGCNEAKQEIMEFVHFLKNPKKYTDLGAKIPRGAI
                     LSGPPGTGKTLLAKATAGEAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARTMAPSI
                     IFIDEIDAIGKERGKGGALGGANDEREATLNQLLVEMDGFQTSDQVIVLAGTNRPDVL
                     DKALMRPGRFDRHIEIDPPDVEGRKSIYLVHLSKLNLDPSFLKTKHDKEMLAGKLAAL
                     TPGFAGADIANACNEAALIAARYNDEYVEMRHFEQAIERVIAGLEKKSRVLSPQEKKT
                     VAFHEAGHAVCGWYLEYADPLLKVSIIPRGQGALGYAQYLPDDRYLYTEEQFKHRMVM
                     TLGGRVSEELHFPSVTSGAHDDFNKVTNMARSMVTALGMSPKLGYVCYDTDANQGGYQ
                     VNKPFSEQTERTIDLEIKRIIDEAHEICKKLLTENIEKVDKVANELLTKESITREDMI
                     RLLGPRPFPERNAAFEKYLDPQGANSQIAKNPKDPEGNISPAPN"
     gene            complement(<351607..>352626)
                     /gene="TPHA0C01530"
                     /locus_tag="TPHA_0C01530"
                     /db_xref="GeneID:11534115"
     mRNA            complement(<351607..>352626)
                     /gene="TPHA0C01530"
                     /locus_tag="TPHA_0C01530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684695.1"
                     /db_xref="GeneID:11534115"
     CDS             complement(351607..352626)
                     /gene="TPHA0C01530"
                     /locus_tag="TPHA_0C01530"
                     /inference="similar to DNA sequence:INSDC:YER016W"
                     /note="similar to Saccharomyces cerevisiae BIM1 (YER016W);
                     ancestral locus Anc_7.167"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684743.1"
                     /db_xref="GeneID:11534115"
                     /db_xref="GOA:G8BRD3"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR004953"
                     /db_xref="InterPro:IPR027328"
                     /db_xref="UniProtKB/TrEMBL:G8BRD3"
                     /translation="MSNIGESRTDLLNWLNELLQLNYRKIEECGTGAAYCQIFDSIYG
                     DVPMHRVKFNATAEYDFQTNYKILQSCFTKHQIEKTVYVDKLIKCRFQDNLEFLQWTK
                     RFWLQNKDEAPYDPNSRRKFKSTISSTPNTSNNGVIKNKKSTYGLSASSNAANIMGSS
                     RVSSFGASRKASSEQLLSLQTELSNSHMKITNLNDELTNYKNSLDIMERERAFYFGKL
                     RDIEILVQSTEDLIKEGIYNANSNSNSDELYKFIKKVQKILYATEEGFEVNDGDEGRI
                     EDKYATSSDQRHQSASNDVINNNANDNDRNNEQLGLMPPASMGTEIDTTNLASQNLII
                     DEETF"
     gene            complement(<353054..>355315)
                     /gene="TPHA0C01540"
                     /locus_tag="TPHA_0C01540"
                     /db_xref="GeneID:11533626"
     mRNA            complement(<353054..>355315)
                     /gene="TPHA0C01540"
                     /locus_tag="TPHA_0C01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684696.1"
                     /db_xref="GeneID:11533626"
     CDS             complement(353054..355315)
                     /gene="TPHA0C01540"
                     /locus_tag="TPHA_0C01540"
                     /inference="similar to DNA sequence:INSDC:YER015W"
                     /note="similar to Saccharomyces cerevisiae FAA2 (YER015W);
                     ancestral locus Anc_7.166"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684744.1"
                     /db_xref="GeneID:11533626"
                     /db_xref="GOA:G8BRD4"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="UniProtKB/TrEMBL:G8BRD4"
                     /translation="MGNQNKKDYSLVDLINNDPSYKGLKKNLDGFKKGSDEYYLQLFD
                     ELPLSSWPDYKTFLKNQAIQINDPLDIMDENTNEYSKTFRSSLSKDNLISCFDTKGMA
                     TIYDHFQFIVRNFPDNDCLGVRPTNPETGELEEFYSYQTYKKVNQRAQDLASGIMTIV
                     NSKRKKKLSKNDFIVSILSYNRPEWALLDIACQFYSLPNTSLYETLGPETSEYILNLT
                     ETPILFFAKSNLYKIIDMLPDLKYLNTLVCMDELPAEELNILNSSILGKFTNINNESI
                     TLFNFSDVENLGKISIVPISPPTLDDLYTISFTSGTTGVPKGVEMLHRNISSGIAFAF
                     SIFKTPEHKKGLQLHDICFLPLAHIFQRMILAYDLSRGVGIGFLHKPDPLVLVEDLQV
                     LKPDFASFVPRILTKFETGIKNALEKSGFQKNVASNIISNKKTRVTARGGHDRSVVNY
                     LVYHRILIDKIRKSLGLSNISYVVTGSAPISKSTLLFLKSSLDIGIRQGYGLTESFAG
                     ISLSEPFERDFGSCGAIGISSECRLKSVPSMGYNAKKDLKGELQLRGPQIFTKYFKKP
                     IETSEVLDKDGWFSTGDIAYIDEKGRLYVIDRVKNFFKLSQGEYVAPEKIENIYLSSC
                     PLITQIFVYGDSLHSYLTGIIGIDVEAVNKLMKEEFPEMSTWNDETLILNLNTNSSMR
                     KKLLVLINSYLKTLQGFEKLHNIKVGIEPLQIADDVITPTLKIKRAKASVVFKESLTD
                     LYNEGSLIKNGNL"
     gene            complement(<356145..>356495)
                     /gene="TPHA0C01550"
                     /locus_tag="TPHA_0C01550"
                     /db_xref="GeneID:11535283"
     mRNA            complement(<356145..>356495)
                     /gene="TPHA0C01550"
                     /locus_tag="TPHA_0C01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684697.1"
                     /db_xref="GeneID:11535283"
     CDS             complement(356145..356495)
                     /gene="TPHA0C01550"
                     /locus_tag="TPHA_0C01550"
                     /inference="similar to DNA sequence:INSDC:YIR009W"
                     /note="similar to Saccharomyces cerevisiae MSL1 (YIR009W);
                     ancestral locus Anc_7.165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684745.1"
                     /db_xref="GeneID:11535283"
                     /db_xref="GOA:G8BRD5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR024888"
                     /db_xref="UniProtKB/TrEMBL:G8BRD5"
                     /translation="MTEPAKKKQKTTPGQVAHPKDKPKGTKKSIPKSTLYINNLSDGI
                     GSKNLRTNLFLLFSVYGEVIKISVNTKRQRGQAFIRMKNVDQANLAKVSLNGEIFFDK
                     QLQIEFSANEMKAV"
     gene            complement(<356865..>360320)
                     /gene="TPHA0C01560"
                     /locus_tag="TPHA_0C01560"
                     /db_xref="GeneID:11534094"
     mRNA            complement(<356865..>360320)
                     /gene="TPHA0C01560"
                     /locus_tag="TPHA_0C01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684698.1"
                     /db_xref="GeneID:11534094"
     CDS             complement(356865..360320)
                     /gene="TPHA0C01560"
                     /locus_tag="TPHA_0C01560"
                     /inference="similar to DNA sequence:INSDC:YER013W"
                     /note="similar to Saccharomyces cerevisiae PRP22
                     (YER013W); ancestral locus Anc_7.163"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684746.1"
                     /db_xref="GeneID:11534094"
                     /db_xref="GOA:G8BRD6"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BRD6"
                     /translation="MSMQKENIIKILGTDDDTVINFIKNINGNSETLEEFQKKIKNLD
                     VGLSLENINKLYNLLNEVHSIPVENNDRTQQSLVNYTDSGKQTTINDRINDILQREIG
                     INDIYVTNFILDIMNTSKDYESFEKKMNDLDVGISTQNIKSLFKLKEPKSNTIENNIT
                     HIKWGDLSKNKNTVSEVKFNPFLSKKQQPQDIKVNGILKGRVRKITSFGCFINIKTSQ
                     SENKDGLLHISEMSNEKIGTPNDLVKTGDMVWVKIITIHENGKISLSMKNIDQQSGKE
                     IINEANIGQDERGRSKEHKKENIRRRKLTSPERWEIQQLIASGAASIDDYPELKLETK
                     VQVDKHYRQKDVTSVQNPDKQVNSQVDEDEPVEIELNHNWKPAFLKNETKNISKKFEM
                     PKINNVPKGSMRRIAMGESQLMREHRDQKFKKKALEQELRSYINMDDPNKDPEEIRRK
                     IKDLKEKMVLTEWERNRMGKKIRYGKRSSKPISVQRQSLPVFKMRSELIHAIRNNQFL
                     VIVGETGSGKTTQITQYLNEDGFADHGIIGCTQPRRVAAVSVATRVAEEYGCRLGDEV
                     GYTIRFEDVSSPKTKIKYMTDGILQIEALTDPLMSKYSVILLDEAHERTVATDVLFAL
                     LKDAVKKRPDLKVVITSATLDSMKFSEYFDNCPVITIPGKTFPVEVLYYDAPNMDYIE
                     SSLDTVMQIHINEGPGDILVFLTGQEEIDTCCEILYSRVKELGDAIGDLIILPIYSAL
                     PSELQSKIFESTPKGSRKVVFATNIAETSITIDGIYYVIDPGFSKINIYNPKVGIEQL
                     VVSPISQAQANQRKGRAGRTGPGKCYRLYTESAFYHEMSSTTTPEIQRQNLSHTILML
                     KSMGIENLLEFDFMDPPPKHILISALEELYHLQALDTEGKLTSLGHRMSQFPMEPALS
                     RTLLSSVKNGCSDDIITIISMLSVQNVFYRPKEKQQEADQKKAKFFHPYGDHLTLLNV
                     FIRWKQANYNENFCTMNFLHYRHLNKAKDIKQQITLIFKKLNLTMTVCYGDPDLIRKT
                     LVSGYFMNAAKRDSQVGYTTVVGNTSVAIHPSSSLYGKDYDYVIYNSLVLTSREYMSQ
                     VTSIEPQWLLECAPHFYKKINQNSMSRKKIKIEPLYDRYSKDQDSWRLSSIRQSREKA
                     LGIKR"
     gene            complement(<360745..>361332)
                     /gene="TPHA0C01570"
                     /locus_tag="TPHA_0C01570"
                     /db_xref="GeneID:11533642"
     mRNA            complement(<360745..>361332)
                     /gene="TPHA0C01570"
                     /locus_tag="TPHA_0C01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684699.1"
                     /db_xref="GeneID:11533642"
     CDS             complement(360745..361332)
                     /gene="TPHA0C01570"
                     /locus_tag="TPHA_0C01570"
                     /inference="similar to DNA sequence:INSDC:YER012W"
                     /note="similar to Saccharomyces cerevisiae PRE1 (YER012W);
                     ancestral locus Anc_7.162"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684747.1"
                     /db_xref="GeneID:11533642"
                     /db_xref="GOA:G8BRD7"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8BRD7"
                     /translation="MDIILGIKVKDSVILATSKAVTRGISVLKDDDDKSRELSTHTLM
                     TFTGEAGDTVQFAEYIQANIQLHDIRENYELSPNAVSSFVRQELAKSLRTRKPFQVNV
                     LIGGYDIKTESPELYQIDYLGTKVSLPYAAHGYSGFYTFSLLDHHYRSDMTTEDGLKL
                     LKLCIEELERRMPVDFKGVIVKIVDKEGIRVVDDL"
     gene            <361999..>363249
                     /gene="TPHA0C01580"
                     /locus_tag="TPHA_0C01580"
                     /db_xref="GeneID:11535260"
     mRNA            <361999..>363249
                     /gene="TPHA0C01580"
                     /locus_tag="TPHA_0C01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684700.1"
                     /db_xref="GeneID:11535260"
     CDS             361999..363249
                     /gene="TPHA0C01580"
                     /locus_tag="TPHA_0C01580"
                     /inference="similar to DNA sequence:INSDC:YIR008C"
                     /note="similar to Saccharomyces cerevisiae PRI1 (YIR008C);
                     ancestral locus Anc_7.171"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684748.1"
                     /db_xref="GeneID:11535260"
                     /db_xref="GOA:G8BRD8"
                     /db_xref="InterPro:IPR002755"
                     /db_xref="InterPro:IPR014052"
                     /db_xref="UniProtKB/TrEMBL:G8BRD8"
                     /translation="MAEVISFGSSTPSSSDMQYYYQQLFPFKTIFNWLNHSNKPTNDI
                     VNREFAMAFRSGAYKRYNSFSTAQEFKATIEKSNPDRFEVGAVYNKPPKERDSILKSE
                     MKPLEKELVFDIDMDDYDAFRTCCSGAQVCQKCWKFISIAIKVMELTLIEDFGFKDFI
                     WVFSGRRGAHCWVSDKRARLMNDNQRRNVLDYVNVVRDRSYNKRQALRRPYHPHLARS
                     LEVLKPYFVEVILEEQNPWQDDKNALETLLQGLHDKQLIEALDSYWASNPNRSSKEKW
                     ADIDQIATNNIIRNFKSNARRQEYLARLREGKEDLVIATLYPKLDIEVTKQTIHLLKS
                     PFCIHPATGNVCVPIHENFTPDDAPKLIKLQSEMEQHNNKVEETSLQPFLNIFQEFVQ
                     RVIKNEHEALKRERDEDSPEDVEF"
     gene            complement(<363373..>365625)
                     /gene="TPHA0C01590"
                     /locus_tag="TPHA_0C01590"
                     /db_xref="GeneID:11534102"
     mRNA            complement(<363373..>365625)
                     /gene="TPHA0C01590"
                     /locus_tag="TPHA_0C01590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684701.1"
                     /db_xref="GeneID:11534102"
     CDS             complement(363373..365625)
                     /gene="TPHA0C01590"
                     /locus_tag="TPHA_0C01590"
                     /inference="similar to DNA sequence:INSDC:YIR007W"
                     /note="similar to Saccharomyces cerevisiae YIR007W;
                     ancestral locus Anc_7.172"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684749.1"
                     /db_xref="GeneID:11534102"
                     /db_xref="GOA:G8BRD9"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G8BRD9"
                     /translation="MPGKINIDLNGNFCDSKGNIIVLRGVNLDPSVKYPSNSFSSTHF
                     GSLKDGLGNNFYDDADKVSYIGHPLSLEDAEVHLNRLKSLGYNCIRLPITWDALEHEG
                     PGIYDYAFMDYIIDLLKKIQDIGGLYVYLDPHQDVWSRFGGGSGAPLWTYHCCGMKPI
                     NFESTGAVILHNSYIDPKTGNEFKGNNYPNMLWPTNYSKLASQTMFTLFFAGKDFAPK
                     CVINGENIQDYLQNHFIDAFLELYKRVQETAPSLISEDVLIALESMNEPNMGFLGERD
                     LGIIPAERDLKLGPTPTGFQSFILGEGMSSNVCTYNYGKLGFVKGKDIKIDPKGKKAW
                     LAKEECDVIDKKYNWIRGSEWVPGTCIWKLHGIWKHSDARNPELIKPDYFYNKQSDNS
                     QQSEKIDEKFFINNYFVDYYSKLYHKFRAISETGLLIMQPPPLKEPPILKNADCIDNN
                     TILACHFYDGMTLIYKTWNRIFNVDTLGITRKKYSNPVLSLSFGENNIRKSIKLQLKQ
                     MVEECKTHIGANVPVMFTEIGIPFNMNNKSSYDDGNYSRQIRALDALQFALEDLNISY
                     SLWCYCHLNSHKWGDGWNNEDLSIWSADDMQLKNSKLLDIPNSPIRNMAKSSVDLVQY
                     DPSMKNYDEQLILIENLDLQGFRALDALIRPFPLKINGSFRHAAFLLKDTSYRLEIDG
                     NSSKDNTSCTQIYLPLYHFPISNIDISSSTNKVLLDANRQVLLWYHKDGLQYIKIELK
                     NRSQNSCTIS"
     gene            complement(365828..365899)
                     /gene="TPHA0Ctrna5E"
                     /locus_tag="TPHA_0Ctrna5E"
                     /db_xref="GeneID:11533631"
     tRNA            complement(365828..365899)
                     /gene="TPHA0Ctrna5E"
                     /locus_tag="TPHA_0Ctrna5E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:11533631"
     gap             366377..366396
                     /estimated_length=20
     gene            <369789..>371093
                     /gene="TPHA0C01600"
                     /locus_tag="TPHA_0C01600"
                     /db_xref="GeneID:11533990"
     mRNA            <369789..>371093
                     /gene="TPHA0C01600"
                     /locus_tag="TPHA_0C01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684702.1"
                     /db_xref="GeneID:11533990"
     CDS             369789..371093
                     /gene="TPHA0C01600"
                     /locus_tag="TPHA_0C01600"
                     /inference="similar to DNA sequence:INSDC:YOR008C"
                     /note="similar to Saccharomyces cerevisiae SLG1 (YOR008C);
                     ancestral locus Anc_7.124"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684750.1"
                     /db_xref="GeneID:11533990"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="UniProtKB/TrEMBL:G8BRE0"
                     /translation="MILQRNRLYSKELILLLLVVNIDSIFKFVNADTQTYINCFASLP
                     SSFVLNNEYQYQSSAYCNAACSALNYAYFALSNHSKCYCGNDDPSSSSSTSDSCDASC
                     YGYSQEMCGGSDSFSVYQLGDGAVSGKGSSSSSSSSSSVNVFANGGSSSSSSPASSSS
                     SRAVSTLSPTSSSSSSSNAVLGALAGGASSSSVSTDSSSSEAQSSSTNSDDNVSPSTY
                     VSVGTSVIYSTQYVTQGGSTIFKTNTITTVAASATASSSLGDSSSKNMSGSKKSNTGA
                     IVGGVVGGVGGAIAITIIILFIVRHFNKKKEEERMEKEYQEAIKPVEYNGRSNSVLSK
                     NTNDHIVIGTGQGFNKSNSDYYSSSISSQNNDNDNGSNNAYFNEHNDIDNGANTNNAI
                     ETQSVDPFDDSRRISLGSIFDENPNGNSNGKILTIVNPDEDD"
     gene            <373462..>375117
                     /gene="TPHA0C01610"
                     /locus_tag="TPHA_0C01610"
                     /db_xref="GeneID:11533472"
     mRNA            <373462..>375117
                     /gene="TPHA0C01610"
                     /locus_tag="TPHA_0C01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684703.1"
                     /db_xref="GeneID:11533472"
     CDS             373462..375117
                     /gene="TPHA0C01610"
                     /locus_tag="TPHA_0C01610"
                     /inference="similar to DNA sequence:INSDC:YPL260W"
                     /note="similar to Saccharomyces cerevisiae YPL260W;
                     ancestral locus Anc_7.125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684751.1"
                     /db_xref="GeneID:11533472"
                     /db_xref="InterPro:IPR018810"
                     /db_xref="UniProtKB/TrEMBL:G8BRE1"
                     /translation="MINITSVTDFKEMSYGVPESEHDILKYLIDVRVRLTQLKTNRSK
                     YLNSKEVRLLHQEVLTKVRELDDIRKSKLKDDGQDDSQTQQITTLLCNLTLHNKVDSL
                     VDDVFQLLSLCFLTVGLKNSAPATYTSLSTVQKLLEHLDESNIFTNHDLRPIKERLDE
                     ISKIVQNNSYKNYEFNEDEINPNQVDDDEIKQNLIEEDLLLRAKLKFCNDEFARIHSK
                     LEEIDPELNSIMEKLYHIRRNLLSLASPTHKIDTTENISIFNNNEESRKMLKHLSDEL
                     TELETHRDEDGNFKSLETNEVKLKGQNALAGLVDNCHDLINDFTNSSGDNQILDKNLQ
                     PIYNNLINIKTNLANLMITRRWTLRETDLFQYQKRLKEIDDQRVNGKFPSESGNTKGQ
                     SILLYLLRRCYAIIYKLLESSEPVSESLQPIHNQLSTTRRCLLALKRMGGVNSPRELY
                     PYQLKLASLDELRIDGKFYDSSGEIPEGQGTLNALLAECFDMLHELEIESEESVDNEN
                     DTADSIQDDNEDYRDVSDDDRPAARSLNTIATGINDENPSEED"
     gene            complement(<375387..>376322)
                     /gene="TPHA0C01620"
                     /locus_tag="TPHA_0C01620"
                     /db_xref="GeneID:11535311"
     mRNA            complement(<375387..>376322)
                     /gene="TPHA0C01620"
                     /locus_tag="TPHA_0C01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684704.1"
                     /db_xref="GeneID:11535311"
     CDS             complement(375387..376322)
                     /gene="TPHA0C01620"
                     /locus_tag="TPHA_0C01620"
                     /inference="similar to DNA sequence:INSDC:YPL055C"
                     /note="similar to Saccharomyces cerevisiae LGE1 (YPL055C);
                     ancestral locus Anc_8.511"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684752.1"
                     /db_xref="GeneID:11535311"
                     /db_xref="UniProtKB/TrEMBL:G8BRE2"
                     /translation="MSGSRYNKYPDQSTSSVNSSRGSAAGSSSAGNTHPNKHKYDNSN
                     AYNSRFNSGYNSGRYNNNYNSRNEEGVDNSPAHAKTAGNGIYYNKNKPHYHNSNNYYT
                     NASHTYYTNNNYNSANKYYNQNRKQHQYNNGGYYSNYKSYKSTANNEYHDLANRGITG
                     DDVYEDHLQDTSINNSMGESGYHAKVDTRVHTNSPSYPSRTSTPYQQRHHTQNSSEQT
                     NYNDNEDLKLNKETFTSDISPFYYLTNLNEDKKNADDIKKVFIDNDNIDKSLQAIKYK
                     ILKTELEYDLLNTQGERDALNVQLTQENLDSILLM"
     gene            <378558..>379619
                     /gene="TPHA0C01630"
                     /locus_tag="TPHA_0C01630"
                     /db_xref="GeneID:11534082"
     mRNA            <378558..>379619
                     /gene="TPHA0C01630"
                     /locus_tag="TPHA_0C01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684705.1"
                     /db_xref="GeneID:11534082"
     CDS             378558..379619
                     /gene="TPHA0C01630"
                     /locus_tag="TPHA_0C01630"
                     /inference="similar to DNA sequence:INSDC:YPL054W"
                     /note="similar to Saccharomyces cerevisiae LEE1 (YPL054W);
                     ancestral locus Anc_8.509"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684753.1"
                     /db_xref="GeneID:11534082"
                     /db_xref="GOA:G8BRE3"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:G8BRE3"
                     /translation="MHTMSSSIKDNKESELGEAFSPEQQKVIMQHLMITKQLNINVKN
                     YSHVPCKFFKSGKCQAGEHCKFSHQSNILNSANLIPCKYYKKGHCKFGEHCVNSHELT
                     SPSLEQTINTQTNSNDRSRSKLEVADDDSIDSISMLAANNNLLSLRNGGVHLGSSYEE
                     SARNINSTFASSIPSSSTNSFAPYNYNRAGFATPISSVSSSSNSWQKSAIMENNRYPQ
                     MTPTSSTYASTRPNTPSNYSNYHLERYSRRYSNNNGNFGYQIKEEEGSMQPMEPNYSV
                     FPPYSQQYGYPPQFDHGKNGISNDMPLMMQMQQSNFHKNYSNVPLSPTSQYPMSANDF
                     TFENHSIQLEDTLFFFDDF"
     gene            complement(<380065..>381279)
                     /gene="TPHA0C01640"
                     /locus_tag="TPHA_0C01640"
                     /db_xref="GeneID:11535252"
     mRNA            complement(<380065..>381279)
                     /gene="TPHA0C01640"
                     /locus_tag="TPHA_0C01640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684706.1"
                     /db_xref="GeneID:11535252"
     CDS             complement(380065..381279)
                     /gene="TPHA0C01640"
                     /locus_tag="TPHA_0C01640"
                     /inference="similar to DNA sequence:INSDC:YDR483W,YPL053C"
                     /note="similar to Saccharomyces cerevisiae KRE2 (YDR483W)
                     and KTR6 (YPL053C); ancestral locus Anc_8.505"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684754.1"
                     /db_xref="GeneID:11535252"
                     /db_xref="GOA:G8BRE4"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BRE4"
                     /translation="MRLRTIYIKKKFLKLLFVSFSIISLITILTKITNNLTTSPPPPP
                     PLVINKDRILNTFPSVNATYDIMKDLEDSFSEDKIGTRPSACFVTLVRNEEMDDMVNS
                     VAYIREKFNKNYNYPWVFLNDEEFTDEFKDKISEAAGNITIEYGLVPEEHWSYPDYID
                     TDKAAETRIRMSDIIYGDSESYRHMCRYQSGFFWRHELLDKYDWYWRVEPGIGYFCDI
                     LDDPFQYMQDNKKVYGFTITIHEFESTIKSLWQTTRDFVANNTEYIAKNNLIDFISDN
                     NGETYNLCHFWSNFEIGNLNFWRSEAYNEYFDYLDHAGGFFYERWGDAPVHSIAASLF
                     LPKDAIHFFPEISYYHVPYTNCPIDNAIYEKYNCECNQDDDFTWQDYSCGVQYHNAQN
                     LTKPMGWTNHTG"
     gene            <382768..>383638
                     /gene="TPHA0C01650"
                     /locus_tag="TPHA_0C01650"
                     /db_xref="GeneID:11535256"
     mRNA            join(<382768..383007,383009..>383638)
                     /gene="TPHA0C01650"
                     /locus_tag="TPHA_0C01650"
                     /product="hypothetical protein"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_003684707.1"
                     /db_xref="GeneID:11535256"
     CDS             join(382768..383007,383009..383638)
                     /gene="TPHA0C01650"
                     /locus_tag="TPHA_0C01650"
                     /inference="similar to DNA sequence:INSDC:YPL052W"
                     /artificial_location="low-quality sequence region"
                     /note="similar to Saccharomyces cerevisiae OAZ1 (YPL052W);
                     ancestral locus Anc_8.504"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684755.1"
                     /db_xref="GeneID:11535256"
                     /db_xref="GOA:G8BRE5"
                     /db_xref="InterPro:IPR002993"
                     /db_xref="UniProtKB/TrEMBL:G8BRE5"
                     /translation="MSHTTIQDSLSKKKDHVLDLIGTDQVQKIFGNSDTEAIAFTFSI
                     LDLIKKKSALYGTNMNTNSQFYTYSREIDSCKTWCADISLDLNSGFSNTELIEFYWDL
                     IIITELQFILPYYLQNKKYYYKSVNNSIIKKIGKTLTSVINEKKINNSISENYSWRFS
                     GLNYSLIYIPLYFKDFIWGKSDSIYFHVILPRSSDSRESLTEADKVLIKHSKEWLLAL
                     LELASDLNLMYMRLYIRRSDIGNISALLKNLNWIGGKLIHNEDRDKLSKNDIDMNEML
                     FGDEEFLILEFEC"
     gene            <384105..>384704
                     /gene="TPHA0C01660"
                     /locus_tag="TPHA_0C01660"
                     /db_xref="GeneID:11534092"
     mRNA            <384105..>384704
                     /gene="TPHA0C01660"
                     /locus_tag="TPHA_0C01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684708.1"
                     /db_xref="GeneID:11534092"
     CDS             384105..384704
                     /gene="TPHA0C01660"
                     /locus_tag="TPHA_0C01660"
                     /inference="similar to DNA sequence:INSDC:YPL051W"
                     /note="similar to Saccharomyces cerevisiae ARL3 (YPL051W);
                     ancestral locus Anc_8.502"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684756.1"
                     /db_xref="GeneID:11534092"
                     /db_xref="GOA:G8BRE6"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BRE6"
                     /translation="MFHLAKGLYSNWNRKEHYSVLILGLDNAGKTTFLETLKKQYSLT
                     SKDLEKIVPTVGQNVAQIPMADNKSILKFWDVGGQQNLRSMWPEYYPQSHGIIFVVDS
                     TDRQRINEWKDALQSIIMDDEIEGIPVLMLANKQDREDTMEIQDIKQIFNQIAEHLGA
                     RDSRVLPVSALTGDGVKDAADWLVVRLQRNKQNRPPNYK"
     gene            complement(<384987..>386198)
                     /gene="TPHA0C01670"
                     /locus_tag="TPHA_0C01670"
                     /db_xref="GeneID:11534073"
     mRNA            complement(<384987..>386198)
                     /gene="TPHA0C01670"
                     /locus_tag="TPHA_0C01670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684709.1"
                     /db_xref="GeneID:11534073"
     CDS             complement(384987..386198)
                     /gene="TPHA0C01670"
                     /locus_tag="TPHA_0C01670"
                     /inference="similar to DNA sequence:INSDC:YDR480W,YPL049C"
                     /note="similar to Saccharomyces cerevisiae DIG2 (YDR480W)
                     and DIG1 (YPL049C); ancestral locus Anc_8.499"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684757.1"
                     /db_xref="GeneID:11534073"
                     /db_xref="UniProtKB/TrEMBL:G8BRE7"
                     /translation="MDSETVEHVPISDDQQLDKHTSEETLNVENKNGTVKESKVQKIG
                     MLCVSPGLHSETLNDKMLSTLKVSEDMEKAERSRRVSDVSDSMQNIPRKQIDTQEDLM
                     LVKDQLKDLKKNSLNRKSIPAPLAINDDTTNMKSGFRSSRIQGRNTFITNDAPFSNTN
                     TLRSAPACVTKHTIQKRPRVQYCGKTPRMNPPNTSTSNYPRVPFHRRQASSEFPTNFT
                     PFQNQYVSPAPVDPYMYPPYYIPHPSGHYLVPNVMGFTPQSPVAGPMPFNINRSANPM
                     FSPQVSLYQTWPKQDIKITNKRENTIFNKNNSEPVHINLSENSTSKDSKSDDESTALA
                     LDDEDISDNNESTIETKVKEMIDGEISLLGHEFKFEYQKSSRKMDKKIFISVCNKIWD
                     DTFELEKRTNQ"
     gene            <388203..>389447
                     /gene="TPHA0C01680"
                     /locus_tag="TPHA_0C01680"
                     /db_xref="GeneID:11535305"
     mRNA            <388203..>389447
                     /gene="TPHA0C01680"
                     /locus_tag="TPHA_0C01680"
                     /product="elongation factor 1 gamma domain-containing
                     protein"
                     /transcript_id="XM_003684710.1"
                     /db_xref="GeneID:11535305"
     CDS             388203..389447
                     /gene="TPHA0C01680"
                     /locus_tag="TPHA_0C01680"
                     /inference="similar to DNA sequence:INSDC:YPL048W"
                     /note="similar to Saccharomyces cerevisiae CAM1 (YPL048W);
                     ancestral locus Anc_8.498"
                     /codon_start=1
                     /product="elongation factor 1 gamma domain-containing
                     protein"
                     /protein_id="XP_003684758.1"
                     /db_xref="GeneID:11535305"
                     /db_xref="GOA:G8BRE8"
                     /db_xref="InterPro:IPR001662"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:G8BRE8"
                     /translation="MSLGTLFSDAKIRGLVPRALVKFLKLDIKIVDPATVSAQFAQQF
                     PLKKLPAFVDNTGVRLSEQLAVDFYLINLADNQEIKTQLLGNPDDFRTQSQILRWASL
                     GNSDLLSIMLSAFGPLRGDVPYNKKAVDEALVKVEVVISIFEERLKTHTYLANEDITL
                     ADLICCASFVRGFNYLFGKEWRAAHPSIVRWFNTVRNSPIIKSEFTEFKFIDKQIDPP
                     KKEKKEKKKNLDCCCCCQKDAEPAENAEPAPEKKAKHPLEALGKATFVLDEWKRKYSN
                     EDTRLVALPWFWEHYNPEEYSLWKVEYKYNDELTQTFMSNNLVGGFFNRLSGSIKYMF
                     GSLVVYGVTNDNGIVGAVLVRGQEFAPAFEVAPDWESYSYVKLDASKEEDKAFVNNMW
                     AWDEPVIVNGVAREIADGKVLK"
     gene            <390180..>391712
                     /gene="TPHA0C01690"
                     /locus_tag="TPHA_0C01690"
                     /db_xref="GeneID:11533508"
     mRNA            <390180..>391712
                     /gene="TPHA0C01690"
                     /locus_tag="TPHA_0C01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684711.1"
                     /db_xref="GeneID:11533508"
     CDS             390180..391712
                     /gene="TPHA0C01690"
                     /locus_tag="TPHA_0C01690"
                     /inference="similar to DNA sequence:INSDC:YDR256C"
                     /note="similar to Saccharomyces cerevisiae CTA1 (YDR256C);
                     ancestral locus Anc_8.497"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684759.1"
                     /db_xref="GeneID:11533508"
                     /db_xref="GOA:G8BRE9"
                     /db_xref="InterPro:IPR002226"
                     /db_xref="InterPro:IPR010582"
                     /db_xref="InterPro:IPR011614"
                     /db_xref="InterPro:IPR018028"
                     /db_xref="InterPro:IPR020835"
                     /db_xref="InterPro:IPR024708"
                     /db_xref="InterPro:IPR024711"
                     /db_xref="UniProtKB/TrEMBL:G8BRE9"
                     /translation="MSEDKTNSADVRNDRVVTTTNGMPINEPFATQRVGKHGPLLLQD
                     YTLIDNLAHFNRERIPERNPHAHGSGAFGYFEVTDDISDICGSAMFNKIGKRTRCLTR
                     FSTVGGEKGSADSARDPRGFATKFYTEEGNLDWVYNNTPVFFIRDPSKFPHFIHTQKR
                     NPQTNLKDANMFWDFLTTPENQVAIHQVMILFSDRGIPATYRNMNGYSGHTYKWSNKK
                     GDWHYVQVHIITDQGIKNLTAEEATEVAGSNPDHAQQDLFDNIKKGNAPSWTVYIQTM
                     TEDQAKRLPFSVFDLTKVWPHKDFPLRRVGKLVLNENPENYFAQIEQAAFAPSNTVPY
                     QEASADPVLQARLFSYADAHRYRIGPNYHQVPVNCPYASKTFNPAIRDGPMNVNGNFG
                     NESNYLATDKTYQYIQKERPIQEHQETWTGPAVPFHWATSAGDVDFVQARNLFHVLGR
                     TRNQQQHLAHNVAGHVSNANPEIRKRVYAMFGRVDLRLSESIRKEAESLVVLKDNPTS
                     KL"
     gene            <392419..>392709
                     /gene="TPHA0C01700"
                     /locus_tag="TPHA_0C01700"
                     /db_xref="GeneID:11533505"
     mRNA            <392419..>392709
                     /gene="TPHA0C01700"
                     /locus_tag="TPHA_0C01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684712.1"
                     /db_xref="GeneID:11533505"
     CDS             392419..392709
                     /gene="TPHA0C01700"
                     /locus_tag="TPHA_0C01700"
                     /inference="similar to DNA sequence:INSDC:YPL047W"
                     /note="similar to Saccharomyces cerevisiae SGF11
                     (YPL047W); ancestral locus Anc_8.496"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684760.1"
                     /db_xref="GeneID:11533505"
                     /db_xref="GOA:G8BRF0"
                     /db_xref="InterPro:IPR013246"
                     /db_xref="UniProtKB/TrEMBL:G8BRF0"
                     /translation="MSATINSVSKEIYNNIITTVIQDIVSREVVEQKQIKSRHPDYKP
                     YHYDSTGTLDILGVPKIQESSQYFHCNNCDRDVSANRFAAHLQRCLNSRSRN"
     gene            <393272..>394525
                     /gene="TPHA0C01710"
                     /locus_tag="TPHA_0C01710"
                     /db_xref="GeneID:11535220"
     mRNA            <393272..>394525
                     /gene="TPHA0C01710"
                     /locus_tag="TPHA_0C01710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684713.1"
                     /db_xref="GeneID:11535220"
     CDS             393272..394525
                     /gene="TPHA0C01710"
                     /locus_tag="TPHA_0C01710"
                     /inference="similar to DNA sequence:INSDC:YDR255C"
                     /note="similar to Saccharomyces cerevisiae RMD5 (YDR255C);
                     ancestral locus Anc_8.495"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684761.1"
                     /db_xref="GeneID:11535220"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024964"
                     /db_xref="InterPro:IPR027370"
                     /db_xref="InterPro:IPR027711"
                     /db_xref="UniProtKB/TrEMBL:G8BRF1"
                     /translation="MAHLLNSLDSGYQSFYIDKNKDETWLSRTYNDTHEFKIQLKKLK
                     AHLNKCIQDAEEDELNATGNVKNINNEKEILKRAKKRGLVISKLNKASRQWNNNVTKQ
                     VKLSGIQYNKFKNQTNMKSHNGDLDSVYINKISEEYKNDIYLAIGYHIARYGLGEMQT
                     VKRNEIETYLKDVYGLDEKVAAIYISMTEKINNIKTYNTKDCINDYDKNSDIYFEIYL
                     LDIMILIKDKNILTTLEYLRKSTSRSFFNNKSSIIVEKISPFLTKVMLGLEVENIDEL
                     LNQQVDICVDLVSKDYCKQNKISFDSSLFSIILSGIISLQFFIKYNNIQKALHVDWTT
                     KNELPFNVKLPESVSKFHSIFICPVLKEETTIENPPYSLPCHHVISRKALDKLSKNGT
                     ISFKCPYCPVAATISKTMKVNFILL"
     gene            complement(<394581..>394874)
                     /gene="TPHA0C01720"
                     /locus_tag="TPHA_0C01720"
                     /db_xref="GeneID:11535255"
     mRNA            complement(<394581..>394874)
                     /gene="TPHA0C01720"
                     /locus_tag="TPHA_0C01720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684714.1"
                     /db_xref="GeneID:11535255"
     CDS             complement(394581..394874)
                     /gene="TPHA0C01720"
                     /locus_tag="TPHA_0C01720"
                     /inference="similar to DNA sequence:INSDC:YPL046C"
                     /note="similar to Saccharomyces cerevisiae ELC1 (YPL046C);
                     ancestral locus Anc_8.494"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684762.1"
                     /db_xref="GeneID:11535255"
                     /db_xref="GOA:G8BRF2"
                     /db_xref="InterPro:IPR001232"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR016073"
                     /db_xref="UniProtKB/TrEMBL:G8BRF2"
                     /translation="MDIITLVSKDNVEFEVPKEVIIISQTLKAMVDSPFIENSGKITL
                     TNFDSPVLAVIVDYLNYNFKYKDEDPTKVDIPEFEIPTELSLELLLAADYLNI"
     gene            <395254..>397644
                     /gene="TPHA0C01730"
                     /locus_tag="TPHA_0C01730"
                     /db_xref="GeneID:11535261"
     mRNA            <395254..>397644
                     /gene="TPHA0C01730"
                     /locus_tag="TPHA_0C01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684715.1"
                     /db_xref="GeneID:11535261"
     CDS             395254..397644
                     /gene="TPHA0C01730"
                     /locus_tag="TPHA_0C01730"
                     /inference="similar to DNA sequence:INSDC:YPL045W"
                     /note="similar to Saccharomyces cerevisiae VPS16
                     (YPL045W); ancestral locus Anc_8.493"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684763.1"
                     /db_xref="GeneID:11535261"
                     /db_xref="GOA:G8BRF3"
                     /db_xref="InterPro:IPR006925"
                     /db_xref="InterPro:IPR006926"
                     /db_xref="InterPro:IPR016534"
                     /db_xref="UniProtKB/TrEMBL:G8BRF3"
                     /translation="MANNPSLNWEKLQNVFYRKIELCELKSLFQKVNKNAFATNTAAT
                     IIGDRLHIMDYNSEILLTINVDRFENIKEISFDHKERPVIITSEAIHVITNFLPLEIE
                     KTISDFNDSSEILFYKQGYVISSKSQNIYKHENGKLKLLYTNVDKYLLTTEEHWDINN
                     DQIILLDQNHVFRFDLTKNNLGCIKTNSSWQRVIISTEGFICLFNEKFRKLQIFKSAT
                     HVSAEYTLDSSPLKIAWCGNDTIACVFDHEVRLFGPGDSYVTFWYPSTPIGLFTEVDG
                     IKVIAGKEFSLIGRVPEHTSNVFKIGSTEAAAVLLDSQENLDNYLPKSIANLRVIDLP
                     KAVTDCINASVDEFDVSLQKILLEASSFGKASIIKASFDSELFVKACERIKLLNYLRK
                     IGILVTNDEYNHLTFDRVCDILKLRNNYYECLQICKITKNITKTENIFIDWACTKVLT
                     SVDQSDDSLYDSITLRQKEIPNGQRVSMINIAHTAFLEGRLGLARKLMLLENRPELKT
                     MGLLELDDDNMALQEVMKTYSPELILSLLLKCRPKLTVAQFTKLLILGMSDNQIFLYF
                     AESDKEFLFDFFRQQDNYVDLARLFVFQGVKNGSLQPFLPQIRDLYAKTGSNSIVKEN
                     IQLFEKQNKLWDYQENLSSIFNENFTNLTLDKTLSKLIEMKMDKQVTDFVKKLKINDK
                     RYYHCKCKTLIDTKRFGELHSFAKERKSPIGYLPFYKYLFKKGHKKEASVYIEFITRV
                     TLKEKIDMYCKCENYLEAIKIAEKDQNLQELNNILKILPSDQTQLKNLINDILNGI"
     gap             397930..398038
                     /estimated_length=109
     gene            <398136..>400229
                     /gene="TPHA0C01740"
                     /locus_tag="TPHA_0C01740"
                     /db_xref="GeneID:11533466"
     mRNA            <398136..>400229
                     /gene="TPHA0C01740"
                     /locus_tag="TPHA_0C01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684716.1"
                     /db_xref="GeneID:11533466"
     CDS             398136..400229
                     /gene="TPHA0C01740"
                     /locus_tag="TPHA_0C01740"
                     /inference="similar to DNA sequence:INSDC:YPL043W"
                     /note="similar to Saccharomyces cerevisiae NOP4 (YPL043W);
                     ancestral locus Anc_8.491"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684764.1"
                     /db_xref="GeneID:11533466"
                     /db_xref="GOA:G8BRF4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BRF4"
                     /translation="MSEAVEGKIASPSKIDNEFDLKTLFVRSIPLQTTDDEFTDFFSN
                     FAPLKHAVIVKDTNKKSRGFGFVSFASEEDSQEALTKARTSKIQNHLLRVDFAKRRDR
                     SKTRTEGSEQTKEIVKKTFKKSATERDDGKDEDKDFDEESSLKGKPKLIIRNMPWSCR
                     DSAKLKNIFSRYGTVDEATIPRKRDGKLCGFAFVTFKNLANCKVALEKSKGLKIDGRA
                     VAVDFAVQKNRWENIQKQQDTQQEETNGPDSDSSSDSEEDDDDDDNDKEGEDKYEDME
                     LDSDEEVYGESDEEEEEKPRRQQNRQEDYSVFIRNVPYDATEESLAEHFTKFGDVKYA
                     LPVIDRNTGLAKGTAFVAFKDQKAYEYCIANAPAAGSTSLLIGDDVLPEYVYEGRVLS
                     VTPTVQRDVANRMAEKNAEKRKELLGKAPGERDRRNLYLLNEGRVAEGTKLAQLLSKT
                     DMEIREKSYSLRVEQLKKNPSLHISMTRLAIRNLPRAMTEKSLKYLARRAVVNFATEV
                     NENKRHPLSKEEIVRSTKEKYKFLSDEEIERLKKKDKKQGLVKQSKIIMEVKGTTIGR
                     SRGYGFVEYKDHKSALMGLRWLNVHAVTKEEILDGLTEEEKKAIAPDMLKSRRLVVEF
                     AIENANVVKRRRENIMNSKEQAVKRKLAEDAAESAEESKKAKIQSEDSKKNGGMSDNV
                     RSIIGQKRKRRSAKK"
     gene            complement(<400389..>401045)
                     /gene="TPHA0C01750"
                     /locus_tag="TPHA_0C01750"
                     /db_xref="GeneID:11533645"
     mRNA            complement(<400389..>401045)
                     /gene="TPHA0C01750"
                     /locus_tag="TPHA_0C01750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684717.1"
                     /db_xref="GeneID:11533645"
     CDS             complement(400389..401045)
                     /gene="TPHA0C01750"
                     /locus_tag="TPHA_0C01750"
                     /inference="similar to DNA sequence:INSDC:YPL041C"
                     /note="similar to Saccharomyces cerevisiae YPL041C;
                     ancestral locus Anc_8.489"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684765.1"
                     /db_xref="GeneID:11533645"
                     /db_xref="InterPro:IPR018811"
                     /db_xref="UniProtKB/TrEMBL:G8BRF5"
                     /translation="MSLLLQKKAVNIIIQLRSYIGSNIKVSNPNIYNGLSVSHKFNCT
                     KSICLYSTKGNKDGKILEEFSTKKKDMLHRMISKSKLLTKLNSHPNFKNYFDRISQTG
                     TVSTVTGFLLLHELSAIVPLFALWWILYHSNIHDTLVLPEILHNLMEYCSDVMNRFVG
                     DKYPDLDRKRIIFTGALSYMTVKVLYPIRILLSLWAAPYFGNLLVSPFRKLIKLSRKK
                     "
     gene            <402424..>402939
                     /gene="TPHA0C01760"
                     /locus_tag="TPHA_0C01760"
                     /db_xref="GeneID:11533446"
     mRNA            <402424..>402939
                     /gene="TPHA0C01760"
                     /locus_tag="TPHA_0C01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684718.1"
                     /db_xref="GeneID:11533446"
     CDS             402424..402939
                     /gene="TPHA0C01760"
                     /locus_tag="TPHA_0C01760"
                     /inference="similar to DNA sequence:INSDC:YDR253C,YPL038W"
                     /note="similar to Saccharomyces cerevisiae MET32 (YDR253C)
                     and MET31 (YPL038W); ancestral locus Anc_8.486"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684766.1"
                     /db_xref="GeneID:11533446"
                     /db_xref="GOA:G8BRF6"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BRF6"
                     /translation="MSVNDTGRKDANLFYKNAIEAINFIREKPEDELDPVIKEIYKRV
                     EIQNDKLQSIQEQPSSTSNSIASHSNISRSNSIDGKNNKGNVDNTINNMVICAKCGIT
                     FKRVSELKRHEKSHLPILSNICSQCGKGFARKDALKRHYNTLTCKRNRSKLLYLGSEI
                     TELLNLGKNIS"
     gene            complement(<403223..>405871)
                     /gene="TPHA0C01770"
                     /locus_tag="TPHA_0C01770"
                     /db_xref="GeneID:11535327"
     mRNA            complement(<403223..>405871)
                     /gene="TPHA0C01770"
                     /locus_tag="TPHA_0C01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684719.1"
                     /db_xref="GeneID:11535327"
     CDS             complement(403223..405871)
                     /gene="TPHA0C01770"
                     /locus_tag="TPHA_0C01770"
                     /inference="similar to DNA sequence:INSDC:YDR251W,YPL032C"
                     /note="similar to Saccharomyces cerevisiae PAM1 (YDR251W)
                     and SVL3 (YPL032C); ancestral locus Anc_8.484"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684767.1"
                     /db_xref="GeneID:11535327"
                     /db_xref="UniProtKB/TrEMBL:G8BRF7"
                     /translation="MASSSLNVLIFCNNPNVLLYASRFQLAKSIKLFHINNSSSNLFE
                     IETFNYGREQVDMKNHFSSVQAMKDELNDSSLVFDMVIFSANSLQDISSISSQMKSVI
                     NSNTKIIIESSGFIQLEPFIRMSTDIPASNVFSIITDFDIREVAPNEFKQFPNSNNSL
                     VNTLYLGCTKPNQIILLMPNITKNIITLLETFERLFKKLFPHDNIDLCDFVENNFLTQ
                     QWIFALPKICFDPLLVIFDEQTPKQLTNQILAKHLISGLVTELIAVSKAMGAKLPSSM
                     STESNLINYWENLYPQKDDIPSLVFNFINVFSSLSTDVLLLQPILLADDSGIKTPYLE
                     FLYSVFCQYEKINKGESKWFMRINNSNDNKEKIQKLSIERDDLRNDITKLNEILASKD
                     RELGIAKNMELQNKNEVTVLQREVSTLKSELANQSRSYKNEISELLSLQNQQQLQQKE
                     HLERLENQTNDSFSKDTSSSNLKKETQYKATGTPLINDFEDLAIYSYDSPTRDHTLSK
                     DRTSMMPPSRNGNYSQSNSPAASLEEISASSPDPSIQKKELELKKRELELQERELDFQ
                     RRSMQQQQRLMMTTPVNSAPMNIPMNAPMNVPMNVPMNAPMNAPMKGQNNQLYGANNA
                     NRKLSHTQLQQPVNTRPIRSMYGASNSSGNFVDPIGSSMMNGMPGNYGNVHSQQGVKP
                     TSRKNRNSTMPTLGHASSLGLSGMANQNNGQNQPRITSYSSSNLANQGRPRQKSQQQP
                     PQQQPLQFTQTPNSYNNANRTNMPKSNKTNSFIIGNQQIGGGSNNNDSNYPQNSNDTN
                     PNVSMSSVVHNPINSSNNNIANNSFSDFSKLQQASVPVLSVSTTPPALDKTVASLEND
                     NQTDKASDNEKLPEKKKKFKLFGKKK"
     gene            complement(<407048..>407965)
                     /gene="TPHA0C01780"
                     /locus_tag="TPHA_0C01780"
                     /db_xref="GeneID:11534076"
     mRNA            complement(<407048..>407965)
                     /gene="TPHA0C01780"
                     /locus_tag="TPHA_0C01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684720.1"
                     /db_xref="GeneID:11534076"
     CDS             complement(407048..407965)
                     /gene="TPHA0C01780"
                     /locus_tag="TPHA_0C01780"
                     /inference="similar to DNA sequence:INSDC:YPL031C"
                     /note="similar to Saccharomyces cerevisiae PHO85
                     (YPL031C); ancestral locus Anc_8.482"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684768.1"
                     /db_xref="GeneID:11534076"
                     /db_xref="GOA:G8BRF8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BRF8"
                     /translation="MSSSSSQFKQLEKLGNGTYATVYKGLNKTTGIFVALKEVKLDSE
                     EGTPSTAIREISLMKELKHENIVRLYDVIHTENKLTLVFEYMDKDLKNYMDSRTSGNS
                     TRGLELSLVKYFQWQLFEGVTFCHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFG
                     IPVNTFSTEVVTLWYRAPDVLMGSRSYSTSIDMWSCGCILAEMITGKPLFPGTNDEEQ
                     LKLIFDIMGTPDEQLWPAVTSLPKYNRNLPKKEPKDLKKLLQAHTKEIVDDQVIDLVT
                     GLLQLNPDARLTAKQALHHPWFGEYYQQQ"
     gene            <408923..>410629
                     /gene="TPHA0C01790"
                     /locus_tag="TPHA_0C01790"
                     /db_xref="GeneID:11533940"
     mRNA            <408923..>410629
                     /gene="TPHA0C01790"
                     /locus_tag="TPHA_0C01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684721.1"
                     /db_xref="GeneID:11533940"
     CDS             408923..410629
                     /gene="TPHA0C01790"
                     /locus_tag="TPHA_0C01790"
                     /inference="similar to DNA sequence:INSDC:YPL030W"
                     /note="similar to Saccharomyces cerevisiae YPL030W;
                     ancestral locus Anc_8.481"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684769.1"
                     /db_xref="GeneID:11533940"
                     /db_xref="GOA:G8BRF9"
                     /db_xref="InterPro:IPR011671"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BRF9"
                     /translation="MTESKSKSQRDQFITKINEPSILGSEWYCMYETDTKVNFLREHF
                     ETAMMNVIREPNINSTAVLRADILKEIKYENSKTDDKIDHNEEITIDNTNNEDFNISV
                     ADSKQTNILDMELRIPQLSEELDFHTFLGIVRRMVPRNPYKDALINQTCLMMESPVRY
                     PESSLVIYTPHLDKKDDCPFYIPAVKNVAILFHEEHLSVHYLFFSDEQMKQLIQDESE
                     RIVRTAWRLLQTAYKHSRGVMQGYEKRVNHDQVVDKVKFQNQYITIKKKYSQFLVENW
                     KESTDPKKHVFEDIAIAAFLLELWNKIYGPDFKNKMQFRDLGCGNGVLCYILIEEGCK
                     GIGIDARHRKSWAMYPTTVRKCLKEQVIVPSVLLRPHPDLKKNNPYLTHNNNLFPVKM
                     TSQDLIAPATVLFTSEDLLNSPQVNATEFPTDTFVIGNHSDELTCWIPLLGYNFMIIP
                     CCSHNFSGQKIRFNVRKQPKPDKQASSDKNASSSKISNSTYAGLVDHVCYISEKVGWK
                     IEKEMLRIPSTRNAAIIGYKNDKLSEFPTQEVYDMLQEDGGPSGWIHNTMQLMKKNPR
                     NH"
     gene            <411768..>412961
                     /gene="TPHA0C01800"
                     /locus_tag="TPHA_0C01800"
                     /db_xref="GeneID:11533966"
     mRNA            <411768..>412961
                     /gene="TPHA0C01800"
                     /locus_tag="TPHA_0C01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684722.1"
                     /db_xref="GeneID:11533966"
     CDS             411768..412961
                     /gene="TPHA0C01800"
                     /locus_tag="TPHA_0C01800"
                     /inference="similar to DNA sequence:INSDC:YPL028W"
                     /note="similar to Saccharomyces cerevisiae ERG10
                     (YPL028W); ancestral locus Anc_8.479"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684770.1"
                     /db_xref="GeneID:11533966"
                     /db_xref="GOA:G8BRG0"
                     /db_xref="InterPro:IPR002155"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR020610"
                     /db_xref="InterPro:IPR020613"
                     /db_xref="InterPro:IPR020615"
                     /db_xref="InterPro:IPR020616"
                     /db_xref="InterPro:IPR020617"
                     /db_xref="UniProtKB/TrEMBL:G8BRG0"
                     /translation="MSNKVYIVSTARTPIGSFQGALSAKTAVELGAIAVKGAFAKVPS
                     IDVTKDVDEIFFGNVLTANNGQNPARQVALNAGLDNHIVATTVNKVCASGMKSIILGS
                     QTILCGNADVVVVGGTESMTNTPYYMPAARAGARFGETKLVDGIQRDGINDAYDNNAM
                     GVHAEKCAKDWEITREEQDNFAIGSYQKAQKATNEGKFKDEIVPVTIKGFRGKPDTIV
                     DRDEEPPKLNVEKLKAARTVFQKENGTVTAPNASPLNDGAAAIILVSERKLKELNLTP
                     LAVIKGWGEAAHQPADFTWAPALAVPKAVKHANISLDDIDYFEFNEAFSVVGIANPKI
                     LKLSQDKINVYGGAVAMGHPLGCSGARVIVTLLSVLRQEGGKLGVGAICNGGGGASSV
                     VIERV"
     gene            complement(<413495..>414790)
                     /gene="TPHA0C01810"
                     /locus_tag="TPHA_0C01810"
                     /db_xref="GeneID:11533771"
     mRNA            complement(<413495..>414790)
                     /gene="TPHA0C01810"
                     /locus_tag="TPHA_0C01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684723.1"
                     /db_xref="GeneID:11533771"
     CDS             complement(413495..414790)
                     /gene="TPHA0C01810"
                     /locus_tag="TPHA_0C01810"
                     /inference="similar to DNA sequence:INSDC:YDR247W,YPL026C"
                     /note="similar to Saccharomyces cerevisiae VHS1 (YDR247W)
                     and SKS1 (YPL026C); ancestral locus Anc_8.477"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684771.1"
                     /db_xref="GeneID:11533771"
                     /db_xref="GOA:G8BRG1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BRG1"
                     /translation="MSTANSHDDNSKYLNNYKFIGIIGSGASGVVYKVLNVINNKYYA
                     IKVVLNNTVIRDKQNLLDSIFNDYFENDKYNTHNEKLKNRMILNSINFHYYLTNEFNY
                     GIKKEISNQLKVHKHKHIISVIDIYNYQITNYYNIKNTNVTFIIYDYIEMDLFTAIVE
                     KQIFQNATDTTLIKKIFIQICRAVKYCHENGIYHCDLKPENILVDIENEHAYLCDFGL
                     STTEKSLCDTQSIGSTFYMAPERVIDYETIYKSAVTKSSPTYSCDIWSLGIILTNIVC
                     SCNLWNLPDPKKDQFFKSYMTNKSVLLDYIEVSTSFYQLLTLILEPDPLKRYGIDDII
                     ESVRNIRSFTQHGKYANVDIYDIIDDDTVNEEEIYDTDFSNGLVSHDSSETMVSLQHN
                     DTNDKEGVFYGGQGVTVLRRPTLQHSSAPFNGNGQAITI"
     gene            complement(<417389..>418126)
                     /gene="TPHA0C01820"
                     /locus_tag="TPHA_0C01820"
                     /db_xref="GeneID:11535242"
     mRNA            complement(<417389..>418126)
                     /gene="TPHA0C01820"
                     /locus_tag="TPHA_0C01820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684724.1"
                     /db_xref="GeneID:11535242"
     CDS             complement(417389..418126)
                     /gene="TPHA0C01820"
                     /locus_tag="TPHA_0C01820"
                     /inference="similar to DNA sequence:INSDC:YDR246W"
                     /note="similar to Saccharomyces cerevisiae TRS23
                     (YDR246W); ancestral locus Anc_8.476"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684772.1"
                     /db_xref="GeneID:11535242"
                     /db_xref="GOA:G8BRG2"
                     /db_xref="InterPro:IPR007233"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:G8BRG2"
                     /translation="MAIQTLLIINKSGGLIYHRNYAGEKNGLNSNDYLILASTLHSVF
                     AIASQLTPQAVQLNAKRSSNSTDNNFSKGGEKIPYIPYVGMNANDSNNTTNKLNKLGS
                     FMGDDYFKESFVSWNKGGLRQLSTDHFTMFIYQTMTGMKFVAISSSVLRNTADPSHSG
                     KSNTTANANGIQNSTTISYSTAQNSSSDYNSNSSNLQVQIADNFLRKIYCIYSDYVMK
                     DPFYSLEMPIKSELFDKKVKQMVSNLE"
     gene            <418463..>419203
                     /gene="TPHA0C01830"
                     /locus_tag="TPHA_0C01830"
                     /db_xref="GeneID:11533792"
     mRNA            <418463..>419203
                     /gene="TPHA0C01830"
                     /locus_tag="TPHA_0C01830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684725.1"
                     /db_xref="GeneID:11533792"
     CDS             418463..419203
                     /gene="TPHA0C01830"
                     /locus_tag="TPHA_0C01830"
                     /inference="similar to DNA sequence:INSDC:YPL024W"
                     /note="similar to Saccharomyces cerevisiae RMI1 (YPL024W);
                     ancestral locus Anc_8.475"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684773.1"
                     /db_xref="GeneID:11533792"
                     /db_xref="UniProtKB/TrEMBL:G8BRG3"
                     /translation="MSIASIISQDITKVTNITFNKTGLNAREQLIINAFENEAWLNNL
                     PDKTNKVVEQKCIKVDRDLLFQVLMVEQISISKTAQIDDYNIKLDPKNQKVDRLRANG
                     TAISNDVSKYKVITQLDMEDSDNFSNGANNNTNLSNNSLNNRKNTVYKITLQAKSGDI
                     FFAINTSPLAWVSCMLGSKLIIKAGTLFNRGVFVLQESSVVFLGGINRQWNDNKETKL
                     CAYLKAKLDQEHKANINLKGSRKRKAVQ"
     gene            complement(<419334..>421259)
                     /gene="TPHA0C01840"
                     /locus_tag="TPHA_0C01840"
                     /db_xref="GeneID:11535266"
     mRNA            complement(<419334..>421259)
                     /gene="TPHA0C01840"
                     /locus_tag="TPHA_0C01840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684726.1"
                     /db_xref="GeneID:11535266"
     CDS             complement(419334..421259)
                     /gene="TPHA0C01840"
                     /locus_tag="TPHA_0C01840"
                     /inference="similar to DNA sequence:INSDC:YPL023C"
                     /note="similar to Saccharomyces cerevisiae MET12
                     (YPL023C); ancestral locus Anc_8.474"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684774.1"
                     /db_xref="GeneID:11535266"
                     /db_xref="GOA:G8BRG4"
                     /db_xref="InterPro:IPR003171"
                     /db_xref="InterPro:IPR004621"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="UniProtKB/TrEMBL:G8BRG4"
                     /translation="MSIRELYNMRTSPSVSLEFFPPKTEAGKRNLLERVNRMSALDPL
                     FVTVTWGAGGTTADKTIQLAILAKQTLNLNVCIHLTCTNMDKNILDEALSKCKSAGIR
                     NILALRGDPPIEHEWSNEMNVDGKREFNYAIDLVKYIRESYDDYFCIGVAAYPEGHCE
                     GELEDSSFSPFKDLPYLKEKIDAGADFVITQLFYDAQKFLDFEKLFRTHISTEVPLIP
                     GLMPINSYSLFNRAAKLSHASIPQHILDKFQSEIQYDDNAVKSIGVKIIIDIIEEIYQ
                     KTNGRIKNFHFYTLNLEKATAHIVADCPLLSHILDDEHDNIAMSLQSDVVISVDDNES
                     EVHNESSFHQKRRRHSSNTEMSRPQVIDKNITNVVASLPSRKVLISISQGSGTLGRDA
                     TWDEFPNGRFGDSRSPAYGEIDGYGPTLKVGNKKAYNIWGAPTRVSDLKSIFIKYLEG
                     SIDVLPWCDLGLSPETALIQEELIQLNQRGYLTLASQPATNAAPSTDKIFGWGPASGY
                     VYQKAFIEMFIQKQQWESVLKPKLESYQQGKFSYYVGDSTGKFDTNLPAHSSSVVTWG
                     IFPNSPVVQTTIVEEESFKAWRDEAFCIWLEWAKLFLSNNPANTFLKQVHQDYYLLSI
                     VHHDFGDVDELWEMLLE"
     gene            <421779..>424946
                     /gene="TPHA0C01850"
                     /locus_tag="TPHA_0C01850"
                     /db_xref="GeneID:11533441"
     mRNA            <421779..>424946
                     /gene="TPHA0C01850"
                     /locus_tag="TPHA_0C01850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684727.1"
                     /db_xref="GeneID:11533441"
     CDS             421779..424946
                     /gene="TPHA0C01850"
                     /locus_tag="TPHA_0C01850"
                     /inference="similar to DNA sequence:INSDC:YPL022W"
                     /note="similar to Saccharomyces cerevisiae RAD1 (YPL022W);
                     ancestral locus Anc_8.473"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684775.1"
                     /db_xref="GeneID:11533441"
                     /db_xref="GOA:G8BRG5"
                     /db_xref="InterPro:IPR006166"
                     /db_xref="InterPro:IPR006167"
                     /db_xref="InterPro:IPR010994"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR020819"
                     /db_xref="UniProtKB/TrEMBL:G8BRG5"
                     /translation="MQSLFVQEDSDDEKLQEELSRQEENIKSQKENINSTVNGEVEEY
                     EKILDDLNANTITSNEKDIDDEKPLYPLIPADENESEQNVPNIKDIRPVNINLTLPLT
                     YQQNIVEHVLISEDPLVIMGKGLCMASIVANLLFILVTPTKIGNVLKRSLVLVLNASP
                     NDNKHIEEELQELYWLSQDEDFEINDDLKENPRSFNVVTADSLSVDNRRKLYLSGGII
                     SVTSRILIADLLSGVIHPNRITGLVVLNVEKIRHLSNESFIVEIYRTKNKWGFIKAFS
                     EVPESFVMEFSPLLRKLKDLRLKNVLLWPRFRFEVSSCLNPKEGQYNKGKVIEIKIDM
                     TDSMLKIQFGLMECLKKCIAELNRKNPELARDWWSIENALDINFQKSIDSVMIPNWHR
                     ISFISKQLIKDIRFLRYLLKYLVSADCVDFYEEIQLSIEANKPSISRKYSESPWLMAD
                     ESQLVISHSRKRVYEDEKYQLEELPKWDALLNILADIALERSMKNVTGPTLIMCADGS
                     TSAQLSTILRNSDRKRGTRKMLEQKLNKYKFRKEERHTLLREANEKIKGNDQQINVST
                     AFAKEKVITKRRRTRGAAAAAAVDKLRTAGSGEDIDGIIDKYQTINNGANDDDPIVIE
                     EYKIVSDDDMVEYVNKDIEFASEKTDQQAWNVLLKKYQFVNSSNEVIIQKFSDIENDS
                     QLQEIMPSYIIMYEPDLTFIRRVEVYKAINAELSPNIFFMYYGDSIEEQRYLTQIKKE
                     KDAFTKLIRENAKLAQSFEADLDLSHLKNLADRKLKMNRLINRNTRIAGGQGNAQVFT
                     QDVVVVDSREFNASLPGLLFRYGVHVIPCMLTVGDYILTPDICVERKSISDLIGSLQN
                     NRLRSQCKKMSRYYKFPTLLIEFDEGQSFSLEPFSEKRSYRSKEMSTVHDISSKLSQD
                     EIQMKLAKLVIEFPGLKFIWSSSPLQTVNIILELKLNREQPDPNVAISLGTNFKGNKS
                     ETTNSNKKIDTEAEFSKLLSVAGISKIDYFLIRKKVKSYRRLKKMALQELIDTLGDET
                     VAETLFEYFLKQEITETEILSDVDN"
     gene            <425216..>427039
                     /gene="TPHA0C01860"
                     /locus_tag="TPHA_0C01860"
                     /db_xref="GeneID:11533480"
     mRNA            <425216..>427039
                     /gene="TPHA0C01860"
                     /locus_tag="TPHA_0C01860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684728.1"
                     /db_xref="GeneID:11533480"
     CDS             425216..427039
                     /gene="TPHA0C01860"
                     /locus_tag="TPHA_0C01860"
                     /inference="similar to DNA sequence:INSDC:YDR243C"
                     /note="similar to Saccharomyces cerevisiae PRP28
                     (YDR243C); ancestral locus Anc_8.469"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684776.1"
                     /db_xref="GeneID:11533480"
                     /db_xref="GOA:G8BRG6"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BRG6"
                     /translation="MARPVDINDLLKGKGNRNPQKGVKSNGKIVKSVTNVIKYKTKKE
                     AGNGYGNLYNINGLKFDLSNASEDLKQNEKRNNENITSGNNSQSTKFNFLWNQKDDTL
                     LEHNPITHIDADDLLRNNKETQSNKFNIENRYLGKHWRDKDYSEMTDRDWRVMEETFN
                     ISVKGSGYRYPLRDWMDTHIIPNDMVEIIKEKLNFETPTPIQRIAIPNICGKVGHSTK
                     NDFMGIAETGSGKTFSFVLPILIKLSRSEFRPMSIKKMDGPKALILAPTRELAQQIQS
                     EIEHFIQYWGGKSLEYTSVSIVGGYSIEELTFKISKGMDILVATPGRLIDCLESKLIV
                     LNDIETLVLDEADKMIDLGFEEQLSTILSYVASYKSKDTVQTIMFSATMSPDIEKLTT
                     SYLHKPIFAKVGSPKSAIERIEQIVRYSETEESTFDKIKELLYGFDSPIIIFINYKRT
                     ADWLYKKIQEETSFHATILHGSKSQDQREHSVKLLKSGKVQVMIATNVAARGIDIPNV
                     SLVINFQIPSSFEDYIHRIGRTGRAGNSGTAVSFMGPEEDPALVKSLYKYVNTVTNIG
                     EKRNSQSSIPNYFDEKLIDIYSLKVNNSFDSFATNNYMIKD"
     gene            complement(427185..427274)
                     /gene="TPHA0Ctrna2Y"
                     /locus_tag="TPHA_0Ctrna2Y"
                     /db_xref="GeneID:11533923"
     tRNA            complement(join(427185..427221,427235..427274))
                     /gene="TPHA0Ctrna2Y"
                     /locus_tag="TPHA_0Ctrna2Y"
                     /product="tRNA-Tyr"
                     /note="codon recognized: UAC"
                     /db_xref="GeneID:11533923"
     gap             427840..427889
                     /estimated_length=50
     gene            <428204..>428905
                     /gene="TPHA0C01870"
                     /locus_tag="TPHA_0C01870"
                     /db_xref="GeneID:11533442"
     mRNA            <428204..>428905
                     /gene="TPHA0C01870"
                     /locus_tag="TPHA_0C01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684729.1"
                     /db_xref="GeneID:11533442"
     CDS             428204..428905
                     /gene="TPHA0C01870"
                     /locus_tag="TPHA_0C01870"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684777.1"
                     /db_xref="GeneID:11533442"
                     /db_xref="UniProtKB/TrEMBL:G8BRG7"
                     /translation="MNSNSSVSIREINDGMSNMIIHDANNNDSIIKGIRRRLVVLRKA
                     RKELFSNSDANPDITNDNDLKEILEFEENEGIIRRAIERYTKELADLEGQTTSKINAK
                     DARNGNHFTKYQLSDAELHDSKSYISSPAENAAQIVIKHTDPNIIKFKTLRGTEIWMN
                     TVQLNYKFNDTLDMLEPFPDWFEKLEQFLNFYSLDEVTKLCAGTTISEVEHQFLTGLI
                     KEKLTVRKLLDILLI"
     gene            <431409..>431852
                     /gene="TPHA0C01890"
                     /locus_tag="TPHA_0C01890"
                     /db_xref="GeneID:11533920"
     mRNA            <431409..>431852
                     /gene="TPHA0C01890"
                     /locus_tag="TPHA_0C01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684730.1"
                     /db_xref="GeneID:11533920"
     CDS             431409..431852
                     /gene="TPHA0C01890"
                     /locus_tag="TPHA_0C01890"
                     /inference="similar to DNA sequence:INSDC:YDL208W"
                     /note="similar to Saccharomyces cerevisiae NHP2 (YDL208W);
                     ancestral locus Anc_8.465"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684778.1"
                     /db_xref="GeneID:11533920"
                     /db_xref="GOA:G8BRG8"
                     /db_xref="InterPro:IPR002415"
                     /db_xref="InterPro:IPR004037"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR018492"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:G8BRG8"
                     /translation="MASESKAEDNYDARMPAVLPFAKPLASKKLNKKILKTVKKASKA
                     KNVKRGVKEVGKALRKGEKGLVVIAGDISPGDVISHLPVLCEDNSVPYIFIPSKQDLG
                     SAGATKRPTSVVFIVPGSNKKKEGKSKEEEYKETFNDVVKEVENL"
     gene            <432274..>433596
                     /gene="TPHA0C01900"
                     /locus_tag="TPHA_0C01900"
                     /db_xref="GeneID:11535211"
     mRNA            <432274..>433596
                     /gene="TPHA0C01900"
                     /locus_tag="TPHA_0C01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684731.1"
                     /db_xref="GeneID:11535211"
     CDS             432274..433596
                     /gene="TPHA0C01900"
                     /locus_tag="TPHA_0C01900"
                     /inference="similar to DNA sequence:INSDC:YDR240C"
                     /note="similar to Saccharomyces cerevisiae SNU56
                     (YDR240C); ancestral locus Anc_8.464"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684779.1"
                     /db_xref="GeneID:11535211"
                     /db_xref="UniProtKB/TrEMBL:G8BRG9"
                     /translation="MPVKKRIRESESAKVTALFKKKRTQLNENDNEDVQNIWRKLNNI
                     STKYEDSGKNIKNSLLFVTFTQSYSDNDISNCITALHQYIDESKLQFIIHCKHKFVIL
                     KTFNILDCCLTLTILFAFKNKRWVSKNTNNYFSISKELDIRGSFYLSERTKLVEEENN
                     NIIMNKIQKSTYSCIQHFDEFHITEGKNILKFMDTLSKFFISLKFSKNNSIIKAFTRS
                     YTNFVTSLDTHMTEMALDPFMLYDLEHIISQNKPLIEESKNHIANYAKELTQYTKGIV
                     LTENGSGNSTRNTNSSESTIDVEKYNNEEHTTRNPKQTLIRSTFMTQEQIKDHCVASV
                     KAGMDTIKEKSPYDIMKVYLKCPKQNYIDLIYQNLNDLTTKSNCNIIVLHLNNLHESE
                     DWFKTLDISKYTNFTQVPHPSTVRIVSIGGVGEHILKAFQMILDILNT"
     gene            <434078..>436498
                     /gene="TPHA0C01910"
                     /locus_tag="TPHA_0C01910"
                     /db_xref="GeneID:11533824"
     mRNA            <434078..>436498
                     /gene="TPHA0C01910"
                     /locus_tag="TPHA_0C01910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684732.1"
                     /db_xref="GeneID:11533824"
     CDS             434078..436498
                     /gene="TPHA0C01910"
                     /locus_tag="TPHA_0C01910"
                     /inference="similar to DNA sequence:INSDC:YDR239C"
                     /note="similar to Saccharomyces cerevisiae YDR239C;
                     ancestral locus Anc_8.463"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684780.1"
                     /db_xref="GeneID:11533824"
                     /db_xref="UniProtKB/TrEMBL:G8BRH0"
                     /translation="MLKSYDTSKPKRKSFFFFGSNNENIIKLDNPNDKKNTKQMKVAS
                     KNKINPLSKEPLRNQPVSSSPFDQIDNTNNKREVEKIAVSSIANSESNEKHNPFRTNA
                     SSNVIIPANTDISKELLRPSGTVLGRRPLPPKLDMRNISKSATLRSNINNKSETKKKF
                     EPDNDNDIGVITNVESLNECLGDENKHRRQRSEAEKLVDDIDDFLAKHKGRSASPSPG
                     IDIDIYSDHAVSPIGALSLDADGIMKFKDSNSNPFQEYNDKDFVEERENSKHHDTLSK
                     RSTLISTATTTESDNFSFAKTIAASSETTQPIQINDTTAANTDMPNLVYKHDTFNMVS
                     SNDNQGYNSFIASDIDISSDESDFANRSVTYSANHNNFNNSNKSTEEIKNYQKLPNNY
                     STDGFSVSSEKKVFRVVNDEKVNFNFHSDSESESESESDSNFTYGNDPTPSNFSQTQV
                     QSKDENKNESLYLSDQQVSVIDKSSHYTGNSEYVYPEEVINNISKISKVDKDLNEISY
                     NAENLSSNAELLSGGVIKPDSINKSLDIESATSSLNHDQIGEVASSSALEDKSLGSPS
                     YMSNKYISSVKREGNVSLVSGYVEEVRLKYIKTANFLQAPPNLPISLKQKNNVIRPQN
                     MKVRIRTSSKQVGIKHGKIKSKLLSLETISDEAKANKIETNLVDHTKEFHNLMNKKDQ
                     IPEQSDEDSDNDVESYLKDIPGDNAYNSDDIFEPLREKKDNNNDLARSNTTTSYYTKA
                     QQRRKRTGTLDNNYSNLHDLPTDININDYLENEIEKVEDIKDDDMPLEPYISVGGLHI
                     TNPDTDSD"
     gene            complement(<436743..>437636)
                     /gene="TPHA0C01920"
                     /locus_tag="TPHA_0C01920"
                     /db_xref="GeneID:11535280"
     mRNA            complement(<436743..>437636)
                     /gene="TPHA0C01920"
                     /locus_tag="TPHA_0C01920"
                     /product="mitochondrial 54S ribosomal protein YmL7/YmL5"
                     /transcript_id="XM_003684733.1"
                     /db_xref="GeneID:11535280"
     CDS             complement(436743..437636)
                     /gene="TPHA0C01920"
                     /locus_tag="TPHA_0C01920"
                     /inference="similar to DNA sequence:INSDC:YDR237W"
                     /note="similar to Saccharomyces cerevisiae MRPL7
                     (YDR237W); ancestral locus Anc_8.461"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL7/YmL5"
                     /protein_id="XP_003684781.1"
                     /db_xref="GeneID:11535280"
                     /db_xref="GOA:G8BRH1"
                     /db_xref="InterPro:IPR002132"
                     /db_xref="InterPro:IPR022803"
                     /db_xref="UniProtKB/TrEMBL:G8BRH1"
                     /translation="MQRLAVNYNLCRGFFTGSALAKSACSIVKPVHHLVKIDKAKLSP
                     RFPELNFNKNDIRSPAFKPVAVCQDRGQEHYLNTLQSDLLLMTYSHGKKKIEGLKRRP
                     WDGTSPYHLNRRTKNPKGSKSQLPDVNPIDWKNIPNIESVVLNCYVSQAKENPLLAIS
                     ASLQLQQITGVKPIPLYSRTDVPSWKVRKGNHMGAKVELKGRPMTQFLLTLSEIVLPR
                     IREYKGISNTSGNKFGSISFGLTPSDVRFFPEIDSNQDLWPVSFGMHININTSAQTDA
                     QARTLISGFQIPFNGSKNQEF"
     gene            <438203..>439906
                     /gene="TPHA0C01930"
                     /locus_tag="TPHA_0C01930"
                     /db_xref="GeneID:11533519"
     mRNA            <438203..>439906
                     /gene="TPHA0C01930"
                     /locus_tag="TPHA_0C01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684734.1"
                     /db_xref="GeneID:11533519"
     CDS             438203..439906
                     /gene="TPHA0C01930"
                     /locus_tag="TPHA_0C01930"
                     /inference="similar to DNA sequence:INSDC:YDL207W"
                     /note="similar to Saccharomyces cerevisiae GLE1 (YDL207W);
                     ancestral locus Anc_8.460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684782.1"
                     /db_xref="GeneID:11533519"
                     /db_xref="GOA:G8BRH2"
                     /db_xref="InterPro:IPR012476"
                     /db_xref="UniProtKB/TrEMBL:G8BRH2"
                     /translation="MKFAFDDLLNSSENDDLLDKVVTSENIQESPLSSPNLDYTYINE
                     SEEDESIPHLRLPRKQLDNEIMINSLNKVNNMNSFVELRKSEETPSLNPELLQYMKDL
                     DLDSRLPRINVSLHVLVSNNGNLLVNNNQADGSLETVKKIEIDNSKEKAVLSIQHSFT
                     SRLNALVNSNLEQVKDIKKRKKEEEQRIRKEREDRERKIEEERRRKKAEEELKRKEEE
                     ERLRLEKEALDKQKKELELKEKARKEEEALKTQQEKLAELKYNQNVGKEITNFKEINK
                     TFLYYKDKIKEIKRDIIEPVKNGDKNFKSILSKHKRKINPKFGQLTNSTQQLKNVYEE
                     LTKLVDETKTNQLSYNWILNFICKAIVSQAETEVRVKPASSLALGKLSVLLMIRYEEL
                     TELLKARFIKKCPFVIGFSCKIDTEEGRLRMGWKRKEDNKWEEETTYDERMGGMVTLF
                     SVITRLPVSTEFNGITAESRNPIPISESWRFLARICNMDKELLTNSHFIILCSWWEAA
                     GKQFVEHYGKQGEKLLRLVAGNLINSVSASKFIGAARLSILIEEWITTGSIKSFPEMD
                     A"
     gene            <440370..>440981
                     /gene="TPHA0C01940"
                     /locus_tag="TPHA_0C01940"
                     /db_xref="GeneID:11535245"
     mRNA            <440370..>440981
                     /gene="TPHA0C01940"
                     /locus_tag="TPHA_0C01940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684735.1"
                     /db_xref="GeneID:11535245"
     CDS             440370..440981
                     /gene="TPHA0C01940"
                     /locus_tag="TPHA_0C01940"
                     /inference="similar to DNA sequence:INSDC:YDR236C"
                     /note="similar to Saccharomyces cerevisiae FMN1 (YDR236C);
                     ancestral locus Anc_8.459"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684783.1"
                     /db_xref="GeneID:11535245"
                     /db_xref="GOA:G8BRH3"
                     /db_xref="InterPro:IPR015865"
                     /db_xref="InterPro:IPR023465"
                     /db_xref="InterPro:IPR023468"
                     /db_xref="UniProtKB/TrEMBL:G8BRH3"
                     /translation="MRAVDVAIPEVPQAPYPIFCSEFNEVINGFGRGSSELGIPTANI
                     DIDKLPSIINDDLSLGVYFGYCQLMENDALNINNNGTETSSNIKFREDGSEVIYNYGA
                     QLNASNGDLEKLPVVLSVGKNPFYNNEQDVDAIQKTVELHILHDFESDFYGALIKFNI
                     LGYIRPELNYTSKEQLIDDINTDIEIARSTLLKPTYLKYKDLL"
     gene            <442370..>443197
                     /gene="TPHA0C01950"
                     /locus_tag="TPHA_0C01950"
                     /db_xref="GeneID:11533461"
     mRNA            <442370..>443197
                     /gene="TPHA0C01950"
                     /locus_tag="TPHA_0C01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684736.1"
                     /db_xref="GeneID:11533461"
     CDS             442370..443197
                     /gene="TPHA0C01950"
                     /locus_tag="TPHA_0C01950"
                     /inference="similar to DNA sequence:INSDC:YDL204W,YDR233C"
                     /note="similar to Saccharomyces cerevisiae RTN2 (YDL204W)
                     and RTN1 (YDR233C); ancestral locus Anc_8.454"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684784.1"
                     /db_xref="GeneID:11533461"
                     /db_xref="GOA:G8BRH4"
                     /db_xref="InterPro:IPR003388"
                     /db_xref="UniProtKB/TrEMBL:G8BRH4"
                     /translation="MSTEQKKDCCACKCITECDVLTWKNPIETGKLFGASLLAILFIK
                     NVNILTFLSKTLYLVFFTTGSIEFITNLLLGNGNGLVTKYGIQNCPNTVGFIRPYVDE
                     FLKQLPIKQAAMRKLVFAASPKNTLKAGALFWFLHKVFSLISFTNLLIIVDLIAFTLP
                     IVYKSYQTEIDQVVKQIIEILQKNLEVAKKQACEKAKPTLQSLDKKLGPVSKLIKSKL
                     NIDDKKNESESTAASSSAPAAATSGSEFPSVPASQPISEAINAAAEDASKKAEELSN"
     gene            complement(<443479..>445266)
                     /gene="TPHA0C01960"
                     /locus_tag="TPHA_0C01960"
                     /db_xref="GeneID:11533952"
     mRNA            complement(<443479..>445266)
                     /gene="TPHA0C01960"
                     /locus_tag="TPHA_0C01960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684737.1"
                     /db_xref="GeneID:11533952"
     CDS             complement(443479..445266)
                     /gene="TPHA0C01960"
                     /locus_tag="TPHA_0C01960"
                     /inference="similar to DNA sequence:INSDC:YDL203C"
                     /note="similar to Saccharomyces cerevisiae YDL203C;
                     ancestral locus Anc_8.452"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684785.1"
                     /db_xref="GeneID:11533952"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G8BRH5"
                     /translation="MDYKYENSQYYDNQRYQNHMKEFPPNQQTNEVSPRINKNTKHTP
                     YPIDDSIEVNHRAPVTGTNFPSKPHTYVTPVHTPVEQTFKMNSSQNSDAISNPSYFDA
                     NNQLGKPNNRTPVINQPSFNASSNSFASSETSIVTAPDMILSQPQSKPAMMKNPSRIQ
                     YERTPSDNEVPPTQTSNLNNTKNNNIKQSRNIDLSSYPPEAIDFYEIYKRTLDDSSNF
                     TNEVQFKWCETLFEYAFKDSFISQYNINAERLTRKLTPEEVIKNQKIMIDHSFKVLSK
                     LISNKYPKAIYLMATLYSHQPYLKIKDKNIIGRDDARAFELYQIAAKFNHSDSFYRAG
                     ICCEFERGISTDPSKGITREHMIQKAIGFYEKGALICQNKLCMYKLGMCYLYGLNNNI
                     NEVSRQRIIQPDVRLSVNWFEESGNSQSVYELAKIYEFDNLLSPIKKLLIDSNMHKDP
                     SKSLRYYYKCATEFNHSLSQWKLGYCYENGYLNLPVCGEKSIAWYMKSVKTNPNAVAM
                     LSIAGWYLTGCPNVLRPNLVESFTWVLKSCQLSDGKFSKAEFILGSYFEYGIGCKQDM
                     NRAINRYEIASKLGHLRAKEKLRQYGIPV"
     gene            complement(<445831..>447459)
                     /gene="TPHA0C01970"
                     /locus_tag="TPHA_0C01970"
                     /db_xref="GeneID:11533981"
     mRNA            complement(<445831..>447459)
                     /gene="TPHA0C01970"
                     /locus_tag="TPHA_0C01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684738.1"
                     /db_xref="GeneID:11533981"
     CDS             complement(445831..447459)
                     /gene="TPHA0C01970"
                     /locus_tag="TPHA_0C01970"
                     /inference="similar to DNA sequence:INSDC:YDR229W"
                     /note="similar to Saccharomyces cerevisiae IVY1 (YDR229W);
                     ancestral locus Anc_8.450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684786.1"
                     /db_xref="GeneID:11533981"
                     /db_xref="UniProtKB/TrEMBL:G8BRH6"
                     /translation="MSASEPKIGTSNELKSNSSLRENSSNNRYHAPHLSEFYSIVNNE
                     NQRLPTVNENNNSVDELVSSINDTDINGNSNKKESGFNPFTKFTSRFSSRRPSSVTSG
                     MSSISDLRTLVTKKDMDNTAIEIEKLYKNSKSYSSKLVDISTESSELACSLEAISKLK
                     GCSDVSADKLLKASGLFHLLANHEQIMSRIINDLLNENILQELTNFKEENKKLTKEFK
                     NNFMELSSSLKLQEKRNAELSKKKIRNILTYRQSLNNLQFQLDQVETLKHHYFQDCYK
                     LVEDTCNNVLKNVASTTRAQVEISENIARKGWSGGGLDNLLSDSNDPFNYESDEEDEE
                     FQQIKNNQETDQHINGEEELPTLKENIVSKIVTAENNGKIAVSPKVTTSDVNENKIVN
                     ENPELMSTPHKFICTSDNANSITNENYITSPLKNETKDSDTKSESDQMDNEEHEDVDS
                     NFDNSFSLPIMPPSRNTNPDHIKSLSRQEQNNGITSVEKLLLPGTNILSDMHTEFEKH
                     ERKPELENEQDFGNTMEESEYPDFADQSTIHDNS"
     gene            <448046..>448837
                     /gene="TPHA0C01980"
                     /locus_tag="TPHA_0C01980"
                     /db_xref="GeneID:11535194"
     mRNA            <448046..>448837
                     /gene="TPHA0C01980"
                     /locus_tag="TPHA_0C01980"
                     /product="mitochondrial 54S ribosomal protein YmL11"
                     /transcript_id="XM_003684739.1"
                     /db_xref="GeneID:11535194"
     CDS             448046..448837
                     /gene="TPHA0C01980"
                     /locus_tag="TPHA_0C01980"
                     /inference="similar to DNA sequence:INSDC:YDL202W"
                     /note="similar to Saccharomyces cerevisiae MRPL11
                     (YDL202W); ancestral locus Anc_8.449"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL11"
                     /protein_id="XP_003684787.1"
                     /db_xref="GeneID:11535194"
                     /db_xref="GOA:G8BRH7"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="UniProtKB/TrEMBL:G8BRH7"
                     /translation="MNSLRLILPNTSFVKCFYNNAIPKVGLTSSLYHHFNGRCYSIET
                     QNKGTKQGHNKVKLPVRKTVKPIDSRKTFLMDSYKNMMEKSSVVLFLHYNNLLKQEDD
                     FFRFQVKANGGTLKKLRNGVFGAYLRASHLEDPCMPLKKGDKNNNHPLLPLLKGSTAA
                     IVFDETDSVAVSKILKILQRHQDKLFVIGAKVENSVFDIEKLNKFKDLPSKAQLHSQL
                     LGLLHALSGVGLVNTLENASKTLYMTLQSHNDNTLNTEKSEDSEN"
     gene            <449489..>450337
                     /gene="TPHA0C01990"
                     /locus_tag="TPHA_0C01990"
                     /db_xref="GeneID:11533960"
     mRNA            <449489..>450337
                     /gene="TPHA0C01990"
                     /locus_tag="TPHA_0C01990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684740.1"
                     /db_xref="GeneID:11533960"
     CDS             449489..450337
                     /gene="TPHA0C01990"
                     /locus_tag="TPHA_0C01990"
                     /inference="similar to DNA sequence:INSDC:YDL201W"
                     /note="similar to Saccharomyces cerevisiae TRM8 (YDL201W);
                     ancestral locus Anc_8.448"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684788.1"
                     /db_xref="GeneID:11533960"
                     /db_xref="GOA:G8BRH8"
                     /db_xref="InterPro:IPR003358"
                     /db_xref="InterPro:IPR025763"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BRH8"
                     /translation="MSNKDTGSKRYAYRANKEENRKELKHVKIDESSVVNENMKMDLP
                     KKRFYRQRAHSNPFSDHQLEYPEKPADMDWSKLYPYYYDENTKEMTKKVTITDIGCGF
                     GGLLIDLSPEFPNDLILGMEIRVQVTNYVEDRIIALRTNNVETKGYQNINVLRGNAMK
                     FLPNFFEKGQLSKMFFCFPDPHFKQRKHKARIITNTLLSEYAYVLKEGGIIYTITDVE
                     DLHIWMAKHLEEHPLFERLDETWESNDKCVQIMRHATEEGKKVERKKGDKFVACFKRL
                     PTPEII"
     gene            complement(<450359..>451009)
                     /gene="TPHA0C02000"
                     /locus_tag="TPHA_0C02000"
                     /db_xref="GeneID:11533465"
     mRNA            complement(<450359..>451009)
                     /gene="TPHA0C02000"
                     /locus_tag="TPHA_0C02000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684741.1"
                     /db_xref="GeneID:11533465"
     CDS             complement(450359..451009)
                     /gene="TPHA0C02000"
                     /locus_tag="TPHA_0C02000"
                     /inference="similar to DNA sequence:INSDC:YDL200C"
                     /note="similar to Saccharomyces cerevisiae MGT1 (YDL200C);
                     ancestral locus Anc_8.447"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684789.1"
                     /db_xref="GeneID:11533465"
                     /db_xref="GOA:G8BRH9"
                     /db_xref="InterPro:IPR001497"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014048"
                     /db_xref="UniProtKB/TrEMBL:G8BRH9"
                     /translation="MMKSEVTYFFVKTDWIKALAVIKNDNNKIVYIRLGQNEANLLKG
                     TLAWFEKVTKKKYNNMSYHLNDESKFKDKVKLHEIKNIFVSILNQEKESPNELLEFEL
                     ITGTDFQKKVWIEISKIKHGKTLQYSDIANNLGNPKAVRAVGRACGENNLVILIPCHR
                     VLGSSKKLTGFAYGLEMKKYLLKKEKLITMKYDTILYLNEHYYSIKCKCYIVNVLH"
     gene            complement(<451294..>452202)
                     /gene="TPHA0C02010"
                     /locus_tag="TPHA_0C02010"
                     /db_xref="GeneID:11533965"
     mRNA            complement(<451294..>452202)
                     /gene="TPHA0C02010"
                     /locus_tag="TPHA_0C02010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684742.1"
                     /db_xref="GeneID:11533965"
     CDS             complement(451294..452202)
                     /gene="TPHA0C02010"
                     /locus_tag="TPHA_0C02010"
                     /inference="similar to DNA sequence:INSDC:YDL198C"
                     /note="similar to Saccharomyces cerevisiae GGC1 (YDL198C);
                     ancestral locus Anc_8.445"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684790.1"
                     /db_xref="GeneID:11533965"
                     /db_xref="GOA:G8BRI0"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8BRI0"
                     /translation="MAPNDKKQSGAARLLGSASAGIIEIGVFHPVDTISKRLMTNHSK
                     VTSLGEFNKVIFKQHSELPFNKKFFTLYPGLGYAAVYKVLQRVYKYGGQPFVNDYLNK
                     NYRSDFDNAFGEKTGKALRSATAGSIIGIGEIVLLPFDVLKIKRQTNPEAFRGRSFIR
                     ILKDEGIFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLQDYSQATWSQNFISSI
                     VGASASLIVSAPLDVIKTRIQNRSFENPESGLTIVKNTIKNEGITAFFKGLTPKLLTT
                     GPKLVFSFALAQSLIPRIDQFMNERK"
     gene            <453212..>455203
                     /gene="TPHA0C02020"
                     /locus_tag="TPHA_0C02020"
                     /db_xref="GeneID:11534090"
     mRNA            <453212..>455203
                     /gene="TPHA0C02020"
                     /locus_tag="TPHA_0C02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684743.1"
                     /db_xref="GeneID:11534090"
     CDS             453212..455203
                     /gene="TPHA0C02020"
                     /locus_tag="TPHA_0C02020"
                     /inference="similar to DNA sequence:INSDC:YDR228C"
                     /note="similar to Saccharomyces cerevisiae PCF11
                     (YDR228C); ancestral locus Anc_8.444"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684791.1"
                     /db_xref="GeneID:11534090"
                     /db_xref="InterPro:IPR006569"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR021605"
                     /db_xref="UniProtKB/TrEMBL:G8BRI1"
                     /translation="MDRDQEAIVKDFTSILDELTFNSRPIITTLTKMAEENISLAQYF
                     VDALESRVEKCVPKQKLYAFYTIDSICKNAGSPYTIYFSRNLYNLYKKAYLLVDNQVR
                     TKLINMFKTWIQPIESTGLPIFDNVELDKIENFLIKASALHHKNFTKLLPEPTVPLLL
                     RDIDKLTTLTNERLTKQKNSDSNDEKEIEKLNMKILVLSQLKQELQKGKLTKVALKQV
                     QVQLLQVFAQDQQVLQERIRQEQLQQEQLQQRQRTEQLQLQQLSHHQNAAINQQFQIK
                     NDHNPLFGNSLNLNPQGFSTLFNNSNFIPMNQNMDDNNTMGGMNLNNIIEPANISNIE
                     KQNKLNKMHSLFESLKAEKLVFQPKEQSIITLNAKLNIDDGKLINNSGRAKSETDLTR
                     LPSIEFLSNIISDCKAYFSTVNIDIVNTPSLNISQDFILGENKIVENNLINTLYRAKP
                     KKCTLCGKRFGNTLDERRLQSDHLDWHFRINKRIKGSENTLSNITATNSSSNTTQKNI
                     QSRNWYLHDSQWIIFKDKEIVSTSRSDHSENNMTVVNLDFNTNMNSQKNNNINNADRN
                     LSGNESNKFVKIDEGLLSKKYVIVPESVEDMSFKCPVCKEIVAATYDEELGEWIWKGC
                     MEYKGKYFHATCYYESAKNKNTSIGLELDMEKLKNLITD"
     gene            complement(<455550..>458213)
                     /gene="TPHA0C02030"
                     /locus_tag="TPHA_0C02030"
                     /db_xref="GeneID:11535310"
     mRNA            complement(<455550..>458213)
                     /gene="TPHA0C02030"
                     /locus_tag="TPHA_0C02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684744.1"
                     /db_xref="GeneID:11535310"
     CDS             complement(455550..458213)
                     /gene="TPHA0C02030"
                     /locus_tag="TPHA_0C02030"
                     /inference="similar to DNA sequence:INSDC:YDR227W"
                     /note="similar to Saccharomyces cerevisiae SIR4 (YDR227W);
                     ancestral locus Anc_8.442"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684792.1"
                     /db_xref="GeneID:11535310"
                     /db_xref="UniProtKB/TrEMBL:G8BRI2"
                     /translation="MLFKPPVHQGLQGLPSINVDVPQQQNNQNNESNVTYNGPLFLRQ
                     HSSKATKDSNSNVQEINTAQKVPAPNKLLDLLISKRNASKKNAKFKSFSEASPTATKK
                     TLSSNPVDNSRGKETIYSILNHDLKSDGKNLQLNKRIADNELESEPRKGLKTAETNIS
                     SDKKSQKDIVETQKNLKNEAIEEGEDDNVTILDVTHLEKETERNAMDTDNTTTVTSIE
                     NNVDAKEAGIKKIQISSLIEPREASKSLNEIEDESYKENDKEVQNNTNDNLSQQEIAE
                     INAMEEKSLLKHKIPDKNIKPLPSSTINVQEGSIMHITNELTSSSASSPSESKEESDE
                     NYSSSEIDGMNSSNNQKFNMENLLAGLVNVETRLQNESEYEAESAFKKYDYEISKRMN
                     KLEFDHSFFNREKLSNLINSGVFTHNAIDSDVYVSSTNNISSFRNYQHSRAFLFQNEK
                     KKSRLKYLPQAEAAFLDSKKGHSEVVCDNTVSNFPRENIIEPKIDLTLQDDFNAGKVR
                     WISEWKRHLKYFHIYFENSDTQVQDSIVIIFEAIKLIFEKELGSIIDRNYSDDTDVII
                     LNCDLENIPEGKRSPALKSAMFKNSTRTARKVRIWTFSKILKFLLTMRVDISKYIYDV
                     KNVRLSNMSRSEIPTTASTKVSPENDPIKQTVEGIYTSSGSPTNVIANDGADRVEKLT
                     ANDGADRVESLIEEEIQGSTVHSKNSTTSEIDKPNEVPNAAPNEVPNAAPNEVPNAAP
                     NEVPNAAPNEVPNAVTNAVPNEVPFNRNCYHQKVIDIINNSSQLSETDINNSSQLLES
                     LGKNIPANIEESTNPEKPTDTNLEILFLRSLLEKSLLLLDSKTKLLVESYSKIESLSA
                     EVLKSQFTISSLKANLQKLEDLADDDNSRSI"
     gene            <460036..>462753
                     /gene="TPHA0C02040"
                     /locus_tag="TPHA_0C02040"
                     /db_xref="GeneID:11533789"
     mRNA            <460036..>462753
                     /gene="TPHA0C02040"
                     /locus_tag="TPHA_0C02040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684745.1"
                     /db_xref="GeneID:11533789"
     CDS             460036..462753
                     /gene="TPHA0C02040"
                     /locus_tag="TPHA_0C02040"
                     /inference="similar to DNA sequence:INSDC:YLR219W"
                     /note="similar to Saccharomyces cerevisiae MSC3 (YLR219W);
                     ancestral locus Anc_8.440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684793.1"
                     /db_xref="GeneID:11533789"
                     /db_xref="UniProtKB/TrEMBL:G8BRI3"
                     /translation="MVFGLNKKERKVPDLSRYDYYYQNKQQDEQNTAQQHHHQQQQVR
                     HSYLPSQNRHSSYSDFHSANRRHASTASAQKQRAYSVTGHNDGSSYTVKNPTSNQITT
                     TKTRSLVPPQKTRTARRPSNNSRSYSIKSQNSNTDQTKRLNSINSVGSKQINNTGRNH
                     KNNGSRSNSITVQTTEIKDPNGKTQSITRKTVKRMNGFEYVETTTTTTTTVKKKSPMK
                     SKQKSKNRNSEINRHFQEFSGDYIEEDGYTNIGNNIDDNNNASDVEDESPYEDEQKDV
                     ESVTEPDNNDFVDSVIEEENEIDIIEEENHGHDDENALFLADSGSDKIHKPHNLRALL
                     MPKETPLEKDEDIVPLDNTSSISKFTEAREEESISEVNNKKNDKQVPVNGSSRNSEIP
                     EQKKKRIVRASSVPSNLRSNNSSYSKLKPKASGSNLRKAHVPSEPKPKKKLTEEEMYA
                     VAYEIARKKVYQNSGLSHPEMNGMQYANPQPPVIVEESKGMSKMAKRMSVRQKPVINY
                     QEDHQRQNYEVSLDAYSQNSRKNSVASTLPTSLNSNKKALDIHKLHSNEKHAPPIKKT
                     MTDEEMYAKALQIAQKRFNDDKTANSMSLSQPEPIIVQESATSSINKKIDILPSIEDN
                     PPHAKVQSIGTEEYNEEPREFVPEASMAKSPMKHRLRKLSSVSLGKKTKNPEITSIQT
                     NNEIAESPNKSKLKNVFNKVVQFSQENSGYQPPKKDRQYQEEKVAPDAGNEHNTNFVR
                     SAFDANEEHEQRVNSNLQNMAPPPAVNGQMNRISTNNENTGAQSINYNTLEAPTVTAG
                     SSNVGGASIKDSTMESVNRQNTKSSSRGAPPSINDSTLLNNQNSNIIIKTNNQAPVNS
                     QAREYASVSNVETALNNSGQPINVQTPKTSKNDNKTKKKKSFFGKLFKH"
     gene            complement(<463169..>463567)
                     /gene="TPHA0C02050"
                     /locus_tag="TPHA_0C02050"
                     /db_xref="GeneID:11533499"
     mRNA            complement(<463169..>463567)
                     /gene="TPHA0C02050"
                     /locus_tag="TPHA_0C02050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684746.1"
                     /db_xref="GeneID:11533499"
     CDS             complement(463169..463567)
                     /gene="TPHA0C02050"
                     /locus_tag="TPHA_0C02050"
                     /inference="similar to DNA sequence:INSDC:YDR225W"
                     /note="similar to Saccharomyces cerevisiae HTA1 (YDR225W);
                     ancestral locus Anc_8.439"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684794.1"
                     /db_xref="GeneID:11533499"
                     /db_xref="GOA:G8BRI4"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G8BRI4"
                     /translation="MSGGKGGKAGSAAKASQSRSSKAGLTFPVGRVHRLLRRGNYAQR
                     IGSGAPVYLTAVLEYLAAEILELAGNAARDNKKSRIIPRHLQLAIRNDDELNKLLGNV
                     TIAQGGVLPNIHQNLLPKKSAKAAKASQEL"
     gene            <464776..>465162
                     /gene="TPHA0C02060"
                     /locus_tag="TPHA_0C02060"
                     /db_xref="GeneID:11533768"
     mRNA            <464776..>465162
                     /gene="TPHA0C02060"
                     /locus_tag="TPHA_0C02060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684747.1"
                     /db_xref="GeneID:11533768"
     CDS             464776..465162
                     /gene="TPHA0C02060"
                     /locus_tag="TPHA_0C02060"
                     /inference="similar to DNA sequence:INSDC:YDR224C"
                     /note="similar to Saccharomyces cerevisiae HTB1 (YDR224C);
                     ancestral locus Anc_8.438"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684795.1"
                     /db_xref="GeneID:11533768"
                     /db_xref="GOA:G8BRI5"
                     /db_xref="InterPro:IPR000558"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G8BRI5"
                     /translation="MSAKAEKKPASKAPAAAKKTPTAGSDGKKRTKARKETYSSYIYK
                     VLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLI
                     LPGELAKHAVSEGTRAVTKYSSSTQA"
     gene            <467715..>468653
                     /gene="TPHA0C02070"
                     /locus_tag="TPHA_0C02070"
                     /db_xref="GeneID:11535254"
     mRNA            <467715..>468653
                     /gene="TPHA0C02070"
                     /locus_tag="TPHA_0C02070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684748.1"
                     /db_xref="GeneID:11535254"
     CDS             467715..468653
                     /gene="TPHA0C02070"
                     /locus_tag="TPHA_0C02070"
                     /inference="similar to DNA sequence:INSDC:YLR220W"
                     /note="similar to Saccharomyces cerevisiae CCC1 (YLR220W);
                     ancestral locus Anc_8.437"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684796.1"
                     /db_xref="GeneID:11535254"
                     /db_xref="InterPro:IPR008217"
                     /db_xref="UniProtKB/TrEMBL:G8BRI6"
                     /translation="MSVVALKNAVVSLAKGSRSDDTDKKSLLNNNNKSYGSNNNTDLE
                     SNQVSTNGDNLLNNNNNGDAMSINDDPFASNSVINKLFGQIDPRVISDLIIGLSDGLT
                     VPFALTAGLSSLGDSKLVITGGFAELISGTISMGLGGYLGAKSESDYFHAEVKAQKKF
                     FYNDPTLINHQVEDILLSINEDFTDDTILSFIKDLQKKPQLMVDFIIRYGKGLEEPDP
                     NRQFISAATIGGGYFVGGLVPLIPYFFVSEVGTGLIYSIIVMMFTLFWFGYIKIQLSM
                     GDQCTMRHKVFEGFQMIAVGGIAAASAWFFVKLLDG"
     gene            complement(<469182..>469703)
                     /gene="TPHA0C02080"
                     /locus_tag="TPHA_0C02080"
                     /db_xref="GeneID:11533930"
     mRNA            complement(<469182..>469703)
                     /gene="TPHA0C02080"
                     /locus_tag="TPHA_0C02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684749.1"
                     /db_xref="GeneID:11533930"
     CDS             complement(469182..469703)
                     /gene="TPHA0C02080"
                     /locus_tag="TPHA_0C02080"
                     /inference="similar to DNA sequence:INSDC:YLR221C"
                     /note="similar to Saccharomyces cerevisiae RSA3 (YLR221C);
                     ancestral locus Anc_8.436"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684797.1"
                     /db_xref="GeneID:11533930"
                     /db_xref="InterPro:IPR028217"
                     /db_xref="UniProtKB/TrEMBL:G8BRI7"
                     /translation="MGEVSTAVKRKRNNKRRNKKRTAISDSDDSSFSDNEITESKDIV
                     AGTNESETVNDEVKPEITQKYESLELSDNEISDIEMKDEAKEDNVIANDKYEEISNIE
                     DIKNKLDSKKADNQLKNEYLNLLFTNYGDDVNSLREAPDFSTKSLSILANVLKDGTKM
                     FDQDTLRSILETK"
     gene            complement(<470274..>473513)
                     /gene="TPHA0C02090"
                     /locus_tag="TPHA_0C02090"
                     /db_xref="GeneID:11533482"
     mRNA            complement(<470274..>473513)
                     /gene="TPHA0C02090"
                     /locus_tag="TPHA_0C02090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684750.1"
                     /db_xref="GeneID:11533482"
     CDS             complement(470274..473513)
                     /gene="TPHA0C02090"
                     /locus_tag="TPHA_0C02090"
                     /inference="similar to DNA sequence:INSDC:YDR223W,YLR223C"
                     /note="similar to Saccharomyces cerevisiae CRF1 (YDR223W)
                     and IFH1 (YLR223C); ancestral locus Anc_8.434"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684798.1"
                     /db_xref="GeneID:11533482"
                     /db_xref="InterPro:IPR018837"
                     /db_xref="UniProtKB/TrEMBL:G8BRI8"
                     /translation="MPSKNSPRKALPKASPIKSGEANKSQVSGKLPANIKQLFKNQNS
                     KTEKSDGNLNVSGTNRPRRFSLLYSSDSSLSDLSDEKSNIARPAYAGKKNRNNQHHMT
                     EGKKLVSGMFANATANNVKNKSATEDDKKVKSSTSGKNSKLIRNQTVNNDSIENRKED
                     EGTESSDYGVFVSADEDGASSSDDDDDDDDTDGDSDTSSEDENIDFVKLTAQRKKRAM
                     EALSALKRKTVLSMEKHNTNNDHTIDSKPQATEDIGEEIKVTENTVKFNNSNNNNNIN
                     NVSLGNKLIEEFHIPKLSSLSESSSSTSDEKLDKNSLENEIDSNQYSDISPTSGTESD
                     YDIDHDEFFKAIGKDDSDALTDVDTGIETGEDDIALLEQEEADIVKELQDDYDISFDG
                     SVHEEGSDPEDNMSQKVKTRIFSNNQGEVEFDEDDFEIPFYEDPKFFNLYSYGDGTEP
                     KLGLSTSLPLLLNDEKLSKLRNKQAKKLERKERLQRHKLLKKNKSLRHASTPSIDNGG
                     DEYIFSVFFHSDEDNDDKRSSKKKLNIDSPLHHLGDANSKYDNEHALTSDDDNNCSLL
                     DEARIPSENEDENIIVNENNKSKDNNQFVLKNKTLNKKSKSRNKSHTSIDSSSDGLSI
                     ELDDDDDDDDLSLTNVFIDIDDLDPDSFYFQYDDEEDDDFLDDLDDIKHNGSSYSDIS
                     VDDIDIDSSDGDKNKLNGGTDKAMIYVDDESTDEDDNLPRPTQKSKSLSTKAKEIVGS
                     NVIGLRPPKLGTWKTNSKPFSIIDGLSTKSLYPLIQEHMQLLEGRANSMTPEGVETPN
                     EIPNTNADELTLNELLNMSDLEDQASEDVDASNTQLLNISEWYNKPKVPLSAFRNKGV
                     NHFDDDEYLIPDNSIKKFPIGYVGNERTRRKIARMKELQKKENEKRRKIKKKRKLLKM
                     QRDQARKVRSEMLNKELASTVAAPTSDSLITNTSRKNSMKNDALYEIHSLLKHEDNDL
                     LDNTHDDDDYDDNIFDLTQINGDIDTTSLDVKDVDILTSLTAPVELGNLDGNSASLWR
                     RRKSIVEAAEENLRFTKNGLFSETALADIEDILEDGTSSSAFNYDEVLQ"
     gene            complement(<474863..>477127)
                     /gene="TPHA0C02100"
                     /locus_tag="TPHA_0C02100"
                     /db_xref="GeneID:11533942"
     mRNA            complement(<474863..>477127)
                     /gene="TPHA0C02100"
                     /locus_tag="TPHA_0C02100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684751.1"
                     /db_xref="GeneID:11533942"
     CDS             complement(474863..477127)
                     /gene="TPHA0C02100"
                     /locus_tag="TPHA_0C02100"
                     /inference="similar to DNA sequence:INSDC:YDR221W"
                     /note="similar to Saccharomyces cerevisiae GTB1 (YDR221W);
                     ancestral locus Anc_8.431"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684799.1"
                     /db_xref="GeneID:11533942"
                     /db_xref="GOA:G8BRI9"
                     /db_xref="InterPro:IPR002172"
                     /db_xref="InterPro:IPR009011"
                     /db_xref="InterPro:IPR026874"
                     /db_xref="InterPro:IPR028146"
                     /db_xref="UniProtKB/TrEMBL:G8BRI9"
                     /translation="MFPISNSVNSLLLISVFINFTSGENVDLNKKNLNCESSNIVGVA
                     PDRQSLYKPGEDGKFHCLNAPSIAIDFKQVNDGVCDCPDGSDEPGTGACGNEDLFYCE
                     NKGFIPRYISNSKVGDGICDCCDCSDELMRLRSSGVEFNEFENNCSILSEEFDKMVDS
                     ELNIYSLGYNSLNELKKKYNIESVEDKLKNSKIQSESIKDKMKDINKKYENYQSILND
                     ERVRYENELKLVNPILLEFEKLDIKYLQDTLSEKFEDIKKINKVFRELTGIMENLIDT
                     YTSSMNDKVVNDNVKKYNKLYSDKKLKRMFRDCNPVVDEDQKGQLLDYLSYELPTLFS
                     MGLKFDDFEEDSSYYNQEAIDDKKFKTVKYNVGKINFVRSLLLGKFSYTGKTIEIIEE
                     IMAILEDITNNFNVNFQDKGVLNAISAYKKVLDQYNGLSVTEDGSKKGISLPIEFSNG
                     VEELFNFVTEKVPTFLEVEDVPVENNVLENNENDNIFGRLNKFLVNVKNDINNEYSVS
                     LLKSLRSQINTHENELQKLNETLELNENSLKSLNEFVEKYQTGDENIKNTKELVIQEY
                     KDLLNKMKSDNEEDGIFCINDAINNYLYNICFDSKNGGRILQKELKGDGNVILIGDLN
                     SINFDDISDSESITNQKYIEYLKTKYSTIQKDDDDEDDNQLYLIDHLVNETSEIGKVD
                     YLIDALYEINNGIKIEFNNGDKCWNGPKRSATVVIKCDENFKISNVQETTKCNYIIEI
                     VGPLGCSSNYHRDK"
     gene            <477769..>479232
                     /gene="TPHA0C02110"
                     /locus_tag="TPHA_0C02110"
                     /db_xref="GeneID:11535315"
     mRNA            <477769..>479232
                     /gene="TPHA0C02110"
                     /locus_tag="TPHA_0C02110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684752.1"
                     /db_xref="GeneID:11535315"
     CDS             477769..479232
                     /gene="TPHA0C02110"
                     /locus_tag="TPHA_0C02110"
                     /inference="similar to DNA sequence:INSDC:YDR219C"
                     /note="similar to Saccharomyces cerevisiae MFB1 (YDR219C);
                     ancestral locus Anc_8.430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684800.1"
                     /db_xref="GeneID:11535315"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:G8BRJ0"
                     /translation="MNAKMEGQAEHSFADLPLNVLISILSNLHIKDLENVSKTCKILR
                     YLANKKLIPRTGQQHSTTAMVNSKRNSTSLDTDKVASISNVLFTIANRKVVIDVFNLL
                     NNNRSIIERLNYKHRILIFESIKKLRVDYNLIYENPIKDKINDTINEKVSEKINKDVV
                     PSPDSKQDNDDSLLDFNDTVLIHNDFDPMNSININEAELRTENKKDTNLKTCIYGTLN
                     SKPIELTSFDATIELFDDDSFENEQIEEKNFKKINSIYEMESQYSEPLTKSFFSTTNK
                     NTNFDEQAKNEVNTNFTESVLSASTTIRKDSSNKDSSTNYNNTTSTISEVDNFPDTDQ
                     LLRSIKSINELRTTKKVKEKAALFEKLFSRESASLGDILMNNDTYNTLINSLPSLQHL
                     EEMGEEEINMYNTDKSGLMDENENTALHLQIESDETSHRNKKNISQNYLDNLKAELVK
                     SNSHEHKEEMKSESNKFIRTKLKAIINGDNKISYQRI"
     gene            <479735..>481069
                     /gene="TPHA0C02120"
                     /locus_tag="TPHA_0C02120"
                     /db_xref="GeneID:11535251"
     mRNA            <479735..>481069
                     /gene="TPHA0C02120"
                     /locus_tag="TPHA_0C02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684753.1"
                     /db_xref="GeneID:11535251"
     CDS             479735..481069
                     /gene="TPHA0C02120"
                     /locus_tag="TPHA_0C02120"
                     /inference="similar to DNA sequence:INSDC:YLR226W"
                     /note="similar to Saccharomyces cerevisiae BUR2 (YLR226W);
                     ancestral locus Anc_8.429"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684801.1"
                     /db_xref="GeneID:11535251"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:G8BRJ1"
                     /translation="MPEVNNLSKENVVESSIIGSKLADEDLKLNTQSNSGDKIVNNSK
                     PKPTEINPIEKISQEPTTNASTGQATVSSSNFNTRILWPDLIKIPTNKWVYECKEIID
                     KLGHVNSVIEETKRNLEKCLLYFYTLKKRLDLFDHTYTASCILFFRYWFVYGIPNSML
                     DCVHIAQAILVTACKSSENNRPIDAYVKATCDFISREIQGNKIVNIDKMKWDIRDKIV
                     ENEKKILCMFGFDLNVENPKEILEEMFSGYYRYNRDYNLPEDFQKIFPKLLQEARNFI
                     VQSITQPVCLLFNGQKFIQLALIFTGIQYKKIADSKFKYPKNFFKNKFASTIKPEEME
                     DLFTDFRILEESFFSLKSNKGDKLFITKQEISDLIEEDEVADDKIIDPYNYDSMKSGE
                     VRQELLDNIETRLQDMFTKMKKDYQNKRASSGTLEGTPNKKQSYKIMMHRKL"
     gene            <481468..>482631
                     /gene="TPHA0C02140"
                     /locus_tag="TPHA_0C02140"
                     /db_xref="GeneID:11535244"
     mRNA            <481468..>482631
                     /gene="TPHA0C02140"
                     /locus_tag="TPHA_0C02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684754.1"
                     /db_xref="GeneID:11535244"
     CDS             481468..482631
                     /gene="TPHA0C02140"
                     /locus_tag="TPHA_0C02140"
                     /inference="similar to DNA sequence:INSDC:YDR218C"
                     /note="similar to Saccharomyces cerevisiae SPR28
                     (YDR218C); ancestral locus Anc_8.428"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684802.1"
                     /db_xref="GeneID:11535244"
                     /db_xref="GOA:G8BRJ2"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BRJ2"
                     /translation="MTNSHEINTEELRIRKRIQKGNNICIMILGSKGSGKSTFLNNLC
                     STNIFPTSQVKECYQDPAYAHISPKLLEIKEKVCIEEGNGSKINLDILLFQGAGDNLD
                     NTKSPGIIRNYLMDQFDTILNEEKQVSRKPKVIDSRPHVCIYFLKPNSRGLREYDIKM
                     MKAIEDFVNIIPVITKIDTLTREELIYNKRLVMETINHYQIQIFDFKDDLLMDNILAT
                     NANKLTSLTKDINNNLRISEMLPFGIICSNESITEENGAPRYIRNFDWGSVAIDDVHY
                     SDFLYLKSIIFGSHFQDFKDITENVLYENYRTKKLSNRDEVNKLSVYDDYGNGGKSSM
                     IYKRENELKQSVMDPIDAELEEKNKLIEAYKRKINELQMVITSKSYQMASDPN"
     gene            <483141..>486446
                     /gene="TPHA0C02150"
                     /locus_tag="TPHA_0C02150"
                     /db_xref="GeneID:11534080"
     mRNA            <483141..>486446
                     /gene="TPHA0C02150"
                     /locus_tag="TPHA_0C02150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684755.1"
                     /db_xref="GeneID:11534080"
     CDS             483141..486446
                     /gene="TPHA0C02150"
                     /locus_tag="TPHA_0C02150"
                     /inference="similar to DNA sequence:INSDC:YDR217C"
                     /note="similar to Saccharomyces cerevisiae RAD9 (YDR217C);
                     ancestral locus Anc_8.426"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684803.1"
                     /db_xref="GeneID:11534080"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR013914"
                     /db_xref="UniProtKB/TrEMBL:G8BRJ3"
                     /translation="MVQSDKINLESSSDGQHAPIETNTHDLVSKTERMHTESQNVIQD
                     TVEVTNKTPKKSIITKSSPRRSPDIERIAKFFKKNKPSILDNNEPLKNNGEHSSDLNN
                     QFKLAENSDRSISQNKNIFHSPSKERATVSENKAASDLRLNILNKLNYSSDEDTPPSQ
                     RKTINLEQNILNPTNIVSRLKNAQKEFPEFNIPEDSAINNGIEINYNMSDDAKGLESN
                     RMTYSLKADQPISKYNSVNSTQVMNTQADNNQILSSENPKTLDYSVIDDTTDANITTR
                     WINNSENEDTNGNNLQTQLINTVNTQNITFSPTQIIDTTLQETSEINTQSVNTATVTV
                     PAGNSDKIEVLSADGNFKLKEFSTQILPPPQLPQLRSSKVFTTSPNKILSENTEPFFN
                     ETKMNDSRSVFGKSAFSQQPADVSYSKYPIRNKHQPSLKMTDSSPTPRNNSDAWENNQ
                     LSEFPSSGKIFLQVSNKTGLHLSQNSSDSSYLDTYNNLVVASEAEMTQELPEMDENTQ
                     EYMATKDGDLLTSSQYAYSNASKDEGSTNRLSKRNKTTPNTIVDDHTNVKKRSKVYAN
                     AKQETLVSDLEKSNIDNDYINFTSTRQLNSSPSALVKTHDFPHSLLSNETHTLTKDDI
                     EFDNSVLCFYDLNFKIYPGILILNNNDSDTSVVQFESEKSIIKNSDIFYLDIKIGDIV
                     NWKGSLYIIFKLECRSFDENTIRCIRGYDTLYLKKKNQTGNLGKKIFITSLASVTFNV
                     NEWTKRPKLNYFEQESLSKKNTPIRLRRVSNHSSPNFRKTTPTIDIITKDQKNDNGNA
                     YLGSKALTKVGSSYKGKENDIFSDCLFIVTGAFPERDKIINIIQSNHGTILNDGFSLL
                     FHYYSDKKTTDFVADEYDLQLNWIDETYSKKYKFACLLSSDFSRSLKYLETLALKWPT
                     LHWKFVLDCMEDEQLLINTIFQYLLPGGYSTHLNSDSNLTSGVLKSSNIFEYFTKTLT
                     GSKLSDMISRESTNADKLLMVVVGNSSINDFVFFSLASFGIRKAYFVKDPDNIDDFFD
                     GFSRKIDDINNEFSGTIFFADGDNEMHSKVIMQSIRDLLSCNPILHNCNFSIENKEWL
                     IQSIINEHVIFKS"
     gene            complement(<486620..>490747)
                     /gene="TPHA0C02160"
                     /locus_tag="TPHA_0C02160"
                     /db_xref="GeneID:11533967"
     mRNA            complement(<486620..>490747)
                     /gene="TPHA0C02160"
                     /locus_tag="TPHA_0C02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684756.1"
                     /db_xref="GeneID:11533967"
     CDS             complement(486620..490747)
                     /gene="TPHA0C02160"
                     /locus_tag="TPHA_0C02160"
                     /inference="similar to DNA sequence:INSDC:YDR216W"
                     /note="similar to Saccharomyces cerevisiae ADR1 (YDR216W);
                     ancestral locus Anc_8.425"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684804.1"
                     /db_xref="GeneID:11533967"
                     /db_xref="GOA:G8BRJ4"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BRJ4"
                     /translation="MTEVKDTIGSFSNNMNSKVNKKHKDLPDNLRLNGKTPSGKVRLF
                     VCSICTRAFARQEHLTRHERSHTKEKPYCCGLCQRKFSRRDLLLRHAQKIHNGDYGDT
                     VIITSNGTITLNNNERKIDDSLVDNLSIDLNLVSKNNKDTIIENLNGRDIKRRKRHMQ
                     VRQLKKNLLNDTSKNNRRSYNSIQNENTINGTSKFSFKRRSSFSAQSATEYVIPRNAE
                     ESNHKIDNVKFSTPEMLPINYFKQNISNISSDDSIEHLNLSLDPNMDNKTNNIKNTNN
                     HNIGIIDISNIRRDENINSKLLSEKNDSIVTNPDINIRKDTIIKDNNYNSINFPLLDI
                     DSSNPFSSKSELNLLDTIEWINGKYNSSTTNSSSNSSCEGTSMNSIQRNQNSIYDTEK
                     SQETSTNEYSKDFTAINNYSSKKSLTQKYLTHYKNADNGNIIPTLFKHNESFLKKKNG
                     LTNSKFDSINGSNTKLNWNKSNITPSSNISYLTNTTENKFEHDSMASTLTDKLSNINL
                     NEKYVDLNIISDFTSDIPSIFGDYLQTEESKMNLTNYQLNNTQEFSINNGVTFQIGVE
                     GDDMNNNNDQHINPNCNDNNNVNPPMLNGNYTFYGLDYVTISNITRASPPYIDNSDNG
                     ILINPDDVKLFTPELHKYCTEILDHYKNNYQKGNKSNISPMLVAKELVLPSCKELNNY
                     LSSFMNNFAPHHSFIHPDILKLDKNQLKMYIHETSNDSNSKNYEKRDEYLYYANLVCL
                     PLFMATCGSFFRPGCKPKNIELYEISRRILHVYLERRKQFQSTEEEEISETSNFPETN
                     AKPHNLWLIQSLILSVVFALFEDQNIKRDDSMIKRQITAVCSIVRKNIIPKINVGYDC
                     NMSNNGDSNSFKFKNQLEYIIFESSIRCVLMVYNFCNHLKIFYHMDSSMFLNEADIEN
                     IVIPDREDKWLFSSFLNNSAAVGLGNDFNKLNGDAKRSSTLLKQYYCNFHKFYGTFAF
                     NNIGIHQIPDVLIKTMLYYEFNSYAYSNFHLFLHKIDTKKLEKNFEQNYECYIKTLGN
                     NFIENDSYAKFQVSSILQHDGLALRNSLMVINLFNKVDRSFCSKIWKSNVYDIFEKFL
                     SSKSTNLLTNGSYNTLTDFLVALNFSIKNITKLFKVRENATIIDIDKKIISLFSLQSY
                     YYDFLVIIKFIIDFEYSPNFKLLCIYTELKKLADKLLIPKFYSLFPEYFVNCPDVIST
                     FVEMDGKIKSDINHHYLQINSDKIEKIINNILVYAFNDSSFLIMSEPSTNEFLFNNSQ
                     PPYYPFASSSSSNIINSNIENVTKERIGSPDPTPTKSAIDLLISQQKGETGNTAIKKN
                     RQDFYERYKLSLKYVVISKCFFEFISRNYIYCHFIENMIEDIKRIEENLELYNSK"
     gene            complement(<492382..>493464)
                     /gene="TPHA0C02170"
                     /locus_tag="TPHA_0C02170"
                     /db_xref="GeneID:11534096"
     mRNA            complement(<492382..>493464)
                     /gene="TPHA0C02170"
                     /locus_tag="TPHA_0C02170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684757.1"
                     /db_xref="GeneID:11534096"
     CDS             complement(492382..493464)
                     /gene="TPHA0C02170"
                     /locus_tag="TPHA_0C02170"
                     /inference="similar to DNA sequence:INSDC:YDR214W"
                     /note="similar to Saccharomyces cerevisiae AHA1 (YDR214W);
                     ancestral locus Anc_8.424"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684805.1"
                     /db_xref="GeneID:11534096"
                     /db_xref="GOA:G8BRJ5"
                     /db_xref="InterPro:IPR013538"
                     /db_xref="InterPro:IPR015310"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:G8BRJ5"
                     /translation="MAVQNPNNWHWVDKNCIEWAKKYLTSKLVGQSTDGDKTSKFAEI
                     SKVSSIEGDCEVNQRKGKVISLFELQITMLISGKVDDQEFDGSISVPDISFDSEITDY
                     QFEISIYKETTKLNEIKPIIRETLLPKLRDIFQQFGKDLLKENGNDIQVSEDKVTSQY
                     TKSNQQASFRSVEENVATTASTTSASKTTNPATAASTATTSSGSTTNKSSSTKFALGT
                     GNTTSIHIEPVFNVPASELYMTFIEKNRVMAWSKSPIKISNTKDTVLKLNEEFKLFGG
                     NVTSKLVSQIENKELVFEWRLNSWNDKIISKLKLEFHESKAYHETKLQVTWDGIPIGE
                     EERVRNNFEEFYVRAIKITFGFGAVL"
     gene            complement(<493972..>496632)
                     /gene="TPHA0C02180"
                     /locus_tag="TPHA_0C02180"
                     /db_xref="GeneID:11533914"
     mRNA            complement(<493972..>496632)
                     /gene="TPHA0C02180"
                     /locus_tag="TPHA_0C02180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684758.1"
                     /db_xref="GeneID:11533914"
     CDS             complement(493972..496632)
                     /gene="TPHA0C02180"
                     /locus_tag="TPHA_0C02180"
                     /inference="similar to DNA sequence:INSDC:YDR213W,YLR228C"
                     /note="similar to Saccharomyces cerevisiae UPC2 (YDR213W)
                     and ECM22 (YLR228C); ancestral locus Anc_8.423"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684806.1"
                     /db_xref="GeneID:11533914"
                     /db_xref="GOA:G8BRJ6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:G8BRJ6"
                     /translation="METTINSTSNSSQLNAVEQGASSDINISSNTDTNSTHTPLLGKR
                     KFHKKSKSGCDHCKRRRVKCDEAKPFCANCQHMKLDCFYSPIKPRKKKTVSKKISKIN
                     NVQDSTTTDASKDYESSQVTNLNDSAYISPKSTVVTDMEDKDEKIGASPYEVSKTKKL
                     KEKKLKVNKTKRTSTKKPAKRKNDTSHSTGLNGIPNNTKILSRQPSSSPYPFGEVLQN
                     QNPRQPQRQQPLLIPQFMTQGGSFQSPHQSATPYSLNLSSNPSLNNQFVELPNPASPV
                     FQSTGMTAASSFNSVFSPGRIPNPLGQQHFLNSGSAIAPPNSTSIIPVTHPIGTSFSL
                     NPESVPLNKSRSIVSVGMNPSLSGSMSMNPGLNLGLFSPVGIGGVNYDFQELLGLKHQ
                     PTVLNVRAADAEQALANMQNQHLETLKSKNLEVKQKSTPQPYSTDNVIDDSDKRNLVA
                     AQLNKLKSDSKTPQVSHNMMTTLSASPNLQDMINRNTTNTHMMESDSTQTYPPHIPSS
                     NVYKQHTTQMTNKIPTANYKPTNFSGANYNTTNSPTRSNSINLFKNNNQAPPIVNQPV
                     SSNKWSQLSNNSNLNLLDLKLFHHYCTEVWQTMVDAGISGEEIWSTDIPAMALDHPFL
                     MHTLLAFSATHLSRTENGLDHCVSSHRIDALRLLRESILQLSDDNIDALVASAIILIM
                     DSLANASTSNSGKTNYISPSAWIFHVRGAATIFTAVWPLPETSKFYDLISMDLSGLGN
                     FIHQNSTTITELTCFDESIMDFYPVEVDSPYLITLAYLDQLNRYKDQSDFILRVFAFP
                     ALLDKTFLALLMSGDLGAMRVMRSYYKLLRNYTTKVMDKVWFLEGVSQILPHDVDQYS
                     GGGGMNMMLDFLGGGLPSISTTNNMSEFII"
     gene            complement(<498886..>499461)
                     /gene="TPHA0C02190"
                     /locus_tag="TPHA_0C02190"
                     /db_xref="GeneID:11533487"
     mRNA            complement(<498886..>499461)
                     /gene="TPHA0C02190"
                     /locus_tag="TPHA_0C02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684759.1"
                     /db_xref="GeneID:11533487"
     CDS             complement(498886..499461)
                     /gene="TPHA0C02190"
                     /locus_tag="TPHA_0C02190"
                     /inference="similar to DNA sequence:INSDC:YLR229C"
                     /note="similar to Saccharomyces cerevisiae CDC42
                     (YLR229C); ancestral locus Anc_8.421"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684807.1"
                     /db_xref="GeneID:11533487"
                     /db_xref="GOA:G8BRJ7"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BRJ7"
                     /translation="MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTV
                     MIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVH
                     HHCPGVPCLIVGTQVDLRDDKVIIEKLQRQRLRPITQEQGDRLARDLRAVKYVECSAL
                     TQHGLKNVFDEAIVAALEPPVIKKSKKCTIL"
     gene            complement(<500617..>502782)
                     /gene="TPHA0C02200"
                     /locus_tag="TPHA_0C02200"
                     /db_xref="GeneID:11533510"
     mRNA            complement(<500617..>502782)
                     /gene="TPHA0C02200"
                     /locus_tag="TPHA_0C02200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684760.1"
                     /db_xref="GeneID:11533510"
     CDS             complement(500617..502782)
                     /gene="TPHA0C02200"
                     /locus_tag="TPHA_0C02200"
                     /inference="similar to DNA sequence:INSDC:YDR211W"
                     /note="similar to Saccharomyces cerevisiae GCD6 (YDR211W);
                     ancestral locus Anc_8.420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684808.1"
                     /db_xref="GeneID:11533510"
                     /db_xref="GOA:G8BRJ8"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR003307"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BRJ8"
                     /translation="MTPKQKRGTASHKDVVEQDDRLQAVVLTDSFETRFMPLSAVKPR
                     CLLPLANIPLIEYTLEFLAKADVKEVYLVCSSHADQINEYIENSKWNLPWSPFKVSTI
                     ISPESRSVGDVMRDIDNRGVINGDFVLISGDVISNVQFDKMLDFHKKTHAKDKDHILT
                     MCLSKAIQHYKTRSIEPATFILDKSNSRCIYYENIDKPHSKIKSALSIDPELLEDVKE
                     FSLRNDLIDCRIDICSAQVPPLFQDNFDYQTLREDFVKGVVSSDLLKKGVYAYITDEY
                     GSRVDSWQAYDEISQDFLGRWVYPVVLEANPLEENTYSYESPHIYKEKDVVLAESCKI
                     GKCTAIGSGTKIGEGTFIQDCVIGKNCSIGKNIKISNSYIWDNTVIGDHSVITHSIVA
                     SDVELGSKVILNDGCVIGFDVKIDSGMILPQGSRISSSPIETDVPSVFEESLSADSNS
                     SGEEKASFAVNKKNRDIIAIELVGPNGIGYVYESDYSDDDDDSSISNHVSNTLVHHVE
                     ELYLSDDSIRSTSARTKKKRTMSSGSMYTDREDYETEFEDEEDFEKEGIATVERAIEN
                     NHDLDTAMLELNTLRMSMNVTYHEVRTVTIKSILRRINHFIFTQTLGAKEAVSKVFSQ
                     WSALFKRQCFDPEDYIDLINIVMEEIMKIDFDKPNLILFASLNSLYENDILEESSIYS
                     WWDTISEDPSYSNVVSLTSKWVEWLKTADEESSEEDDDE"
     gene            complement(503045..503186)
                     /gene="TPHA0Ctrna2I"
                     /locus_tag="TPHA_0Ctrna2I"
                     /db_xref="GeneID:11535296"
     tRNA            complement(join(503045..503081,503149..503186))
                     /gene="TPHA0Ctrna2I"
                     /locus_tag="TPHA_0Ctrna2I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUA"
                     /db_xref="GeneID:11535296"
     gene            <504550..>506658
                     /gene="TPHA0C02220"
                     /locus_tag="TPHA_0C02220"
                     /db_xref="GeneID:11533615"
     mRNA            <504550..>506658
                     /gene="TPHA0C02220"
                     /locus_tag="TPHA_0C02220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684761.1"
                     /db_xref="GeneID:11533615"
     CDS             504550..506658
                     /gene="TPHA0C02220"
                     /locus_tag="TPHA_0C02220"
                     /inference="similar to DNA sequence:INSDC:YDR207C"
                     /note="similar to Saccharomyces cerevisiae UME6 (YDR207C);
                     ancestral locus Anc_8.416"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684809.1"
                     /db_xref="GeneID:11533615"
                     /db_xref="GOA:G8BRJ9"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8BRJ9"
                     /translation="MAHNSLHKIPTLNIVETNKMYSNSSDVNTDYKYNKPKEKIIEST
                     RTSYDDNPFLSIKNPTSAPNNTPVESPGSSPEFQNNKLTNKQMEPNYTTNNLQNSFED
                     NRITTENKDYTSSSTILNYNDGGCVPPKENKLSGKNKDFEKSATVPKPSSHSTKDDIL
                     KGKPKMEEKREEAEEAEETKQEEEHDSNSNVLNNEAKNKNSDITSSQGFAPEKFMIDN
                     TRSMSEIKSSDNHEKKINIGPWPGTENNDEMYSVLNTKGFREDTSSRESDKVVIPSSK
                     SNNIGFQESGNILSSQPTVSALSFSSSSNLRSSRQDYNQIGMHVLPITTERLPGQHKI
                     NEVQNHKIELPHINTIKESITEVAALDTEPRKVRNSVGTVLEIKLDKTLSNDNESLFP
                     PPPPKFINSKLDEVRFRLLNNSRPVTASSIPPTAKVDEDMGSAAAVLSNMRSSPFKFS
                     TGNNQNVSNNRNSENLKSDQTEETHSVKNRPSSSSNLFLGKNLQRPVIKIHNRQKIFD
                     DADNSVETRSSEHPISRKRSYSADLEIPLNRGVTWNKSGKRVTSKEVTLDTSSKRKQK
                     IKNETNKKSAPQSRKVRSPSLDETSTSSDDVLSVKSKHEGSYSNAESKKALSGTRSRN
                     GCWICRLRKKKCSEEKPSCSNCHRLNLECHYHIQKPDFVSDPVKKQQKLEEIKKKTKE
                     AKRNAMRKNQLLKGHRIPSP"
     gene            <508585..>510357
                     /gene="TPHA0C02230"
                     /locus_tag="TPHA_0C02230"
                     /db_xref="GeneID:11535218"
     mRNA            <508585..>510357
                     /gene="TPHA0C02230"
                     /locus_tag="TPHA_0C02230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684762.1"
                     /db_xref="GeneID:11535218"
     CDS             508585..510357
                     /gene="TPHA0C02230"
                     /locus_tag="TPHA_0C02230"
                     /inference="similar to DNA sequence:INSDC:YLR237W"
                     /note="similar to Saccharomyces cerevisiae THI7 (YLR237W);
                     ancestral locus Anc_8.412"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684810.1"
                     /db_xref="GeneID:11535218"
                     /db_xref="GOA:G8BRK0"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="UniProtKB/TrEMBL:G8BRK0"
                     /translation="MSEKESRLTRALRFLEIPVENRSTISILRNPDLQPIKREYQTWG
                     FFSNFSYWGIISFSVGTWLSGSAALSVGLSYGETIGTFILGDVLTIMFTLANSYPGFD
                     WKVGYTLSQRFVFGIYGSWFGILIRVLLSIVNYASNAWLGGLCINMILDSWSHHYLTL
                     PNTLSHHVHMKTREVIGFCLFHVVCAACYYMKPYHIKYILIISCLATFFSMMGMVIYL
                     SKENGGVGDAFNAPSTATGSAKCWAWVYMISYWFGSVSPGSVNQSDYSRFGSSQTAIW
                     LGTILALLIPTTVVPVFGIIGASTSEQLYGETLWMPNEFFTYWLTKDYSAGARAASFF
                     CGVSFVLSQIAYTISNAGFASGMDLAGLFPKYINIRRGAILTAIISVACQPWNFYNSS
                     SIFLTVTSSFGVIMTPIITVMICDNLMIRQRQYSIGEAFKLKGDYYYTKGVNWRAMFA
                     MTVGMAPGLPGIAWQVDNNYFNNQGIVNFYYGDSFFSFAISFFTYWIVCYFFPITITV
                     PHDTKDYYGAFDDEVARKKGLIPYSEISEAELIRFALNSGLESESSSDDSSTIISDSH
                     FNHESDEKNKLDGVTISTKTSSVQ"
     gene            complement(<510539..>511534)
                     /gene="TPHA0C02240"
                     /locus_tag="TPHA_0C02240"
                     /db_xref="GeneID:11533779"
     mRNA            complement(<510539..>511534)
                     /gene="TPHA0C02240"
                     /locus_tag="TPHA_0C02240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684763.1"
                     /db_xref="GeneID:11533779"
     CDS             complement(510539..511534)
                     /gene="TPHA0C02240"
                     /locus_tag="TPHA_0C02240"
                     /inference="similar to DNA sequence:INSDC:YDR204W"
                     /note="similar to Saccharomyces cerevisiae COQ4 (YDR204W);
                     ancestral locus Anc_8.411"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684811.1"
                     /db_xref="GeneID:11533779"
                     /db_xref="GOA:G8BRK1"
                     /db_xref="InterPro:IPR007715"
                     /db_xref="InterPro:IPR027540"
                     /db_xref="UniProtKB/TrEMBL:G8BRK1"
                     /translation="MLLRLTFLSSKLDRCLHNRAQQRHIFIATALTIGSFLFGKDARL
                     ADMMDRGELHDKNVEYELKRQERIDARLKTLQSTRPMKPMYKGHVPLTAIEKMILFTV
                     SGVRSFFHPENGINIVQLGESTALPFVLENLKQTMLSDETGRRILREKPNVTTDQLDM
                     GKLSKLPKNTFGYRFFKWLEKEGVSPDTRAPVTYIDDPVHAYIFKRYRQCHDFYHSLN
                     DLPIIIEGEITVKALEAANLGIPMAALGALLAPLRLKSVQRDRLYDIYLPWAVKTGLS
                     CKPLINVYWEELLEKDIDKLKKELGITAPPDLREIRKERAQKRKQLKLRYENFDQ"
     gene            <511971..>513053
                     /gene="TPHA0C02250"
                     /locus_tag="TPHA_0C02250"
                     /db_xref="GeneID:11533833"
     mRNA            <511971..>513053
                     /gene="TPHA0C02250"
                     /locus_tag="TPHA_0C02250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684764.1"
                     /db_xref="GeneID:11533833"
     CDS             511971..513053
                     /gene="TPHA0C02250"
                     /locus_tag="TPHA_0C02250"
                     /inference="similar to DNA sequence:INSDC:YDR202C"
                     /note="similar to Saccharomyces cerevisiae RAV2 (YDR202C);
                     ancestral locus Anc_8.410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684812.1"
                     /db_xref="GeneID:11533833"
                     /db_xref="InterPro:IPR028241"
                     /db_xref="UniProtKB/TrEMBL:G8BRK2"
                     /translation="MTTELYPNDYFGDINKHDIVKETETELKWLIDEIVKPELPNIID
                     NVEKCLDMLQSNEVFKMPITNNNGNNLQGKSNANNGPTIRGIISRQNEYIVGFQTIVT
                     FPEFNKGKPIILKMEPEASKFKLPQLVTTKDNLSDLLHTLEDSEIISDSSSFISNMDK
                     SLKLLAQSISLLETPPRNLIFPEIGNNVIKELFPSNHSSLFETPHHEISLELVLIKNE
                     LYIDFRNLVKVVKVPWCKVDPNTSLSFVDNIKEELKVDRRKNLKDVLISRGLQVEESN
                     LFNNLLISAFNTEKTTLSEARNFLSRCITFNNKVVIEGEKIVATTSDPSLISLSSKLH
                     SLESTIGNLYTNLNTYTPTTHNNVTK"
     gene            complement(<513237..>513689)
                     /gene="TPHA0C02260"
                     /locus_tag="TPHA_0C02260"
                     /db_xref="GeneID:11533603"
     mRNA            complement(<513237..>513689)
                     /gene="TPHA0C02260"
                     /locus_tag="TPHA_0C02260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684765.1"
                     /db_xref="GeneID:11533603"
     CDS             complement(513237..513689)
                     /gene="TPHA0C02260"
                     /locus_tag="TPHA_0C02260"
                     /inference="similar to DNA sequence:INSDC:YDR201W"
                     /note="similar to Saccharomyces cerevisiae SPC19
                     (YDR201W); ancestral locus Anc_8.409"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684813.1"
                     /db_xref="GeneID:11533603"
                     /db_xref="GOA:G8BRK3"
                     /db_xref="InterPro:IPR013251"
                     /db_xref="UniProtKB/TrEMBL:G8BRK3"
                     /translation="MTEYLDDVVSKLSGTVELLQNSIDKLHNNSAPNNNLTSNMLQTR
                     RYFELISEYDVEKAKLAQNEEIDPLVKILHDKLGRSLGKLQREYDTLQKTYELNKLRL
                     NNRVTEENGARGDNDDPNKINEIDFDLSTDVVVMASSTNEELEELGNN"
     gene            <514271..>516055
                     /gene="TPHA0C02270"
                     /locus_tag="TPHA_0C02270"
                     /db_xref="GeneID:11535224"
     mRNA            <514271..>516055
                     /gene="TPHA0C02270"
                     /locus_tag="TPHA_0C02270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684766.1"
                     /db_xref="GeneID:11535224"
     CDS             514271..516055
                     /gene="TPHA0C02270"
                     /locus_tag="TPHA_0C02270"
                     /inference="similar to DNA sequence:INSDC:YDR200C,YLR238W"
                     /note="similar to Saccharomyces cerevisiae VPS64 (YDR200C)
                     and FAR10 (YLR238W); ancestral locus Anc_8.408"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684814.1"
                     /db_xref="GeneID:11535224"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:G8BRK4"
                     /translation="MNDSNETIYNRRTLFQPRSSLKETLISPAKSNYNTQASSHDNNS
                     GKMPDNANQIVGRRARSNSRSAGSTSNEPMEQFSMDKVNNNTESTLSKNTANIIQINN
                     PGSPDLGSVNAFKGLDDTNTTILKSNANNIPNMENLTMRERYNNIVVLKPLNSTFETK
                     HLVVPHKPDVIKLGRPVINNNSNCTNTYKGLNERNAQHKKSNIRNDNGNFNSRVLSRN
                     HAALTCDSNTGKIFIRDLKSSNGTFINGTRIGTNDVELSVGDVIDLGTDIDNKQEHRR
                     ISALVDNILSVPLVNETVDMLNSNTFFSEKRKNSFQTSSNKHTGVGSDVESNQDIVST
                     NSKANPIAETLEHNYLSKPALSSKHAAFEAAMFGDVNNIDLENDILGTETALLSEIFI
                     DNSSGTSANLINIMKILSTEIALEKLENQKLKAMDNFLVNFTVNIDNIDNELIQKNQT
                     QIDALQENLKHRLYKKHNKILDNTYLQVEQLQLEKERLEEDFELQEKKQAAEFQSLIT
                     ELDTLKEDLGSKSVLNESFGVSYKDRDLNVINKTTKFSNETKEKYLDLFGEKSDSSNW
                     KSGLILILSTAFVGFVAYALNLSSKNCN"
     gene            complement(<516206..>517171)
                     /gene="TPHA0C02280"
                     /locus_tag="TPHA_0C02280"
                     /db_xref="GeneID:11533781"
     mRNA            complement(<516206..>517171)
                     /gene="TPHA0C02280"
                     /locus_tag="TPHA_0C02280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684767.1"
                     /db_xref="GeneID:11533781"
     CDS             complement(516206..517171)
                     /gene="TPHA0C02280"
                     /locus_tag="TPHA_0C02280"
                     /inference="similar to DNA sequence:INSDC:YLR239C"
                     /note="similar to Saccharomyces cerevisiae LIP2 (YLR239C);
                     ancestral locus Anc_8.407"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684815.1"
                     /db_xref="GeneID:11533781"
                     /db_xref="GOA:G8BRK5"
                     /db_xref="InterPro:IPR000544"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR020605"
                     /db_xref="UniProtKB/TrEMBL:G8BRK5"
                     /translation="MFPVLLNLRVPTNGPQIQKHFLRAVGSTFKPKTTPIDESSKVLK
                     HLHFTKTMDFEKGLDIQEKFVAAQLDMKKLKAKIKRKIFEVEQNHNGAPLNVFERSML
                     DNILTMKPNPTILTFEFWPVYSGGKRIKKTITDKQIKKYEEFVPTSEIDNPAPKFVQT
                     ERGGQITFHGPGQIVAYIILDLKTFNKFSVKDHVSAIQGAVSNSMLKINKEDGNPLAL
                     ETKTNCDTGVWTTKDEKLASIGIHVRRSITSHGVCINVDPDLSYLNNFEMCGLPNKKA
                     TSIYQERPGTDLSVQDVAKSFVNEYAKILDIDTVERIDLDNIEID"
     gene            <517647..>519059
                     /gene="TPHA0C02290"
                     /locus_tag="TPHA_0C02290"
                     /db_xref="GeneID:11533985"
     mRNA            <517647..>519059
                     /gene="TPHA0C02290"
                     /locus_tag="TPHA_0C02290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684768.1"
                     /db_xref="GeneID:11533985"
     CDS             517647..519059
                     /gene="TPHA0C02290"
                     /locus_tag="TPHA_0C02290"
                     /inference="similar to DNA sequence:INSDC:YDR198C"
                     /note="similar to Saccharomyces cerevisiae RKM2 (YDR198C);
                     ancestral locus Anc_8.406"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684816.1"
                     /db_xref="GeneID:11533985"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:G8BRK6"
                     /translation="MQAKIDALISWLKQDESFYLAPNITIQDTIESGRGVILVEDSLN
                     KNDIIVSIPSSHQINFNTIVCHLSHFNKNLSIPSVTAAKDSVIADLYGHIYQDKGLEE
                     YEDIRFEKYKLFASEFVEGLTSFQLVSLYILAEWILLPVWSNNEISSFWEPFFNVWPS
                     NHELRSIPTIWNLSEKTKFKHLLPLLTDGALAHTKRISSLIENDWEIIKPIIIKWLDS
                     TTIKNGMDINSLFEDYLHIYFVINSRCLYCPIPNRDADIASNFTLVPYVDFLNHNEKV
                     GEFCYPHVSNKSISGYGIGQFSILCGDHSYQTKKEEILLNYGAHSNDFLLNEYGFVME
                     SNCWNYIDVTKFLIGLFENDNESRQFLEEHEYWGDYTINENEVSYRIIIALSLFATKD
                     YRGVEKLMSGYISEDNFMPKVRPILLQILTTVLKHCEERHTELKEVGTLPNSDKWIIS
                     NLVTIIKGYEEILKVHIDNL"
     gene            complement(<519246..>520355)
                     /gene="TPHA0C02300"
                     /locus_tag="TPHA_0C02300"
                     /db_xref="GeneID:11533608"
     mRNA            complement(<519246..>520355)
                     /gene="TPHA0C02300"
                     /locus_tag="TPHA_0C02300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684769.1"
                     /db_xref="GeneID:11533608"
     CDS             complement(519246..520355)
                     /gene="TPHA0C02300"
                     /locus_tag="TPHA_0C02300"
                     /inference="similar to DNA sequence:INSDC:YDR195W"
                     /note="similar to Saccharomyces cerevisiae REF2 (YDR195W);
                     ancestral locus Anc_8.403"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684817.1"
                     /db_xref="GeneID:11533608"
                     /db_xref="UniProtKB/TrEMBL:G8BRK7"
                     /translation="MYQDYINDIMMIASKTDVYEFLKNSIIKLEPNERKGYIDNLNSD
                     SIDILKKDEYKSKINEVFTELFSLDSARNDIIRSYINFLMLLDYKKEDLKLFKIPEEL
                     IDEFNINALEQSNKQDEIDNTKKISFSKYLKKAENDTESDNDNKKRSLETSNINEESN
                     SKDESTRKRIKIENQSKIPSILKYKTQESLRKKSAGGTSSCNSNSRSISFASDAQLIT
                     VFGEDLPEKGLKLSPPELKKLLKPFNENEPREVFALEGKKPFTKAKELIIKLSNNKED
                     ISDITVLKNGPIQTEVMHPLKYTVNFSNFSPDLGNKQPREPVIINSSNTDKKKILIVK
                     AFGKNNLLLRSDRGGLPYRLVPKFKQNDYPPRPLH"
     gene            <521123..>524017
                     /gene="TPHA0C02310"
                     /locus_tag="TPHA_0C02310"
                     /db_xref="GeneID:11535314"
     mRNA            <521123..>524017
                     /gene="TPHA0C02310"
                     /locus_tag="TPHA_0C02310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684770.1"
                     /db_xref="GeneID:11535314"
     CDS             521123..524017
                     /gene="TPHA0C02310"
                     /locus_tag="TPHA_0C02310"
                     /inference="similar to DNA sequence:INSDC:YLR240W"
                     /note="similar to Saccharomyces cerevisiae VPS34
                     (YLR240W); ancestral locus Anc_8.401"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684818.1"
                     /db_xref="GeneID:11535314"
                     /db_xref="GOA:G8BRK8"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR001263"
                     /db_xref="InterPro:IPR002420"
                     /db_xref="InterPro:IPR008290"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015433"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="UniProtKB/TrEMBL:G8BRK8"
                     /translation="MNVVGQFHDKVSLNDVENSASATNGNGIKYDSDNENITWNEMNH
                     YNNESKYINEVTFYVSQDLNIPFKVKLNSLEGFKTLLKPSEKILHPELCIIQSNVNTV
                     SELIASVQIFNSDTEQILTLPEFTPYIQFQKQRKWDFTISLPILINQLNLNSKLRIIL
                     WEFNGYKKIPFYKIETFVFDQKDNTLKRGLEAIKFDITQKDHCSIITDNKHLNNLNKY
                     LRGEMKAVDWLDKVTLPLIEKQLFKSLRDLPKNTFVLNIEYPTYELPVVYTDRLTVKT
                     QNNPLSLANSELNSSMLQNNYKKNNTNGSNYNRAASKIGSKNEYNTQSVNNTNTGNNT
                     VNNNTMDTLGAKISTGTPYKSTLKFYDPDQYNTDPIEEKYRRLERTTKSTSLDRNLKP
                     DAKKRDYLNKIINYPPGTTLTAHEKGSIWKYRYFLVNNRKALTKLLKSTNLNEEGERT
                     EVLDLMDSWVEIGIDDTIELLGSEYKNISIRAYAVNRLKKATDKELELYLLQLVQAVC
                     FESLTTLTDESNNEYSIVNINSFKNNISNQKKRETENNAHNNKNTLNSDSILKDSEIV
                     ISPLAEFLIRRALKNLRLGTYFYWYLKAELADNPSLNNIIESYYARLSSEGRLTLDEQ
                     LKFIDILRDCCIQVKKLKDSTKKNELAQHLLSSKLRNHLKRHHVVLPLNPDITVVDVD
                     PEGSRVFKSSLSPLKINLKGVHGEHYSMMFKVGDDLRQDQLIVQIISLMNELLKNENV
                     DLKLLTYKILATNSQEGAIEFIPNETMATILSSYNGIRPYFKAHNFDANESSGVKQVV
                     MDTFVKSCAGYSVITYLLGVGDRHLDNLLITPDGHFFHADFGYVLGQDPKPFPPLMKL
                     PPQIIEAFGGIESANFDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPEG
                     AVQKVKERFNLDMSEEEATIHFQTLINDSVSAILPIVIDHLHNLAQYWRA"
     gene            complement(<524130..>525038)
                     /gene="TPHA0C02320"
                     /locus_tag="TPHA_0C02320"
                     /db_xref="GeneID:11533620"
     mRNA            complement(<524130..>525038)
                     /gene="TPHA0C02320"
                     /locus_tag="TPHA_0C02320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684771.1"
                     /db_xref="GeneID:11533620"
     CDS             complement(524130..525038)
                     /gene="TPHA0C02320"
                     /locus_tag="TPHA_0C02320"
                     /inference="similar to DNA sequence:INSDC:YLR242C"
                     /note="similar to Saccharomyces cerevisiae ARV1 (YLR242C);
                     ancestral locus Anc_8.399"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684819.1"
                     /db_xref="GeneID:11533620"
                     /db_xref="InterPro:IPR007290"
                     /db_xref="UniProtKB/TrEMBL:G8BRK9"
                     /translation="MICIQCLHPVPALYTVYANGHIQLTTCSYCNTIADEYVEIDDVI
                     LFIDILLLKPGAFRHIVFNSLEERVSKIPDWFRLQGSVRERSITLFTNISNWSLKYDQ
                     IIRYWILITTFEVYLRWTEEDNKAREYFKILPTKTKIVSDLITSRILLQDFFHQYIYV
                     AIFCVIDMLVLYFLTIGIITKWFKWGQDNKYSVYILSYTVLISYGAKILPTLMLIWPY
                     DTISYMGIIKWVANLYLIESLKIITRLPYSSIVFIFVVVSIFRMVVPKLLLACIFSNS
                     SDDLQSMLNAEYVFAIQKYIISKDFF"
     gene            <525437..>527239
                     /gene="TPHA0C02330"
                     /locus_tag="TPHA_0C02330"
                     /db_xref="GeneID:11533606"
     mRNA            <525437..>527239
                     /gene="TPHA0C02330"
                     /locus_tag="TPHA_0C02330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684772.1"
                     /db_xref="GeneID:11533606"
     CDS             525437..527239
                     /gene="TPHA0C02330"
                     /locus_tag="TPHA_0C02330"
                     /inference="similar to DNA sequence:INSDC:YDR192C"
                     /note="similar to Saccharomyces cerevisiae NUP42
                     (YDR192C); ancestral locus Anc_8.398"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684820.1"
                     /db_xref="GeneID:11533606"
                     /db_xref="GOA:G8BRL0"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:G8BRL0"
                     /translation="MSYYNRGRNNTTPCKYFQNGTCNKGSSCRFAHVYQNNSKHNNNN
                     NNNNNNNNGTSRYGGSSSNDQNSKGRSDAEKLNDFKNESRQNEIQKIINFDMNESKQF
                     QVKPLTSTYSYELPCMLNLINGRDYSAEESRFKYYQAQKDGTSNAYQTEMTARENDMQ
                     KAIMHVSAHPDWAARYLSKGTKELSETGKTSFASEFINFPLDLIGQSYGSSAYGTTSA
                     AFGSSSQAFGNANLAFGSTNLAFGGTNSAFGNSNSAFGNNTNATTSGVFGAPVFGASN
                     NTVSAFGATQTNPSSSVSAFGSSPFGASAHTLSNSGTTGSAFGQPTFGNSSKTGTSAF
                     GTPAFSSTSQPTSTAFGSPAFGSMTDRNKATFGNQLGTSNNPLNSAFGASPFSNNTSA
                     NPFGSTQQAATSGTSVFGAPAFGTSAATGKSPFGSIQQTSTPPFGQAAHNNNPLLPSA
                     NGQQTNNNDVFGNTASSMSTNLNSNNLSDSLKNNQVITNSFGSNQGNQIANTFDSAST
                     NSLFGSQTTQNNSQGGFPSNGFQNVGSAFGRNAASGVFNNNISNSNLRQGPPTEDDRK
                     TPDELLPETLNQFQAESFTLGKVPDIPPPLSLCT"
     gene            complement(<527474..>529114)
                     /gene="TPHA0C02340"
                     /locus_tag="TPHA_0C02340"
                     /db_xref="GeneID:11533758"
     mRNA            complement(<527474..>529114)
                     /gene="TPHA0C02340"
                     /locus_tag="TPHA_0C02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684773.1"
                     /db_xref="GeneID:11533758"
     CDS             complement(527474..529114)
                     /gene="TPHA0C02340"
                     /locus_tag="TPHA_0C02340"
                     /inference="similar to DNA sequence:INSDC:YDR188W"
                     /note="similar to Saccharomyces cerevisiae CCT6 (YDR188W);
                     ancestral locus Anc_8.393"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684821.1"
                     /db_xref="GeneID:11533758"
                     /db_xref="GOA:G8BRL1"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012722"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:G8BRL1"
                     /translation="MSLQLLNPKAESLRRDAALKVNVTSAEGLQSVLETNLGPKGTLK
                     MLVDGAGNIKLTKDGKVLLTEMQIQSPTAVMIARAAAAQDEITGDGTTTVVCLVGELL
                     KQAYRFVQEGVHPRIVTDGFEIARAETLKFLDEYKVSKLNDETDEVDREFLLQVARSS
                     LATKVKPELTEILSPIVTDAVLNVQDKENKSLDLYMVETMQMQHLSPNDTVFVKGLVL
                     DHGGRHPDMPQRVENAYVLILNVSLEYEKTEVNSSFFYSTPEQRDSLAASERKFVDEK
                     LKKIIDLKNEVCGLDSDKGFVIINQKGIDPMSLDVLAKHNILALRRAKRRNMERLQLV
                     TSGEAQNSVDDLSPSILGYSGLVYQETIGEEKFTYVTANKNPKSCTILIKGSTNYQLA
                     QTKDAVRDGLRAVANVLKDKTVVPGAGAFFIAASQHLKKLNMNKLGAKGKTKTGVDAF
                     AEALLVIPKTLIKNSGYDALDVLALCEDELNGAEENGERRYVGVDLNLGDSCDPTIEG
                     IWDSYRVIRNAISGANGIASNLLLCDELLRAGRSTLKE"
     gene            complement(<529723..>530901)
                     /gene="TPHA0C02350"
                     /locus_tag="TPHA_0C02350"
                     /db_xref="GeneID:11533667"
     mRNA            complement(<529723..>530901)
                     /gene="TPHA0C02350"
                     /locus_tag="TPHA_0C02350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684774.1"
                     /db_xref="GeneID:11533667"
     CDS             complement(529723..530901)
                     /gene="TPHA0C02350"
                     /locus_tag="TPHA_0C02350"
                     /inference="similar to DNA sequence:INSDC:YLR244C"
                     /note="similar to Saccharomyces cerevisiae MAP1 (YLR244C);
                     ancestral locus Anc_8.392"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684822.1"
                     /db_xref="GeneID:11533667"
                     /db_xref="GOA:G8BRL2"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001714"
                     /db_xref="InterPro:IPR002467"
                     /db_xref="UniProtKB/TrEMBL:G8BRL2"
                     /translation="MSAAAAAAAAVTTTEPVMKTYCSGLQCGKETQSELKCPICLKAD
                     IISVFCNETCYKNNYKAHKSLHFKENEDGTLNKDVSYDPYTKFKYTGDVRAQYPLTPK
                     RIVPEHIKKPDWAANGLPIGEQKNDRLNKIPVYSKDQIKKIRKAAILGREILDIAGAA
                     VKPGVTTDEIDEIVHNETIKRNAYPSPLNYYNFPKSVCTCVNEVICHGIPDRTVLKEG
                     DIVNIDVSLYHNGFHADLNETYYVGEKISKEAINTVETSRECLKNAIKLCKPGVTFQE
                     LGDHIEKHATLNKCSVVRTYCGHGVGEYFHSLPNIPHYARNRTAGVMKPGMVFTIEPM
                     INEGTWRDVTWPDDWTSATQDGKLSAQFEHMLLITENGVEILSARNKKSPGGPRERTK
                     "
     gene            <531446..>532660
                     /gene="TPHA0C02360"
                     /locus_tag="TPHA_0C02360"
                     /db_xref="GeneID:11533924"
     mRNA            <531446..>532660
                     /gene="TPHA0C02360"
                     /locus_tag="TPHA_0C02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684775.1"
                     /db_xref="GeneID:11533924"
     CDS             531446..532660
                     /gene="TPHA0C02360"
                     /locus_tag="TPHA_0C02360"
                     /inference="similar to DNA sequence:INSDC:YLR246W"
                     /note="similar to Saccharomyces cerevisiae ERF2 (YLR246W);
                     ancestral locus Anc_8.389"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684823.1"
                     /db_xref="GeneID:11533924"
                     /db_xref="GOA:G8BRL3"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:G8BRL3"
                     /translation="MNTGRDSLISSSHRSPLDNLAIRGANDGLASTISSGSIIVNTPW
                     YKKLYYWLIVFDGDNDIIDGKTYNYLPSITNYVYFIGGRVKFLYKPNDKLNLLYPSLV
                     LFILVSPMVLFSIFEANTLWNTKFGYKGFVFFFYYFWCMSLSFFVRAMTSDPGILPKN
                     IHIPKLANNFQLPQEYYNLIRLPIKDESQYVEITYCRTCRIWRPPRSSHCSICDCCVM
                     SLDHHCLWLNNCVGKRNYRYFLIFLTSTIMTVIFLLINTGIHIGKNRHEKKPASNIPV
                     TILLTVYGSLSISYPIILLAYHLVLTGTNQTTREFLKYVYEIRDQHRKSKNPVFMKII
                     KNKNNIYDKHNAFKNILSLFCQSRGISLQPARKTVKNQKYASHNIDDGLQMVNPQNNE
                     LRYTNLKYDNLQ"
     gene            <533212..>533973
                     /gene="TPHA0C02370"
                     /locus_tag="TPHA_0C02370"
                     /db_xref="GeneID:11533939"
     mRNA            <533212..>533973
                     /gene="TPHA0C02370"
                     /locus_tag="TPHA_0C02370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684776.1"
                     /db_xref="GeneID:11533939"
     CDS             533212..533973
                     /gene="TPHA0C02370"
                     /locus_tag="TPHA_0C02370"
                     /inference="similar to DNA sequence:INSDC:YDR185C,YLR168C"
                     /note="similar to Saccharomyces cerevisiae YDR185C and
                     YLR168C; ancestral locus Anc_8.388"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684824.1"
                     /db_xref="GeneID:11533939"
                     /db_xref="InterPro:IPR006797"
                     /db_xref="UniProtKB/TrEMBL:G8BRL4"
                     /translation="MKLFENSCDFDYSWAHVTAANWKKYPNEVSTHVIAVDVLKREVE
                     RNGQVLITERLITCKQNVPQWIMMLLGGSNISYVREVSTVDLSQKSLVMRSCNLTYSN
                     LLKVYETVTYTPHPEDPVNRTLFSQEAQITAYGAITRLCNKMEDWSVQRFRDNANKGK
                     IGFDNVLKKFEAHWQQKEKLVDEISSSIISKVNETVEDIKLQTEGLIIETERQNKLLY
                     NTHQELLSSKDDLVIYNDDNKSVNQEQFMQTKTHT"
     gene            <534626..>535687
                     /gene="TPHA0C02380"
                     /locus_tag="TPHA_0C02380"
                     /db_xref="GeneID:11533666"
     mRNA            <534626..>535687
                     /gene="TPHA0C02380"
                     /locus_tag="TPHA_0C02380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684777.1"
                     /db_xref="GeneID:11533666"
     CDS             534626..535687
                     /gene="TPHA0C02380"
                     /locus_tag="TPHA_0C02380"
                     /inference="similar to DNA sequence:INSDC:YDR184C"
                     /note="similar to Saccharomyces cerevisiae ATC1 (YDR184C);
                     ancestral locus Anc_8.387"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684825.1"
                     /db_xref="GeneID:11533666"
                     /db_xref="UniProtKB/TrEMBL:G8BRL5"
                     /translation="MYQYDSKDVKTEEVSNSTVQESNLGTLQKLLQQNNVNLDDSTKL
                     DGNNKDEPPSNNNKNHSSNGSQLDELDELDVKWLENDMLNSKTLTLEILLENQPEELL
                     FELMDNHMVDGDQVEKNQNNSSQNKITEQPTDPQQDLNVKTRIVDGDDAYDASDKNND
                     DIDSNFMKRSINALNNGDGNKTQLPNKKQKHIKNTAYRPLLSPASLSPTSTDEERDSN
                     VNNNDDKVELKSKATEAQPVKLSTAEITKHVRQQKVLNKKDKSSQPLQIIETPKKLTN
                     AFTMNQVSEMKQRIINTHKLLLNFNLLKDSYAKTCVEMKNALVNLKDAEIHRAHLLIE
                     NENLKRELEFYKLNNSNEK"
     gene            complement(<536137..>536589)
                     /gene="TPHA0C02390"
                     /locus_tag="TPHA_0C02390"
                     /db_xref="GeneID:11535239"
     mRNA            complement(<536137..>536589)
                     /gene="TPHA0C02390"
                     /locus_tag="TPHA_0C02390"
                     /product="ubiquitin-40S ribosomal protein S31 fusion
                     protein"
                     /transcript_id="XM_003684778.1"
                     /db_xref="GeneID:11535239"
     CDS             complement(536137..536589)
                     /gene="TPHA0C02390"
                     /locus_tag="TPHA_0C02390"
                     /inference="similar to DNA sequence:INSDC:YLR167W"
                     /note="similar to Saccharomyces cerevisiae RPS31
                     (YLR167W); ancestral locus Anc_8.386"
                     /codon_start=1
                     /product="ubiquitin-40S ribosomal protein S31 fusion
                     protein"
                     /protein_id="XP_003684826.1"
                     /db_xref="GeneID:11535239"
                     /db_xref="GOA:G8BRL6"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR002906"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8BRL6"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGGKKRKKKVYTTPKKIKHKHKKVKLAI
                     LSYFKVDGEGKVTKLRKECSTCGAGTFLANHNDRFYCGKCHQVFKTGA"
     gene            complement(<537421..>538101)
                     /gene="TPHA0C02400"
                     /locus_tag="TPHA_0C02400"
                     /db_xref="GeneID:11535317"
     mRNA            complement(<537421..>538101)
                     /gene="TPHA0C02400"
                     /locus_tag="TPHA_0C02400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684779.1"
                     /db_xref="GeneID:11535317"
     CDS             complement(537421..538101)
                     /gene="TPHA0C02400"
                     /locus_tag="TPHA_0C02400"
                     /inference="similar to DNA sequence:INSDC:YDR183W"
                     /note="similar to Saccharomyces cerevisiae PLP1 (YDR183W);
                     ancestral locus Anc_8.385"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684827.1"
                     /db_xref="GeneID:11535317"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR024253"
                     /db_xref="UniProtKB/TrEMBL:G8BRL7"
                     /translation="MSEDIKNFENKLVTESNGDSDADIDELLEELELEDELNNNKNDE
                     DAAFLNRYREQRMQDISDHLKKVEKNVLHEGYGKLEVITDEKKIIDLTTSNKRAVISF
                     MIPSFRKCQYMNEKLDKLSKRHLTTKFVTITVENCPFLVHKLQIKVLPFVVGYKDGIE
                     KLRIVGFSALGNDPNGFEIDSLEKLLYSKNIIETMKGISNNINIKQIKKTIRDRHSDE
                     DSDSGLDI"
     gene            <538626..>541127
                     /gene="TPHA0C02410"
                     /locus_tag="TPHA_0C02410"
                     /db_xref="GeneID:11535270"
     mRNA            <538626..>541127
                     /gene="TPHA0C02410"
                     /locus_tag="TPHA_0C02410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684780.1"
                     /db_xref="GeneID:11535270"
     CDS             538626..541127
                     /gene="TPHA0C02410"
                     /locus_tag="TPHA_0C02410"
                     /inference="similar to DNA sequence:INSDC:YLR166C"
                     /note="similar to Saccharomyces cerevisiae SEC10
                     (YLR166C); ancestral locus Anc_8.384"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684828.1"
                     /db_xref="GeneID:11535270"
                     /db_xref="GOA:G8BRL8"
                     /db_xref="InterPro:IPR009976"
                     /db_xref="UniProtKB/TrEMBL:G8BRL8"
                     /translation="MNSLYDLDPKWKRLLSTNNFLGGLTVNEFVEELSKDQTLKGSTA
                     KDAETWQKLDPKPYIRTFESILKELKTLCQDTDDKKSYLADEVSREELNHSNNIVQLF
                     DNLKLTINNYDDLDNKLSNVIQIVSPLGEKVETAVKKKKNYIRSVELISYYDQFYGEG
                     KSERLDQLLASNNKHNVSQAIMIVKNLLVLSRKIETKSLPKTGETNKLIEKYSETMEN
                     NLLESFNKAYRENNFSQLNEIALILNHFNGGVNVIQSFINQHSYFIDTAELEMDENQE
                     FMIEESTKAKLLDEGYHNVVYDKKIVGLVNGIETVIKDESKIVKRVFEERAPHVLQLF
                     IQRIYAQKIESKFENLLQNSFALSDLAHIRILHSLYSIISQFTKDLSEYFKMLELDED
                     SLLTSTLSHCFNDLFSRYLHGSSSYFEVEKRSLESILIQKTSAFNLSHEREIHLRSLV
                     NKLENKVNLGIEFNELGNISRGKLSQINDFFKSHLDTERLTLARSNTNTQRDAFGHAH
                     DNLEAGKVVQQDLAIDSALFNIENADSMLRCVVESIARVMELTPNFASDYTLELLGIM
                     NVGIIGSYVETALELAYQEIVKIDVTKVSDINISFLTYISTSTDIISIVSSSVKALFL
                     PLMISSPTTKKDIIDMTNKQIQRTELLINTIIEELTHLYYSLFTELLSKQKKKDFLPK
                     SQDLLNQDTIISLEIVAVLNSLFEQSQKYLKGNNLTLFLTVVGNLLYSLLLSHYGKYQ
                     VNSMGGIIVTKDIISYQNIIDEWEIEELSEKFATLRELANLFTVQPELLGSLSREGRL
                     VNLNDNIIAEYIGNRVEINHDKLVSSVKLNFKKDH"
     gene            <541603..>543285
                     /gene="TPHA0C02420"
                     /locus_tag="TPHA_0C02420"
                     /db_xref="GeneID:11533664"
     mRNA            <541603..>543285
                     /gene="TPHA0C02420"
                     /locus_tag="TPHA_0C02420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684781.1"
                     /db_xref="GeneID:11533664"
     CDS             541603..543285
                     /gene="TPHA0C02420"
                     /locus_tag="TPHA_0C02420"
                     /inference="similar to DNA sequence:INSDC:YDR181C"
                     /note="similar to Saccharomyces cerevisiae SAS4 (YDR181C);
                     ancestral locus Anc_8.382"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684829.1"
                     /db_xref="GeneID:11533664"
                     /db_xref="GOA:G8BRL9"
                     /db_xref="InterPro:IPR029184"
                     /db_xref="UniProtKB/TrEMBL:G8BRL9"
                     /translation="MKSTEERMLRSKHTDNNGKEKFDFERNEFDLDINKSRKINSRVS
                     LSNINKIYEKSKAKSMNDEVSNKRKQVMKMVLKIKDYHIEKPKGTKYSKALTGDRKSD
                     DIQHHHKMAISCESESSLLHKTVNLSPSKKNNIIYKTVDPLADEKYKPYHKKMLRQEN
                     RMIERDASETEREADRLLLLLDKLDMIDWKITLAKVTVINNIEDAEEMNSKRVKTKEL
                     IQSMLAKYESTNLRASLFSKSTRRSVKIDSKKDWYKIYKQIDRRLLLDYHSSSDEDED
                     DMNIEKIREHRLKKRKQQCGGLIVVGFRVDNDVSNYKTNFRKYQIVTEPLRNPYIVRL
                     TKQEKDIWKGKVDQLSSKFEYHKNFGKQTAIMKNKVIIQAGDNNVDQAQNILSNEYID
                     RLKYDNTMDDDNSSLSSACEINEEEEITLSRILEDENNNEQIKNETQSPSSTFSLQTS
                     QKAFTLNHSDSFKTGEKIRTETSIVTNNSSNANQPLTTAFVDYEKVNNITPVIIKTIP
                     NTNGGIKHLDSESNPNINKPETEMKNDFTNNLVYNNVTVINELRPRKNLNKL"
     gene            <543553..>544104
                     /gene="TPHA0C02430"
                     /locus_tag="TPHA_0C02430"
                     /db_xref="GeneID:11533793"
     mRNA            <543553..>544104
                     /gene="TPHA0C02430"
                     /locus_tag="TPHA_0C02430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684782.1"
                     /db_xref="GeneID:11533793"
     CDS             543553..544104
                     /gene="TPHA0C02430"
                     /locus_tag="TPHA_0C02430"
                     /inference="similar to DNA sequence:INSDC:YDR179C"
                     /note="similar to Saccharomyces cerevisiae CSN9 (YDR179C);
                     ancestral locus Anc_8.378"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684830.1"
                     /db_xref="GeneID:11533793"
                     /db_xref="GOA:G8BRM0"
                     /db_xref="InterPro:IPR016806"
                     /db_xref="UniProtKB/TrEMBL:G8BRM0"
                     /translation="MNIDYNIIAELEDPKQYSYKEHWLKYDESHEYNILYEVFTFGGI
                     EQVGQLVEIYGDELIYRSDILNKLIKLNMIKLASELRCLWYKDVWALLNSHCNDKVAN
                     LIGLASNFVNYIENMFIELNDCIDFEINSIEGSIKIKECKRCRDVYCFEKPLLVVNQN
                     DVLTNENLIKDLENWKSKLMNII"
     gene            complement(<544301..>544807)
                     /gene="TPHA0C02440"
                     /locus_tag="TPHA_0C02440"
                     /db_xref="GeneID:11535271"
     mRNA            complement(<544301..>544807)
                     /gene="TPHA0C02440"
                     /locus_tag="TPHA_0C02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684783.1"
                     /db_xref="GeneID:11535271"
     CDS             complement(544301..544807)
                     /gene="TPHA0C02440"
                     /locus_tag="TPHA_0C02440"
                     /inference="similar to DNA sequence:INSDC:YDR178W,YLR164W"
                     /note="similar to Saccharomyces cerevisiae SDH4 (YDR178W)
                     and YLR164W; ancestral locus Anc_8.377"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684831.1"
                     /db_xref="GeneID:11535271"
                     /db_xref="GOA:G8BRM1"
                     /db_xref="InterPro:IPR007992"
                     /db_xref="UniProtKB/TrEMBL:G8BRM1"
                     /translation="MLRNSINFASKRSFHACKPACFRIPFLPTLPQQPGGVKGNVNEA
                     YVPPKIDKVHGSYHWGFEKIISMSVLPLVTLPLISGGAPLSVTTDVLLASAGMFAFMV
                     EFQSCITDYVQKRVYGNINKYAMYLLYGGSVLSILGIYNLQKPDEEKKENTGFIGLLN
                     KFFKIEQK"
     gene            <545815..>547224
                     /gene="TPHA0C02450"
                     /locus_tag="TPHA_0C02450"
                     /db_xref="GeneID:11533964"
     mRNA            <545815..>547224
                     /gene="TPHA0C02450"
                     /locus_tag="TPHA_0C02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684784.1"
                     /db_xref="GeneID:11533964"
     CDS             545815..547224
                     /gene="TPHA0C02450"
                     /locus_tag="TPHA_0C02450"
                     /inference="similar to DNA sequence:INSDC:YLR163C"
                     /note="similar to Saccharomyces cerevisiae MAS1 (YLR163C);
                     ancestral locus Anc_8.376"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684832.1"
                     /db_xref="GeneID:11533964"
                     /db_xref="GOA:G8BRM2"
                     /db_xref="InterPro:IPR001431"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:G8BRM2"
                     /translation="MLRNSLKLNSLSSRLISTTRKTLMQGTEISKLSNGLTVATEYMP
                     NTSTATVGIYVNAGSRAENVKNNGTAHFLEHLAFKGTSKRSQKQIELDIENIGSHLNA
                     YTSRENTVYYAKTLKENLPLAVDILSDILTNSKLEKNAIERERDVIVRESEEVDKMYD
                     EVVFDHLHEIAYKDQPLGRTILGPIKNIKSINRSDLVHYITSNYKGDRMVLAGAGDIN
                     HQDLIKLAEKYFGHLPKGSSSLVNNMNDQLPVFTRGERLIENLTLQTTHIAIALEGVS
                     WSSPDYFIALATQAIVGNWDRSLGAGTNSPSSLAFAASNGLKENNNQPLANSYMSFST
                     SYADSGLWGMYIVANSMEHNPTLIIKEIIKEWTRIKKGDFTEMEVNRAKAQLKAALLL
                     SLDGSTPVVEDIGRQIVTTGQRLSPEEVFEKVDKITKDDIKLWANYRLQNKPISMVAL
                     GNVDNVPKLKKIEAELNAM"
     gene            complement(<547572..>548430)
                     /gene="TPHA0C02460"
                     /locus_tag="TPHA_0C02460"
                     /db_xref="GeneID:11533787"
     mRNA            complement(join(<547572..548240,548386..>548430))
                     /gene="TPHA0C02460"
                     /locus_tag="TPHA_0C02460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684785.1"
                     /db_xref="GeneID:11533787"
     CDS             complement(join(547572..548240,548386..548430))
                     /gene="TPHA0C02460"
                     /locus_tag="TPHA_0C02460"
                     /inference="similar to DNA sequence:INSDC:YDR174W"
                     /note="similar to Saccharomyces cerevisiae HMO1 (YDR174W);
                     ancestral locus Anc_8.372"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684833.1"
                     /db_xref="GeneID:11533787"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:G8BRM3"
                     /translation="MSVDPSDKLKSAKDSLVSSLFELSKSASSAASNIIDFYNAIGED
                     EEEKIEAFTTLTESLQKLTSATNTLHGISSELTNPMEDEKEIVPPVPVVSVKQPRKRI
                     PRDPNAPKKPLTVFFAYSAYIRQEIRDDREKRGETPLSSTEITQEISKKWKELSDSEK
                     EKWKQAYNIELEHYQLEKQKYLEAKKNGSLPTSNGIPTHAPVGIPSSLQSIKRSHDDS
                     GSSEKKKKKKKKDKKKDSN"
     gene            <549862..>550986
                     /gene="TPHA0C02470"
                     /locus_tag="TPHA_0C02470"
                     /db_xref="GeneID:11533778"
     mRNA            <549862..>550986
                     /gene="TPHA0C02470"
                     /locus_tag="TPHA_0C02470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684786.1"
                     /db_xref="GeneID:11533778"
     CDS             549862..550986
                     /gene="TPHA0C02470"
                     /locus_tag="TPHA_0C02470"
                     /inference="similar to DNA sequence:INSDC:YDR173C"
                     /note="similar to Saccharomyces cerevisiae ARG82
                     (YDR173C); ancestral locus Anc_8.371"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684834.1"
                     /db_xref="GeneID:11533778"
                     /db_xref="GOA:G8BRM4"
                     /db_xref="InterPro:IPR005522"
                     /db_xref="UniProtKB/TrEMBL:G8BRM4"
                     /translation="MDSQYVKLKHQAAGHAGTLSDKDGILVFKPTVKQEIDFLKESQD
                     RYYKDTITESTDQDSTEVLLGAWMPRYLGIIEEGDKKSSIDGSISSVYSIQRTKNEQP
                     IVDSLVDFDTDEGNSSANDNVTMKDNNEKPFIVLENLLHGYSKPNIMDIKLGKILYDE
                     NASPEKKIRLQEVSDSTTSGSMGFRICGMKLQKNHLISTVSKDHFELDIIEHDGENIE
                     YVFLNKLYGRTRTPENIQEAFELYFTNNDLTEKRKKQLITMFWQRLQLFYNTLLDEEI
                     RLISSSLLFVYEGDPEHWDYNQDEDLLLKPDFIDKEVDSDDDDNGTVEKERKYSDVLS
                     SMSLIDFAHSKFVPGEGYDVNIIEGVEALLKIFEEMLRQH"
     gene            complement(<551085..>553070)
                     /gene="TPHA0C02480"
                     /locus_tag="TPHA_0C02480"
                     /db_xref="GeneID:11533763"
     mRNA            complement(<551085..>553070)
                     /gene="TPHA0C02480"
                     /locus_tag="TPHA_0C02480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684787.1"
                     /db_xref="GeneID:11533763"
     CDS             complement(551085..553070)
                     /gene="TPHA0C02480"
                     /locus_tag="TPHA_0C02480"
                     /inference="similar to DNA sequence:INSDC:YDR172W"
                     /note="similar to Saccharomyces cerevisiae SUP35
                     (YDR172W); ancestral locus Anc_8.370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684835.1"
                     /db_xref="GeneID:11533763"
                     /db_xref="GOA:G8BRM5"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR003285"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BRM5"
                     /translation="MSAPNANPQDQSQGQYYQQYYQQQAQGAAGGQNYQQYYQQQAQG
                     GNGQNFQQYYQQPIANGQGYQQGGYQQGGYQQGGYQQGGYQQGGYQQGGRGGFKNNNN
                     RRNNFNNNYNNTGYQGYQQQSQSQGMSLEDYQKQQLATATPKPKKTLKLVSSSGIKLA
                     NASKKPEVTETKKPEAAKEDDVPSVAKLSIKEEPVKTEQETKANAEPTPKAETLIVEE
                     EDEIDNEIVQDMFGGKDHVSIIFMGHVDAGKSTMGGNILYLTGSVDKRTVEKYEREAK
                     DAGRQGWYLSWVMDTNKEERNDGKTIEVGKAYFETEKRRYTILDAPGHKMYVSEMIGG
                     ASQADVGVLVISARKGEYETGFEKGGQTREHALLAKTQGVNKMIVVVNKMDDPTVNWS
                     EERYNHCVSNISNFLKAIGYNLKEDVIFMPVSGYSGAGLKERVNAADCPWYTGPSLLE
                     YLDNMSHMDRHINAPFMLPVASKMRDMGTIVEGKIESGHIRKGNSTLLMPNKIQVEIQ
                     NIYNETENEVDMAVCGEQVKLKIKGVEEEDVAAGFVLTSPKNPIKSVTKFVAEIAIVE
                     LKSIISAGFACVMHVHTAIEEVQITRLLHKLEKGTNRRSKKPPAFAKKGMKIIALLET
                     EKAVCVETYQDYPQLGRFTLRDQGATIAIGKIIKIVE"
     gene            <554165..>554704
                     /gene="TPHA0C02490"
                     /locus_tag="TPHA_0C02490"
                     /db_xref="GeneID:11533780"
     mRNA            <554165..>554704
                     /gene="TPHA0C02490"
                     /locus_tag="TPHA_0C02490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684788.1"
                     /db_xref="GeneID:11533780"
     CDS             554165..554704
                     /gene="TPHA0C02490"
                     /locus_tag="TPHA_0C02490"
                     /inference="similar to DNA sequence:INSDC:YKL069W"
                     /note="similar to Saccharomyces cerevisiae YKL069W;
                     ancestral locus Anc_2.614"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684836.1"
                     /db_xref="GeneID:11533780"
                     /db_xref="InterPro:IPR000614"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR029016"
                     /db_xref="UniProtKB/TrEMBL:G8BRM6"
                     /translation="MEDDKHHADYTTFSASQSREEVLQTVIDSYEALTTGQDNWVCNL
                     ANASSLLWHAYHSLNVNVNWAGFYLTDKSVLDKQELILGPFQGKVACQQILFGRGVCG
                     SAASEKVTQLVHDVNKHPNHIACDGETKSEIVVPILDESNNTVGVIDIDCLDYEGFSE
                     VDQKYLEELAKLIIKTCKF"
     gene            complement(<554909..>555823)
                     /gene="TPHA0C02500"
                     /locus_tag="TPHA_0C02500"
                     /db_xref="GeneID:11533944"
     mRNA            complement(<554909..>555823)
                     /gene="TPHA0C02500"
                     /locus_tag="TPHA_0C02500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684789.1"
                     /db_xref="GeneID:11533944"
     CDS             complement(554909..555823)
                     /gene="TPHA0C02500"
                     /locus_tag="TPHA_0C02500"
                     /inference="similar to DNA sequence:INSDC:YMR048W"
                     /note="similar to Saccharomyces cerevisiae CSM3 (YMR048W);
                     ancestral locus Anc_2.612"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684837.1"
                     /db_xref="GeneID:11533944"
                     /db_xref="GOA:G8BRM7"
                     /db_xref="InterPro:IPR012923"
                     /db_xref="UniProtKB/TrEMBL:G8BRM7"
                     /translation="MESNLDPTVISSLDNAYHGNVDNYLLNNDPTAVDSTMNDPTAVV
                     TKKRKPIVKLTAERLLSDNGLPYVMKNARKRIHISKNKSPCDNFNNILLFYQLWAHNL
                     YPKAKFKDFIKLAQGLGKSDKILREYRSALFRKEMGLIDDDELNRLVNFLQNNDEVIP
                     IQEDSTHDPNAVENNADATHHESSILDLEQGNQPQKKHLFEVNSDLSDADEEDQIYNV
                     TRPTTEDNTITIPLNNSGNNEEEALLLEMEEQQAGITKRNAKVISDDEEELELLKDFE
                     MEQQKLETHNDVVQEHMEEDEMELMRGM"
     gene            <557824..>560418
                     /gene="TPHA0C02510"
                     /locus_tag="TPHA_0C02510"
                     /db_xref="GeneID:11535229"
     mRNA            <557824..>560418
                     /gene="TPHA0C02510"
                     /locus_tag="TPHA_0C02510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684790.1"
                     /db_xref="GeneID:11535229"
     CDS             557824..560418
                     /gene="TPHA0C02510"
                     /locus_tag="TPHA_0C02510"
                     /inference="similar to DNA sequence:INSDC:YKL068W,YMR047C"
                     /note="similar to Saccharomyces cerevisiae NUP100
                     (YKL068W) and NUP116 (YMR047C); ancestral locus Anc_2.610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684838.1"
                     /db_xref="GeneID:11535229"
                     /db_xref="GOA:G8BRM8"
                     /db_xref="InterPro:IPR007230"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="UniProtKB/TrEMBL:G8BRM8"
                     /translation="MFGQATRGAFSNTTPFGSNNTNSMFGSQQNNGFNGANSSNNAFS
                     GFGGFNSMNNNNNNNNNNTSTGSMFGAKRNNNAFGQTQNSPFGNASNANNNNSVGAFG
                     QQNQSSTFGSNNNSNAFGGSSFGQNNNSNQQSGGLFGLNNNATMNNQQSGGLYGQNNN
                     SQQQGGLFGQNNNTQQTGGLFGQQNNNNAQSGGLFGQTNSSAQSGGLFGQNNNNNAQS
                     GGLFGQTNNTLNNNQQQQGTLFGQNNNSQQSNGLFGQNNNNQQSGGLFGQNNNNNNQQ
                     QGGLFGQNNNANTISNMNNQQSGSLFGQNNTSSNAQSGGLFGNKPAGGLFGSTPSQPT
                     SFGNNALGNTMNQPKLTSGLFGQNSATSNNLSGGLFGNTNASNNNKPGGLFGNTNNSN
                     NNQAGGLFGSSGVNNATKPSGGLFGSSTTTSNTTNQLGGFFGAKPATPAVTLYGNNST
                     NTNTAGLNSTPASGGLFGGQNQNTASTNIGTGLFGNSNTLATGTPTTTTGSIGGSTLN
                     TNTGLFSSGANTLQQNTAQPAPNAQSMMTAQNVESLDINATKELFARVSVPASITKPT
                     KPNITKINANMKLKIDMTSAYRSAPKPLFSTKSLLDKQLVKSDKSHSKSFPDTNSNGF
                     DVATERSLIDTTKLFFNPDRVNFKSIISSKKKPKDIMIKTEKVQITNSIEESSETKLI
                     ELTNNVSGKPAQNDNDETTVAIIKPQGIISDDISFMGNGYYLTPSIETLSSNSLLQLR
                     SVKNLIIGHKSYGKIEFLKPVDLTNVSLSALCDSIVVFSPRTCALYPLSSHKPQPSEG
                     LNIKARITLYNCFPIDKSTRTPITDPTHPLVVRHIQKLKENVEASTFESYDPVTGTYV
                     FVTDQPVK"
     gene            complement(<560692..>562050)
                     /gene="TPHA0C02520"
                     /locus_tag="TPHA_0C02520"
                     /db_xref="GeneID:11533485"
     mRNA            complement(<560692..>562050)
                     /gene="TPHA0C02520"
                     /locus_tag="TPHA_0C02520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684791.1"
                     /db_xref="GeneID:11533485"
     CDS             complement(560692..562050)
                     /gene="TPHA0C02520"
                     /locus_tag="TPHA_0C02520"
                     /inference="similar to DNA sequence:INSDC:YMR044W"
                     /note="similar to Saccharomyces cerevisiae IOC4 (YMR044W);
                     ancestral locus Anc_2.609"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684839.1"
                     /db_xref="GeneID:11533485"
                     /db_xref="InterPro:IPR000313"
                     /db_xref="UniProtKB/TrEMBL:G8BRM9"
                     /translation="MSTEYLYQPTDIVLAKVKGFSAWPAMIIPNELIPEAVLRNRMKM
                     TSNSNNDANSIDEHDEQGEESDEDDYIIYSSLLKFQKFKTVKKLYCVKFLCDDTYYWV
                     KPVDFHLLTVDECKDWLKTEKTKRRINKKLIPAYEMASKGSQNIDVMEFVEYGSYGKP
                     EEDEYIDEVDEEEEEEYTTETSSSKSRKKGASKEKNPTRVSSRVSAKRKQEEIEEAKK
                     KRNTRSNRAKVNEDTKDEEKMMLEETPVVSKKQTKSKNKDKQKKVQPELEKYNYDTDE
                     DWSLVGLGPQDLSISQHENKLVSKLSQKKNLEIHKEKCLDIADKLSTINKLITDILIP
                     NPDDATVGCSTTIQDYEVLIDELQLALQYNTRNDEFISIFQSNNEFLSNFRILINLQF
                     EQLKKWNLLKDLNNIFRVIYKADLIIDTEPWNLQFESSKVIDEVTEPVEGSVTTESIK
                     SE"
     gene            complement(<562476..>563234)
                     /gene="TPHA0C02530"
                     /locus_tag="TPHA_0C02530"
                     /db_xref="GeneID:11533661"
     mRNA            complement(<562476..>563234)
                     /gene="TPHA0C02530"
                     /locus_tag="TPHA_0C02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684792.1"
                     /db_xref="GeneID:11533661"
     CDS             complement(562476..563234)
                     /gene="TPHA0C02530"
                     /locus_tag="TPHA_0C02530"
                     /inference="similar to DNA sequence:INSDC:YMR043W"
                     /note="similar to Saccharomyces cerevisiae MCM1 (YMR043W);
                     ancestral locus Anc_2.608"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684840.1"
                     /db_xref="GeneID:11533661"
                     /db_xref="GOA:G8BRN0"
                     /db_xref="InterPro:IPR002100"
                     /db_xref="UniProtKB/TrEMBL:G8BRN0"
                     /translation="MSDSEDHKLDLKTDSKDSSLLSPSSTGSTAKERRKIEIKFIENK
                     TRRHVTFSKRKHGIMKKAFELSVLTGTQVLLLVVSETGLVYTFSTPKFEPIVTQQEGR
                     NLIQACLNAPDEEEEEEEETNKHENGNNAGSLIQQQQQQQQQQQLQQDQQQKQQQSPQ
                     MQQQPPQLQQHQQHPPPPQQQHSGILNNNNSANYMSVQQIQQPLKQVPFSNVNIQPPI
                     PNNQYYQAQNPTQQQQQQNSVYQQYFQETQQTNY"
     gene            complement(<565197..>565544)
                     /gene="TPHA0C02540"
                     /locus_tag="TPHA_0C02540"
                     /db_xref="GeneID:11535215"
     mRNA            complement(<565197..>565544)
                     /gene="TPHA0C02540"
                     /locus_tag="TPHA_0C02540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684793.1"
                     /db_xref="GeneID:11535215"
     CDS             complement(565197..565544)
                     /gene="TPHA0C02540"
                     /locus_tag="TPHA_0C02540"
                     /inference="similar to DNA sequence:INSDC:YMR042W"
                     /note="similar to Saccharomyces cerevisiae ARG80
                     (YMR042W); ancestral locus Anc_2.607"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684841.1"
                     /db_xref="GeneID:11535215"
                     /db_xref="GOA:G8BRN1"
                     /db_xref="InterPro:IPR002100"
                     /db_xref="UniProtKB/TrEMBL:G8BRN1"
                     /translation="MTDHKTKNKKIKIDFIVNKTKRRLTYNTRRVGLMKKSYELSLIT
                     GVNILLLISSINDDYVYFFSSPKLRNFVNCNEGQKLIRKCLQEESPKAIETKKHHLEM
                     CRFCNWRFKIRNH"
     gene            complement(565798..565887)
                     /gene="TPHA0Ctrna4F"
                     /locus_tag="TPHA_0Ctrna4F"
                     /db_xref="GeneID:11533653"
     tRNA            complement(join(565798..565834,565850..565887))
                     /gene="TPHA0Ctrna4F"
                     /locus_tag="TPHA_0Ctrna4F"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /db_xref="GeneID:11533653"
     gene            <567340..>567798
                     /gene="TPHA0C02550"
                     /locus_tag="TPHA_0C02550"
                     /db_xref="GeneID:11533970"
     mRNA            <567340..>567798
                     /gene="TPHA0C02550"
                     /locus_tag="TPHA_0C02550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684794.1"
                     /db_xref="GeneID:11533970"
     CDS             567340..567798
                     /gene="TPHA0C02550"
                     /locus_tag="TPHA_0C02550"
                     /inference="similar to DNA sequence:INSDC:YKL067W"
                     /note="similar to Saccharomyces cerevisiae YNK1 (YKL067W);
                     ancestral locus Anc_2.606"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684842.1"
                     /db_xref="GeneID:11533970"
                     /db_xref="GOA:G8BRN2"
                     /db_xref="InterPro:IPR001564"
                     /db_xref="InterPro:IPR023005"
                     /db_xref="UniProtKB/TrEMBL:G8BRN2"
                     /translation="MTNTERTFIAIKPDGVQRGLVTKILNRFEQRGYKLVAIKMLNAS
                     QELLDQHYAEHVGKPFYPKMSAFMRSGPIVATVWEGKDAVQQGRKLLGATNPADSLPG
                     TIRGDFGIDLGRNVCHGSDSVESANREIKLWFKAEELVTYEQFQAKWIYE"
     gene            <568135..>569157
                     /gene="TPHA0C02560"
                     /locus_tag="TPHA_0C02560"
                     /db_xref="GeneID:11533975"
     mRNA            <568135..>569157
                     /gene="TPHA0C02560"
                     /locus_tag="TPHA_0C02560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684795.1"
                     /db_xref="GeneID:11533975"
     CDS             568135..569157
                     /gene="TPHA0C02560"
                     /locus_tag="TPHA_0C02560"
                     /inference="similar to DNA sequence:INSDC:YMR041C"
                     /note="similar to Saccharomyces cerevisiae ARA2 (YMR041C);
                     ancestral locus Anc_2.604"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684843.1"
                     /db_xref="GeneID:11533975"
                     /db_xref="GOA:G8BRN3"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:G8BRN3"
                     /translation="MTILESRQCHYIKSHDVKNLPNLILGGATLSSQYNDDPNSIPIA
                     DMIRFAFRNGITAIDTSPYYGDSEIIYGKALKSIKIEFPRDTYFICTKVGRIGSNEFD
                     YSANNVRKSILRSCKRLNTNYLDVVYLHDVEFTPLEDSIEALTELKKLKDEGIIKNFG
                     LSGYPLDYITKLLDYVHDTCSDSIGDLDLILSYCNMNLQNTRLLQFEDALRKNNIKTI
                     CNASILSMSLLNSFETKPFHPCSEELKQCSIQSAKYCASKQVDLADLATRYAISKWYR
                     RGPTVIGVSDIDELKDALNNYWEVRNNDGNLSKKDMELVDHIQKKIFKDHLNERWKSG
                     IDHAKI"
     gene            complement(<569283..>569816)
                     /gene="TPHA0C02570"
                     /locus_tag="TPHA_0C02570"
                     /db_xref="GeneID:11533618"
     mRNA            complement(<569283..>569816)
                     /gene="TPHA0C02570"
                     /locus_tag="TPHA_0C02570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684796.1"
                     /db_xref="GeneID:11533618"
     CDS             complement(569283..569816)
                     /gene="TPHA0C02570"
                     /locus_tag="TPHA_0C02570"
                     /inference="similar to DNA sequence:INSDC:YKL063C"
                     /note="similar to Saccharomyces cerevisiae YKL063C;
                     ancestral locus Anc_2.599"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684844.1"
                     /db_xref="GeneID:11533618"
                     /db_xref="UniProtKB/TrEMBL:G8BRN4"
                     /translation="MQGGIRRKRDLLPKYQNGASGAGATRLTTPMKKIIVYFCALFSL
                     FVMMSIAFRDENSVDLRTELDNTVKMVMNMYYKDYNAKIEQVSDEEARNLKQGSQITE
                     ENSSAVQGAGAGAAQGAGAAQGAGAAQGAGAAQGAGAAQGAGAAQGAGAAQGAGAAQG
                     AGAAQGAGQAPNDLLNN"
     gene            <572294..>573391
                     /gene="TPHA0C02580"
                     /locus_tag="TPHA_0C02580"
                     /db_xref="GeneID:11533484"
     mRNA            <572294..>573391
                     /gene="TPHA0C02580"
                     /locus_tag="TPHA_0C02580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684797.1"
                     /db_xref="GeneID:11533484"
     CDS             572294..573391
                     /gene="TPHA0C02580"
                     /locus_tag="TPHA_0C02580"
                     /inference="similar to DNA sequence:INSDC:YKL062W,YMR037C"
                     /note="similar to Saccharomyces cerevisiae MSN4 (YKL062W)
                     and MSN2 (YMR037C); ancestral locus Anc_2.598"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684845.1"
                     /db_xref="GeneID:11533484"
                     /db_xref="GOA:G8BRN5"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BRN5"
                     /translation="MADLDELLNNDAAVLELDSLTNLEFESLSNNINVNFNNSYLDGL
                     LINKNNNISESTLVTPKKLHKSNSNVSIGWKEDTVDYKYTTTNSNEIHNSTLSVVDQN
                     QPRNSISHGVDFWNVSNTKRNSLVKQEGNRDENGNEDKNENVDDIVNYEYDTNLSKSL
                     NYFYFNSENLSNSALFSESPVPVQEQSLLGNFQPTIKYSNSISPYPTSNIFIQDNNSN
                     TTMNPNDISIRKNSKNSYDQEFLTNNERRPSTLINATPVLAKSIDPSQNFIAKRNSIH
                     TSIKQSASSKDKLPFVKRNSISPQIIYSDKPFKCNKCEKKFKRSEHLKRHIRSVHSTE
                     RPYHCQFCEKNFSRSDNLSQHLKTHKRHGDF"
     gene            <574010..>575803
                     /gene="TPHA0C02590"
                     /locus_tag="TPHA_0C02590"
                     /db_xref="GeneID:11533668"
     mRNA            <574010..>575803
                     /gene="TPHA0C02590"
                     /locus_tag="TPHA_0C02590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684798.1"
                     /db_xref="GeneID:11533668"
     CDS             574010..575803
                     /gene="TPHA0C02590"
                     /locus_tag="TPHA_0C02590"
                     /inference="similar to DNA sequence:INSDC:YMR036C"
                     /note="similar to Saccharomyces cerevisiae MIH1 (YMR036C);
                     ancestral locus Anc_2.596"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684846.1"
                     /db_xref="GeneID:11533668"
                     /db_xref="GOA:G8BRN6"
                     /db_xref="InterPro:IPR000751"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:G8BRN6"
                     /translation="MGLQFMNTKDSTDLDPNTSKRLSFTSPFHEGTKIFKNIHSLLKS
                     SSKKDSQSPLQEKDAKDKMYIDDDSISDELLIASPSRNKSKSKLNYKTVDRLPLHDIS
                     DSVINTLANMDRSQRYDDEQSLDKHILNLKIDNPLNAPLLSSFNSLGSNTNTVNRNNS
                     ANHDSYFDSDDLIVNNITISLPNKQDNRILKTRSNSLRRIQSTSSHKDTENHCRSKYP
                     ARKRNNSMAIEVKNLYGKVTLNNTQKRDRISNNKVEYETTNITAEGPSSLFDSVLSES
                     NILFYHNNDKNTKDNFPRISPSTLNEIIDNKIYEPHYQSYIIIDTRFSYEFFGGHVKN
                     ALNISTKDDIEWELLNESRIKSNANQKPILVIFHCEFSCFRSPILASHLRNCDRILNF
                     ESYPSLLYPDIVILDGGYKSFFDKYSLQCFPCNYISMDSQENVVNRGQELHKFRSESR
                     KVVSRSNSLYRLSSISRSNSALRNSTSHNNNRAEFSKSNLFIAKTEDCSVNPFQVNFK
                     PPPPRSIFTKGSSYSSKESIYNSSPTSRSSFYSILDSANDLSVFNQNKPEDTEDNFFA
                     EEMPISSGTNEASLTLHEADERDLTVCLEEQ"
     gene            complement(<576085..>576615)
                     /gene="TPHA0C02600"
                     /locus_tag="TPHA_0C02600"
                     /db_xref="GeneID:11533656"
     mRNA            complement(<576085..>576615)
                     /gene="TPHA0C02600"
                     /locus_tag="TPHA_0C02600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684799.1"
                     /db_xref="GeneID:11533656"
     CDS             complement(576085..576615)
                     /gene="TPHA0C02600"
                     /locus_tag="TPHA_0C02600"
                     /inference="similar to DNA sequence:INSDC:YMR035W"
                     /note="similar to Saccharomyces cerevisiae IMP2 (YMR035W);
                     ancestral locus Anc_2.595"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684847.1"
                     /db_xref="GeneID:11533656"
                     /db_xref="GOA:G8BRN7"
                     /db_xref="InterPro:IPR000223"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019758"
                     /db_xref="InterPro:IPR019759"
                     /db_xref="InterPro:IPR028360"
                     /db_xref="UniProtKB/TrEMBL:G8BRN7"
                     /translation="MSTIFHSPGFKRSLKILSWIPVIIAFNDNVSYIARIKGPSMRPS
                     LNPNDNELSTDWVLLWKWGCTQSYNLKRNDIVLIKSPSDPHKIYCKRIKGVQFDTIKT
                     LHPYPKETVLVPRNHIWVEGDNVTQSVDSNNFGAVATGMIVGKVVKVIWPPTRWGTNL
                     NETVGRHDALSLATRQ"
     gene            complement(<577049..>579061)
                     /gene="TPHA0C02610"
                     /locus_tag="TPHA_0C02610"
                     /db_xref="GeneID:11533452"
     mRNA            complement(<577049..>579061)
                     /gene="TPHA0C02610"
                     /locus_tag="TPHA_0C02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684800.1"
                     /db_xref="GeneID:11533452"
     CDS             complement(577049..579061)
                     /gene="TPHA0C02610"
                     /locus_tag="TPHA_0C02610"
                     /inference="similar to DNA sequence:INSDC:YMR032W"
                     /note="similar to Saccharomyces cerevisiae HOF1 (YMR032W);
                     ancestral locus Anc_2.591"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684848.1"
                     /db_xref="GeneID:11533452"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:G8BRN8"
                     /translation="MSYNFEECFWDQHDNGVNVLLTHISSGIKACDTMVSFFKQRSEL
                     EKDYARRLGAGNDKLMKDISNSPDYGNVQESLVALVNIEKSRAQAHSKQSEIIYRQLF
                     IDTRDFISQIQAKYTTLSGKIEKLRVDKYNKRKGCKELSKRLEEAESRARSLKLNQFN
                     TVGVRKSEQNQKELAKWSNNLQEIQNQLAVLKQEYKSSQKFWLSEWRSITSQFQEMES
                     TRISFIQEKLQQFADATMETSILEQSKDESLINQLAMFTAIDDIASFSSKFGTGRLKE
                     KNHKETKKNEIINGNYTTSHSLVMPRKERSNTMLSKESSGSRNLTHNKRNSYVESIRM
                     LSSQLQKFNGDSNYIDLTKDDFDTTKPVKDQDMYMAAENIDEVLAKNYEISKFNSSKT
                     KRYQKEKKSEDKEENLSSSGSSNPTDFKSHVKNQSSVDTLQTSISSYTSNIDDSERFA
                     KSWNSKNRRRKSVTNLQLPSPTTSDNEQEEKEGKAKDFSRMDNNEAESSKYNLPSEKL
                     VVPSDKVNDDLRYNSMNTTIVNPQLDISTNSKGKLRRKSMVYGDGESPIKEALYKMNR
                     IQSSATNAFAESNPKVGRVRDNGITVTLPLVTSDGLNVIRYAKAEYPLMENDAPGLAH
                     FEKNDYLLITEVVSDEWYKGEVYGNDMIGINHRSGLIPFNFIQLLN"
     gene            complement(<580190..>581266)
                     /gene="TPHA0C02620"
                     /locus_tag="TPHA_0C02620"
                     /db_xref="GeneID:11533983"
     mRNA            complement(<580190..>581266)
                     /gene="TPHA0C02620"
                     /locus_tag="TPHA_0C02620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684801.1"
                     /db_xref="GeneID:11533983"
     CDS             complement(580190..581266)
                     /gene="TPHA0C02620"
                     /locus_tag="TPHA_0C02620"
                     /inference="similar to DNA sequence:INSDC:YKL051W"
                     /note="similar to Saccharomyces cerevisiae SFK1 (YKL051W);
                     ancestral locus Anc_2.589"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684849.1"
                     /db_xref="GeneID:11533983"
                     /db_xref="InterPro:IPR019402"
                     /db_xref="UniProtKB/TrEMBL:G8BRN9"
                     /translation="MSSFNFKFRFRKPANYFFIIPWIAFIPWWGMLVAMLACWAGQGH
                     PIYWFMDSYQFPVFISDIGATNLRPLFISCAGWQGLGYCITLACEFFQRSGYWPFQIS
                     KFSSKTTADNNNPRDNYYNSVSSEYTRMMATKHYYMPPYYTKHERNLIIAAFFLAGIG
                     ELGLLFCSIFSTALYPHVHISMVSVFVAFLFLSTCCLIAEYFLMGKHYAIFHPLADPS
                     KTKKYEDMRWNEWTGYVWNKFTISAVLKTVWLTLAVIWAIAFGADNGSVSACFEWLLA
                     FWYGLLFIILSADFYVGGRYKESLYFHQIESFEGYYKYDNLISSSDSYNTSDSDGSID
                     AHMLEIKNQNTSDLASFTNEPIVA"
     gene            <582630..>583442
                     /gene="TPHA0C02630"
                     /locus_tag="TPHA_0C02630"
                     /db_xref="GeneID:11533445"
     mRNA            <582630..>583442
                     /gene="TPHA0C02630"
                     /locus_tag="TPHA_0C02630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684802.1"
                     /db_xref="GeneID:11533445"
     CDS             582630..583442
                     /gene="TPHA0C02630"
                     /locus_tag="TPHA_0C02630"
                     /inference="similar to DNA sequence:INSDC:YKL052C"
                     /note="similar to Saccharomyces cerevisiae ASK1 (YKL052C);
                     ancestral locus Anc_2.588"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684850.1"
                     /db_xref="GeneID:11533445"
                     /db_xref="GOA:G8BRP0"
                     /db_xref="InterPro:IPR013964"
                     /db_xref="UniProtKB/TrEMBL:G8BRP0"
                     /translation="MASQSPEEQLEKLEQEITIHLQKIDSNFSYCFNKITQDIVPHVQ
                     GYGEICEKIIDSSSWLMNMFQQSGNIDLNSYTKRNDELGNNTLNGNKISHNHGDTLFP
                     SNNSTVNNNTNSGVIMVSKMPEMKPTKSNDRNSMREENSSFRQDYYTADITSDGKILK
                     VPDSSDEENARDADMELGSESTIQRQNRKRKVSLLLQEEYGSSSVMGSPFAEKQSARK
                     RLQTTQNEQDEVDSNQDSDRYNSSPMKESLSDHESTKEAPKPGTVIHFTTQS"
     gene            <583789..>584055
                     /gene="TPHA0C02640"
                     /locus_tag="TPHA_0C02640"
                     /db_xref="GeneID:11534070"
     mRNA            <583789..>584055
                     /gene="TPHA0C02640"
                     /locus_tag="TPHA_0C02640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684803.1"
                     /db_xref="GeneID:11534070"
     CDS             583789..584055
                     /gene="TPHA0C02640"
                     /locus_tag="TPHA_0C02640"
                     /inference="similar to DNA sequence:INSDC:YKL053C-A"
                     /note="similar to Saccharomyces cerevisiae MDM35
                     (YKL053C-A); ancestral locus Anc_2.587"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684851.1"
                     /db_xref="GeneID:11534070"
                     /db_xref="InterPro:IPR007918"
                     /db_xref="UniProtKB/TrEMBL:G8BRP1"
                     /translation="MGNTMSNSFAPECTELKKEYDDCFNEWYCEKFLKGKSIENECSK
                     QWYAYTTCVDAALIKQGIKPTLDDARKEAPFENGGALTETKDDK"
     gene            <585233..>587410
                     /gene="TPHA0C02650"
                     /locus_tag="TPHA_0C02650"
                     /db_xref="GeneID:11535243"
     mRNA            <585233..>587410
                     /gene="TPHA0C02650"
                     /locus_tag="TPHA_0C02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684804.1"
                     /db_xref="GeneID:11535243"
     CDS             585233..587410
                     /gene="TPHA0C02650"
                     /locus_tag="TPHA_0C02650"
                     /inference="similar to DNA sequence:INSDC:YKL054C"
                     /note="similar to Saccharomyces cerevisiae DEF1 (YKL054C);
                     ancestral locus Anc_2.586"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684852.1"
                     /db_xref="GeneID:11535243"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="UniProtKB/TrEMBL:G8BRP2"
                     /translation="MSSQYRRSNTHSSRNNSHNSHNNSKIDSQTKFKIETLSELFPDW
                     TNDDLIELVQEFDDLETIIDKITSGAVTKWDEVKKPTKKEKQEKKELLLQQQQQELLN
                     NIQDNNTHNSHGSATASSANNSASSNGAGSASSASNANNENNTSNTHTSSNTVREHIS
                     SSVHSSNNNSSSYHGGHHDKNSNNAGSYNNRYSSANPNVRNKRVPYNNSTKHSEKLVA
                     NATVKTASSTSSHATSNGGAASWADIANKKDVSTKKNIDQQQGQQQSFAEKTEAEIKK
                     SQNEQIDEGEVQKTSKKQEFLPIKQTEESQDSAKPKKMSWAAVAAPKPKPQKKKESPL
                     DDVDALREEVETIASEEIVVKEETFIESASQVQSESPSNVEQSVQETSTINKNIDVTE
                     SPAAISIQKTVVSETVETEKEIDQPQLQQSHEHTAVKPDAQIEQSMEQSLDRTTEQAQ
                     QQNLYQQGQQTQHGQQQYGMQHSNEAAAAAAAAAAAQQQQYFMYQNQFPGYSYPGMYD
                     TQNYGYAQQQYQQHMGQNTPVSSGNAAQGTQYDMQQRYGQTANASAATEMGNATDSPT
                     AANIQLQQQQQQQPYGGSFMPYYAQFYQQSFPYAHPQYNMGGQYPYQVPKSGYQQYYQ
                     QGVQGAQGAQGAQGAQGAQGAQGQQAGQQAEDQSQQQSRQHAAASQQNQQQGLQQMTP
                     QEMQYQQYYQYQQQQAQQAVNGQQPYGYSSGYDYTSQTSRGFY"
     gene            <588017..>588883
                     /gene="TPHA0C02660"
                     /locus_tag="TPHA_0C02660"
                     /db_xref="GeneID:11533511"
     mRNA            <588017..>588883
                     /gene="TPHA0C02660"
                     /locus_tag="TPHA_0C02660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684805.1"
                     /db_xref="GeneID:11533511"
     CDS             588017..588883
                     /gene="TPHA0C02660"
                     /locus_tag="TPHA_0C02660"
                     /inference="similar to DNA sequence:INSDC:YKL055C"
                     /note="similar to Saccharomyces cerevisiae OAR1 (YKL055C);
                     ancestral locus Anc_2.585"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684853.1"
                     /db_xref="GeneID:11533511"
                     /db_xref="GOA:G8BRP3"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8BRP3"
                     /translation="MQFLPVAIITGATRGIGKEITKKLSSNGISCISVGASLHSISRI
                     KQNDHLSFIKENQHHGALAIDLSQWPNSLDSSNIDTVDFSLDGNTMVSKQEHGDSVFS
                     LIDIWNKQLKEKGLSHDVVYYTSLLINCAGITQENISIKESNEKITKIMNVNFLSAVT
                     LCNKTIIRIIKEKRQIKNQLVGHDESISRMKTKIINISSALETSKYIIPGTSIYSASK
                     SALSCYSKTLNEEIQKTGIKVTSLPINLIEGTDMIKDLSNSSGFENLEKYNLPTDTKE
                     NVANKVFQLYLK"
     gene            <589655..>590158
                     /gene="TPHA0C02670"
                     /locus_tag="TPHA_0C02670"
                     /db_xref="GeneID:11533506"
     mRNA            <589655..>590158
                     /gene="TPHA0C02670"
                     /locus_tag="TPHA_0C02670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684806.1"
                     /db_xref="GeneID:11533506"
     CDS             589655..590158
                     /gene="TPHA0C02670"
                     /locus_tag="TPHA_0C02670"
                     /inference="similar to DNA sequence:INSDC:YKL056C"
                     /note="similar to Saccharomyces cerevisiae TMA19
                     (YKL056C); ancestral locus Anc_2.584"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684854.1"
                     /db_xref="GeneID:11533506"
                     /db_xref="InterPro:IPR011057"
                     /db_xref="InterPro:IPR011323"
                     /db_xref="InterPro:IPR018103"
                     /db_xref="InterPro:IPR018105"
                     /db_xref="UniProtKB/TrEMBL:G8BRP4"
                     /translation="MIIFNDIFSNDELLSDAYDVKLVDDVIYEADCAMVRVGGDNIDI
                     GANPSAEGGDEDVEDGTELVNNVVHSFRLQPTAFDKKSFLTYMKGYMKAIKARLQESD
                     PDAVATFEKGAQTYAKKVIGSFKDWEFYTGESMDPDAMVVMLNYREDGTTPFVAIWKH
                     GIRKEKV"
     gene            complement(<590403..>591515)
                     /gene="TPHA0C02680"
                     /locus_tag="TPHA_0C02680"
                     /db_xref="GeneID:11535282"
     mRNA            complement(<590403..>591515)
                     /gene="TPHA0C02680"
                     /locus_tag="TPHA_0C02680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684807.1"
                     /db_xref="GeneID:11535282"
     CDS             complement(590403..591515)
                     /gene="TPHA0C02680"
                     /locus_tag="TPHA_0C02680"
                     /inference="similar to DNA sequence:INSDC:YMR028W"
                     /note="similar to Saccharomyces cerevisiae TAP42
                     (YMR028W); ancestral locus Anc_2.581"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684855.1"
                     /db_xref="GeneID:11535282"
                     /db_xref="GOA:G8BRP5"
                     /db_xref="InterPro:IPR007304"
                     /db_xref="UniProtKB/TrEMBL:G8BRP5"
                     /translation="MSVRQEYTLLLRSIKVKIDESTFRQNSTEFQNELVNIIGKLLSL
                     KDKVYHHLALFSDNESLDDISTSSLEFLSIDYYLAYLCSKKQVVSTQINDDSSKNRMK
                     LKFLEKSVQLYIQFLITLQESEILDKYLAKKLDAFEETYKPRLSELYNVTVKDQNDMA
                     GAMLKRQQKIEGFKNARAVEAQLKELEKRIAVREDVDIDTNDDELLREIYIQKLKVLS
                     YTSFNEIEQILYESELLANFLKEPVLQEVKEDNETQPEENSTGGYTERLETLNKPLLS
                     KTGKILRNFTLMDKKTQLQKKVKGYGQYGPTMTVEEFLEKEFEEGRVLQGGEEQPEEH
                     DSDDDEWLDKETYKAREWDEFKEANQKGSGNTINRG"
     gene            complement(<591916..>592305)
                     /gene="TPHA0C02690"
                     /locus_tag="TPHA_0C02690"
                     /db_xref="GeneID:11533936"
     mRNA            complement(<591916..>592305)
                     /gene="TPHA0C02690"
                     /locus_tag="TPHA_0C02690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684808.1"
                     /db_xref="GeneID:11533936"
     CDS             complement(591916..592305)
                     /gene="TPHA0C02690"
                     /locus_tag="TPHA_0C02690"
                     /inference="similar to DNA sequence:INSDC:YKL058W"
                     /note="similar to Saccharomyces cerevisiae TOA2 (YKL058W);
                     ancestral locus Anc_2.580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684856.1"
                     /db_xref="GeneID:11533936"
                     /db_xref="GOA:G8BRP6"
                     /db_xref="InterPro:IPR003194"
                     /db_xref="InterPro:IPR009083"
                     /db_xref="InterPro:IPR009088"
                     /db_xref="InterPro:IPR015871"
                     /db_xref="InterPro:IPR015872"
                     /db_xref="UniProtKB/TrEMBL:G8BRP6"
                     /translation="MSTPGYYELYRRSTVGSCLVDALDTLISDGRIEASLAMKVLESF
                     DKVVSESLRENTQSKLNVKGLLDTYGFCDDVWTFIIKDCKVTVESNKTATITNENGEQ
                     VTSTTDEQQTIQVDKLRIVACNSKKGD"
     gene            <592727..>594175
                     /gene="TPHA0C02700"
                     /locus_tag="TPHA_0C02700"
                     /db_xref="GeneID:11534108"
     mRNA            <592727..>594175
                     /gene="TPHA0C02700"
                     /locus_tag="TPHA_0C02700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684809.1"
                     /db_xref="GeneID:11534108"
     CDS             592727..594175
                     /gene="TPHA0C02700"
                     /locus_tag="TPHA_0C02700"
                     /inference="similar to DNA sequence:INSDC:YKL059C"
                     /note="similar to Saccharomyces cerevisiae MPE1 (YKL059C);
                     ancestral locus Anc_2.579"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684857.1"
                     /db_xref="GeneID:11534108"
                     /db_xref="GOA:G8BRP7"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014891"
                     /db_xref="UniProtKB/TrEMBL:G8BRP7"
                     /translation="MSSVIFYRFRSQKDPSRILFDGTGLTVFDLKREIIFENKLGDGL
                     DFQLKLFTPDTEEEYEDDAQVIPRSSSVIVRRSPAIKATNLNSRPKLGALAAVGNATR
                     YVTGKPRVLQKKSTVLGGNPASPSRPVTGVTEEERIANMFANQENQWEQTQQEMSSAT
                     PVFFKSASGAANNSDADGPPPPGYMCYRCGGRDHWIKNCPTNTDPNFEGKRIKRTTGI
                     PKKFLKSVEIDPDSMTAEEMAQKKIMITDEGKFVVQVADQTSWEDYQRKQQNRLLNGN
                     NVYRKGYYKDLPESLKCPITGGLLKDPIKTKCCNKYFSKTALEDSLVESDFVCPGCDT
                     PDILLDSLVEDKERKQEVDKYIEEHKSNQESLNVTDNIIPDITAGVTRHDVNQINNVN
                     NQLSNAEPDAKKRKLNEQQAGTPNAMPAVPMPMPPFGMAPFPMAPFPMAPFPMPFPMQ
                     SAPQQQLNQTNSTNSNTDDKVNTSTSKEQTNN"
     gene            complement(<594356..>595744)
                     /gene="TPHA0C02710"
                     /locus_tag="TPHA_0C02710"
                     /db_xref="GeneID:11535297"
     mRNA            complement(<594356..>595744)
                     /gene="TPHA0C02710"
                     /locus_tag="TPHA_0C02710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684810.1"
                     /db_xref="GeneID:11535297"
     CDS             complement(594356..595744)
                     /gene="TPHA0C02710"
                     /locus_tag="TPHA_0C02710"
                     /inference="similar to DNA sequence:INSDC:YMR027W"
                     /note="similar to Saccharomyces cerevisiae YMR027W;
                     ancestral locus Anc_2.578"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684858.1"
                     /db_xref="GeneID:11535297"
                     /db_xref="InterPro:IPR002791"
                     /db_xref="UniProtKB/TrEMBL:G8BRP8"
                     /translation="MAFPPRFLTGDSKTFGGFTSTSRWPTLVQNMIDDLDSELSTKIK
                     GTNVYLQGQIILKQLLELKQEIKQDKKLRSFTEEEIRIAQVPLSFNEYLSEFNDATWQ
                     HAEWLFTEVYLYRRVNVYFRMQSLWYNFDIFNKVKQHAFHSSYYGVIELAIKYQSLET
                     ELENISDPTILKTLFEEFIEISLWGNATDLSLLTNVTLEDIKSLQGEKTRADSRAKIL
                     VNDSENAWELLFSKTSNKQEVIRVDFVLDNSGFELYADLMLASFLLKSKLATKCIFHC
                     KDIPYMVSDVMLKDFDILVKDLQDRKFFPIADEHKQHADTLDFFAKAVTQFVTDGSLE
                     FVENSFWTCAMDYTYIDPSEIKYNGDKVHADLLNSDLVIFKGDLNYRKLTGDRTWKRT
                     TPWPEAIGSLASSGVTTLSLRTCKADVQVALDEGVDEKLSALWEKDHPNQGSWWCCSG
                     KYAVICYCDGKQ"
     gene            <597432..>598517
                     /gene="TPHA0C02720"
                     /locus_tag="TPHA_0C02720"
                     /db_xref="GeneID:11533460"
     mRNA            <597432..>598517
                     /gene="TPHA0C02720"
                     /locus_tag="TPHA_0C02720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684811.1"
                     /db_xref="GeneID:11533460"
     CDS             597432..598517
                     /gene="TPHA0C02720"
                     /locus_tag="TPHA_0C02720"
                     /inference="similar to DNA sequence:INSDC:YKL060C"
                     /note="similar to Saccharomyces cerevisiae FBA1 (YKL060C);
                     ancestral locus Anc_2.577"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684859.1"
                     /db_xref="GeneID:11533460"
                     /db_xref="GOA:G8BRP9"
                     /db_xref="InterPro:IPR000771"
                     /db_xref="InterPro:IPR006411"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G8BRP9"
                     /translation="MGVQEVLKRKSGVIVGDDVRALFDHAKANNYAIPAINVTSTSTA
                     VAALEAARDAKSPIVLQTSNGGAAYFAGKGVSNEGQNASIQGSIAAAHYIRSIAPAYG
                     IPVVLHSDHCAKKLLPWFDGMLEADEAYFKVHGEPLFSSHMLDLSEESDDENISTCVK
                     YFKRMSAMNQWLEMEIGITGGEEDGVNNEHVSKEDLYTSPETVFAVHEALAPISANFS
                     IAAAFGNVHGVYKPGNVVLSPEILGDHQKYAAEKIGAAADSKPLYLVFHGGSGSTQEE
                     FNTGISNGVVKVNLDTDCQYAYLTGIRDYVLTKKDYIMTMVGNPDGADKPNKKYFDPR
                     VWVRAGEVTMTKRIDEALTIFHTKNVL"
     gene            <598894..>600081
                     /gene="TPHA0C02730"
                     /locus_tag="TPHA_0C02730"
                     /db_xref="GeneID:11533503"
     mRNA            <598894..>600081
                     /gene="TPHA0C02730"
                     /locus_tag="TPHA_0C02730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684812.1"
                     /db_xref="GeneID:11533503"
     CDS             598894..600081
                     /gene="TPHA0C02730"
                     /locus_tag="TPHA_0C02730"
                     /inference="similar to DNA sequence:INSDC:YMR026C"
                     /note="similar to Saccharomyces cerevisiae PEX12
                     (YMR026C); ancestral locus Anc_2.576"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684860.1"
                     /db_xref="GeneID:11533503"
                     /db_xref="GOA:G8BRQ0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017375"
                     /db_xref="UniProtKB/TrEMBL:G8BRQ0"
                     /translation="MSFYSNLPSIQNNDSSNSVYPTIYEPISSSEIDELVPYSVRYIL
                     TNYWITRYPNWYTLQVNNYFDEWFNLGLKGLIEWHHIDKYNSTFIDKFYGLQRFNAEN
                     KVLLKSHVKDNSIDKKWPLGLQLTKLQKRALFIEQIVFPYFRTKLDHYHDTLTHLVIQ
                     NEEGTEMVPGLSKYMKVLFRKFYPIIKRCFQIFNLLIKLKFLAGKTGSLSLIDYLFNI
                     AYSRALFPLESKNRSLTQNIGRHNRERLQRQNYYKFRSNFNENFTDTLSVLSYLGTKV
                     FPTFLFTLRIYQWWTAENISSKIERKLNNIDRAIPRPPLTESNLQQNRKSADKCPVCK
                     DKIQNPCVIETGYVMCYPCALDYITQHEGRCPVTNKKLLGCKYNSLTKNWNIVNGIRR
                     LII"
     gene            complement(<600093..>600938)
                     /gene="TPHA0C02740"
                     /locus_tag="TPHA_0C02740"
                     /db_xref="GeneID:11533815"
     mRNA            complement(<600093..>600938)
                     /gene="TPHA0C02740"
                     /locus_tag="TPHA_0C02740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684813.1"
                     /db_xref="GeneID:11533815"
     CDS             complement(600093..600938)
                     /gene="TPHA0C02740"
                     /locus_tag="TPHA_0C02740"
                     /inference="similar to DNA sequence:INSDC:YMR025W"
                     /note="similar to Saccharomyces cerevisiae CSI1 (YMR025W);
                     ancestral locus Anc_2.575"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684861.1"
                     /db_xref="GeneID:11533815"
                     /db_xref="UniProtKB/TrEMBL:G8BRQ1"
                     /translation="MNNEFAFITQNTIREVNYFYETRNFNAINNSFLNYPQCFLLLGH
                     GRSTNAAKITRSLEVPLLSNKGNLGESDFDRSTNLHPDIQAMYKRIKLLNKIDPLLET
                     SGILLINNEHFDYENCIITIIQELGNIKWLFRYSPSFNKEILLDCYLLNQIGDAISIK
                     KTYFELETEKYSFKTEQLKKELDTEFNYNDKNYSLSKYENEIADQKRVILQIVKNIDK
                     ITGYIKNGGRDPDILNKIALLLYQLKKPPTEDIEYELMNQESEIDIINIACKQLEIAN
                     KLDGK"
     gene            complement(<601308..>602399)
                     /gene="TPHA0C02750"
                     /locus_tag="TPHA_0C02750"
                     /db_xref="GeneID:11533820"
     mRNA            complement(<601308..>602399)
                     /gene="TPHA0C02750"
                     /locus_tag="TPHA_0C02750"
                     /product="mitochondrial 54S ribosomal protein YmL3"
                     /transcript_id="XM_003684814.1"
                     /db_xref="GeneID:11533820"
     CDS             complement(601308..602399)
                     /gene="TPHA0C02750"
                     /locus_tag="TPHA_0C02750"
                     /inference="similar to DNA sequence:INSDC:YMR024W"
                     /note="similar to Saccharomyces cerevisiae MRPL3
                     (YMR024W); ancestral locus Anc_2.574"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL3"
                     /protein_id="XP_003684862.1"
                     /db_xref="GeneID:11533820"
                     /db_xref="GOA:G8BRQ2"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="InterPro:IPR011907"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:G8BRQ2"
                     /translation="MEAMMLQGARPSLVRNVIANHGSSLNIWNKCIVRGLQTKPVSNL
                     NGYKEYYQGLKNVINNVPEDLATNSSLLNSLHKRLNLPKEFSYSLLSRCLTCRSSQLP
                     NLSQLSQGSGYVNTVTTSNQFDNHGLNIFGKNILTYHVTHHLMKKYPRLPTVVLNAAI
                     DAYISQEVLANVGRGWGIEIEDSSVLERFSKNEPYTVTLGKLRFFNNTLNKEDGILVI
                     SAANYSESSAYALAVRSIIASLWASTYSVNDALTSKFINDHILSRKLDITKIFQFEQP
                     TRELSTLCAREGFERPISRLLAESGRLSKAPIFIVGVFSGTNKLGEGFGSSLKEAKAR
                     AATDALMKWYCYEPTQLQSEVIDHGTVIV"
     gene            <603110..>603694
                     /gene="TPHA0C02760"
                     /locus_tag="TPHA_0C02760"
                     /db_xref="GeneID:11535279"
     mRNA            <603110..>603694
                     /gene="TPHA0C02760"
                     /locus_tag="TPHA_0C02760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684815.1"
                     /db_xref="GeneID:11535279"
     CDS             603110..603694
                     /gene="TPHA0C02760"
                     /locus_tag="TPHA_0C02760"
                     /inference="similar to DNA sequence:INSDC:YDR071C"
                     /note="similar to Saccharomyces cerevisiae PAA1 (YDR071C);
                     ancestral locus Anc_8.190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684863.1"
                     /db_xref="GeneID:11535279"
                     /db_xref="GOA:G8BRQ3"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G8BRQ3"
                     /translation="MASTLPLHMYVRPLIIEDVDQVLSLETQGFPENERASLEKIKFR
                     LNTCPELCSGLFIRDFEGKELKKETLIGHILGTKIQTNNKVGPQFITLESMGETHCES
                     SDTIAIHSVIIHPDYQKKNLATLLLTDYIQKLSNQEIGSRIVIIAHEHLIPFYERVGF
                     EQKGENTDVSKDPSFASTKWINMVRELVKEEYDN"
     gene            <604690..>607602
                     /gene="TPHA0C02770"
                     /locus_tag="TPHA_0C02770"
                     /db_xref="GeneID:11535257"
     mRNA            <604690..>607602
                     /gene="TPHA0C02770"
                     /locus_tag="TPHA_0C02770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684816.1"
                     /db_xref="GeneID:11535257"
     CDS             604690..607602
                     /gene="TPHA0C02770"
                     /locus_tag="TPHA_0C02770"
                     /inference="similar to DNA sequence:INSDC:YDR069C,YER144C"
                     /note="similar to Saccharomyces cerevisiae DOA4 (YDR069C)
                     and UBP5 (YER144C); ancestral locus Anc_8.188"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684864.1"
                     /db_xref="GeneID:11535257"
                     /db_xref="GOA:G8BRQ4"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G8BRQ4"
                     /translation="MMNTNSEKVLHFDPIVRLSEIADKFISQDNKYTNMKSSLQECID
                     TLANYQDECKKLKKLSVKNQQDDSDKKDINLLGDIYSLYESAYIYYKIIHIIVLNRIP
                     NLQEFAHSKSQNATKEEEELLKIYNMLVKTLLNDDKIQHIKTYLRNNQVTKNHKTTEE
                     YKKDINKELINTELFNLPLSGSGISAIQLNHLIQIYNDTLLVIDVRPRMEFEESHIKC
                     KNIICIEPVSFNESFTDLELQKKSMITSPSDEVKTFAKKDTFNYIVICTDTDEKKQFY
                     LHQQLVLLDLLMNKSFTKPMFQKNVKIFILEKGFKNWVYKKGECEASSPITDVVKPDF
                     TTTRIQDNNKLIEKPEIQKQSGDSIYIEGNTSALNLQKLPELTANVGYAKDNSMRVMM
                     NSSSNFSYSKDYHLPLQQSPLPQRTPSFKSLFNRNGSIPTVSQNGNPAASPYMTKYSN
                     SGQYNINSESPHKSPSTSQITNAYSLPVNSKPSINLNISRYPETPNLSTVSTNNMNIH
                     NNTMGPISPINSRVITPSSRLDESSSPGHRLVPINSSELYNIKSIENYKPSSGSTMKP
                     LLLKSATSKPPSQSLPSLPQLPSASDTLKSYTNSDKDYDFSIGLENMGNSCYLNCIIQ
                     CLLSSHEFTRIFLNNSYEKHINLKSKLGSKGVLARNFARLINTMYTEGSEQSKNDRNG
                     PVKPAQFKLACGSINSIFRSDLQQDSQEFCQFLLDGLHEDLNQCGANPPLKELSPNAE
                     KMREKLSLRIASSIEWERYLTTDFSVIVDQFQGQYASQLRCKVCGGTSTTYQAFSVLS
                     VPVPRGKSCNIIDCFNEFTKVENLETDELWACPHCKKKQPSTKKLTITRLPRNLIIHL
                     KRFDNMLNKNNIFVKYPFLLDLTPYWANDFDGRLPPGVTEELPTRGQIPPFNYKLNAV
                     AAHFGSLYGGHYTSYVDKGKFGWRYFDDTKIRPLKNSYECITSNAYVLFYHRVYGV"
     gene            complement(<607856..>608953)
                     /gene="TPHA0C02780"
                     /locus_tag="TPHA_0C02780"
                     /db_xref="GeneID:11533817"
     mRNA            complement(<607856..>608953)
                     /gene="TPHA0C02780"
                     /locus_tag="TPHA_0C02780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684817.1"
                     /db_xref="GeneID:11533817"
     CDS             complement(607856..608953)
                     /gene="TPHA0C02780"
                     /locus_tag="TPHA_0C02780"
                     /inference="similar to DNA sequence:INSDC:YDR068W"
                     /note="similar to Saccharomyces cerevisiae DOS2 (YDR068W);
                     ancestral locus Anc_8.187"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684865.1"
                     /db_xref="GeneID:11533817"
                     /db_xref="InterPro:IPR005607"
                     /db_xref="UniProtKB/TrEMBL:G8BRQ5"
                     /translation="MDFIVENEESLQVGLKPADDTDTTVSDNNDKSSGIIIKKDEKTE
                     HAFNQLEDTVAKTYEKTSEVLGQYLQEDEEGIHITLPDFNTDVTDKAQEYLKSLDSNL
                     QNAEEVASNYWKKVSSNNFWSSMSNSLSSQLDKVVKIKDDVVRNTMKSDNNTSKNTSS
                     LLHVAGNRTEAELRELSNNEKLYTDNKLELEESFNVDQKTDEISKLLETDKDIAKLMN
                     KLVPTDVTYKDFWNIYFVNKQQIKEREDRRKKLLEAEKKYEEEHDDVGGWDDDEDDEE
                     DNELEEKPVIIEKEDAVEPTIEISTPAIEEIDHKKAVETNSNVNEVLPNIDNGTSDKA
                     ERETKTQEKNIEATVKHQDEDEDENEDNDWE"
     gene            <609800..>610714
                     /gene="TPHA0C02790"
                     /locus_tag="TPHA_0C02790"
                     /db_xref="GeneID:11535307"
     mRNA            <609800..>610714
                     /gene="TPHA0C02790"
                     /locus_tag="TPHA_0C02790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684818.1"
                     /db_xref="GeneID:11535307"
     CDS             609800..610714
                     /gene="TPHA0C02790"
                     /locus_tag="TPHA_0C02790"
                     /inference="similar to DNA sequence:INSDC:YER142C"
                     /note="similar to Saccharomyces cerevisiae MAG1 (YER142C);
                     ancestral locus Anc_8.184"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684866.1"
                     /db_xref="GeneID:11535307"
                     /db_xref="GOA:G8BRQ6"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="UniProtKB/TrEMBL:G8BRQ6"
                     /translation="MTTSEEKGSKKRTREAIKEEEIVDSKALSQEFIEAHTPEFIEGC
                     KFILEKDPSLFDVLTSGNFINFEIDKKGDEITDTEMRVENFFHRLTFVIIAQQISNKA
                     SLSIKQKYLDIFDNEKPTIKTVYERFHGEDGNEFKSQIRAAGFSGRKLSYFESLTDYF
                     FEKKTEIENLFFINKADDDIIIDHLVTNIKGIGPWSAKMFLTMDLKRPNVFAADDLGV
                     ARGCSLYFERRPDILKDLTSKRTQKIKSKFNKAKRPTFKVYDHDLVESCGELFAPHRT
                     VFMYLLWRLSSTRVDAMTKKRIRIDPIY"
     gene            <611168..>611857
                     /gene="TPHA0C02800"
                     /locus_tag="TPHA_0C02800"
                     /db_xref="GeneID:11534089"
     mRNA            <611168..>611857
                     /gene="TPHA0C02800"
                     /locus_tag="TPHA_0C02800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684819.1"
                     /db_xref="GeneID:11534089"
     CDS             611168..611857
                     /gene="TPHA0C02800"
                     /locus_tag="TPHA_0C02800"
                     /inference="similar to DNA sequence:INSDC:YDR066C,YER139C"
                     /note="similar to Saccharomyces cerevisiae YDR066C and
                     YER139C; ancestral locus Anc_8.181"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684867.1"
                     /db_xref="GeneID:11534089"
                     /db_xref="InterPro:IPR007308"
                     /db_xref="UniProtKB/TrEMBL:G8BRQ7"
                     /translation="MISKENIQENVLKSHQKHRQLSMKESESISVELLELLCDSCCKD
                     EDSLKYLSRLLTPELYNDLIDERNLNKKCGYPLCDKSPERIRDPFSINYVTKKFLWEN
                     NPYAYLSTYCSKFHFKCSQFYMTQLSEDALFARTGVHLYSPVTKLSSEVGDSNNLDDK
                     YTVTLFEEIVRNKSSDEDIKKLISNLKKLGIHNADDSQDEVESDISKWISDIKIIENN
                     DPSELGDLIKE"
     gene            complement(<612020..>613204)
                     /gene="TPHA0C02810"
                     /locus_tag="TPHA_0C02810"
                     /db_xref="GeneID:11533799"
     mRNA            complement(<612020..>613204)
                     /gene="TPHA0C02810"
                     /locus_tag="TPHA_0C02810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684820.1"
                     /db_xref="GeneID:11533799"
     CDS             complement(612020..613204)
                     /gene="TPHA0C02810"
                     /locus_tag="TPHA_0C02810"
                     /inference="similar to DNA sequence:INSDC:YDR065W"
                     /note="similar to Saccharomyces cerevisiae YDR065W;
                     ancestral locus Anc_8.180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684868.1"
                     /db_xref="GeneID:11533799"
                     /db_xref="UniProtKB/TrEMBL:G8BRQ8"
                     /translation="MVLHFRLLQSHRKYVIHLYRASHRNILRQVNSKSLQRAIINLLH
                     NEASKNTNNLSSWHVFIALTDLEKLNNHLMNNEMEQVIQIVNDYGEKSNCKDPNIDKS
                     VELIKRLTNAKELNDINRTNQQSPEIVRDMFILDRYIKKLQNLDKLPTIIPKQTKREL
                     FMPYALHEHAKMKLNIIHNRLLKGPPPVYLTKTVMGKSDVWFIRSIFNKKKNQSKSLT
                     AILMTERKRYQKWIDFINSSKYLVQMSMYEGIWDHYLKSGEITKINLDKLHSDLLSKV
                     HRFTSNKTGTLEDLVKKVLANQEANNDTLIQWLLPISEILYRLEDKELKAQTKFKLFK
                     TKLQDPNNKIINIYKKRSQLLYELNVTRYKNVVKDLPTVDIFSQTQNLRSIMKRHKLW
                     SN"
     gene            complement(<613524..>614743)
                     /gene="TPHA0C02820"
                     /locus_tag="TPHA_0C02820"
                     /db_xref="GeneID:11535290"
     mRNA            complement(join(<613524..613958,614723..>614743))
                     /gene="TPHA0C02820"
                     /locus_tag="TPHA_0C02820"
                     /product="40S ribosomal protein S13"
                     /transcript_id="XM_003684821.1"
                     /db_xref="GeneID:11535290"
     CDS             complement(join(613524..613958,614723..614743))
                     /gene="TPHA0C02820"
                     /locus_tag="TPHA_0C02820"
                     /inference="similar to DNA sequence:INSDC:YDR064W"
                     /note="similar to Saccharomyces cerevisiae RPS13
                     (YDR064W); ancestral locus Anc_8.179"
                     /codon_start=1
                     /product="40S ribosomal protein S13"
                     /protein_id="XP_003684869.1"
                     /db_xref="GeneID:11535290"
                     /db_xref="GOA:G8BRQ9"
                     /db_xref="InterPro:IPR000589"
                     /db_xref="InterPro:IPR009068"
                     /db_xref="InterPro:IPR012606"
                     /db_xref="InterPro:IPR023029"
                     /db_xref="UniProtKB/TrEMBL:G8BRQ9"
                     /translation="MGRMHSSGKGMSSSSLPYSRNAPAWFKLSSESVIEQITKYARKG
                     LTPSQIGVLLRDAHGVTQAKIITGNKIMRILKANGLAPEIPEDLYFLIKKAVSVRKHL
                     ERNRKDKDAKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASALVN"
     gene            complement(<615209..>615655)
                     /gene="TPHA0C02830"
                     /locus_tag="TPHA_0C02830"
                     /db_xref="GeneID:11533809"
     mRNA            complement(<615209..>615655)
                     /gene="TPHA0C02830"
                     /locus_tag="TPHA_0C02830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684822.1"
                     /db_xref="GeneID:11533809"
     CDS             complement(615209..615655)
                     /gene="TPHA0C02830"
                     /locus_tag="TPHA_0C02830"
                     /inference="similar to DNA sequence:INSDC:YDR063W"
                     /note="similar to Saccharomyces cerevisiae YDR063W;
                     ancestral locus Anc_8.178"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684870.1"
                     /db_xref="GeneID:11533809"
                     /db_xref="GOA:G8BRR0"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR011171"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:G8BRR0"
                     /translation="MSTLTHIGSATKETIRKFRTSTSRTEVIKALSIKIASKPSYEIV
                     IEEEETEELDEIDSLNELADILPDNSPRYVLMAYPLTTREGIKQAPLILLFWKPPTVV
                     SQEWKMLYANSLELIRHECGINKLIEVTNGLEDEDQVEELIEEIEK"
     gene            <616530..>617876
                     /gene="TPHA0C02840"
                     /locus_tag="TPHA_0C02840"
                     /db_xref="GeneID:11533604"
     mRNA            <616530..>617876
                     /gene="TPHA0C02840"
                     /locus_tag="TPHA_0C02840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684823.1"
                     /db_xref="GeneID:11533604"
     CDS             616530..617876
                     /gene="TPHA0C02840"
                     /locus_tag="TPHA_0C02840"
                     /inference="similar to DNA sequence:INSDC:YER136W"
                     /note="similar to Saccharomyces cerevisiae GDI1 (YER136W);
                     ancestral locus Anc_8.175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684871.1"
                     /db_xref="GeneID:11533604"
                     /db_xref="GOA:G8BRR1"
                     /db_xref="InterPro:IPR000806"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018203"
                     /db_xref="UniProtKB/TrEMBL:G8BRR1"
                     /translation="MSQSDLDTDYDVIILGTGLTECILSGLLSVDGKKILHIDRQDHY
                     GGEAASASLSQLFNKFKQKPMSDADREAKFGKDRDWNVDLIPKFLMANGELTNILVHT
                     NVTSYLDFKQVSGSYVFKNGKIYKVPSNEMEAITSPLMGIFEKRRMKKFLEWISNYND
                     DDNSTHQGLDLDKNTMDEVFYKFGLGNATKEFIGHAMALWTNDDYIQEPARPTFERIL
                     LYCKSVAKYGKSPYLYPMYGLGELPQGFARLSAIYGGTYMLDTPIEEIMYTADDKFKS
                     IKTKLGEFRAPVVIADPTYFPEKCKSTGKRVIRAICILEHSVPGTGDADSLQIIIPQS
                     QVGRSNDIYIAVVSDSHNVCSKGRYIAIISTIVETDKPHIELEPALKLLGPIAEKFMG
                     IAELFEPKEDGFKDNIFLSKSYDASSHFETTTDDVKDIYFRVTGHPLMLKTRELQE"
     gene            <618333..>618779
                     /gene="TPHA0C02850"
                     /locus_tag="TPHA_0C02850"
                     /db_xref="GeneID:11533637"
     mRNA            join(<618333..618386,618546..>618779)
                     /gene="TPHA0C02850"
                     /locus_tag="TPHA_0C02850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684824.1"
                     /db_xref="GeneID:11533637"
     CDS             join(618333..618386,618546..618779)
                     /gene="TPHA0C02850"
                     /locus_tag="TPHA_0C02850"
                     /inference="similar to DNA sequence:INSDC:YBL026W"
                     /note="similar to Saccharomyces cerevisiae LSM2 (YBL026W);
                     ancestral locus Anc_8.174"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684872.1"
                     /db_xref="GeneID:11533637"
                     /db_xref="GOA:G8BRR2"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR016654"
                     /db_xref="UniProtKB/TrEMBL:G8BRR2"
                     /translation="MLFFSFFKTLVDQEVTVELKNDIELKGTLKSVDQFLNLKLDNIS
                     CNDKTKYPHLTSVRNIFIRGSNVRYVYLQKNMVDTNLLQDAARREAMSDKR"
     gene            <620162..>620584
                     /gene="TPHA0C02860"
                     /locus_tag="TPHA_0C02860"
                     /db_xref="GeneID:11533961"
     mRNA            <620162..>620584
                     /gene="TPHA0C02860"
                     /locus_tag="TPHA_0C02860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684825.1"
                     /db_xref="GeneID:11533961"
     CDS             620162..620584
                     /gene="TPHA0C02860"
                     /locus_tag="TPHA_0C02860"
                     /inference="similar to DNA sequence:INSDC:YBL025W"
                     /note="similar to Saccharomyces cerevisiae RRN10
                     (YBL025W); ancestral locus Anc_8.172"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684873.1"
                     /db_xref="GeneID:11533961"
                     /db_xref="InterPro:IPR022793"
                     /db_xref="UniProtKB/TrEMBL:G8BRR3"
                     /translation="MDRNVYEACSDLIKRYKSYTAGPDEVLAEKLDHLVPIPFLTREE
                     LEKVASNDRDQGLYTGELIPSIDLRVLHYYATQLCLKKYPHLLNKFDDSSLISLGLLV
                     EKWVKDFLVARQDRTKINPGVSQMLSKIVNYEEDPANI"
     gene            <620913..>622937
                     /gene="TPHA0C02870"
                     /locus_tag="TPHA_0C02870"
                     /db_xref="GeneID:11535197"
     mRNA            <620913..>622937
                     /gene="TPHA0C02870"
                     /locus_tag="TPHA_0C02870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684826.1"
                     /db_xref="GeneID:11535197"
     CDS             620913..622937
                     /gene="TPHA0C02870"
                     /locus_tag="TPHA_0C02870"
                     /inference="similar to DNA sequence:INSDC:YBL024W"
                     /note="similar to Saccharomyces cerevisiae NCL1 (YBL024W);
                     ancestral locus Anc_8.171"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684874.1"
                     /db_xref="GeneID:11535197"
                     /db_xref="GOA:G8BRR4"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023270"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BRR4"
                     /translation="MARKKNFRGKQKTFGARDDSNAQKNWSELVRDNEQWGLYYKKLN
                     IIPEDQWEEFKKACQAPLPLTFRVTGSRNHAQEVLQLFKERHLPNLTDVEFEGEKIKS
                     PMELPWYPNHLAWQLDVPKTVIRKHEQFAKTQRFLVVETAVGNISRQEAVSMIPPILL
                     EVESNHTVLDMCAAPGSKTAQLIEALHTNEDEPTGIVVANDADARRSHMLVHQLKRLN
                     SANLMVVNHDAQFFPRIALHENTTDSNDFLKFDRILCDVPCSGDGTMRKNVNVWRDWT
                     SQGGLGLHNIQLNILNRGLHLLKPKGRLVYSTCSMNPIENEAVIAAALRKWGSKIRVI
                     NCDEKLPGLVRSKGIDSWPVFNRDMEIRQKGDQGVSNTWFPPSEEEKSQFNLQNCIRV
                     YPHQQNTGAFFITVIEKLEEFDVVPPKSEEPALKKVKRSTEEELEKKEKLPRDANEEP
                     FVFIDPEHATLKNCWKFYGIDDKFDKRTCLVRNATGEPTRVIYTVSPFLRDIVQANGD
                     ILKIIYSGVKLFVSQRSDIECAWRIQSEALPIMKHHMNSDRVVPANMPLLKHLLMESF
                     PSFDDISAKKLDDEYVSRMDKLSSGCCFIEIEREGEDKESLFLPVWKGNKCMNLMVCK
                     EDAHELLYRLFGVETKSSDNPKAKAQAERLAKINAEKAAAAKAEKSTSDN"
     gene            <623723..>624778
                     /gene="TPHA0C02880"
                     /locus_tag="TPHA_0C02880"
                     /db_xref="GeneID:11533476"
     mRNA            <623723..>624778
                     /gene="TPHA0C02880"
                     /locus_tag="TPHA_0C02880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684827.1"
                     /db_xref="GeneID:11533476"
     CDS             623723..624778
                     /gene="TPHA0C02880"
                     /locus_tag="TPHA_0C02880"
                     /inference="similar to DNA sequence:INSDC:YBL016W"
                     /note="similar to Saccharomyces cerevisiae FUS3 (YBL016W);
                     ancestral locus Anc_8.162"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684875.1"
                     /db_xref="GeneID:11533476"
                     /db_xref="GOA:G8BRR5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008349"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BRR5"
                     /translation="MGKKIVFNISSEFQLKSLLGEGAYGIVCSATHKPTGETVAIKKI
                     EPFDKPLFALRTLREIKLLKHFQHENIISLFDLQKPDSFENFNEVYIIQELMQTDLHR
                     VISTQQLSDDHLQYFIYQTLRAVKILHSCNVIHRDLKPSNLLINSNCDLKVCDLGLAR
                     IGKDNDSDGDEQDTSAMTEYVATRWYRAPEVMLTAAKYTKAMDIWSCGCILAELFLKR
                     PIFPGKDYRHQLMLIFGFVGTPDEEGLQCIESQRARQYIASLPSYDPVNVEEVFKGVN
                     PLGIDLLQKMLVFDPAKRITAEEALNHPYLDVYHDPNDEPDGEPIPLNFFEFDKYKST
                     LTTKDLKNLLWQEIFSS"
     gene            <626566..>628146
                     /gene="TPHA0C02890"
                     /locus_tag="TPHA_0C02890"
                     /db_xref="GeneID:11533665"
     mRNA            <626566..>628146
                     /gene="TPHA0C02890"
                     /locus_tag="TPHA_0C02890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684828.1"
                     /db_xref="GeneID:11533665"
     CDS             626566..628146
                     /gene="TPHA0C02890"
                     /locus_tag="TPHA_0C02890"
                     /inference="similar to DNA sequence:INSDC:YBL015W"
                     /note="similar to Saccharomyces cerevisiae ACH1 (YBL015W);
                     ancestral locus Anc_8.161"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684876.1"
                     /db_xref="GeneID:11533665"
                     /db_xref="GOA:G8BRR6"
                     /db_xref="InterPro:IPR003702"
                     /db_xref="InterPro:IPR026888"
                     /db_xref="UniProtKB/TrEMBL:G8BRR6"
                     /translation="MSVSQLLKQRVRYLPYLDKVKTADELIPLFKNGMYIGWSGFTGV
                     GAPKAVPEALSDHVEKNNLQGKLRFNLFVGASAGPEEFRWADNDMIIKRAPHQVGKPI
                     SKAINDGRMLFFDKHLSMFPQDLTYGFYSRDRSDGKILDYSIVEATAIKEDGSIVPGP
                     AVGGSPEFLSVSDKIIIEVNTKTPSFEGIHDIDMPVLPPYRKPYPYCKVDEKSGVNSI
                     PVDPKRVVAIVETHKTDKVPPNTPSDDMSRAIAGYLVEFFRNEVKHGRLPENLLPLQS
                     GIGNVANAVIEGLADANFKHLNVWTEVLQDSFLDLFQNGTLDYATATSIRLTEDGFNR
                     VFNDWDNFMTKMCLRSQVVSNNPEIIRRLGVIAMNTPVEVDIYAHANSTNVNGSRMLN
                     GLGGSADFLRNAKLSIMHAPSARPTKTDPTGISTIVPMASHVDQTEHDLDILVTDQGL
                     ADLRGLAPRERAREIIDNCAHPDYRDLLHDYLQRSEHYAAKHSCLHEPHMLKNALKFH
                     INLSEKGTMKVDSWDPVD"
     gene            complement(628342..628415)
                     /gene="TPHA0Ctrna3I"
                     /locus_tag="TPHA_0Ctrna3I"
                     /db_xref="GeneID:11535250"
     tRNA            complement(628342..628415)
                     /gene="TPHA0Ctrna3I"
                     /locus_tag="TPHA_0Ctrna3I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:11535250"
     gene            <630971..>635239
                     /gene="TPHA0C02900"
                     /locus_tag="TPHA_0C02900"
                     /db_xref="GeneID:11533493"
     mRNA            <630971..>635239
                     /gene="TPHA0C02900"
                     /locus_tag="TPHA_0C02900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684829.1"
                     /db_xref="GeneID:11533493"
     CDS             630971..635239
                     /gene="TPHA0C02900"
                     /locus_tag="TPHA_0C02900"
                     /inference="similar to DNA sequence:INSDC:YNL088W"
                     /note="similar to Saccharomyces cerevisiae TOP2 (YNL088W);
                     ancestral locus Anc_2.201"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684877.1"
                     /db_xref="GeneID:11533493"
                     /db_xref="GOA:G8BRR7"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002205"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR013506"
                     /db_xref="InterPro:IPR013757"
                     /db_xref="InterPro:IPR013758"
                     /db_xref="InterPro:IPR013759"
                     /db_xref="InterPro:IPR013760"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018522"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR024946"
                     /db_xref="UniProtKB/TrEMBL:G8BRR7"
                     /translation="MAVQQKSASERYQKISQLEHILKRPDTYIGSVEIQEQEQWIYDN
                     ELDCMIEKPVNIVPGLFKIFDEILVNAADNKVRDKNMKRIDVDINAEENTISVRNDGR
                     GIPVEIHEKEQIYIPELIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFILET
                     ADSKHAKKYVQKWENNMTTCHPPTITTYKKGPSYTKVTFKPDLKRFNMEKLDDDILGV
                     MRRRVYDINGSVRDINVYLNGNHLKIKTFKNYIELYLKSLEKKRQIDNGEDASVQANI
                     PTILYERINDRWEVGFAASDISFQQVSFVNSIATTTGGTHVNYIADQIVRKVGEVLKK
                     KKNNKKNVKPFQIKNNMFIFINALVENPAFTSQTKEQLTTRVKDFGSRCEVGADFITK
                     IMKTDFATKIYEIADANDTNALKKSDGSRKSRITEYPKLEDANKAGTKEGYKCTLILT
                     EGDSALSLAVAGLAVVGRDYYGCYPLRGKMLNVREASADQILKNAEIQAIKKIMGLQH
                     KKKYEDASSLRYGHLMIMTDQDHDGSHIKGLIINFLESSFPGLLDIPEFLVEFITPII
                     KVTITKPHREQISFYNMPDYERWREEESQKYTWKQKYYKGLGTSSGQEVREYFADLDT
                     HLKKFHALEGNDKDLIELAFSKKKADDRKEWLRLYEPGTVLDPTLKEIPISDFINKEL
                     ILFSLADNIRSIPSVLDGLKPGQRKVMYGCFKRNLVSEIKVAQLAPYVSECTAYHHGE
                     QSLAQTIISLAQNFVGASNIYLLKPNGAFGTRATGGKDAAAARYIYTQLSKITRKIFH
                     PSDDTLYKYVQEDEKTVEPEWYLPILPMVLVNGTEGIGTGWSTSIPPFNPKDIIKNLK
                     HLMNGEEMEEMHPWFRGWTGSLERIDPQRYRLFGKIEQTGPTTLEITELPARVWTSTI
                     KEYLLLGLSGNDKTKAWIKDMEEQHSDAIKFIIKLTPEEMSKTRKIGFYDRFKLVSSI
                     SLNNMVAFDPHGKIKKYETPQEILQEFYYVRLEYYQKRKDYMCERLQWVLEKISYQVK
                     FIKMIIDRELIVTNKPKKLVIKELTELGFPRINKIGKPFYGEIKEESEEGIEDVSDEE
                     SDQNGNDDSLVNGPEEQYGNYDYLLGMKIWSLTKERYEKLSQQKKEKEIELEELLKLS
                     AQDLWVIDLDAFDEAYETFMADDAFARNDDKSGKGKRKRGGDDDEYSPKGKAKKTKKL
                     SKIKIEDQNFKRKLLAPSSNVKAKKVVPKIKSESSVEPSATPIVADGETPTINIKSED
                     ANTNEGNVLTTVPISSDVTTAVSSTLFDENKSSEDKSNDNDNDSLKLSTFSSKFKKLS
                     EDFDNVKSEALKSEITKPVVTAAKKNRTKATITITDDEEESGESNIDSDVDDDIPLKP
                     RTKRAARATTTAKKSYTETVDLSDDSFVEEEEEDIGSDESFNDE"
     gene            <636120..>639743
                     /gene="TPHA0C02910"
                     /locus_tag="TPHA_0C02910"
                     /db_xref="GeneID:11533632"
     mRNA            <636120..>639743
                     /gene="TPHA0C02910"
                     /locus_tag="TPHA_0C02910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684830.1"
                     /db_xref="GeneID:11533632"
     CDS             636120..639743
                     /gene="TPHA0C02910"
                     /locus_tag="TPHA_0C02910"
                     /inference="similar to DNA sequence:INSDC:YNL087W,YOR086C"
                     /note="similar to Saccharomyces cerevisiae TCB2 (YNL087W)
                     and TCB1 (YOR086C); ancestral locus Anc_2.202"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684878.1"
                     /db_xref="GeneID:11533632"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR017147"
                     /db_xref="UniProtKB/TrEMBL:G8BRR8"
                     /translation="MTTVANPTNIDISDNTDGIEDIVKQIKNSSSDSVLKNGQKDNSP
                     PSGLSRTKTSINISEEKVANISASEEKGSRQRKEASYVGWKQIGGWEESDALTAEDEL
                     LDLNKETPLDNFIPDKFYGDWYHSVAIFAIGGILSFTIGYFKLPLSITFFVIIVSSVF
                     YRISVKTYRASIRDLVQREFTVQNIDDDYESMEWVNNFLDKFWPKIEPNVSQMVVAQV
                     NDLLATNEQIPAFIKALWIDQFTLGVKPPRIDLVKTFQNTDNDVVVMDWGVSFTPHDL
                     TDLNAKQMKNFINQKCVIKAKLFGLTLPVSVSDIAFKATARISLKLMTPFPHVETANV
                     QLLEVPDIDFYALLFGDSIFNTEVLAIPGLMTMIQKMAKKYMAPMLLPPFSLQFNIPQ
                     LLSGSALSIGVLEVTVKNAKNIRRASTLVGDSIDPYLMFEINGKKTGKTRIVRDTLNP
                     VWNETLYILLGTFTDPLSITLWDKREKLKDKVLGRIEYNLNSLHDAHFQRNINVNFLR
                     NSRSVGELNLDLHFYPTLTPKVLPDGTEEGSPDLNTGISKIVIEEAYGLDKPGNKVCA
                     YVEVYSAGELLFSTDKAEGIDVIKWNKSYESVIMDRRKTKYKIVVKNSKNGEVISSTL
                     QSLNDLIDRTEIDRKRIPLNNCKGQLKITVYWKPVAMDLGSSAIAYTPPIGVVRIFIN
                     KAWDLKNLETIGKIDPYVNVLVNGVPKGRTPEIEQTLSPVWNTAIYVAVTSPNQRITL
                     DCMDVETADTDRSVGKVDLKVLDLFQKDENDKYMKIINDEPITSRLITKKGIKGSIRY
                     STSFYPALPVLTLEEIEDLDQIKEKKKKLLEKKFLTDEAQMTAEQKEKFKNQENAIQD
                     MEEMYGNKEQLDLSQLISYNSGVLSISVLDGELPIPGLYVQAFFDANGYARFTSPKIS
                     TRTIKTGWTGDVMIKELEWSITTLRVTKHKNNNKVEECLCEVTIPTIELVKNCFYRPS
                     FLNLAGAHTAKLMIQTSWFPIDTDTLPESDLIVNTGDLTITVKGAENLISADNNGFSD
                     PYVKLYLNDEEDCFFKSKTQKKQLNPTWNETTTIVLDNRVNEKLRIKVMDWDAGNFND
                     LIGTGVISLSDVKPSGVTNMDVPITDPDGGDGGVLHLSFEFDPKYALTIKKKETKVGD
                     FASKSLGTGLRVGTTVVGAGLGTGLKAGSTVVDTFGSVGKFGIGLFGKKKNKHDASFE
                     PEV"
     gene            complement(<639897..>640955)
                     /gene="TPHA0C02920"
                     /locus_tag="TPHA_0C02920"
                     /db_xref="GeneID:11535235"
     mRNA            complement(<639897..>640955)
                     /gene="TPHA0C02920"
                     /locus_tag="TPHA_0C02920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684831.1"
                     /db_xref="GeneID:11535235"
     CDS             complement(639897..640955)
                     /gene="TPHA0C02920"
                     /locus_tag="TPHA_0C02920"
                     /inference="similar to DNA sequence:INSDC:YOR085W"
                     /note="similar to Saccharomyces cerevisiae OST3 (YOR085W);
                     ancestral locus Anc_2.204"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684879.1"
                     /db_xref="GeneID:11535235"
                     /db_xref="InterPro:IPR006844"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR021149"
                     /db_xref="UniProtKB/TrEMBL:G8BRR9"
                     /translation="MKLSASVIQYAVICLSVLTYSVYGLSNSELAKLALESPNHIIQL
                     NDQNKEQLLNTQREGYVVVLFTATDPKVKCKICREFESEYIHFVKSWYKDHPNGQSNE
                     DKSKSLFFFEVNIRNVRSMPDLIKYYKIEDVPRFILFRPDGLMDDFEKFTIQTTNTEV
                     RINDLLTKIKTATQIYDIKYYEPTDYSSLLWTVFMTFTVVFIIKRYRNFIYSVFHSNV
                     SKAALLTSFIILMISGYMFNTIKNPRYAGVNKEGDIMYFIPGQLQAQFAIESQIVALL
                     YVSFTIVLVTLVAGQKPLKEFLKGEKHASKIITVLMPITLSFAFYVFVAGFTSIYKVK
                     QSSYPFQVAKLSSLFRRK"
     gene            <642332..>644833
                     /gene="TPHA0C02930"
                     /locus_tag="TPHA_0C02930"
                     /db_xref="GeneID:11535293"
     mRNA            <642332..>644833
                     /gene="TPHA0C02930"
                     /locus_tag="TPHA_0C02930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684832.1"
                     /db_xref="GeneID:11535293"
     CDS             642332..644833
                     /gene="TPHA0C02930"
                     /locus_tag="TPHA_0C02930"
                     /inference="similar to DNA sequence:INSDC:YNL085W"
                     /note="similar to Saccharomyces cerevisiae MKT1 (YNL085W);
                     ancestral locus Anc_2.205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684880.1"
                     /db_xref="GeneID:11535293"
                     /db_xref="GOA:G8BRS0"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR022039"
                     /db_xref="InterPro:IPR022040"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:G8BRS0"
                     /translation="MPIKTLESYLFERGLVGSYPIDILKNATIGIDVNHYLSRIINNK
                     KNNQLTDAIGEFLPNNLNHFLENDLKIFEENKITPIFVFNGLLTVNQAEYHHSNARFN
                     EGAVNNLEDINTNIFFNKFKISNHRDKAWRSYEYSVKKNQETYIDQPVVPHLSENFNY
                     ANNINFSTNLKNYLIRFFIERKISYQVAPYSSWLQLSYLYDSEFIDIIYGPTDCLMLP
                     NMEKFIIGMEFLNKEFRFIDKTKILKDLDLTNDEFVDIAMVLGNDLQPLTLPPLNTIN
                     LPTNKMPNSSNNGSNINTNAIVDMAIDMVYNTGTNFYVYQLNNLLQDNNKKNLQFYQR
                     GYSSLKNMPVLQANGKVQLYSSESVLNARDLDKKKNKSTETGSKQITADKQLTTQYEI
                     PNDVYDFIGQQLPAEYYFYQSIGLLDTKLLETLTSGFYYEDIPFSGVPTKSYKQLIKK
                     SAEVFKDLEIGLLTSPINRYYQIKTIKAIIYNNVSGENPDEIQLTNKVTPPTFDKINK
                     IVVKTKTNQQFTIKSFVKLLSNSKDLTKDFTSEIVLFPNTVSSEDKLNVAFDLLATNL
                     LRTLCLLGIFEYDVKAKSLEPTKWGKLLLNFPHLNITETNYSALLVLMIFIKLNVLPF
                     TDSLETTAVSTLSNATLRSYPVESSYIDILSRLLTLYQIGLENSSNDSSNNSNYHGPI
                     DRSSLIVKDHFDYINNNLKELFQSVLVASLASGEFNRLSLKGNTAWQSEIIARLPFNE
                     ENTNTIMSMMWEYFLQKYLHNGNTKTDALAFVSTEFKTLKITTEIDEKFNDSLKFLKE
                     VLVLSKELNESNLMNSKEYEIIGKSLEFAEKALSS"
     gene            complement(<645053..>646216)
                     /gene="TPHA0C02940"
                     /locus_tag="TPHA_0C02940"
                     /db_xref="GeneID:11533812"
     mRNA            complement(<645053..>646216)
                     /gene="TPHA0C02940"
                     /locus_tag="TPHA_0C02940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684833.1"
                     /db_xref="GeneID:11533812"
     CDS             complement(645053..646216)
                     /gene="TPHA0C02940"
                     /locus_tag="TPHA_0C02940"
                     /inference="similar to DNA sequence:INSDC:YNL084C"
                     /note="similar to Saccharomyces cerevisiae END3 (YNL084C);
                     ancestral locus Anc_2.207"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684881.1"
                     /db_xref="GeneID:11533812"
                     /db_xref="GOA:G8BRS1"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR025604"
                     /db_xref="UniProtKB/TrEMBL:G8BRS1"
                     /translation="MPKLEQFEIKKYWQIFTGLKPVDNKVDHDQVLPMLYNSKLDSSI
                     LNQIWFLADIDDDDNLDFEEFVICMRLIFDLVNKNISSVPDELPDWLVPGSKAKLVKE
                     RKKLKQEENIELPKANDLPQIDWYISPEDKTFYDNLISSIQMNTDGTYTLQSISDALK
                     NKFFNIGTSDINKAWTLVNPSSSASINKDPALYFIHILRQRNDVGALIPSEYPTNLES
                     VINKKQIDYNISSSQNDLTRSSAIKTPARVQTSASSNNTTLQRTNDITINNNREAITL
                     NEIPRGNPNDINSLEKELQLLDIELMRVKEEVSKQTNTTQIKAQLQELLNYKELQYQR
                     NLNNKTPKTPTNLNSVRDDLSNLESQVDILESYLSDKKSELDQLNQQIQSHNQ"
     gene            complement(<646888..>647253)
                     /gene="TPHA0C02950"
                     /locus_tag="TPHA_0C02950"
                     /db_xref="GeneID:11535249"
     mRNA            complement(<646888..>647253)
                     /gene="TPHA0C02950"
                     /locus_tag="TPHA_0C02950"
                     /product="putative mitochondrial 37S ribosomal protein
                     SWS2"
                     /transcript_id="XM_003684834.1"
                     /db_xref="GeneID:11535249"
     CDS             complement(646888..647253)
                     /gene="TPHA0C02950"
                     /locus_tag="TPHA_0C02950"
                     /inference="similar to DNA sequence:INSDC:YNL081C"
                     /note="similar to Saccharomyces cerevisiae SWS2 (YNL081C);
                     ancestral locus Anc_2.213"
                     /codon_start=1
                     /product="putative mitochondrial 37S ribosomal protein
                     SWS2"
                     /protein_id="XP_003684882.1"
                     /db_xref="GeneID:11535249"
                     /db_xref="GOA:G8BRS2"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="InterPro:IPR010979"
                     /db_xref="InterPro:IPR027437"
                     /db_xref="UniProtKB/TrEMBL:G8BRS2"
                     /translation="MVVHILGKAFKGKEVIKIALASKFYGIGTKTSEKLCSKLGFYPW
                     MRMHQLSEPQVMSITSELSNMTIEGDARAVVKDNIQRLKKIGSYRGMRHTLGLPARGQ
                     NTRNNAKTARKLNKIDRRG"
     gene            complement(<647899..>648384)
                     /gene="TPHA0C02960"
                     /locus_tag="TPHA_0C02960"
                     /db_xref="GeneID:11533601"
     mRNA            complement(<647899..>648384)
                     /gene="TPHA0C02960"
                     /locus_tag="TPHA_0C02960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684835.1"
                     /db_xref="GeneID:11533601"
     CDS             complement(647899..648384)
                     /gene="TPHA0C02960"
                     /locus_tag="TPHA_0C02960"
                     /inference="similar to DNA sequence:INSDC:YIL138C,YNL079C"
                     /note="similar to Saccharomyces cerevisiae TPM2 (YIL138C)
                     and TPM1 (YNL079C); ancestral locus Anc_2.215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684883.1"
                     /db_xref="GeneID:11533601"
                     /db_xref="InterPro:IPR000533"
                     /db_xref="UniProtKB/TrEMBL:G8BRS3"
                     /translation="MDKVREKLSNLKLEAEQWQEKYEELKEQYKVIEQDNTDKENEIK
                     SLSTKNENLEAELETLENKLTDSKQVLEDSDNLKSNNETFLKKNQQLEEELEESDSKL
                     KEAIEKLRETDLKSEQLERKVAALEEERDDWERKHEELSEKYEQAKKELDEFAASLEN
                     L"
     gene            complement(<649245..>652091)
                     /gene="TPHA0C02970"
                     /locus_tag="TPHA_0C02970"
                     /db_xref="GeneID:11533968"
     mRNA            complement(<649245..>652091)
                     /gene="TPHA0C02970"
                     /locus_tag="TPHA_0C02970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684836.1"
                     /db_xref="GeneID:11533968"
     CDS             complement(649245..652091)
                     /gene="TPHA0C02970"
                     /locus_tag="TPHA_0C02970"
                     /inference="similar to DNA sequence:INSDC:YIL137C"
                     /note="similar to Saccharomyces cerevisiae TMA108
                     (YIL137C); ancestral locus Anc_2.217"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684884.1"
                     /db_xref="GeneID:11533968"
                     /db_xref="GOA:G8BRS4"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR024571"
                     /db_xref="UniProtKB/TrEMBL:G8BRS4"
                     /translation="MSVQAITNGMSLLTLDNPVLPSHYEIKLNLEPNSVTAKSSIKIT
                     MSKNDKMVASAKEDLKQFRLHSKDLKIANAFIVDEDSNKKLLLKWKEDVNTNLLTLNS
                     EEAIPFKDNHFFLHIEYDATVKIIKTHEDKTYGIFKTNFMKQSSESSIADNVIISTHC
                     QPSYAKTIFPCVDEPSIKTSFQLTLETPSQFKTISNTGIKSEEKLKSGRTVTTFKTTP
                     LMSTSVFGFAAGDFDFIKSEVEMPISKKKIPLCVYAPDNIDFTVFTLDTIQKYLPLLE
                     NYFNKEYPLDKLDFVLLPFLSDMAMENFGMVSILMNHLTLPPQALANDNIREQCQQLI
                     VHELVHQWFGNFITYESWEYLWFNESFATWLASVLLTETGDSPSYWTSNAYLQQHMYI
                     TMENEISNPSILSIIEQSKRSMNSEIIETSDVFNAHSYAKGIAILRSLQLTIGDELLK
                     KGIQTFINDEKNHTHSIKPMDMWTQVGSTLKSANIANYFASWSRLQGVPIVHVEVETD
                     GNNEISYKLTQHRYYHGEQDEIEDIPYHIPLFILNEDGSEDRNNVLFTDRTLIINGKK
                     DLVLLNHNGQGYYKVSYESETLYDSICKQLLANKLNGVDLFTIMKDIKSFIGDEKYQK
                     PIHFDGLFKILRTLCSPEIQLDETSVYWYGLNVGLDIIQKIDRYERTFKNVSMDKISQ
                     TLTSEIFIPFMNKIDWPKDFSKIKENVSTEQLECMSQIMFLNRQHGTIIKKCDTYFQK
                     MLNGPKQCIPIELVNSILTVYCSNMTSLKQWKKLINVMDETSESNKEILQHLIENSDN
                     LNKYEINFQFIKNSILENIGFTSKEELMERNLRYINEHIGSMNIEYILIGINYNSNGG
                     DGDANEKNIKSIEEWYLTNLPNWIKIGMKLKNTIKNISLIVFQIVNNKKSFVDKLTRF
                     KGNSLGIDFISYYSLATAEINSQKLIIEDLNKVL"
     gene            <652607..>654271
                     /gene="TPHA0C02980"
                     /locus_tag="TPHA_0C02980"
                     /db_xref="GeneID:11533644"
     mRNA            <652607..>654271
                     /gene="TPHA0C02980"
                     /locus_tag="TPHA_0C02980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684837.1"
                     /db_xref="GeneID:11533644"
     CDS             652607..654271
                     /gene="TPHA0C02980"
                     /locus_tag="TPHA_0C02980"
                     /inference="similar to DNA sequence:INSDC:YNL077W"
                     /note="similar to Saccharomyces cerevisiae APJ1 (YNL077W);
                     ancestral locus Anc_2.218"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684885.1"
                     /db_xref="GeneID:11533644"
                     /db_xref="GOA:G8BRS5"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="UniProtKB/TrEMBL:G8BRS5"
                     /translation="MVASTQLYDILQVRYDSDESVIKKAYRTLALKYHPDKNNLSEES
                     KQMFQKISEAYVVLSNKDKRQMYDKYGTVDPLEIETIIAKQEQKKQNLQQQRGNRVVN
                     IFDADPFFHDSMGMGMNMGMNMGMNMGMNGFGNLGGFGNINMGSFSAGDLFSQFFDNT
                     NKSAQKFNQFPSQGAFNTNNKENVSKTNNNNNMDNGFTSFSNRPTGDAFFNSNINSLN
                     KCISDDKNLKRGPDIKHTLKCTLSNLYSGKRSKLRLERTRCCLKCKGFGSLNIKSCSK
                     CNGRGSLTQTKKFGPMTQTFTQTCDGCGGNGTFADAQDICNECQGEGFLNEKKIFEVE
                     ITPGMTDGQLIILTGEADEVISTNLGKERVIPGDIILTINLLPDPTFKVVQGADLLYA
                     NYKINLLTSLCGGSIYIKNHPSEHLIKINIIPGELIKNGAIKTVENLGMPKIDLSVGH
                     SNDIQANKPTLKGNLVIHFEIVYPDMLETDTVIELQNILNNDKYIQNQITEEEADNKV
                     DLEDLVEYEEHVFNNFATEYSNLDDVLGKKNPSSEFNENNKRPKTE"
     gene            complement(<654523..>655731)
                     /gene="TPHA0C02990"
                     /locus_tag="TPHA_0C02990"
                     /db_xref="GeneID:11533598"
     mRNA            complement(<654523..>655731)
                     /gene="TPHA0C02990"
                     /locus_tag="TPHA_0C02990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684838.1"
                     /db_xref="GeneID:11533598"
     CDS             complement(654523..655731)
                     /gene="TPHA0C02990"
                     /locus_tag="TPHA_0C02990"
                     /inference="similar to DNA sequence:INSDC:YIL135C,YNL074C"
                     /note="similar to Saccharomyces cerevisiae VHS2 (YIL135C)
                     and MLF3 (YNL074C); ancestral locus Anc_2.222"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684886.1"
                     /db_xref="GeneID:11533598"
                     /db_xref="UniProtKB/TrEMBL:G8BRS6"
                     /translation="MEVELGLSKQQSMEQPIAVHNVNNSMIFERHVEEQVHILNSNSP
                     IVHRSSSALNLPNADENDEAISFTDSNLLRSRQNSFASINARKYSNGNLSLLRVPSNY
                     STSSVSSTVTNSNTNNISSTPHHHRHLENFVPPMLDAGCSMVNDAKTNLNDIDMLVPE
                     RPSSTLGLELALGRSRSYSSNNIFQTSNSNSMEQSFMEQNIPSKHNNNSDNRENVQNP
                     LSRSYSYNLSSNRDSRTSIPSLQTRSETSEASLNSSNLSNNLRSPLGSPETGSRVLSC
                     YSYADVLLDEITDNTNKSLQSHPSQVQLQRNLSTPFIVRRDSNSSLNKRILTNTSRSP
                     TNSANPSSSFIGLNQIRSPRSNITNANINMNNPLINTNNLRQFSSKFQIGEDDNISDY
                     DGLVKFSDGI"
     gene            complement(<656929..>657402)
                     /gene="TPHA0C03000"
                     /locus_tag="TPHA_0C03000"
                     /db_xref="GeneID:11533756"
     mRNA            complement(<656929..>657402)
                     /gene="TPHA0C03000"
                     /locus_tag="TPHA_0C03000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684839.1"
                     /db_xref="GeneID:11533756"
     CDS             complement(656929..657402)
                     /gene="TPHA0C03000"
                     /locus_tag="TPHA_0C03000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684887.1"
                     /db_xref="GeneID:11533756"
                     /db_xref="UniProtKB/TrEMBL:G8BRS7"
                     /translation="MYAVLSGLYLHIYIGRSFHRISLLQRKVVPFAIVYFVVRSSRRI
                     NTNLPLFFFLFSLSLLCSCCNNESRRLLPTYFTLTIVREAYIIENYWKPRFLFLVVDF
                     EQFQVNNTVQNAHVYRYFSNARQFFSLDPLSSIFFFLLICSAQRRGLLCAVLIHA"
     gene            <658399..>660078
                     /gene="TPHA0C03010"
                     /locus_tag="TPHA_0C03010"
                     /db_xref="GeneID:11533457"
     mRNA            <658399..>660078
                     /gene="TPHA0C03010"
                     /locus_tag="TPHA_0C03010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684840.1"
                     /db_xref="GeneID:11533457"
     CDS             658399..660078
                     /gene="TPHA0C03010"
                     /locus_tag="TPHA_0C03010"
                     /inference="similar to DNA sequence:INSDC:YNL073W"
                     /note="similar to Saccharomyces cerevisiae MSK1 (YNL073W);
                     ancestral locus Anc_2.223"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684888.1"
                     /db_xref="GeneID:11533457"
                     /db_xref="GOA:G8BRS8"
                     /db_xref="InterPro:IPR002313"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018149"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:G8BRS8"
                     /translation="MLKLSSINRMATLTRFYSLKSKKIILDASNLEFTKRNEIILKNL
                     HKYYPSISRLDNDNSVDAYQKISIKKFNETYSNLDNDNSEVKLSIYGRIKKIRFSGKK
                     ICFIDLINNYNKQLQLIVNYNNIQNINNEQEFYEVLHFLKNGDYIQSFGFPGLSQSKF
                     KTLSLKCNRLPIIISPAQLPLPPKLNDHNKIKNNRVIDYQVNGISTIILRSFINKQIR
                     KFLDERDFVEVETPILSRQSNGAIAKPFVTKLSSSIENGKEKLLQLRIAPELWLKRLV
                     VGGIDRVYEIGKVFRNEGIDQTHNPEFTTLEFYQSYASMEDLIKQAEQLFKYIITSLH
                     ESEIVKESVRCKEIVDSLYNTLSENDWRFNRIDFLPTLTKEFNNEINFNEIDLNDPTA
                     ILDCLPEHVKAELFQGVSQNKLSPQQILNKLCSHFIEKKYCNNLLPTLICNHPTVMSP
                     LSKTDAMKGNVSKRFELFINGTEFINAYEEENCPQLQEQKFLQQKNSSDCYGDEEALP
                     IDNNYIESMKWGMPPIGGLGLGIDRLCMLLLHKTRIEEVLSFGTLSDVNRQ"
     gene            <660407..>661333
                     /gene="TPHA0C03020"
                     /locus_tag="TPHA_0C03020"
                     /db_xref="GeneID:11533929"
     mRNA            <660407..>661333
                     /gene="TPHA0C03020"
                     /locus_tag="TPHA_0C03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684841.1"
                     /db_xref="GeneID:11533929"
     CDS             660407..661333
                     /gene="TPHA0C03020"
                     /locus_tag="TPHA_0C03020"
                     /inference="similar to DNA sequence:INSDC:YNL072W"
                     /note="similar to Saccharomyces cerevisiae RNH201
                     (YNL072W); ancestral locus Anc_2.224"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684889.1"
                     /db_xref="GeneID:11533929"
                     /db_xref="GOA:G8BRS9"
                     /db_xref="InterPro:IPR001352"
                     /db_xref="InterPro:IPR004649"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR023160"
                     /db_xref="InterPro:IPR024567"
                     /db_xref="UniProtKB/TrEMBL:G8BRS9"
                     /translation="MSILPPTVEASLDSIHTKTYYSKVPDEIANGSDIKVILGVDEAG
                     RGPVMGPMVYGISYCTQRYQDEVLIPNYEFDDSKKLTDVVRRKLFAKMYEPITEGSDQ
                     VEIDGVGYATTAITPVDISSGMLRFPPSKNYNLNEQAHDVTMALIEGVVQRGVVLDHV
                     YVDTVGPPNSYQKKLEERFPSIKFTVAKKADSLYCVVSVASVVAKVSRDILIEKLKRS
                     SDEKTGSGYPSDPNTVAWLRDNQRPLFGWPNSMVRFSWQTCKTLLVEDKYKVGSIPIE
                     WEEDYIVSKKNMSQQWTPATANDIITLDNWYN"
     gene            <661838..>662020
                     /gene="TPHA0C03030"
                     /locus_tag="TPHA_0C03030"
                     /db_xref="GeneID:11533648"
     mRNA            <661838..>662020
                     /gene="TPHA0C03030"
                     /locus_tag="TPHA_0C03030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684842.1"
                     /db_xref="GeneID:11533648"
     CDS             661838..662020
                     /gene="TPHA0C03030"
                     /locus_tag="TPHA_0C03030"
                     /inference="similar to DNA sequence:INSDC:YNL070W"
                     /note="similar to Saccharomyces cerevisiae TOM7 (YNL070W);
                     ancestral locus Anc_2.226"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684890.1"
                     /db_xref="GeneID:11533648"
                     /db_xref="GOA:G8BRT0"
                     /db_xref="InterPro:IPR012621"
                     /db_xref="UniProtKB/TrEMBL:G8BRT0"
                     /translation="MFSLPSFILSDESKERIAKVWTLTNSAAHYGWIPFILYLGWANT
                     ANKPNLFNLLSPLPSI"
     gene            complement(<662403..>663644)
                     /gene="TPHA0C03040"
                     /locus_tag="TPHA_0C03040"
                     /db_xref="GeneID:11535299"
     mRNA            complement(join(<662403..662971,663611..>663644))
                     /gene="TPHA0C03040"
                     /locus_tag="TPHA_0C03040"
                     /product="60S ribosomal protein L16"
                     /transcript_id="XM_003684843.1"
                     /db_xref="GeneID:11535299"
     CDS             complement(join(662403..662971,663611..663644))
                     /gene="TPHA0C03040"
                     /locus_tag="TPHA_0C03040"
                     /inference="similar to DNA sequence:INSDC:YIL133C,YNL069C"
                     /note="similar to Saccharomyces cerevisiae RPL16A
                     (YIL133C) and RPL16B (YNL069C); ancestral locus Anc_2.228"
                     /codon_start=1
                     /product="60S ribosomal protein L16"
                     /protein_id="XP_003684891.1"
                     /db_xref="GeneID:11535299"
                     /db_xref="GOA:G8BRT1"
                     /db_xref="InterPro:IPR005755"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR023563"
                     /db_xref="InterPro:IPR023564"
                     /db_xref="UniProtKB/TrEMBL:G8BRT1"
                     /translation="MSSFEPVVVIDGKAHLVGRLASTVAKQLLNGQKIVVVRAEALNI
                     SGEFFRNKLKYHDYLRKATAFNKTRGPFHFRAPSRIFYKAVRGMVSHKTARGKAAMER
                     LKVFEGIPPPYDKKKRVVVPQALRVLRLKPGRKYTTLSKLSSAVGWKYEDVVAKLEEK
                     RKVRSAEFYAKKKAFNKKAAAATAASAESEAAKQLATFGY"
     gene            complement(<664958..>665656)
                     /gene="TPHA0C03050"
                     /locus_tag="TPHA_0C03050"
                     /db_xref="GeneID:11533491"
     mRNA            complement(<664958..>665656)
                     /gene="TPHA0C03050"
                     /locus_tag="TPHA_0C03050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684844.1"
                     /db_xref="GeneID:11533491"
     CDS             complement(664958..665656)
                     /gene="TPHA0C03050"
                     /locus_tag="TPHA_0C03050"
                     /inference="similar to DNA sequence:INSDC:YIL132C"
                     /note="similar to Saccharomyces cerevisiae CSM2 (YIL132C);
                     ancestral locus Anc_2.229"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684892.1"
                     /db_xref="GeneID:11533491"
                     /db_xref="UniProtKB/TrEMBL:G8BRT2"
                     /translation="MNANFDNLNLLTAWVPDSTTAVTEFITKALLNSAESSAPDIFLK
                     LYFIDATNSFPISQFQETIPICDENNHIYENIRITTCLDLNELLININKMTQLIAINR
                     FKKQQKSDNSAKQSIKDQQGICRSGILVFINGIEIMFRNSQIKSSNEKSHYLLREAML
                     KLRVMANQYTPSEEETSLKTVLQFPVTEVFASTSKDLSQNKKNGKRMKNKQHIKGNTV
                     GEYICKFYVDQIVS"
     gene            complement(<666031..>668286)
                     /gene="TPHA0C03060"
                     /locus_tag="TPHA_0C03060"
                     /db_xref="GeneID:11533623"
     mRNA            complement(<666031..>668286)
                     /gene="TPHA0C03060"
                     /locus_tag="TPHA_0C03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684845.1"
                     /db_xref="GeneID:11533623"
     CDS             complement(666031..668286)
                     /gene="TPHA0C03060"
                     /locus_tag="TPHA_0C03060"
                     /inference="similar to DNA sequence:INSDC:YIL131C,YNL068C"
                     /note="similar to Saccharomyces cerevisiae FKH1 (YIL131C)
                     and FKH2 (YNL068C); ancestral locus Anc_2.230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684893.1"
                     /db_xref="GeneID:11533623"
                     /db_xref="GOA:G8BRT3"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="UniProtKB/TrEMBL:G8BRT3"
                     /translation="MSNTEVPEYNVVDFNNYSPAQQARFIQAMISTFMEPEHPTGISK
                     TNFNEDNVDSQIRAYAKISGRNWTYYVKDLEVVFGRNTNPPTGTKTIDIKNDVNIDLG
                     PSKVVSRKHAVLRFNMQSGHWEIYVLGRNGAKVDFEKVNGKAAPYELKSGSILEIGGN
                     QMIFILPEETPSISKECIKPFIPQIINKFSDLSQLDYGNEINSMIIDLIKMNSNESDN
                     GTKQSNARPSESDVENTNKKVMIQPNEKVRTFKMYGSNNSKLGQNKNNNTFAFNNPSG
                     TVLFTPHMGGSSKSSNSVIQGTYWSQNSNSSAPSIIATEFPQSLDFGSDLSNEENKNI
                     KPPYSYATMIAQGILSTPEGVISLSDIYKYISDNYAYYRFSKTGWQNSIRHNLSLNKA
                     FEKVAKKSSESGKGMNWRITKSYQDDFIKKWNSGKITKLLRRGSSVSRQLQLHMSKYN
                     CLPTEKSPEKEKALSIPLAAPTVSQSPTATTKNTTSKISKIKETTANEKLTTTANSNP
                     LNTDNSMPLLRKASYEPESYQQSVNEHLTKENQLNGNPDKQGAIIYDINTSQTPKSIK
                     PSIGSSSLKMLPFPFALPSMSPSNDLFFRSPTKSFHVTAMETYTPERGGSNLNRSPKL
                     SIPQLSTNFGNKNINDSTKKTDFHKNQLTTNDAASIQPPDINRSHNIVSSPNVWNLMH
                     FTSVTNTPAIDGDKNIRLNVNAECNKDNDGLPDLNSSPLKRQSNRRSNNSTDNNPTLM
                     LDTESAKITTE"
     gene            complement(<668810..>676282)
                     /gene="TPHA0C03070"
                     /locus_tag="TPHA_0C03070"
                     /db_xref="GeneID:11535294"
     mRNA            complement(<668810..>676282)
                     /gene="TPHA0C03070"
                     /locus_tag="TPHA_0C03070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684846.1"
                     /db_xref="GeneID:11535294"
     CDS             complement(668810..676282)
                     /gene="TPHA0C03070"
                     /locus_tag="TPHA_0C03070"
                     /inference="similar to DNA sequence:INSDC:YIL129C"
                     /note="similar to Saccharomyces cerevisiae TAO3 (YIL129C);
                     ancestral locus Anc_2.232"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684894.1"
                     /db_xref="GeneID:11535294"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR025481"
                     /db_xref="InterPro:IPR025614"
                     /db_xref="InterPro:IPR029473"
                     /db_xref="UniProtKB/TrEMBL:G8BRT4"
                     /translation="MNSGYTFPPQNPDAINDAINGNETEFNVNDSNTTDFGFTTNGQY
                     FDDQTNIDYPIIDIQRDIENPISISNIEDGSPLPMSKSISMTPTINIPEPPNSTSDII
                     VSTPKIIQNFDSITTNSTPDNFQDYHVNEQAEIASLSGTDNVIGNLRQQLATDWKSPS
                     EYALHILFTKFVRQAEYKLNICLEHPLESELPIVDILGEGVDLEFDNIIDSLGHIAKN
                     KPKPVIDAMMFWRKTKSEIALLAADETQKLMKEYSIEQTRLLRTKSTQSSQLSSNPRR
                     SRSSSVTTKLSHARNNSSKSSVNIPSVSTNNRLKELEAQINSAKEITFQADKKSLISI
                     YILCRVLIEIVKQSPEDADEDLNNKLEEIVFTQLKTTDPISISTSLIKSSNWNAFAEL
                     LGYMSEKKFISVSDRFVASIEKIPKQISPEIEPSVHLLILGMRYLKLKHYPMEKFEDS
                     AEFMKSITKFFLQTNNLSTKLSYAEVISQLLLPLAGVITVEVNHPTWVKTMSSLLDEA
                     NKLQLNNKYWASGFKLAVAVLCVSPTELFTKHWLSLIESNIINLRSKSLSNKITFAVS
                     LSRLVWVYLYRCPETLNNTTRRIKQLINLYIGNQKKKDNWITTDLELINPLCDVLVTI
                     GYLYPTLIMEEAILPLVKQSFNGSTLNNILYEKLILAINTFKGLLLTNSRPEFPENDN
                     RFYDNNLNNIKVEQNENLVLNNDEITSQFYKLFLLLDSNIGSEVWSPENEHQKQNSFG
                     IGPFSFNFSNDGKDFNGNKNLNIALFATLIETIPCSLSVSKKIPIKSAIEILSRNAVH
                     VDLLIASSSQNALKSLAAKENPYTLITWFAKYSFDFDEQTQSRYNLSYLASSEYKQLL
                     VLYIELLECWLEEFQSSEVEEKQKETGLDGIQLPIKETETEGAKDSNKLQWKNMAAVI
                     EEVEGNGLFFLCDNDASVRMLGIRILKIISKFDTVMVEKTSSLYMGHSRSSSHFAADR
                     GTRLIDFLLTSDANSLLNVKMQKLSSTERTRLSKLNLRYKKGLLLKLAESDSSVDTAL
                     WQRMFPKLLSVIFLSCPVTMALCRSIVCVRLVQMHDTILKLANDISFKPDDASPEIVT
                     EQWKLYLIVACTFLTSTNNQRLLIPDSKASKNKNKSQQIFTVQHQKIKSATSIFKMVL
                     PLLSSESTLVVGAIIAGVSSMNINIYKSYIESIDGFISNWGPDYSLQQTRIETFHILA
                     ILSNYISDPIILNDKWLLLKLSEYVKILKNVLQDEVIQFSFEYQNLRIYFMEFLLGYY
                     NAVKDLNNISELFPFQARTSCFNFLSEWCGFGNRGHIFDERFQSMINSAGNDSSRTAI
                     ASSLESQKPKLQQLALEGMIALCTGCITENITSDPDIPMIVSFDTSDLLSWISSLMKS
                     EKPSIISLGVRALEGILEHNKENASLYEEVKHQCLSSNHLGISNLYYITLCKSLLKLD
                     MPLLNPDQLVTLGLCGLVAEHADTRYYAVDLLSSIELNLHSTSFTKGFKEQLSNQSKM
                     IYKPTAKKISSMFAELFPQELCLEIFSNMVNVLDLYESERKKDILTLLVPWVNKITLK
                     SIEDFDTLMVLQNLFYITIELNNSIPESVEKLWISLGKGNSFQNTYVSIEYIINSSIK
                     YRNPLFVRQAKDVILYLSNVPGSIGVIDLLLKKLEPKSMIPKTNIDLSEPANSGNYCF
                     VADIWARLNYTGGGVLFSEVQLSIIFLSSFLSNQNESIKQNTATLLHISLCLADHYVP
                     LVQESAKRILCDLIFSAAPISDISEKTVAVLRNKKGLWSYDDLSRTRMGAKSPKAMDL
                     IVRNIISIFSGIPTLQVEWQRIALNWATSCSVRHVACRSFQIFRSLLTFIDQDMLRDM
                     IHRLSNTISDDNRDIQGFAMQILMTINAITAELEPADLINYPQLFWSITACLNSVHEL
                     EFIEVLSCLNKFISKIDLDAPDTVQCLVAIFPSNWEGRFDGLQQIIMPGLRSANSCEA
                     SWKFLDKLNLLKDSRIIANSDSRLLLALISNLPRFLHAMELKDFTQIQNACNSLISLA
                     DSYSEPSLSRVIDSLAKDKFRSKKDFISQIVNFISRKYFPVFSGQTVVFFLGLLLNKH
                     QWMKIQTIEILKHILPLIDFTLPEFTGVGADLISPLLRLLLTDLDIEALKVLDCIPDI
                     SGSKMDKDVLRISMGNKDVNERFSTTTIFGIPESTGWSVPLPSVTAATTRHNVHSVFS
                     TFIKDNPEAEISNDLTKLDEVVEFHQDDDYKLAKVDSNETYSITEENDASLSHMWAEL
                     DNLDSFFTKNVAAASLPSSVPSKSNIFGHDRVHSIETNTSTLTSNLESAPQLYDMKVS
                     AILNKSLLRTSSNTSFKANLADSFTTNNSSENINDSPFNSTVVNTTPELSGSRSRTSH
                     LLRSPNSSVLKQIESPQDSLFKFEGFLRPAQRNRRKWHSYQQHQQLMSQTIHEQVPQA
                     HYESESSPLRYGSTSPMLGLNKQKPYSVNLEVTTGKQAKDTMKQTKDTNRQTRYQKHY
                     HIPHFSSNKG"
     gene            <677677..>678252
                     /gene="TPHA0C03080"
                     /locus_tag="TPHA_0C03080"
                     /db_xref="GeneID:11535273"
     mRNA            <677677..>678252
                     /gene="TPHA0C03080"
                     /locus_tag="TPHA_0C03080"
                     /product="60S ribosomal protein L9"
                     /transcript_id="XM_003684847.1"
                     /db_xref="GeneID:11535273"
     CDS             677677..678252
                     /gene="TPHA0C03080"
                     /locus_tag="TPHA_0C03080"
                     /inference="similar to DNA sequence:INSDC:YNL067W"
                     /note="similar to Saccharomyces cerevisiae RPL9B
                     (YNL067W); ancestral locus Anc_2.236"
                     /codon_start=1
                     /product="60S ribosomal protein L9"
                     /protein_id="XP_003684895.1"
                     /db_xref="GeneID:11535273"
                     /db_xref="GOA:G8BRT5"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002359"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="UniProtKB/TrEMBL:G8BRT5"
                     /translation="MKYIQTEQSINIPAGVNVSIKARVVKVTGPRGTLVKNLKHIDVT
                     FKKIDNTLIKVTVHDGERKHVAALRTVKSLIDNLITGVTRGYKYKMRYVYAHFPINVN
                     VIENEGKKFIEIRNFLGDKKVRQVPVREGVAVEFSANQKDEIVLSGNSVEDVSQNAAD
                     IQQICRVRNKDIRKFLDGIYVSQKGHIVEEI"
     gap             679907..680001
                     /estimated_length=95
     gene            <681537..>682742
                     /gene="TPHA0C03090"
                     /locus_tag="TPHA_0C03090"
                     /db_xref="GeneID:11534088"
     mRNA            <681537..>682742
                     /gene="TPHA0C03090"
                     /locus_tag="TPHA_0C03090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684848.1"
                     /db_xref="GeneID:11534088"
     CDS             681537..682742
                     /gene="TPHA0C03090"
                     /locus_tag="TPHA_0C03090"
                     /inference="similar to DNA sequence:INSDC:YIL123W,YNL066W"
                     /note="similar to Saccharomyces cerevisiae SIM1 (YIL123W)
                     and SUN4 (YNL066W); ancestral locus Anc_2.239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684896.1"
                     /db_xref="GeneID:11534088"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="UniProtKB/TrEMBL:G8BRT6"
                     /translation="MKFSARNAIVSSLLGSSVLAAAATTTITGNHQHKRAVAVEYVYE
                     TVTVDENGNTIAAASANTWVASTSTLSPTSTQAAATTSSTQAAATISSTQAAAVTTSS
                     TQAAATTSSTQAAASTQAASSGSSSSNGIAGDLSDFSGPNEKFQDGTIACSDFPSGQG
                     VIALDWLGFGGYSGIQNPSDGSTGGSCREGTYCSYACQPGMSKTQWPSSQPASGESLG
                     GLYCKGGYLYRTNTDTDYLCEWGVQMADVVSEISDSVAICRTDYPGTENMVIPLVVDA
                     GSTKPLTVVDEDSYYTWEGLKTSAQYYVNNAGVSVEDGCIWGTDGSGVGNWAPLNFGA
                     GYTNGIAYLSLIPNPNNKSAANFNVKIVAAEGATVNGDCYYENGSYSGGSDGCTVAVT
                     NGKAQFVFY"
     gene            <684842..>686650
                     /gene="TPHA0C03100"
                     /locus_tag="TPHA_0C03100"
                     /db_xref="GeneID:11535324"
     mRNA            <684842..>686650
                     /gene="TPHA0C03100"
                     /locus_tag="TPHA_0C03100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684849.1"
                     /db_xref="GeneID:11535324"
     CDS             684842..686650
                     /gene="TPHA0C03100"
                     /locus_tag="TPHA_0C03100"
                     /inference="similar to DNA sequence:INSDC:YIL121W"
                     /note="similar to Saccharomyces cerevisiae QDR2 (YIL121W);
                     ancestral locus Anc_2.241"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684897.1"
                     /db_xref="GeneID:11535324"
                     /db_xref="GOA:G8BRT7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8BRT7"
                     /translation="MTKLENTNKSRSDLLPSNDIYNMNNNNETKGSLHSHSETTKILQ
                     DSNIDEHEDINSIFGNNDSYENETMSHVNTNASDSNYMMELGDVSDQSSDKSNKNLNN
                     KIDELDENSPPHSRFTRNDKIMLIAQCAFTGFFSSIAGAIYYPVLTLIEGLFKITEEQ
                     ANISVVVYFIFQGIAPIIVGNLADTNGRRPLILSCLLIYFCACVGLASCNTYAQLIGL
                     RCLQAAGIAPVIAINSGIAGDITTRRERGSYIGYVSGFVVIGSAFGALIGAGLSSTWD
                     WRAIFWFLAIGSGVCVIYSIILFPETKRSIVGNGSIAPKSILNKCVILSIPAVRRKWH
                     LDKPEYNTLEPPKKSKAFPIFEILKHKEMIILLIVAGLQFSMWTTHQTSLTTVLSKRY
                     NLTVAKIGLCFLPTGICTMISVITCGKFLNYAYKKDIAKYELWIKDQREILLQENNED
                     EDKVDEIIFNDPKYTFNICRSRLKPAFVTLFLSSCGFIAFGWCIEKRVPLAAVLVTSG
                     FSSLFSNCILTMSTTVCVDLFPSISTTATGCLNLFRCSMSAILIACLSKMVSKMNYGG
                     VFTFLGALTGVSSFLLLITVRNGKELTFYRNKLNYN"
     gene            complement(<687136..>688359)
                     /gene="TPHA0C03110"
                     /locus_tag="TPHA_0C03110"
                     /db_xref="GeneID:11533627"
     mRNA            complement(<687136..>688359)
                     /gene="TPHA0C03110"
                     /locus_tag="TPHA_0C03110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684850.1"
                     /db_xref="GeneID:11533627"
     CDS             complement(687136..688359)
                     /gene="TPHA0C03110"
                     /locus_tag="TPHA_0C03110"
                     /inference="similar to DNA sequence:INSDC:YNL064C"
                     /note="similar to Saccharomyces cerevisiae YDJ1 (YNL064C);
                     ancestral locus Anc_2.243"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684898.1"
                     /db_xref="GeneID:11533627"
                     /db_xref="GOA:G8BRT8"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="UniProtKB/TrEMBL:G8BRT8"
                     /translation="MVKETKFYDLLGVSPNASETEIKKGYRKQALKYHPDKNPSEEAA
                     EKFKECSAAYEVLSDSQKREVYDQYGEEGLNGGGAGGFPGGGFGFGDDIFSQFFGGAG
                     AQRPSGPQRGRDIKHEIQNTLEELYKGRTAKLALNKQILCKTCEGRGGKAGAVKKCTS
                     CNGQGIKFVTRQMGPMIQRFQTECDVCHGSGDIIDPKDRCKDCKGKKIANERKVLEVH
                     VEPGMREGQKIVFKGEADQAPDVIPGDVIFVVVEKPHKHFKRAGDDLLYEAEIDLLTA
                     IAGGEFAIQHVSGDWLKVSTVPGEVISSGMKKVIEGKGMPVPKYGGYGNLIVTFKIKF
                     PENNFATEDKLKELENILPARTPVSIPAKASIDECVLSDFDPTKYSKSKGRSGRSYDS
                     DEEEQHGEGVQCASQ"
     gene            complement(<689473..>691068)
                     /gene="TPHA0C03120"
                     /locus_tag="TPHA_0C03120"
                     /db_xref="GeneID:11533675"
     mRNA            complement(<689473..>691068)
                     /gene="TPHA0C03120"
                     /locus_tag="TPHA_0C03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684851.1"
                     /db_xref="GeneID:11533675"
     CDS             complement(689473..691068)
                     /gene="TPHA0C03120"
                     /locus_tag="TPHA_0C03120"
                     /inference="similar to DNA sequence:INSDC:YIL119C"
                     /note="similar to Saccharomyces cerevisiae RPI1 (YIL119C);
                     ancestral locus Anc_2.244"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684899.1"
                     /db_xref="GeneID:11533675"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="UniProtKB/TrEMBL:G8BRT9"
                     /translation="MNSQNSELNNHNYYVQKSSQAPNNQSTLINILEHNQNRVPLNQY
                     QPHYSNYNNVGSPAYSQNYNQQASPNIINRAPVNQMPMGIDNIRNRQNLYLVTNDSLN
                     NQYVERNDNDKYMYSANPQNISHNYQRRISQEENSFGVHLLANQLPQNNIRYPSESTL
                     PRTQSSNFKIIGFGKNLIKRKSNSIDYSSKLNISDNKINARQKRNKWKIEEDCALIEV
                     LLENSNLLTFVEYYKPMKRFWVKISTLLKQEHSFERNSRQCNDRFKVLNSRASKLDYT
                     KIESDTTKSENTIRLNNLQIRLRNTYGFSNGNIVLKNHKTLSQIDSGDSTQLQMNKEG
                     NLHLDESDSHIRSYYKDPSNFLQPLRDTSKNNEKEVTAILTSNKQKITNMINDLISSQ
                     DAIFQMEKQNIDQLRLGVATSIKGVEQLVTLALNEICMYKDLTVKKMTDLENILSSIQ
                     SNFVNQNENSLKSKTKTKLKTKSKTKIKTKTKTKLVTKTKPSINKDTITSDEQKSVKK
                     EYKCKPMSISKIVLNNEPESHKQ"
     gene            <694391..>695389
                     /gene="TPHA0C03130"
                     /locus_tag="TPHA_0C03130"
                     /db_xref="GeneID:11533624"
     mRNA            <694391..>695389
                     /gene="TPHA0C03130"
                     /locus_tag="TPHA_0C03130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684852.1"
                     /db_xref="GeneID:11533624"
     CDS             694391..695389
                     /gene="TPHA0C03130"
                     /locus_tag="TPHA_0C03130"
                     /inference="similar to DNA sequence:INSDC:YNL063W"
                     /note="similar to Saccharomyces cerevisiae MTQ1 (YNL063W);
                     ancestral locus Anc_2.245"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684900.1"
                     /db_xref="GeneID:11533624"
                     /db_xref="GOA:G8BRU0"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR004556"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BRU0"
                     /translation="MPRISPRVMHDAFKINYCLPLLLPECRTIENAQQEYKWIHSELS
                     LKSASLNELDKTIKLACIQRFHHVPLQYILRSQPFGYINISCKKNVLIPRWETEEWTL
                     DFVNSIKKYKNSIESLYSQQNKLNVVDLCTGTGCIALLLRHEFNKILDKPNIVQISAF
                     DCSKHALRLADHNKQHSANEPLDISIKKMNVLRDKIDLKEYQNRKIDILLCNPPYIPR
                     SQFIRHTSKSVRFFEPKLALIGNEEFYENLVDIWLSNINSFIYEVGNQEQIDLVKKLV
                     SKNRHIVGDWVVDQKNDSNRQPRLVFGYRNTSSDKCQLLKHIFDNFSKLKEAHFYD"
     gene            complement(<695550..>696986)
                     /gene="TPHA0C03140"
                     /locus_tag="TPHA_0C03140"
                     /db_xref="GeneID:11533827"
     mRNA            complement(<695550..>696986)
                     /gene="TPHA0C03140"
                     /locus_tag="TPHA_0C03140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684853.1"
                     /db_xref="GeneID:11533827"
     CDS             complement(695550..696986)
                     /gene="TPHA0C03140"
                     /locus_tag="TPHA_0C03140"
                     /inference="similar to DNA sequence:INSDC:YNL062C"
                     /note="similar to Saccharomyces cerevisiae GCD10
                     (YNL062C); ancestral locus Anc_2.246"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684901.1"
                     /db_xref="GeneID:11533827"
                     /db_xref="GOA:G8BRU1"
                     /db_xref="InterPro:IPR007316"
                     /db_xref="InterPro:IPR017423"
                     /db_xref="UniProtKB/TrEMBL:G8BRU1"
                     /translation="MTSQLDPLKQIAFNQFVILKLPSNNWKIVELRKNGSISLGKFGA
                     FQVNDVIGYPLGTTFEIYYDNTSDITENEDDSQNKNKNKNKNNKIPVGKVRIMEEKLS
                     ESSNNNLDEGEELKNDIPELTNINSSENNKHLINIGNKVQKLTMAEIENLKNKSVSGD
                     EIIAKIIDSHESFHKKTIQSQEKYLKRKQQKFAKYFTVNYLSGSALLEYFLAKGDQQR
                     VMDMSQESVGMLLNLANIRSNGTYLCVDETGGLLVYFLLERMFGGDTDSKLDGKVVVI
                     HENEHPNLDLLKYSNYSEEFINDHVKTISILDYFEPPTVAEVNSTFTPFSKEEIKELK
                     GNKRNAYFRRSKLYKSQLDVVKFATEVKYDALVVTSTLSLPSLIPRLAENVHGSRPIV
                     CFSQFKETLLELSHTLYDDLKFLAPSIYETRCRPYQTIRGKLHPLMTMRGGGGYLLCC
                     HRVIPAPEPEQLVATDNKDPDVKKQKTE"
     gene            <697508..>699334
                     /gene="TPHA0C03150"
                     /locus_tag="TPHA_0C03150"
                     /db_xref="GeneID:11533951"
     mRNA            <697508..>699334
                     /gene="TPHA0C03150"
                     /locus_tag="TPHA_0C03150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684854.1"
                     /db_xref="GeneID:11533951"
     CDS             697508..699334
                     /gene="TPHA0C03150"
                     /locus_tag="TPHA_0C03150"
                     /inference="similar to DNA sequence:INSDC:YNL061W"
                     /note="similar to Saccharomyces cerevisiae NOP2 (YNL061W);
                     ancestral locus Anc_2.247"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684902.1"
                     /db_xref="GeneID:11533951"
                     /db_xref="GOA:G8BRU2"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR011023"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023273"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BRU2"
                     /translation="MGSRRHKNKQGAPPTLDEFQAKKDKKLNKIKQKSKRATPIEDKR
                     EKVSVKKQKKNHKEVVKTTESDEVAGEEQSEEELSKETKTLFDDSDDDEEANPEDLKD
                     EFDLEQEYDYEEDAEQPTTAMFSDDDDEGDLEDLNAENMEAFSKQLDEEEAEEAEEAE
                     RELVETDIMQPRADVLPSERELELMADQPPNLTAVRTRILEIVKVLEDFRNLAAEGRS
                     RTEYVDRLLLDICDYFGYSPFLAEKLFNLFSPAEALEFFEANEIARPITIRTNTLRTR
                     RRDLAQALVNKGVNLQPIGTWTKVGLQIFDSQVPIGATSEYLAGQYILQAASSFLPVV
                     ALDPQLNERVLDMAAAPGGKTTYISALMKNTGCVFANDANKARTKSLIANIHRLGCTN
                     TIVCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKDFIQIPHLQKQL
                     LLSAIDSVDANSKTGGFIVYSTCSVAVEEDEAVVDYALRKRPNVRLVDTGLAIGKEGF
                     TSFRGKKFHPSVKLTRRYYPHTYNVDGFYVAKFQKIAPSRHDDNQASAREKEAAARDE
                     ALEEGIIKDDFAEFDDQEDKQYIEKSKKTILQKKGLNPKGKK"
     gene            complement(<699424..>701691)
                     /gene="TPHA0C03160"
                     /locus_tag="TPHA_0C03160"
                     /db_xref="GeneID:11533625"
     mRNA            complement(<699424..>701691)
                     /gene="TPHA0C03160"
                     /locus_tag="TPHA_0C03160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684855.1"
                     /db_xref="GeneID:11533625"
     CDS             complement(699424..701691)
                     /gene="TPHA0C03160"
                     /locus_tag="TPHA_0C03160"
                     /inference="similar to DNA sequence:INSDC:YNL059C"
                     /note="similar to Saccharomyces cerevisiae ARP5 (YNL059C);
                     ancestral locus Anc_2.248"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684903.1"
                     /db_xref="GeneID:11533625"
                     /db_xref="GOA:G8BRU3"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR027664"
                     /db_xref="UniProtKB/TrEMBL:G8BRU3"
                     /translation="MLSRNCSLPPATVRVIDESPLNNEPEHFISTSTYDSSIPIAIDF
                     GTCSVKAGYVNKADPAFNFPTRLTRFRDRKMSRTMTFIGNDTNLDYAVRSQSKTPFDG
                     PFVTNWEYAEDILEYTFKHLGVTANHGISNPLIMTEKLATLQSQRANWYQLLFETFNT
                     SNVSFGIDNVFAFYANTDKHSSGLVFGLNNQDTNVIPIIDGKPVLTDTKRINWGGSQS
                     VGYLSDLMTLKYPYFPTKLTEFQYETLYKDYCYVSPDYAKELEDILSLEQLEKKDIVV
                     EAPFTEIMQPEKTEEELRIQAEKRKENGRRLQEQAKQKRIEKMVEKQEEWEYYSQLKE
                     QFVDQSKKQIQSILENAGFDDERDFKKYLYNLEKSLKRAQAAELSESLEGDEEEEEED
                     ENANKFELLEVPDDQLDEEQIKEKRKQRLMKANYDARQRAKEEKLKAKQEAEELRIKE
                     EQWRATDLSGWIRSKRKALDELLQKRKEKIKTREDMKDRKSQASQNRMKSLATLAEDN
                     LKTGTKRTRQQATIDNDPNDTFGADDEDWMVYNDIFQNTETLDELIEEDYRDIVEIEK
                     ELLEFDSNFTMEDTVDAQYDWRNSTLHLFLRGPRPFDSENSHEQHQMHMNIERPRVPE
                     ILFQPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQLPGLK
                     TRIVKEFTSFLPNDAKFSVNISKHPSLDAWKGMAKFSSDDADFKSSLISKKEYEEYGP
                     EYIKEHRLGNTGYYE"
     gene            complement(<701936..>703039)
                     /gene="TPHA0C03170"
                     /locus_tag="TPHA_0C03170"
                     /db_xref="GeneID:11533455"
     mRNA            complement(<701936..>703039)
                     /gene="TPHA0C03170"
                     /locus_tag="TPHA_0C03170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684856.1"
                     /db_xref="GeneID:11533455"
     CDS             complement(701936..703039)
                     /gene="TPHA0C03170"
                     /locus_tag="TPHA_0C03170"
                     /inference="similar to DNA sequence:INSDC:YIL117C,YNL058C"
                     /note="similar to Saccharomyces cerevisiae PRM5 (YIL117C)
                     and YNL058C; ancestral locus Anc_2.250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684904.1"
                     /db_xref="GeneID:11533455"
                     /db_xref="UniProtKB/TrEMBL:G8BRU4"
                     /translation="MNVDKYIKRRGLPSLVTTTTSTTHTQSTTLTSESVSITSSISTA
                     STTSILTTSLTSSAISIPSIIAPSAENNPNIWRSDDIDGTVFICFGAIFGAILLFILI
                     WRLYNNLKSTRYTYLTEAYDLEDPFKAAYNTNSSIMNNSLYDDDFNNDFERTHDGMPL
                     SPTRSPMKLKYNGFQDAGHDTSNTEYFNNSVIQNPFDVIQDSGTPKKKATTNNVSLFI
                     SPTLEILNQQEKRKSRFVKDTRESISKSPLGHRNNAEFNRPERSISPDRSISPDRRHI
                     SPTRYHGKNNSILTLNIDNNTFDDNTVLRFNEDNSYNNFDQEIPREPTKKHTKVINWS
                     FNLHHHFWMTCWKIANSALEVYTINKSTHLYIH"
     gene            <703611..>704138
                     /gene="TPHA0C03180"
                     /locus_tag="TPHA_0C03180"
                     /db_xref="GeneID:11535259"
     mRNA            <703611..>704138
                     /gene="TPHA0C03180"
                     /locus_tag="TPHA_0C03180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684857.1"
                     /db_xref="GeneID:11535259"
     CDS             703611..704138
                     /gene="TPHA0C03180"
                     /locus_tag="TPHA_0C03180"
                     /inference="similar to DNA sequence:INSDC:YNL056W"
                     /note="similar to Saccharomyces cerevisiae OCA2 (YNL056W);
                     ancestral locus Anc_2.251"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684905.1"
                     /db_xref="GeneID:11535259"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G8BRU5"
                     /translation="MQHKTYIPPLNFSPVVSTDVSLYRSGYPMPLNYSFIKDRLNLKT
                     IIYVGDKEDLTDEYSEFLKAEGIEFYHVFMDSCRDKNINSQINTVLEIILDIDNYPIL
                     IHSNKGKHRVGIIVGIIRKVLQGWSTAGIYQEYSIFSGGLKGDADLEFITMFETHMSV
                     RKDKIPKYVTDSLNI"
     gene            complement(<704312..>705169)
                     /gene="TPHA0C03190"
                     /locus_tag="TPHA_0C03190"
                     /db_xref="GeneID:11533826"
     mRNA            complement(<704312..>705169)
                     /gene="TPHA0C03190"
                     /locus_tag="TPHA_0C03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684858.1"
                     /db_xref="GeneID:11533826"
     CDS             complement(704312..705169)
                     /gene="TPHA0C03190"
                     /locus_tag="TPHA_0C03190"
                     /inference="similar to DNA sequence:INSDC:YIL114C,YNL055C"
                     /note="similar to Saccharomyces cerevisiae POR2 (YIL114C)
                     and POR1 (YNL055C); ancestral locus Anc_2.254"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684906.1"
                     /db_xref="GeneID:11533826"
                     /db_xref="GOA:G8BRU6"
                     /db_xref="InterPro:IPR001925"
                     /db_xref="InterPro:IPR023614"
                     /db_xref="InterPro:IPR027246"
                     /db_xref="UniProtKB/TrEMBL:G8BRU6"
                     /translation="MAPPTFNNITKDVNSLINADYYHGQPLALDISTTAKNGVKFDIK
                     TKQQKAGSPLSTTIETKFNDKSTGLSLTQSVANSDNIATKIEVDDILTKGLKTELITS
                     IVPDVSKDAKLNLSFTQDFLTARGNFTLINKPSFIGDFTIARDGVVGGAQLSYDITQG
                     SLSSYLVALAYKQADYTVGVSYTDKHLSTISLFQNVSDVLQIGAKATTVCKYIPDHKN
                     TSIEFATKYIPDESSQIKAKIQDTGILALAYKQQLRKGINVGIGASFNALNLNEPVHK
                     IGGSLSFST"
     gene            complement(<705431..>705913)
                     /gene="TPHA0C03200"
                     /locus_tag="TPHA_0C03200"
                     /db_xref="GeneID:11533669"
     mRNA            complement(<705431..>705913)
                     /gene="TPHA0C03200"
                     /locus_tag="TPHA_0C03200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684859.1"
                     /db_xref="GeneID:11533669"
     CDS             complement(705431..705913)
                     /gene="TPHA0C03200"
                     /locus_tag="TPHA_0C03200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684907.1"
                     /db_xref="GeneID:11533669"
                     /db_xref="UniProtKB/TrEMBL:G8BRU7"
                     /translation="MTMIFWLTQRPIEEVNVHNPQNHTVLGLSQDLAVFAILKNNPAQ
                     SNTRHTIIQLYNIINTTTVSYWCKKRSCVHNERCILTSNSNTSYCVISCLLLTSFNSS
                     RERNLIRFLNPILFEIGFLDFNRVIGWISLLCSLLYLFCCFAVLYFQQSKVSLLSFWG
                     "
     gene            <706568..>707782
                     /gene="TPHA0C03210"
                     /locus_tag="TPHA_0C03210"
                     /db_xref="GeneID:11533813"
     mRNA            <706568..>707782
                     /gene="TPHA0C03210"
                     /locus_tag="TPHA_0C03210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684860.1"
                     /db_xref="GeneID:11533813"
     CDS             706568..707782
                     /gene="TPHA0C03210"
                     /locus_tag="TPHA_0C03210"
                     /inference="similar to DNA sequence:INSDC:YNL051W"
                     /note="similar to Saccharomyces cerevisiae COG5 (YNL051W);
                     ancestral locus Anc_2.260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684908.1"
                     /db_xref="GeneID:11533813"
                     /db_xref="GOA:G8BRU8"
                     /db_xref="InterPro:IPR019465"
                     /db_xref="UniProtKB/TrEMBL:G8BRU8"
                     /translation="MSSSTEYNDIDEQLLHENFSVVEFSNDLLTTVSSNDSLFFQLPL
                     KKMNYELEEIEKRIEKLIKTYSMDLVNQFYKKKNVNSVMQKELHSILHYLNISYNRLN
                     DDIILKYDKIKKLQNILNKIHQTSNLLRDSMIFLHLVNKMMKIKLNMNNILELSILQS
                     QLNYILSNNLNLITLKLIKKLKNDILVKNEKELVSFTSINIIKMFNADSTTEVDYSRN
                     SELAILIHSLGLISKNDFVSNINKILNVIILSTSQSLSKSINSIKILPSLFDNTILPN
                     ATKIYQLENLLKSIQLENENGTFFTEFINLQRSKPLQSSSSIALRKANKSLLDIYWSS
                     VSSLYKKDFEITINRGGPVGKSLITNKSFIIDTFKDKLSTEITIDKSESVNFSNYIEV
                     MSNSIVILSKKN"
     gene            complement(<707955..>708818)
                     /gene="TPHA0C03220"
                     /locus_tag="TPHA_0C03220"
                     /db_xref="GeneID:11533497"
     mRNA            complement(join(<707955..708705,708802..>708818))
                     /gene="TPHA0C03220"
                     /locus_tag="TPHA_0C03220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684861.1"
                     /db_xref="GeneID:11533497"
     CDS             complement(join(707955..708705,708802..708818))
                     /gene="TPHA0C03220"
                     /locus_tag="TPHA_0C03220"
                     /inference="similar to DNA sequence:INSDC:YNL050C"
                     /note="similar to Saccharomyces cerevisiae YNL050C;
                     ancestral locus Anc_2.261"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684909.1"
                     /db_xref="GeneID:11533497"
                     /db_xref="InterPro:IPR018555"
                     /db_xref="UniProtKB/TrEMBL:G8BRU9"
                     /translation="MNHLKIVSRKDLYDEPFSTIDDESLEGNNRVILAEPIFEIVEVD
                     NINNKEDSNKGDSNNENDDEENNQVHDEFDFPLFSFGASFPISNVDQVETNSEDIAGR
                     GGSEVKLMKISLREPSPEITNTERPDSYYFATYTEDDKRNFEKSAIEFDAIFEDKAIN
                     INRPGKKHKIIVLEDYNKKINELNERANILRKRRPGKKQRVAKKLAKEKIKEREQLLK
                     TLKKEKKKMFNKRGGKKNKKKETLNPLKDAAATIIQN"
     gene            complement(<709166..>712078)
                     /gene="TPHA0C03230"
                     /locus_tag="TPHA_0C03230"
                     /db_xref="GeneID:11535247"
     mRNA            complement(<709166..>712078)
                     /gene="TPHA0C03230"
                     /locus_tag="TPHA_0C03230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684862.1"
                     /db_xref="GeneID:11535247"
     CDS             complement(709166..712078)
                     /gene="TPHA0C03230"
                     /locus_tag="TPHA_0C03230"
                     /inference="similar to DNA sequence:INSDC:YIL109C,YNL049C"
                     /note="similar to Saccharomyces cerevisiae SEC24 (YIL109C)
                     and SFB2 (YNL049C); ancestral locus Anc_2.262"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684910.1"
                     /db_xref="GeneID:11535247"
                     /db_xref="GOA:G8BRV0"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:G8BRV0"
                     /translation="MSHKKRVYPSMVGYSQDSNYIQQGTQNFLGGDVGNINANIQGQM
                     GFPNDPNAQIYDQQLGQDHHIQQQGQQQYMQQGFDPSQGQQGQLQGQSMQPLQGQQGQ
                     PQQARVFTPAQQQLNYQIDQAATVMSNMQLHNVPTSDPSMAYQQQQQQQQMGGGAGAG
                     AVAGGLPQQSNYGQNQNQQLNYSKTNKPMNQLYPIDLLVDLPPPITDLSLPPPPLMVP
                     ADKMLVPSETANTPPAYVRSTLNAIPKNSSLLKKSKLPLALVIRPYQFLNDDTEAPPL
                     NEDGLIVRCRRCRSYMNPFVTFTDQNRKWRCNFCRLANDVPMLFDQTMGGGAPSNRYE
                     RNEVKHAVMEYIAPKEYALRQPPPAVYSFILDVSQNAIKNGLLATATRTILETLDSIP
                     NRDERTRISIVCVDNSIHYFSIPADEVSDQIKMMDIGDLEEAFLPKPTSMLIPLIDRR
                     NNIEKLLNMIPEIFKFNVMNKFALGPSLKSVFNLISGIGGKIIVISSTLPNIGVGKLS
                     KRNEAGVVNTNKESSQLLSCQDAFYKTFAIDCSKSQVTVDLFLASEEYMDVATLTNLT
                     RFTSGQTHFYPGFSAAHMADVTKFTKEFSKHLSMDLSMETVMRARGSTGLRMTSFYGH
                     FFNRSSDLCSFSTMPRDQSYVYEFNVDEPITTEYCFVQVAVLLSANTGQRRIRVITLA
                     LPTTDSLLEVYASADQLAMTNYFADKAVEKALNSSLEDARLFLSKSVQEILAVYKKDM
                     VVSNTAGGAPLRLCANLRMFPLLMHSLSKHMAFRQGIVPSDHRAIALNNIESMPLKYL
                     IKNIYARVYSLHDMVDEAGLPDENGQIVLPQPINASATIFERYGLYIIDNGNELFLWI
                     GGDAVPELVADVFGINDIIQVPIGKQELPVLENSEFNERVRNIIAKIREHDDIVTYQT
                     LYIVRGASLSEPVNHASAREVATLRLWATSALVEDKVLNSESYREFLQNMKSRISK"
     gene            <713341..>715434
                     /gene="TPHA0C03240"
                     /locus_tag="TPHA_0C03240"
                     /db_xref="GeneID:11534098"
     mRNA            <713341..>715434
                     /gene="TPHA0C03240"
                     /locus_tag="TPHA_0C03240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684863.1"
                     /db_xref="GeneID:11534098"
     CDS             713341..715434
                     /gene="TPHA0C03240"
                     /locus_tag="TPHA_0C03240"
                     /inference="similar to DNA sequence:INSDC:YIL108W"
                     /note="similar to Saccharomyces cerevisiae YIL108W;
                     ancestral locus Anc_2.263"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684911.1"
                     /db_xref="GeneID:11534098"
                     /db_xref="InterPro:IPR001229"
                     /db_xref="InterPro:IPR021917"
                     /db_xref="UniProtKB/TrEMBL:G8BRV1"
                     /translation="MPPLPDTKKKEQLEIFNLQEIAIVTSPCIIIHGKCLSNNGSKTI
                     QVQHQSLPTLTYPVDENFFKITCHLQPGENTLTMVTDTNLFKIIKCIYTPMYQNLPVH
                     LCLLIARDSPLLFDSPKSQIQKEGGNNLDLAIRKLRMAGRLMQAFTNEQMLRAGFGQR
                     CFQFVEEYALDTIFQSSQEMRNTIKIHILRSDKTTKEIRDYNIAQQNKDAKNSGGLFD
                     IAMNCVRGSEFFNQPGLKKPVQAAVMFMDTHWDGKMITGHAALGGGTSDIKLAIFGSH
                     GMYSWPTCMEQLLPYMLDTTKSSTKEVANDCNECGSHWECCVVTMGAFMHEIGHLLGC
                     PHEENGVMLRDYVRLNRSFLTRESFCLRTNSNGAKPPIYPREECTWHRLDLLRFLYHP
                     SFTLPQDFYDPSFLRPSKINSDGLTQPALFPLGNGSCMIKSEGGIYCIEIICGDLTRA
                     YIEYLPKSLGGTGTQKEVILSLQDLRSRIPPNHLEKHANDFKIGILCTNGPNKTFDNF
                     PNLLNISTISMAKYNYPGNVKGIKSPLLGNSNRGSEFDIIPINIKNITMVRVYYGSAL
                     DGLRFYQRTDDPNKPPSIPPRTYVSGLKDSMKNFSINDKNTYNVLIGNETTNFSDINL
                     ENGEIIKEFNVRCGAWIDGIQIVTSRGRSSPMFGNANGGSLGQLKAPHGQQILGIYGR
                     KSNWMDAIGIVYGNI"
     gene            complement(<715620..>717545)
                     /gene="TPHA0C03250"
                     /locus_tag="TPHA_0C03250"
                     /db_xref="GeneID:11534107"
     mRNA            complement(<715620..>717545)
                     /gene="TPHA0C03250"
                     /locus_tag="TPHA_0C03250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684864.1"
                     /db_xref="GeneID:11534107"
     CDS             complement(715620..717545)
                     /gene="TPHA0C03250"
                     /locus_tag="TPHA_0C03250"
                     /inference="similar to DNA sequence:INSDC:YIL107C"
                     /note="similar to Saccharomyces cerevisiae PFK26
                     (YIL107C); ancestral locus Anc_2.264"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684912.1"
                     /db_xref="GeneID:11534107"
                     /db_xref="GOA:G8BRV2"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR016260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G8BRV2"
                     /translation="MDFTPKNTPLQTPFTSDVNINQIQSQTQPHTHTQTQNQVDNNKI
                     NKLKLKVKDKNVNYRSSSFDIPGLTKSKKSPYGLLTNDDIEKKLIIVMCGLPASGKSF
                     ITNKLSRYLNFMMFNCKAFNVGNTRRTFSKENKLEEQTSDFFNANNEKYLQLRDKWAL
                     DTLEELLNYLLVKDGAVAIFDATNTTKERRRLLFQQIKNRSNKINVVFLETICSNEEL
                     TKKNIKLKISGPDYIYKDPVDSLIDFEERLKNYKKVYESIEDSENLSYIKMIDVGEKI
                     ITYKLNGFLTSETLYYLMNFNLNERKIWITRNGESKYNLEVKMGGDSYLTKRGKKYSK
                     ALKNFIDDQKLIEQNNYKIKSDETQKKEYLRMIERYGENNITIDTNNEVEEVEEEEND
                     EFHIWSSMRKRAIESVQYFDENKYQIKQIRMLDEINAGDFDSLSHSDFKEYYPIEFEK
                     KQNDTLRYKYPGNGGESYLDVINRLRTVINEIERLKDSVLIVTHPVPARVLLGYFLNI
                     SKDIIADIDIPLHCVYCLDIKPYGISWSLYEYVEKLDTFVQLPQNSINTTKVKEVGLV
                     YKEKHYSEIPTKLARTLSNENNCSSLIHRSVSFDSLVDLPMSPNVNKYIIKKNKHLHT
                     MPLSRKPFTKDDFEYLK"
     gene            complement(<718569..>720437)
                     /gene="TPHA0C03270"
                     /locus_tag="TPHA_0C03270"
                     /db_xref="GeneID:11533502"
     mRNA            complement(<718569..>720437)
                     /gene="TPHA0C03270"
                     /locus_tag="TPHA_0C03270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684865.1"
                     /db_xref="GeneID:11533502"
     CDS             complement(718569..720437)
                     /gene="TPHA0C03270"
                     /locus_tag="TPHA_0C03270"
                     /inference="similar to DNA sequence:INSDC:YIL105C,YNL047C"
                     /note="similar to Saccharomyces cerevisiae SLM1 (YIL105C)
                     and SLM2 (YNL047C); ancestral locus Anc_2.267"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684913.1"
                     /db_xref="GeneID:11533502"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G8BRV3"
                     /translation="MSLQNTLSSNISDYLSQQQQQQQPSLSLNNNNIHNENIQKVIPS
                     GLDLPNIVLSRNSLTNTSIRRVSKLNQAIKSNSINKTSGTNVQQDPRSPLVILIPTNS
                     QPTDILAARFNAWRSIIKSLIGYLTEFASVQDEIVRHNLRLLQAINFPFFTIENQYQP
                     AQQNDKVLQNFFIPFGNGSIQDLPTILTKYHNSMAAFALKASKELTSDLIPRLEDLRG
                     DLSVKIKEIKSLESDFKNTCDKQLHITANLLNKFEESIDDCKFGNTKKMNDPYLNKII
                     LDRQIKKQLTEENFLHEAYNNLENSGLELEKVIVMELQNAITIYARLSGQESQLVFDK
                     LITTLDSSILSQDIGFEWENFINSNLNNFIIPNSPMRKFNDISYKNMNNPLNNEIFSA
                     FFDKRSKYLKNYSISCFVLSGSYLHEFKTADRKKDLIPMSSIPLNEIISVESNDINNN
                     KKSKPSGHGYKVTIQCTNNSLINRRTNIVLKTDSLNTLTTFYRHLKNLISMSNDYKKK
                     CQYCLDNTTEASSSSPLSKFNTNENTIDVLKSTSTDNTTRSRTLQNKDLQPTITNDIV
                     NDVDPDTSIPRLDNQTNTITTTSSIQDINNDSQLKANIPSNIYIRNMDDTSTINNK"
     gene            <722373..>723407
                     /gene="TPHA0C03280"
                     /locus_tag="TPHA_0C03280"
                     /db_xref="GeneID:11535277"
     mRNA            <722373..>723407
                     /gene="TPHA0C03280"
                     /locus_tag="TPHA_0C03280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684866.1"
                     /db_xref="GeneID:11535277"
     CDS             722373..723407
                     /gene="TPHA0C03280"
                     /locus_tag="TPHA_0C03280"
                     /inference="similar to DNA sequence:INSDC:YNL042W"
                     /note="similar to Saccharomyces cerevisiae BOP3 (YNL042W);
                     ancestral locus Anc_2.270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684914.1"
                     /db_xref="GeneID:11535277"
                     /db_xref="InterPro:IPR021216"
                     /db_xref="UniProtKB/TrEMBL:G8BRV4"
                     /translation="MGENESSKNLNALLEVLLGSKVDNVDCTEESLLKLIELKKQQEI
                     TKQHYYQLEISNASINLLKLAMSYKIPPNQISSMFISSSRQAAAGAVSSNKNVTMEEN
                     TPITKIKTEPLSKQPLSYQFPPRASPTNQASNHITKTKHKRTNSPARIGANAVALLND
                     ANVINEEEPQPQIPSFDTMNNNVSSYKNLKQPQKVKLHKRNISLPMNTSNYYNMTNVI
                     DFNVGQASIAENLTIKNFSNKTKMPSNQSGNHLLPTISAGSYHQRTRSSSPFKVVDLN
                     QIEIGTQQFKESLSPGKEKALTLAHPKSRGNTIENTDELTYSEKSSANNSPVRPTNSQ
                     KLVSNIISRA"
     gene            complement(<723518..>725017)
                     /gene="TPHA0C03290"
                     /locus_tag="TPHA_0C03290"
                     /db_xref="GeneID:11534087"
     mRNA            complement(<723518..>725017)
                     /gene="TPHA0C03290"
                     /locus_tag="TPHA_0C03290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684867.1"
                     /db_xref="GeneID:11534087"
     CDS             complement(723518..725017)
                     /gene="TPHA0C03290"
                     /locus_tag="TPHA_0C03290"
                     /inference="similar to DNA sequence:INSDC:YIL104C"
                     /note="similar to Saccharomyces cerevisiae SHQ1 (YIL104C);
                     ancestral locus Anc_2.271"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684915.1"
                     /db_xref="GeneID:11534087"
                     /db_xref="InterPro:IPR007009"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:G8BRV5"
                     /translation="MITPSFKVSQTDEFVIIDVKISSIRFNAPGMEIVATDNVLVFHL
                     APYYLRLRFPHNLVDDERAKAEYKAADESIHIEIPKEEKGQYFEDLDFPSKLLAREGD
                     IIGADKLTKLKDTKQAKGPLIQEVGSSNNINNEVKEIGLSGEQFNWEIEQSVSENLSS
                     SLLHATYGFDNLYSSDILLSVANGNDINELDEPEKATAKERVEERLRKENLKFDPEYY
                     VADLMLLKHGSEDDLELNGIKEIMNFTPNVIDQYLKWVKEIGNQDSSMPIEFTEKEQE
                     QMQKNLPKKEYLVKDLKPLYVTILSVLFAYIFEQMENTGNHQTESAWTIGKLCPQISF
                     LDQQLELNDEPQISIMNQNSSKNSIIRSCVISGVKRALSYPLHRNLELTLKVWKYVYY
                     ILRGGKRLVIRCLLDVHEIFRFHDVYYVYNKVLLNDLCSWFISNGNENVIRSLAVEVN
                     NELGQVTPEQISFDCISDFNPETGEPLWENMTLKEMEILAEDEYRETAE"
     gene            <725377..>726645
                     /gene="TPHA0C03300"
                     /locus_tag="TPHA_0C03300"
                     /db_xref="GeneID:11533761"
     mRNA            <725377..>726645
                     /gene="TPHA0C03300"
                     /locus_tag="TPHA_0C03300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684868.1"
                     /db_xref="GeneID:11533761"
     CDS             725377..726645
                     /gene="TPHA0C03300"
                     /locus_tag="TPHA_0C03300"
                     /inference="similar to DNA sequence:INSDC:YIL103W"
                     /note="similar to Saccharomyces cerevisiae DPH1 (YIL103W);
                     ancestral locus Anc_2.272"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684916.1"
                     /db_xref="GeneID:11533761"
                     /db_xref="GOA:G8BRV6"
                     /db_xref="InterPro:IPR002728"
                     /db_xref="InterPro:IPR016435"
                     /db_xref="UniProtKB/TrEMBL:G8BRV6"
                     /translation="MPETSKAPKRRFVGSRKKNVDVIPNADGNVSTIIHTPRRPATGK
                     ALNTIPDDILNDEELNEAIKLLPNNYNFELHKTIWNIKKSNAKRVALQMPEGLLIYSL
                     IISDILEQFCECETVVMGDVSYGACCIDDFTARSLDCDFIVHYAHSCLVPIDVTTIKV
                     LYVFVTIYIEEQHIIKTLQKNFKGGSRIATFSTIQFNPTVHSIKDKLKNDKEHVLYII
                     PPQIKPLSKGEVLGCTSQRLDKNQIDYMLYIGDGRFHLESPMIHNPGIPAFRYDPYSR
                     KFTRETYDQSELVEVRSEAIESARSAQTVGLILGALGRQGNLATVENLEAKLKKAGKK
                     IVKIILSEIFPQKLAMFDKIDAFIQVACPRLSIDWGYAFNKPLLTPYEANVLLNFDVM
                     FTKDYYPMDYYEENGYGRGRIPEHAIETDI"
     gene            complement(<726866..>729538)
                     /gene="TPHA0C03310"
                     /locus_tag="TPHA_0C03310"
                     /db_xref="GeneID:11533651"
     mRNA            complement(<726866..>729538)
                     /gene="TPHA0C03310"
                     /locus_tag="TPHA_0C03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684869.1"
                     /db_xref="GeneID:11533651"
     CDS             complement(726866..729538)
                     /gene="TPHA0C03310"
                     /locus_tag="TPHA_0C03310"
                     /inference="similar to DNA sequence:INSDC:YIL101C"
                     /note="similar to Saccharomyces cerevisiae XBP1 (YIL101C);
                     ancestral locus Anc_2.274"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684917.1"
                     /db_xref="GeneID:11533651"
                     /db_xref="GOA:G8BRV7"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="UniProtKB/TrEMBL:G8BRV7"
                     /translation="MMFNIRDLSFNDLKLTESPLDDYQRVALLIFCYKEATQGNVGGF
                     DVTNTLDIKQSNYKSNTAQNFKLNNLENCNSNVLNCFEYNLPDIKLCFSDEKNPLSKD
                     NIDVKLLEFLNNNQELKCKLGISSDTLKNINYLQIFENIDPVNFESNGFLGMHHNHES
                     INKHWDDDKPLIFLKNQQFKINKVNYDLIKESTLVNPNLSVMWTHDTGYVFITGIWRL
                     YQDVMKGLTHLTRFNDDVTIKNGNAKNAILINNCFIDKVCFEEFDLIMNHIFYDDLEI
                     DRDSIKIKRKRRNSSQLNKLKSPTVDNFDIGKKRSRTNSFGNAAKKEGTKIIKDECMK
                     STLQEKDDNPTLSTVVTNPNHIDLHWANVSNYLKEELLIVFKNYILNGENDGVNTDKM
                     QNLSIYDLINRIRGGYIKIQGTWLPWIMAKEICKRFCFPIRYFLVPLFGSNFADECVK
                     YHEEVIEKFKQNMPLEIFDNINNFFEKGKPTKSTKLNDDLMIDPLNKCVQQKNTYIGI
                     NEVPSCTLKQPVPKKLAKEIDMEKLLDFVYKNDISRGNFINNKDSAIKDTFLCDKSNG
                     NNFKIERKGKQETNHNVIKSTMNDKNNGILKKKRKAYPRTKQMKKNLSKAFDILIQTA
                     RSTKPKTIPLTDLKNSRITSYYYGGSSRLLLLSIPTLRRKSDSNLTNDTSSLNYFDSD
                     NYDRSRRNSDIVVSNYLQRFDGLQLLNHHQDQNSINKSQALSDNNVSMYRNKIPVNQF
                     DETLTTTMSHIPVYVNTQNGKYQYNYVNASTQKTQVRSNFSNASMSQNKGLTSYYGKS
                     RRISQTSVSKDLNNEASDLNVRKYTASHQNIDNGYQLVSNSKAILLRSDNTPRYVDKN
                     HEYALTNKVVSLSNSKVKYNDENQIWNQNISLNK"
     gene            complement(<730496..>731146)
                     /gene="TPHA0C03320"
                     /locus_tag="TPHA_0C03320"
                     /db_xref="GeneID:11533977"
     mRNA            complement(<730496..>731146)
                     /gene="TPHA0C03320"
                     /locus_tag="TPHA_0C03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684870.1"
                     /db_xref="GeneID:11533977"
     CDS             complement(730496..731146)
                     /gene="TPHA0C03320"
                     /locus_tag="TPHA_0C03320"
                     /inference="similar to DNA sequence:INSDC:YNL036W"
                     /note="similar to Saccharomyces cerevisiae NCE103
                     (YNL036W); ancestral locus Anc_2.275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684918.1"
                     /db_xref="GeneID:11533977"
                     /db_xref="GOA:G8BRV8"
                     /db_xref="InterPro:IPR001765"
                     /db_xref="InterPro:IPR015892"
                     /db_xref="UniProtKB/TrEMBL:G8BRV8"
                     /translation="MPDLPQDSIFTLNRESDIDQFLHSNHKWVNSMNSAHPVLFDQYN
                     GKGQDPHTLLISCSDSRYNENCFGVLPGEIFTLKTVANICHADDLSLLATIEFAVLQL
                     KVSKIIILGHTDCGGIKTCLTNKRKDLPSQNCGHLFKYLTELDTLVNDVNKKNENNFV
                     DLPIEEKSKILSIKNVENQFNNINTIDTVKEGISNSTLQVFGMLYNVNTGLIEKCV"
     gene            complement(<733157..>733675)
                     /gene="TPHA0C03330"
                     /locus_tag="TPHA_0C03330"
                     /db_xref="GeneID:11533448"
     mRNA            complement(<733157..>733675)
                     /gene="TPHA0C03330"
                     /locus_tag="TPHA_0C03330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684871.1"
                     /db_xref="GeneID:11533448"
     CDS             complement(733157..733675)
                     /gene="TPHA0C03330"
                     /locus_tag="TPHA_0C03330"
                     /inference="similar to DNA sequence:INSDC:YIL098C"
                     /note="similar to Saccharomyces cerevisiae FMC1 (YIL098C);
                     ancestral locus Anc_2.277"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684919.1"
                     /db_xref="GeneID:11533448"
                     /db_xref="UniProtKB/TrEMBL:G8BRV9"
                     /translation="MAHASKTELLSLYKNLIKSAVRHDRRYKIIQEVNEINKEVTLLK
                     YEKLKLAKSQQLLKDSNSTMALNLKAIEKKLVELKNANPSKNREFYFSPLEFRNLIRP
                     HFEKQIRSSTGQDMINKRTLEHYKDIYLFLDNQREYDELFERYNMGEFNKMAQNVRVQ
                     KTAKRVGLEVPL"
     gene            complement(<733935..>734945)
                     /gene="TPHA0C03340"
                     /locus_tag="TPHA_0C03340"
                     /db_xref="GeneID:11533643"
     mRNA            complement(<733935..>734945)
                     /gene="TPHA0C03340"
                     /locus_tag="TPHA_0C03340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684872.1"
                     /db_xref="GeneID:11533643"
     CDS             complement(733935..734945)
                     /gene="TPHA0C03340"
                     /locus_tag="TPHA_0C03340"
                     /inference="similar to DNA sequence:INSDC:YIL096C"
                     /note="similar to Saccharomyces cerevisiae YIL096C;
                     ancestral locus Anc_2.280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684920.1"
                     /db_xref="GeneID:11533643"
                     /db_xref="InterPro:IPR019446"
                     /db_xref="UniProtKB/TrEMBL:G8BRW0"
                     /translation="MSRKLKGKIGYKKLRTTLLNHISKKQALKKRKQKIAHKTKPVIN
                     SKVKKNQQKQKEHETKFIPISKNETLLLVGEGNFSFARSLIEQDYILPENLIVTSYDA
                     SVQELKLKYPHTFEENYKFLVEEKVLIFFHIDCTNLIKSFKISKKNTWKKIMQTKGNI
                     SISGKVIQNIMFNFPHNGKGIKDMDKNIRDHQELISAYFKNCKDFFKMINSTITDAKT
                     KYTQGYSLDERKNDGRLVDGVSESGIGKVILTMFTGEPYDLWEVRALAKQTGFQVEKS
                     NKFQWENYPEYHHKRTNSEQDTTKPAQEREARTYVFKIFENSKKNKRSQKNNDDDDKD
                     MD"
     gene            complement(<735335..>735946)
                     /gene="TPHA0C03350"
                     /locus_tag="TPHA_0C03350"
                     /db_xref="GeneID:11535278"
     mRNA            complement(<735335..>735946)
                     /gene="TPHA0C03350"
                     /locus_tag="TPHA_0C03350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684873.1"
                     /db_xref="GeneID:11535278"
     CDS             complement(735335..735946)
                     /gene="TPHA0C03350"
                     /locus_tag="TPHA_0C03350"
                     /inference="similar to DNA sequence:INSDC:YNL038W"
                     /note="similar to Saccharomyces cerevisiae GPI15
                     (YNL038W); ancestral locus Anc_2.281"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684921.1"
                     /db_xref="GeneID:11535278"
                     /db_xref="GOA:G8BRW1"
                     /db_xref="InterPro:IPR019328"
                     /db_xref="UniProtKB/TrEMBL:G8BRW1"
                     /translation="MDTDMIDNMKVKETNQAELTTIERKNYTLYVSKFKSGRCLQFLI
                     LPKNYHLKLLINNVVIILITYLSYICLKNNYKQLSHITLLIGTFCVFALSNIVSTPPE
                     VNSFMVLKNYGIQVSSVKGINIFPYKLNEKYFKKNEFYSENTIVDIIINEGFKKGFQV
                     VFYLALIIRGAKNLTLLLHVCILRYLILLLRLSIILTFIMISN"
     gene            complement(<736307..>738169)
                     /gene="TPHA0C03360"
                     /locus_tag="TPHA_0C03360"
                     /db_xref="GeneID:11533947"
     mRNA            complement(<736307..>738169)
                     /gene="TPHA0C03360"
                     /locus_tag="TPHA_0C03360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684874.1"
                     /db_xref="GeneID:11533947"
     CDS             complement(736307..738169)
                     /gene="TPHA0C03360"
                     /locus_tag="TPHA_0C03360"
                     /inference="similar to DNA sequence:INSDC:YNL039W"
                     /note="similar to Saccharomyces cerevisiae BDP1 (YNL039W);
                     ancestral locus Anc_2.282"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684922.1"
                     /db_xref="GeneID:11533947"
                     /db_xref="GOA:G8BRW2"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017174"
                     /db_xref="UniProtKB/TrEMBL:G8BRW2"
                     /translation="MSSVVNKSGTRFAPKVRQRRVIKQLSVPLSAQKTLEPEIKLSDK
                     GVFDDDDPKSKVIKNISDGNKDHNVDVEKISFEQKLATDNQKDLTPSETSSSTESRLS
                     TSSTSSLDTKRRRSSRLNSLSNSNSQLLFKPIAMQSSKQQLNTTAGETVHRRLSTISN
                     PSTKKSRMSSIPESDDNLITLKKSRMSTRISISKKSGSVHRISIVPVENNNDSTSSES
                     STSNSDKKNVNSKSNMKSTKTRSKTRNKATKISFPISRADLNKVMSDDLFPETEDKYK
                     SFKIKNLGQIPKNIDDGDSEKYTIDEDQFTMAELCKHLLPIGKPSENFKKAKEADDIK
                     VKKRIEKREIRKRAREEFKSVYSLTKETIEQAKEERKKLRDDLLNSDIPDLQPSTIQL
                     KLNKEGTIAVDDESIQIDRHKNASYENSQKEKVDENPFENLCNSATYGRNSYTDPWTS
                     TELIKFYKALTMWGTDFNVIAQLFPYRTRKQIKAKFINEEKKHPIMIELALRSRLPPD
                     FDTYCDEIRKKLGSIDEFNDKLEKLQVEHEEHLKEIEDAKELAKNEDLKISKSKDINK
                     KTSGGFMTEDLKSYRKSEIVLGTIDDRKNNQRRKLQESVNFKKIDHPNSIVQGR"
     gene            complement(<738736..>739977)
                     /gene="TPHA0C03370"
                     /locus_tag="TPHA_0C03370"
                     /db_xref="GeneID:11533507"
     mRNA            complement(<738736..>739977)
                     /gene="TPHA0C03370"
                     /locus_tag="TPHA_0C03370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684875.1"
                     /db_xref="GeneID:11533507"
     CDS             complement(738736..739977)
                     /gene="TPHA0C03370"
                     /locus_tag="TPHA_0C03370"
                     /inference="similar to DNA sequence:INSDC:YNL035C"
                     /note="similar to Saccharomyces cerevisiae YNL035C;
                     ancestral locus Anc_2.283"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684923.1"
                     /db_xref="GeneID:11533507"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BRW3"
                     /translation="MSAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNS
                     PSIIKKFEVGETNINSLRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKN
                     SVFLSLESRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSD
                     KNILLSGSTDGYTNIYDLAQEDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAI
                     HELNDKSDELTEPRPLDFGDIRGQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENE
                     IMNTENHIIIPNAHGDEVIRDVFIPPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILN
                     VSKDFWNATEQLDVLSDDYNMLVGRNNEQYGENSEIKKHIKPLMITKKSRNIKAKNIN
                     RNVIKTNTPQRLVLNLIRICL"
     gene            <740939..>743032
                     /gene="TPHA0C03380"
                     /locus_tag="TPHA_0C03380"
                     /db_xref="GeneID:11534099"
     mRNA            <740939..>743032
                     /gene="TPHA0C03380"
                     /locus_tag="TPHA_0C03380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684876.1"
                     /db_xref="GeneID:11534099"
     CDS             740939..743032
                     /gene="TPHA0C03380"
                     /locus_tag="TPHA_0C03380"
                     /inference="similar to DNA sequence:INSDC:YIL095W,YNL020C"
                     /note="similar to Saccharomyces cerevisiae PRK1 (YIL095W)
                     and ARK1 (YNL020C); ancestral locus Anc_2.284"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684924.1"
                     /db_xref="GeneID:11534099"
                     /db_xref="GOA:G8BRW4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8BRW4"
                     /translation="MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPY
                     DIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGV
                     PNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLL
                     HRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEM
                     LSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLK
                     NLIRVMLMVDPSKRPNICQVVEEVSRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQME
                     QFPPLHLQHSISSPALSTVNNNIGLSNINFLQNVNNSAIQTANTTSRINNNPYSLHNS
                     STLQNTPQTIAADRRYPVSTAPKQQHNIPAYNNQINDITLQKSLSATMADAPVSTINI
                     SDNAFDRGLHLSELQKSVTALNNDMNHIYSQKQEGGRGKISSILNSNPNSLDQSPTRA
                     ENNALSTKSSRVDLSVFNDNDQPPYIKNVLPVEDDADDDIYTTKPFNSKLTDISLTSL
                     QKEITELKMELSKNDSKNAVDSRSSFNSNAEPSSELTNKTVKKNSITDRYLNSVGDNG
                     VTSVKKTAEGYGKYTKVSDKEGSLTSVNTAKPLESGHKSENTNKYIKGNTKQKVPPKL
                     PTKPSYLGGKRIESK"
     gene            complement(<743315..>745420)
                     /gene="TPHA0C03390"
                     /locus_tag="TPHA_0C03390"
                     /db_xref="GeneID:11535262"
     mRNA            complement(<743315..>745420)
                     /gene="TPHA0C03390"
                     /locus_tag="TPHA_0C03390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684877.1"
                     /db_xref="GeneID:11535262"
     CDS             complement(743315..745420)
                     /gene="TPHA0C03390"
                     /locus_tag="TPHA_0C03390"
                     /inference="similar to DNA sequence:INSDC:YNL021W"
                     /note="similar to Saccharomyces cerevisiae HDA1 (YNL021W);
                     ancestral locus Anc_2.285"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684925.1"
                     /db_xref="GeneID:11535262"
                     /db_xref="GOA:G8BRW5"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR017321"
                     /db_xref="InterPro:IPR019154"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:G8BRW5"
                     /translation="MSEQIGDKRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKP
                     NLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPS
                     LTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVY
                     LNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSV
                     AAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPE
                     GNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDA
                     AHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGE
                     PPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAIESQIPKMFP
                     LQDAIRNAQLSHYYDDFGMISLSLPNLNLPKNSIICSSNFFKAKSLCVLLHDTPEVWG
                     NRDIITGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDV
                     MISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPI
                     VPSLDESLGDWYFKNSLVFTDHFHGCWSENDKKPRKKYGRVLRCDTDGIHNIIEERFE
                     EATDFILDAFDEWSDTEDE"
     gene            <747016..>748500
                     /gene="TPHA0C03400"
                     /locus_tag="TPHA_0C03400"
                     /db_xref="GeneID:11534078"
     mRNA            <747016..>748500
                     /gene="TPHA0C03400"
                     /locus_tag="TPHA_0C03400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684878.1"
                     /db_xref="GeneID:11534078"
     CDS             747016..748500
                     /gene="TPHA0C03400"
                     /locus_tag="TPHA_0C03400"
                     /inference="similar to DNA sequence:INSDC:YNL022C"
                     /note="similar to Saccharomyces cerevisiae YNL022C;
                     ancestral locus Anc_2.286"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684926.1"
                     /db_xref="GeneID:11534078"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BRW6"
                     /translation="MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNP
                     KHIYAVMASCWKYKPYLETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKR
                     IQMGKHPLKEYVLKYKTSLRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINP
                     IRTPLSKGVEGILEELEKKFPTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHEL
                     YKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQI
                     HAFEKDPERAKVLQKMVRTAGCARTIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSG
                     IFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVK
                     HAMTFPKARKLVYSTCSIHAEENERVVIDLLLDETIKKAGWRVANREKVIPTWPRRGW
                     VDEFKEVFRDDEEKCKEIAGGCIRALPKEDGGIGFFAVCFERDI"
     gene            complement(<748639..>749754)
                     /gene="TPHA0C03410"
                     /locus_tag="TPHA_0C03410"
                     /db_xref="GeneID:11533605"
     mRNA            complement(<748639..>749754)
                     /gene="TPHA0C03410"
                     /locus_tag="TPHA_0C03410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684879.1"
                     /db_xref="GeneID:11533605"
     CDS             complement(748639..749754)
                     /gene="TPHA0C03410"
                     /locus_tag="TPHA_0C03410"
                     /inference="similar to DNA sequence:INSDC:YIL094C"
                     /note="similar to Saccharomyces cerevisiae LYS12
                     (YIL094C); ancestral locus Anc_2.287"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684927.1"
                     /db_xref="GeneID:11533605"
                     /db_xref="GOA:G8BRW7"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:G8BRW7"
                     /translation="MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQ
                     VLETIGPKHGLTFNFIDLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTK
                     VEGYSSPIVALRKELGLYANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDE
                     KTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFR
                     EVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAAL
                     VGSLGVVPSANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQ
                     DIQTAVDSNLREDKIKTPDLGGKNSTSDVVNDVIRRL"
     gene            complement(<750353..>751159)
                     /gene="TPHA0C03420"
                     /locus_tag="TPHA_0C03420"
                     /db_xref="GeneID:11533471"
     mRNA            complement(<750353..>751159)
                     /gene="TPHA0C03420"
                     /locus_tag="TPHA_0C03420"
                     /product="mitochondrial 37S ribosomal protein RSM25"
                     /transcript_id="XM_003684880.1"
                     /db_xref="GeneID:11533471"
     CDS             complement(750353..751159)
                     /gene="TPHA0C03420"
                     /locus_tag="TPHA_0C03420"
                     /inference="similar to DNA sequence:INSDC:YIL093C"
                     /note="similar to Saccharomyces cerevisiae RSM25
                     (YIL093C); ancestral locus Anc_2.290"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM25"
                     /protein_id="XP_003684928.1"
                     /db_xref="GeneID:11533471"
                     /db_xref="GOA:G8BRW8"
                     /db_xref="InterPro:IPR016939"
                     /db_xref="UniProtKB/TrEMBL:G8BRW8"
                     /translation="MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFER
                     TPKFTNPSNNKKLNELRIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYI
                     EDQLREVFYIQHPWELSRPKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKK
                     KLIMIFQKHTIKARYEFYRVRMQSEIEEQVAQEEAEMFGSVFGPSTIEFGMDQEQKVI
                     DVWKRKAIAETELMEAKRTNPSETWAQEKEEDVNYPDGEQITEEATGITL"
     gene            <751723..>751941
                     /gene="TPHA0C03430"
                     /locus_tag="TPHA_0C03430"
                     /db_xref="GeneID:11533962"
     mRNA            <751723..>751941
                     /gene="TPHA0C03430"
                     /locus_tag="TPHA_0C03430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684881.1"
                     /db_xref="GeneID:11533962"
     CDS             751723..751941
                     /gene="TPHA0C03430"
                     /locus_tag="TPHA_0C03430"
                     /inference="similar to DNA sequence:INSDC:YNL024C-A"
                     /note="similar to Saccharomyces cerevisiae YNL024C-A;
                     ancestral locus Anc_2.291"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684929.1"
                     /db_xref="GeneID:11533962"
                     /db_xref="InterPro:IPR009653"
                     /db_xref="UniProtKB/TrEMBL:G8BRW9"
                     /translation="MSALFNFSSLLQVILLLICSSTYIHSQWPSLFDRYKDTGVLSTF
                     WKLSRIGERASPYVSIACIIMAVNQFNS"
     gene            <752685..>754424
                     /gene="TPHA0C03440"
                     /locus_tag="TPHA_0C03440"
                     /db_xref="GeneID:11533979"
     mRNA            <752685..>754424
                     /gene="TPHA0C03440"
                     /locus_tag="TPHA_0C03440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684882.1"
                     /db_xref="GeneID:11533979"
     CDS             752685..754424
                     /gene="TPHA0C03440"
                     /locus_tag="TPHA_0C03440"
                     /inference="similar to DNA sequence:INSDC:YIL090W"
                     /note="similar to Saccharomyces cerevisiae ICE2 (YIL090W);
                     ancestral locus Anc_2.293"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684930.1"
                     /db_xref="GeneID:11533979"
                     /db_xref="InterPro:IPR013635"
                     /db_xref="UniProtKB/TrEMBL:G8BRX0"
                     /translation="MTSDNKLFSFQEGTKKKKRQRQKQKQREKLMQETVVVRQPSRRK
                     YILQNLIPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFIST
                     SVTIITKRLTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYY
                     NEKNGTNTKYQILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNS
                     WILFFYYYYIFIKPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWV
                     ILSLLSSGGVITATLYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGS
                     AIESSLFFAYIVRCIYEMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKY
                     IMDAFSSFSSIEHHLFPKTIELGISKNLIVKQFWVFLKNFTINVPSSINDLIQITAQM
                     AVDSISPAIIINLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIA
                     MYTHLILQFSGELKKNICLWNCENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWT
                     IIIYASELIGGRS"
     gene            <756410..>757495
                     /gene="TPHA0C03450"
                     /locus_tag="TPHA_0C03450"
                     /db_xref="GeneID:11535268"
     mRNA            <756410..>757495
                     /gene="TPHA0C03450"
                     /locus_tag="TPHA_0C03450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684883.1"
                     /db_xref="GeneID:11535268"
     CDS             756410..757495
                     /gene="TPHA0C03450"
                     /locus_tag="TPHA_0C03450"
                     /inference="similar to DNA sequence:INSDC:YNL025C"
                     /note="similar to Saccharomyces cerevisiae SSN8 (YNL025C);
                     ancestral locus Anc_2.294"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684931.1"
                     /db_xref="GeneID:11535268"
                     /db_xref="GOA:G8BRX1"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015429"
                     /db_xref="InterPro:IPR023598"
                     /db_xref="UniProtKB/TrEMBL:G8BRX1"
                     /translation="MSASYWTSTQRFQWQHTKESLDKERQKLWILEYQLFPQGLNIVI
                     DPKPNNLNLDSATKNPGNNVSLSGNMNVPVTKNIPISHRDLHYDKDFNLRIYCYFLIM
                     KLGRRLNIRQCALATAQIYLSRFLIKVSIREINLYLLVTTCVYLACKVEECPQYIRTL
                     VSEARSLWPEFIPPDPTKITEFEFYLIEELESYLIVHHSYTSMEQIINILNDKKYNLV
                     ISSEDIQNCWSLINDSYISDVHLLYPPHVIAMACLFITICIRGKVSKSSLNGTQSSTN
                     SLKINNDNYNNSLNIDRRSHSIFNRFMAESHVDLDEVMDTIQELITLYDHWDKYHESW
                     IKFLLHTLYLRPNRVNQPHASITPDNL"
     gene            complement(<757629..>759050)
                     /gene="TPHA0C03460"
                     /locus_tag="TPHA_0C03460"
                     /db_xref="GeneID:11533612"
     mRNA            complement(<757629..>759050)
                     /gene="TPHA0C03460"
                     /locus_tag="TPHA_0C03460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684884.1"
                     /db_xref="GeneID:11533612"
     CDS             complement(757629..759050)
                     /gene="TPHA0C03460"
                     /locus_tag="TPHA_0C03460"
                     /inference="similar to DNA sequence:INSDC:YIL088C"
                     /note="similar to Saccharomyces cerevisiae AVT7 (YIL088C);
                     ancestral locus Anc_2.295"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684932.1"
                     /db_xref="GeneID:11533612"
                     /db_xref="GOA:G8BRX2"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:G8BRX2"
                     /translation="MEAVATVNSSIVNLVKTIVGAGLLAIPFVFQNDGILFGVLLTLL
                     AATTSGFGLFALAKCSKVMLNPRNASFFTVCLMTNHKLSVINDLAMIVQCFGVGVSYV
                     VLVGDLFPIVFGGERNTWIIASLVVILPLCLLRSMNSLKYSSILGLFALTYLTLLVIS
                     NFLDDVILTDKFMQHRGDVNWIKIRDYKGFVTTFNIIIFAFTGAMNLFSIINELEENS
                     MKNISHVINYSIGISTILFLSVGITGYLTFGSNTVGNIMLNYDPNSVWTNVGNFCLGA
                     MVILSFPLLFHPLRDAVNNIIVYYQYYKSNNDQDSGVIVGNNYDSTYSRPISLSVADD
                     EEEEVNSLVNGEMNITVDNSSILEDVNENQFTSGIKSDFSQSRFYIITFALLAVIYIT
                     ALTVTSFSLILAFVGATGSTSISFILPGYFGFKLIGTDSLIVGEMIPKRDMFYKKCSQ
                     GLCFFGLFIMVFSLYLILTGNNS"
     gene            <759402..>760196
                     /gene="TPHA0C03470"
                     /locus_tag="TPHA_0C03470"
                     /db_xref="GeneID:11535204"
     mRNA            <759402..>760196
                     /gene="TPHA0C03470"
                     /locus_tag="TPHA_0C03470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684885.1"
                     /db_xref="GeneID:11535204"
     CDS             759402..760196
                     /gene="TPHA0C03470"
                     /locus_tag="TPHA_0C03470"
                     /inference="similar to DNA sequence:INSDC:YNL032W"
                     /note="similar to Saccharomyces cerevisiae SIW14
                     (YNL032W); ancestral locus Anc_2.296"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684933.1"
                     /db_xref="GeneID:11535204"
                     /db_xref="GOA:G8BRX3"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020428"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G8BRX3"
                     /translation="MPAIEDIVNLKSSNEEESLLTQTDFGDNIDPCQVLTENEIYSKQ
                     GDEYLRKFHDECGDLKVNSEDADDQLDNLELQLKTQRMTELIGDHNGMLTDRNEVIPP
                     ENFSHVIGEIYRSSFPRIENFSFLQKRLKLKSILVLIPEEYPQENLEFLNKANIKLFQ
                     VGMSGNKEPFVNIPSDLFTKALEIVINPENQPILIHCNRGKHRTGCLIGCIRKLQNWS
                     LTMIFDEYRRFSFPKARALDQQFIELYDDKYIKEVATKNSWLPLKW"
     gene            complement(<760332..>760742)
                     /gene="TPHA0C03480"
                     /locus_tag="TPHA_0C03480"
                     /db_xref="GeneID:11533772"
     mRNA            complement(<760332..>760742)
                     /gene="TPHA0C03480"
                     /locus_tag="TPHA_0C03480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684886.1"
                     /db_xref="GeneID:11533772"
     CDS             complement(760332..760742)
                     /gene="TPHA0C03480"
                     /locus_tag="TPHA_0C03480"
                     /inference="similar to DNA sequence:INSDC:YNL031C"
                     /note="similar to Saccharomyces cerevisiae HHT2 (YNL031C);
                     ancestral locus Anc_2.298"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684934.1"
                     /db_xref="GeneID:11533772"
                     /db_xref="GOA:G8BVI6"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G8BVI6"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
     gene            <761873..>762184
                     /gene="TPHA0C03490"
                     /locus_tag="TPHA_0C03490"
                     /db_xref="GeneID:11533647"
     mRNA            <761873..>762184
                     /gene="TPHA0C03490"
                     /locus_tag="TPHA_0C03490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684887.1"
                     /db_xref="GeneID:11533647"
     CDS             761873..762184
                     /gene="TPHA0C03490"
                     /locus_tag="TPHA_0C03490"
                     /inference="similar to DNA sequence:INSDC:YNL030W"
                     /note="similar to Saccharomyces cerevisiae HHF2 (YNL030W);
                     ancestral locus Anc_2.299"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684935.1"
                     /db_xref="GeneID:11533647"
                     /db_xref="GOA:G8BQI9"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR019809"
                     /db_xref="UniProtKB/TrEMBL:G8BQI9"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEEVRAVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            complement(<762403..>763437)
                     /gene="TPHA0C03500"
                     /locus_tag="TPHA_0C03500"
                     /db_xref="GeneID:11533832"
     mRNA            complement(<762403..>763437)
                     /gene="TPHA0C03500"
                     /locus_tag="TPHA_0C03500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684888.1"
                     /db_xref="GeneID:11533832"
     CDS             complement(762403..763437)
                     /gene="TPHA0C03500"
                     /locus_tag="TPHA_0C03500"
                     /inference="similar to DNA sequence:INSDC:YIL084C"
                     /note="similar to Saccharomyces cerevisiae SDS3 (YIL084C);
                     ancestral locus Anc_2.301"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684936.1"
                     /db_xref="GeneID:11533832"
                     /db_xref="InterPro:IPR013907"
                     /db_xref="UniProtKB/TrEMBL:G8BQJ0"
                     /translation="MLSRKMNQTELSRRDKRRHNIESKVTKVYSGFISNKDTYYKDRL
                     TTLQTNLTTLHQGNNQFYVRSIRDLEEERDAELIRLRLYEEYRISRSSVEFQEDIEKG
                     KSEYEDLVKLCKEKLYESIENKMKNLKEERLLMDIANTHSYAMDYNRTRFHKNTRSHT
                     ASGWESASNTDFASFATGKNNNNAYNSPNESTDTGANTDRRSLRRRVATKSAMGTLNS
                     ENHSDHGNSTSAYNRDGFTSGNANESDYNSAGKDTANRQLQSDSDFLQYLSDNSDLQT
                     LLFGEDAQNNANSSNSSNKRKPKNSQRLSTKTAPPLASLSSDEVTNDIVVIRDLTGQP
                     EAPFKVRTEQ"
     gene            <763454..>763978
                     /gene="TPHA0C03510"
                     /locus_tag="TPHA_0C03510"
                     /db_xref="GeneID:11533806"
     mRNA            <763454..>763978
                     /gene="TPHA0C03510"
                     /locus_tag="TPHA_0C03510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684889.1"
                     /db_xref="GeneID:11533806"
     CDS             763454..763978
                     /gene="TPHA0C03510"
                     /locus_tag="TPHA_0C03510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684937.1"
                     /db_xref="GeneID:11533806"
                     /db_xref="UniProtKB/TrEMBL:G8BQJ1"
                     /translation="MVTLSTGRIDTKAHTHTHTHLYIYTYMYVKIDMSAYICALVGTI
                     KVKLLSSCEEAWCEYPIRSISRSGHMSARGKQALSDPTSTSDGAILRRACSHGGFESV
                     SAQRHSSKQHFMGLLQRRHVYMHASPMALACPYPPPHAAPRCHCRCPLPSLLRCGYPP
                     LTNNEGPHPLAGRR"
     gene            <764414..>765742
                     /gene="TPHA0C03520"
                     /locus_tag="TPHA_0C03520"
                     /db_xref="GeneID:11535193"
     mRNA            <764414..>765742
                     /gene="TPHA0C03520"
                     /locus_tag="TPHA_0C03520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684890.1"
                     /db_xref="GeneID:11535193"
     CDS             764414..765742
                     /gene="TPHA0C03520"
                     /locus_tag="TPHA_0C03520"
                     /inference="similar to DNA sequence:INSDC:YNL016W"
                     /note="similar to Saccharomyces cerevisiae PUB1 (YNL016W);
                     ancestral locus Anc_2.306"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684938.1"
                     /db_xref="GeneID:11535193"
                     /db_xref="GOA:G8BQJ2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BQJ2"
                     /translation="MSEQEHIVEDTVPAEELASSSPASPESIETPVAAESQENQEDEN
                     QDRQKDQESVGTAAEDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIG
                     GPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTT
                     SDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQE
                     DAQTAMDKMQSTELNGRQIRINWASKRENATNGNGNNNNRNMNNRRNNNNSNSNGPRG
                     GFRSYNNNMPPLPMGNMPMSAPPAGPAVLPPVNPQAVDDMIRRAPLRVTTVYIGNIPH
                     FATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYPFQGRNLKT
                     GWGKEKAVFIPMGQQQGMMMSGMPPPPPQQQQQFQQDASTPIPNEQQQQQ"
     gene            <766335..>766877
                     /gene="TPHA0C03530"
                     /locus_tag="TPHA_0C03530"
                     /db_xref="GeneID:11533937"
     mRNA            <766335..>766877
                     /gene="TPHA0C03530"
                     /locus_tag="TPHA_0C03530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684891.1"
                     /db_xref="GeneID:11533937"
     CDS             766335..766877
                     /gene="TPHA0C03530"
                     /locus_tag="TPHA_0C03530"
                     /inference="similar to DNA sequence:INSDC:YDL120W"
                     /note="similar to Saccharomyces cerevisiae YFH1 (YDL120W);
                     ancestral locus Anc_2.309"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684939.1"
                     /db_xref="GeneID:11533937"
                     /db_xref="GOA:G8BQJ3"
                     /db_xref="InterPro:IPR002908"
                     /db_xref="InterPro:IPR017789"
                     /db_xref="InterPro:IPR020895"
                     /db_xref="UniProtKB/TrEMBL:G8BQJ3"
                     /translation="MFRNSIIRFQRYVSHPVQKNISRSISSKILVLSAARNLTFKQLT
                     VNNKVSQRAYASASTGGFQIPDEVKNLNIEVYHNVADQFLEELSENIEDISQNFPKDI
                     PDVDLSHGVLTVTVHKFGTYVINKQPPNKQIWLASPISGPNRYDYYKGEWVSLRDNTK
                     ILDVLKKELTEAVPNAKISL"
     gene            complement(<767147..>768049)
                     /gene="TPHA0C03540"
                     /locus_tag="TPHA_0C03540"
                     /db_xref="GeneID:11533821"
     mRNA            complement(<767147..>768049)
                     /gene="TPHA0C03540"
                     /locus_tag="TPHA_0C03540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684892.1"
                     /db_xref="GeneID:11533821"
     CDS             complement(767147..768049)
                     /gene="TPHA0C03540"
                     /locus_tag="TPHA_0C03540"
                     /inference="similar to DNA sequence:INSDC:YDL119C"
                     /note="similar to Saccharomyces cerevisiae YDL119C;
                     ancestral locus Anc_2.313"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684940.1"
                     /db_xref="GeneID:11533821"
                     /db_xref="GOA:G8BQJ4"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8BQJ4"
                     /translation="MSEKVTRNRTHLLGGFLGGLTSAVALQPLDLLKTRIQQQKTNTL
                     WSVFKSFDSPSQLWRGTLPSALRTSIGSALYLTSLNVMRTTLVKQKSWNHQSQLVTNK
                     SSLLPHLSVYENLLTGAFARGVVGFITMPITVIKVRYESTLYNYKSINDSIKDIYKTD
                     HIKGFFRGLLPTIIRDAPYAGIYVLLYEKAKEITPSLVPLKLLNDRNNGHFSSTTSTL
                     INSSSAILAASLATTITAPFDTIKTRMQLQPNLFPSFLKAGMIIIQKENLRQLFSGLS
                     MRLSRKAMSAGIAWGIYEELIKIT"
     gene            complement(<768350..>769180)
                     /gene="TPHA0C03550"
                     /locus_tag="TPHA_0C03550"
                     /db_xref="GeneID:11533782"
     mRNA            complement(<768350..>769180)
                     /gene="TPHA0C03550"
                     /locus_tag="TPHA_0C03550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684893.1"
                     /db_xref="GeneID:11533782"
     CDS             complement(768350..769180)
                     /gene="TPHA0C03550"
                     /locus_tag="TPHA_0C03550"
                     /inference="similar to DNA sequence:INSDC:YGL154C"
                     /note="similar to Saccharomyces cerevisiae LYS5 (YGL154C);
                     ancestral locus Anc_2.314"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684941.1"
                     /db_xref="GeneID:11533782"
                     /db_xref="GOA:G8BQJ5"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="UniProtKB/TrEMBL:G8BQJ5"
                     /translation="MDSSNDFETLMDTLKNGVDNNWSAILLVLIDPTSISFLDDDYEF
                     ELALGLIPFEQRVCILNKKNNADKYKALSNKLLQLFGCGMLLDWKGSADASFTTNKFG
                     KPSVENVSFNMSNGRNLVGMYVVNAGNVDVGIDIASFSDYNTELLNTTDVFAFEEIAL
                     FDGVAGNDLRRQLFAHLWSLKEAYIKFLGTGLSYYNALSTLNFAEELKNIYYIKDIDK
                     NEFEKVIGGKSLTFTSYNALNNEVVSVCSENERSVDNKRPSPVVYSINIRCVIDYLDK
                     "
     gene            <769686..>770816
                     /gene="TPHA0C03560"
                     /locus_tag="TPHA_0C03560"
                     /db_xref="GeneID:11533622"
     mRNA            <769686..>770816
                     /gene="TPHA0C03560"
                     /locus_tag="TPHA_0C03560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684894.1"
                     /db_xref="GeneID:11533622"
     CDS             769686..770816
                     /gene="TPHA0C03560"
                     /locus_tag="TPHA_0C03560"
                     /inference="similar to DNA sequence:INSDC:YGL148W"
                     /note="similar to Saccharomyces cerevisiae ARO2 (YGL148W);
                     ancestral locus Anc_2.318"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684942.1"
                     /db_xref="GeneID:11533622"
                     /db_xref="GOA:G8BQJ6"
                     /db_xref="InterPro:IPR000453"
                     /db_xref="InterPro:IPR020541"
                     /db_xref="UniProtKB/TrEMBL:G8BQJ6"
                     /translation="MSTFGQIFRVTTYGESHCKSVGCIVDGIPPGMSLTEEDIQPQLT
                     RRRPGQSKLSTPRNEKDKVEIQSGTEFGKTLGTPLAMIVKNEDQRPHDYSDMDNYPRP
                     SHADYTYMEKYNLKASSGGGRASARETIGRVAAGAIAEKFLQQVSNVEIVAFVTQIGE
                     IKMNRDPFDKKFQHLLNTITRSKVDAVGPIRCPDTSVAGDMVKEIEKYRGANDSIGGV
                     VTCVIRNVPTGLGEPCFDKLEAMLAHAMLSIPASKGFEIGSGFAGVAVPGSKHNDPFY
                     FDDESKKLRTTTNNSGGIQGGISNGENIYFSVPFKSAATICQEQETATYEGQTGILSA
                     KGRHDPSVTPRAIPIVEAMAALVLADALLIQKARDFGKSVVH"
     gene            <771348..>773585
                     /gene="TPHA0C03570"
                     /locus_tag="TPHA_0C03570"
                     /db_xref="GeneID:11534086"
     mRNA            <771348..>773585
                     /gene="TPHA0C03570"
                     /locus_tag="TPHA_0C03570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684895.1"
                     /db_xref="GeneID:11534086"
     CDS             771348..773585
                     /gene="TPHA0C03570"
                     /locus_tag="TPHA_0C03570"
                     /inference="similar to DNA sequence:INSDC:YDL116W"
                     /note="similar to Saccharomyces cerevisiae NUP84
                     (YDL116W); ancestral locus Anc_2.320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684943.1"
                     /db_xref="GeneID:11534086"
                     /db_xref="GOA:G8BQJ7"
                     /db_xref="InterPro:IPR007252"
                     /db_xref="UniProtKB/TrEMBL:G8BQJ7"
                     /translation="MDIDIVNDSTTDLCYTEFSKALTEFVYNHFKRNGKHTSISSKNE
                     DDSETSYEDPIDLIREFRSIAAKMAIKESSNDDGNSKLSSDFELEAKLWHLTELILDF
                     RMSSDDDNLDGVSNIKAKPYNSNIVYEKECLENNKSLHEIWIIIYWLQSNLPRVERPN
                     DIPGTKWNNTMVSGNLHSVDLDSPLRDANVIIDAKDKVQDHVFYKYIFDLLLCGEYER
                     VFEECKLSDNITMYMILCGMQEYVDPVVDSQLRNGFEKQQGVKKRILWRRAVYNLSLN
                     DSLDSYERAIYSYLAGDFPNDEEVRSNLSWAKELLIYLNQIMNIEIENYLMKEEKVTK
                     DELILALPSKSMDLQSILNLLSNKYSTEAAHPLRVLIGAVILDTLPSVLHSSVSMLMD
                     VVNGNDDDNDLFHEAYLLRIVTHMSIFIELLNPEVVSKEDNYNLITAYITVLRLHSLL
                     EYIPVYVKFIDSDKGIDAYSFILSTLKDPDTRLKQIEISNSLYLPIVNILKRTTERVF
                     SETEQSYIPNTEVLITKGVSDIDEHLILAVEWLILGKQYEDSIASVLALARRFLINGK
                     VGALSLLFSRNELSSLIKNYQLTKLENSSYDSNSDFSIKELKEYHYLTDIFKQYEEWH
                     KSIKLLNTQSNIPSLIEKFTEYSKNTTDLIKFFLVELTANTDGVDYDILFEIRALYTP
                     YLIIELHKGLLEAASMLKIPKFLDQALRFTDLVANEESKIYLLFQSSGRLKEYLKLVA
                     YTATL"
     gene            complement(<773805..>775688)
                     /gene="TPHA0C03580"
                     /locus_tag="TPHA_0C03580"
                     /db_xref="GeneID:11533518"
     mRNA            complement(<773805..>775688)
                     /gene="TPHA0C03580"
                     /locus_tag="TPHA_0C03580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684896.1"
                     /db_xref="GeneID:11533518"
     CDS             complement(773805..775688)
                     /gene="TPHA0C03580"
                     /locus_tag="TPHA_0C03580"
                     /inference="similar to DNA sequence:INSDC:YDL113C"
                     /note="similar to Saccharomyces cerevisiae ATG20
                     (YDL113C); ancestral locus Anc_2.324"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684944.1"
                     /db_xref="GeneID:11533518"
                     /db_xref="GOA:G8BQJ8"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:G8BQJ8"
                     /translation="MDKQASIHDQNIVEELETVNLNENEPSVLIDSNINSVNSGIPSN
                     NIQKKRIKEISSASEPPDLEQPDRAPEMHETTEARGDTSYVAYSNKIENIDGSNLEIN
                     DDLMEKLNISSNKLSSMVNPNTEYSKSHSLDGGLITDSETVRENESKQVPNKSVFITN
                     TNKISEGQGRSYISYSIKYGNDVVQRRYSDFENFRSILVRLFPINIIPSIPEKQTLKS
                     YGKSITNKNTSYLLPLEGTSSIDMALSNINGTVRASEETFIRHRIRILTRFLNKLLDD
                     DEIMSTTIVTDFLDPNVSNWSDFVNSSATFSSLRKSELQCNPLDPTNTTRMHACLPIP
                     SSSSLSPITKERKTEAADGEVEKRDSFEILDNDHKQYETLMKNGIYRHNKRITKAWVG
                     VQEDMNDLSEIFAYLSNNQMGKEATLAEQTTYVSNAYDESATELEKLVGLLYYDIDES
                     FSELVYDAESMKELLNYRRMKKLQLNLIESTLGSKIKHLEKIEHKENETQKNTETFTN
                     EISDPLKPQRQLTYGGLLKNKFNKLTTMVKESLNYQELDPESLKEELGKDIKYLKESQ
                     VVASSDLEEISKIIVGRRVSKYVAEREEALTKSLENYSKYMMEYSKKNMEIWKLIRDS
                     QNT"
     gene            <776267..>780547
                     /gene="TPHA0C03590"
                     /locus_tag="TPHA_0C03590"
                     /db_xref="GeneID:11535274"
     mRNA            <776267..>780547
                     /gene="TPHA0C03590"
                     /locus_tag="TPHA_0C03590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684897.1"
                     /db_xref="GeneID:11535274"
     CDS             776267..780547
                     /gene="TPHA0C03590"
                     /locus_tag="TPHA_0C03590"
                     /inference="similar to DNA sequence:INSDC:YDL112W"
                     /note="similar to Saccharomyces cerevisiae TRM3 (YDL112W);
                     ancestral locus Anc_2.325"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684945.1"
                     /db_xref="GeneID:11535274"
                     /db_xref="GOA:G8BQJ9"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:G8BQJ9"
                     /translation="MSSSEAFIAKYLSQQQQLELINDLIDNNDFVKLSELFVALKDLL
                     ILSDIDEAIIKLYSKIEPIIIEVLSNSEIDDESLNIEVNIMQGETMENIVQLINTLPS
                     LQCKVQNWILVKLKEYIRHFKTRLFNPEFYDNFVNNSIKNFEDSSSQTYSAVALLNLL
                     ECIQTSSNDTENHETSEINTIIVILLGSDINNIASAAEKNLRWRIQYIVQQCLSSDSF
                     DKFIWVLIQSLYQDGKSSEWKIYNALTFQLRFISAGKISDHLKLILKIDSFWENIQSA
                     LNSDIHLYRKLGLSVLQSTIKVISLSIEKIDTKLFHWDMNQKNEIIESWKKFTTLYEI
                     ITLDTSLNQLEEASSEVIEIFKNEYIYPSWSMLLFSTGLNASMESVRKYVLSLVFKVQ
                     NKEIFLSNTDILKDTILPTIAQAQFYITDGVTCKYGDTVSSFVSDLILTGSNTAEDIL
                     KVILEMIIERNSSFDASRVYISFGILSAFKSKKLRILSSTHLVLLRKIFEFEAEDEIT
                     ETTLQKIYLKCLLYISKTVSVTEWIHTLANEITCRGSYRYISSLFEDLRDFAVINFEF
                     DKSRDLLEPLLGTSVTFDLLAAILFSVEVQPTKSFLLEIAKSEEVLDNYTQDINDLLL
                     KLLNEDLEDEEYILMDQLCKYKGFSTITWTSVSAKHVFQQLNSKFTGNKFIFFVSIFE
                     YTANYNMEADEINFNDIIQLYNTIKLHVQQFSQDEFKFKDKIYANYFQLVQTYLKSNA
                     IEIKIGDGELSHLIEIMRSNCTTDSGNYLSDFSIGMLIEYILNTFFTETVENGDIENA
                     YVLNLFDILVLLWENIASERLVLKQRAFHLCLIKSIFNPIIMLHAAKKNNSIYLMLKD
                     IGCNIIAQAHARRGFLPSISKCFSDFIPKFSKLLSKDNSEYEWIGKLLRKAFTLQLAN
                     SNVFQIKSTIATLFDNNLTSYVASSPYGIYFDVYGAEESSSRVYIIDTIISSPSFFKE
                     HFVYAALTETSALTPVKRTDGVEEVQRLLLWQLIVACAPKLDAEILIHYSSKYILDSL
                     FLESSPLVRIYKEWYLAFEIAHSIESGSISNSCDFLFSQLDDHSRPMLVVSAEKILFI
                     VLKYLAENGIEHQAILERFIGILIANASSNKPHVRHFSNSLMISFWPVFEESISDKTL
                     RLVLHNLYDNAKMSELTGQYRTGDANIWDLKADYTFTNVFGIILKRTTDHDVPYICES
                     TFTKYMQHLDDSLIGSDNEDSWLSKRDPSNNNREIKVIDQKGSQLQTKSGAWETVVDI
                     NATENEEKVKRSDLIVVSSLVDKPPNLGGICRLCDVLGVGLLTVQDLRVKNHPQFKNV
                     AVTADKWMPMVEVPIDNIIKFMQEKKKEGYTLIGLEQTDKSIELNQYYKFPKKSLILL
                     GTEAHGIPGYLLSELDLCLEIQQHGVIRSMNIQTATAVICYSYTVQHM"
     gene            <781013..>783151
                     /gene="TPHA0C03600"
                     /locus_tag="TPHA_0C03600"
                     /db_xref="GeneID:11534101"
     mRNA            <781013..>783151
                     /gene="TPHA0C03600"
                     /locus_tag="TPHA_0C03600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684898.1"
                     /db_xref="GeneID:11534101"
     CDS             781013..783151
                     /gene="TPHA0C03600"
                     /locus_tag="TPHA_0C03600"
                     /inference="similar to DNA sequence:INSDC:YGL145W"
                     /note="similar to Saccharomyces cerevisiae TIP20
                     (YGL145W); ancestral locus Anc_2.329"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684946.1"
                     /db_xref="GeneID:11534101"
                     /db_xref="InterPro:IPR007528"
                     /db_xref="UniProtKB/TrEMBL:G8BQK0"
                     /translation="MLRDINDILDITSKIEEVNRERDELASKIQKINATSELALREST
                     HRDKIVTEATKDILNNAKSLDSVIELKDKYGDLSILNNLQEHFKKQKKIDLALKDLEN
                     VESDINSLFLDSIINTNYEVVKEIADKLNVFVSEYLNLDSKISTFLQSLIKKFNEEFL
                     ENYISVISEDFEKELLEAKWDKIDYMLRIDDNVLKLRALSTNIYKFSQCYIICNENDN
                     NKLQKFRFRNFKSIANNFKIRFMFHFHETNLNNKKFKLQIYFQFLNSYLSENLYKCIN
                     IFHDHRNAISESLVHEQFIDHILEPIRTKIKFILMNKKKENDIKTLLILISEILTTDK
                     NLTKSYKYQGNSLINLIPSDIWDLWVSYHIEVSTKQVDSLFNVNNPNANSNEDQLTNS
                     SKDFIKLFNKFFLNLEAFFELSLISIHEEYKLILFSKIFLNLINKYLSFVLEINILKD
                     GNKHSKQEELLQTLIKLENLSIVNKMLIEYSNNLIFIQLTDLVNKQNKSNSQKINSIF
                     ENVINEYETNINHDIKDSIIYRIQKLLKESLLKYFKISSKTWSTISDNSDNANKNMHI
                     SSELSNTVKLMTNINTQLKNLDIDQSLKFSIGNEILNITVKYFTENILKLNIFNRQGL
                     MQVKHDYESVVMSLDILNDDYINFNHKIMLESLAILNLKYDFNAQEFTLKEYAKGNQF
                     TDLKDYLSIKYMNDSEIQETLFRIVYGNIV"
     gene            <783935..>785566
                     /gene="TPHA0C03610"
                     /locus_tag="TPHA_0C03610"
                     /db_xref="GeneID:11533516"
     mRNA            <783935..>785566
                     /gene="TPHA0C03610"
                     /locus_tag="TPHA_0C03610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684899.1"
                     /db_xref="GeneID:11533516"
     CDS             783935..785566
                     /gene="TPHA0C03610"
                     /locus_tag="TPHA_0C03610"
                     /inference="similar to DNA sequence:INSDC:YMR171C"
                     /note="similar to Saccharomyces cerevisiae YMR171C;
                     ancestral locus Anc_2.336"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684947.1"
                     /db_xref="GeneID:11533516"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR027713"
                     /db_xref="UniProtKB/TrEMBL:G8BQK1"
                     /translation="MIIQSFDNQGIPLNNNQDKINYDGDDLDGDLIIYSFIIMLLTYL
                     VLTGILLLVRFIFIRWHTTTGRLSLFPTFGELDLDLERDLNGAHSNIRRFRNQNNDQN
                     STYDNTSDHGNRTSKRKSKYSINEMNRRWPSVLFDENDNEIIFKTNNLPIEEQFYFRQ
                     GEEYIKSNPPLIIPYNHNYDVTGIDDNEDAIINEQTKIYIKEEGASAWTFVPDVNLPN
                     DTVLITNKTEVEFLNYNYDASVQTNLPIPRLNRVYYCEFKIYEVNNSNQVNDFELRDG
                     EVISFGLATSPYPYFRLPGRHHHSIAYDSTGARRFNDPFEMDSDLKNLFPKCQRGDVI
                     GVGYRINSGTVFFTRNGKKVSEKEVGGHIKGWKFKYLYPIVGANVPCKIHVNLGTSGF
                     VFIEANVKKWGFAKAHGLKLPPPSYNNYGNDTLLEGINDDDDNSQLHDESDESDYENE
                     YRIQNDIFDENGDLLPPPPSFEYSVSPNHKSIVNGEPLTLDSYPTQPPDYSDYTESNG
                     LLANFEHENEQGTSNEEEDDDDDLQEYDNDMEEYR"
     gene            complement(<785783..>787429)
                     /gene="TPHA0C03620"
                     /locus_tag="TPHA_0C03620"
                     /db_xref="GeneID:11533659"
     mRNA            complement(<785783..>787429)
                     /gene="TPHA0C03620"
                     /locus_tag="TPHA_0C03620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684900.1"
                     /db_xref="GeneID:11533659"
     CDS             complement(785783..787429)
                     /gene="TPHA0C03620"
                     /locus_tag="TPHA_0C03620"
                     /inference="similar to DNA sequence:INSDC:YDL106C"
                     /note="similar to Saccharomyces cerevisiae PHO2 (YDL106C);
                     ancestral locus Anc_2.337"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684948.1"
                     /db_xref="GeneID:11533659"
                     /db_xref="GOA:G8BQK2"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017970"
                     /db_xref="UniProtKB/TrEMBL:G8BQK2"
                     /translation="MNNSYQYYMTDQKANTQQFQSNAPPMQNLTKNNDMDPSKQKRTR
                     ARGEALDVLKAEFLKNTNPSSKRRKVLSEVTGLSEKKIRIWFQNRRAKMRKTDKSNLN
                     TGHDSASGDQNSIIGNKKNSTSPIFLAFDTIPLTSNNNYYFIDVCSITVGSWNRMKSG
                     SLKSKNPNELILSSVSNLTNLSPISINNLMLDKTDLIALISKKNYEINYFFSAIANNT
                     KILFRIFYPINTITNCSLVLETDDIISNQKSTKTNKDDLKLGELKISLSRSPNFAVFF
                     LEQSNSDNLNANQWSICEDFSEGRQVSDAFIGGSNIPHVLKGLQDSLRFINSLILDYN
                     CTNVNVNQQPTLNSFPNQQQHLLYPQPQQQQQQKQYIQQPLVSRSPMQLNGYNQPQLQ
                     QQYQPSYLNPRNQNFFFDNNDTSSMLTNNVQELNNYQTMMDPNIGISDLSENQLNMNL
                     QQTQPVQTQTQQQQQQQQQYDFANPIPIVATAATNTTTATTAAVNNTNNNTKNNNNTS
                     NNNMLMNTPEYFRTTSDMHMNINYNNNSNSHDNNVINRWL"
     gene            <789125..>790900
                     /gene="TPHA0C03630"
                     /locus_tag="TPHA_0C03630"
                     /db_xref="GeneID:11535217"
     mRNA            <789125..>790900
                     /gene="TPHA0C03630"
                     /locus_tag="TPHA_0C03630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684901.1"
                     /db_xref="GeneID:11535217"
     CDS             789125..790900
                     /gene="TPHA0C03630"
                     /locus_tag="TPHA_0C03630"
                     /inference="similar to DNA sequence:INSDC:YMR168C"
                     /note="similar to Saccharomyces cerevisiae CEP3 (YMR168C);
                     ancestral locus Anc_2.340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684949.1"
                     /db_xref="GeneID:11535217"
                     /db_xref="GOA:G8BQK3"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8BQK3"
                     /translation="MLGSYKSRTVCHECSKRKIKCDRLIPCRNCIKRNLQHRCIESNN
                     GVSSVDALDEYELYKFYLNYESVVVDVGLFKTLPTSNEQLQSNDEFKLLFNNEVYSKL
                     LDYTVTNLGCLYFGVVQDITELYDILHKAIGSDDNSYDDLLVWSLIALAVYFMDEHTF
                     SDLMGPAVARGKLYHSVVNYIIKSLYDLNFVETLDVRFLQIVAVLSNTIFLFEHNNLY
                     NNLLILSMNLLKYYKTSIGKITSHDVTGRNTIYLKLIKNTTNKIWYKFALLDYLQSNN
                     SKKFSIHTEISSLTNEPVMVTDVDPFQEAESFDLLCWKIVSLDKDITHYIAEARKPTL
                     KTLETLEKNIQGLETTVKLFLESNKRNDNISINSSFERFLLKFFIHTTKWKLYRIYYV
                     HYDNTENSFNKMAYHTRIIISQLVKNVKLKQGQFNKFPIVLFFISKMITFYTFAKLVN
                     SIENNRNHNDENEELSSDLVELLMSLPMSLNPSLEKVIFLVEKLNKLIQLFNKIRIAD
                     SISILKHPVMLILQNDINTINLINNKIPNLISSANLESLNDSLFDDYNYDNNNALENQ
                     STSFKLIIDEFELKYNIKEIIRYSA"
     gene            complement(<790924..>793332)
                     /gene="TPHA0C03640"
                     /locus_tag="TPHA_0C03640"
                     /db_xref="GeneID:11535246"
     mRNA            complement(<790924..>793332)
                     /gene="TPHA0C03640"
                     /locus_tag="TPHA_0C03640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684902.1"
                     /db_xref="GeneID:11535246"
     CDS             complement(790924..793332)
                     /gene="TPHA0C03640"
                     /locus_tag="TPHA_0C03640"
                     /inference="similar to DNA sequence:INSDC:YMR167W"
                     /note="similar to Saccharomyces cerevisiae MLH1 (YMR167W);
                     ancestral locus Anc_2.341"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684950.1"
                     /db_xref="GeneID:11535246"
                     /db_xref="GOA:G8BQK4"
                     /db_xref="InterPro:IPR002099"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR011186"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:G8BQK4"
                     /translation="MPGRIKALDETVVNKIAAGEIIISPVNALKEMMENSIDANSTNI
                     DVITKDGGIKLLQISDDGSGIDKEDLPILCQRFTTSKLNKFEDLQSINTYGFRGEALA
                     SISHIARVTVTTKTKSDNCAWKVSYAEGKMLGEPQPTAGRDGTVILVEDLFYNMPSRL
                     RSLRSGNDEYSKIVDVMGRYAVHSENIGFSCKKLGDSNFTLAIRSHAKQQDRIRIVFG
                     KNVSSNMTEIAMADDINLELKSVKGQVSDLNFVMKKSVTPTFFINNRLVSCDPLRRSI
                     YQVYTNYLPKGSKPFVYLSLLINPKSVDVNVHPTKREVRFLNQDEIIEKITTYLNEEL
                     SKLNTSKTFKTGSLLSRQLTRSQPVKSLNSSTIAANNASNASSLNKKIYEHKLVRTDA
                     NQRSITTFLKPNVSSSYDNIVKTQVIPSKRKILEESFHDPTIDSNNSEQTNGDDTLTN
                     KILKRSTRSVMEVNEATATDDGSVNISEQTINEVEIRNSVTDSNDKQFNPTVETSKTD
                     VDYEEESITQVDESKPSEYTIIDKKRTDVNLSSIKTLKEMVDNASHMELTNIFANLTY
                     VGLVDPRRRLASIQYDLKLFLVDYGAICYELFYQIGLTDFANFGQINLCTENEESLTI
                     YNILKSFEVLKDNEISIKSIIEQFITMRDMLEEYFSIKIDFIDKDQKDYKTARLASLP
                     LLLKRYTPSLSKLPFFLYRMGTKVNWKSEEECLEGILKQIALLYIPEIITEDVDNNDM
                     QDSTMIDSVKMTAVAKKEKMADLLENVIFPCVKRRFLAPDTLLKDVAEIANLPGLYKV
                     FERC"
     gene            complement(<793762..>794943)
                     /gene="TPHA0C03650"
                     /locus_tag="TPHA_0C03650"
                     /db_xref="GeneID:11533776"
     mRNA            complement(<793762..>794943)
                     /gene="TPHA0C03650"
                     /locus_tag="TPHA_0C03650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684903.1"
                     /db_xref="GeneID:11533776"
     CDS             complement(793762..794943)
                     /gene="TPHA0C03650"
                     /locus_tag="TPHA_0C03650"
                     /inference="similar to DNA sequence:INSDC:YDL104C"
                     /note="similar to Saccharomyces cerevisiae QRI7 (YDL104C);
                     ancestral locus Anc_2.343"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684951.1"
                     /db_xref="GeneID:11533776"
                     /db_xref="GOA:G8BQK5"
                     /db_xref="InterPro:IPR000905"
                     /db_xref="InterPro:IPR017860"
                     /db_xref="InterPro:IPR017861"
                     /db_xref="UniProtKB/TrEMBL:G8BQK5"
                     /translation="MSLITKLTFRNRLLHSSHTVKKRGYKVLAIETSCDDTCVSIIDR
                     FSKDEPPNLLVNLKDTLNSAETGGIIPTKAHLHHQLKIGPLTKKALDISNNPKIDLIC
                     VTRGPGMPGSLSGGLDFAKGLSVAWNVPYVGVHHMLGHLLMPRMKNNGNLVKFPLLSL
                     LASGGHTTLVYSSSVTEHEILCDSLDIAVGDSLDKCGREIGIQGNMIAKEMESFINSS
                     VNEIDESILTENQKVTLPNPLKNKPKRMDTQAFSFAPFLTAVRNHLIKYPLVNYSEED
                     RRVLAFQIQEANFVHIITRVKTVIQLNENKLKNVESFVCSGGVSANKRLRHLLEVEFT
                     DNFKQFHYPDLDLCSDNAAMIGWAGIELFESAALTTDLEVTPIRKWPLSELLLPSGWK
                     R"
     gene            <795739..>796896
                     /gene="TPHA0C03660"
                     /locus_tag="TPHA_0C03660"
                     /db_xref="GeneID:11533762"
     mRNA            <795739..>796896
                     /gene="TPHA0C03660"
                     /locus_tag="TPHA_0C03660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684904.1"
                     /db_xref="GeneID:11533762"
     CDS             795739..796896
                     /gene="TPHA0C03660"
                     /locus_tag="TPHA_0C03660"
                     /inference="similar to DNA sequence:INSDC:YMR166C"
                     /note="similar to Saccharomyces cerevisiae YMR166C;
                     ancestral locus Anc_2.344"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684952.1"
                     /db_xref="GeneID:11533762"
                     /db_xref="GOA:G8BQK6"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8BQK6"
                     /translation="MIKFITPFISSHSLPPYGDHNEPTSSAHLNNGNLNKKGDDDLSQ
                     PRGNDKEQKDVNSRPLLHNILAGGLGGAIGDSAMHSLDTVKTRQQGASTVLKYKNMIS
                     AYKTMFIEEGVTRGLYSGYSAAMLGSFPSAAIFFGTYEYSKRQMVNKFGINETTAYLA
                     SGFLGDLVSSIVYVPSEVLKTRLQLQGCYNNMHFDSGYNYKNVRDAIKTILRVEGYSA
                     LFFGYKATLSRDLPFSALQFAFYEEFRRLAYNLEGKNLIINNHLEQDDLSIFSELITG
                     ASAGGLAGILTTPLDVVKTRIQTQQSLPITAGTTKLVSDSSNSNKQSPLTNSINKSLK
                     VIYKTEGVVGLFSGVGPRFIWTSIQSSICLLLYQMLLRGLNKTMHSGEQLN"
     gene            <797568..>800213
                     /gene="TPHA0C03670"
                     /locus_tag="TPHA_0C03670"
                     /db_xref="GeneID:11533797"
     mRNA            <797568..>800213
                     /gene="TPHA0C03670"
                     /locus_tag="TPHA_0C03670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684905.1"
                     /db_xref="GeneID:11533797"
     CDS             797568..800213
                     /gene="TPHA0C03670"
                     /locus_tag="TPHA_0C03670"
                     /inference="similar to DNA sequence:INSDC:YMR165C"
                     /note="similar to Saccharomyces cerevisiae PAH1 (YMR165C);
                     ancestral locus Anc_2.345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684953.1"
                     /db_xref="GeneID:11533797"
                     /db_xref="InterPro:IPR007651"
                     /db_xref="InterPro:IPR013209"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G8BQK7"
                     /translation="MQYVGRAIGVVSKNWSSINPATLSGAIDVIVVEHPDGTLACSPF
                     HVRFGKFRILKPSQKKVQVIVNGKSTNIPMKLSDNGEAYFVFSTGSDIHDIPDDLLSS
                     PVLSATSSPPQSPHSIDANNDITGHLVDKDGMKIVLEEPDFLDINMNSLYNNVNNKSK
                     ETDSSLSIPTSPKIVNINKRLTDINIPSKIDYNGDLVLDIEGYKPDDEKMHDTDEKLR
                     KLLQEELGDSYKLSNIMTEDKNGNLRISNPSDYFHSPSISTSSISDFNSNGTFTSPTA
                     ISTGSDEYTSDTDLNTNTINSSSIDEQSNKVSSNSNNTQQYIRTIRLTSDQLKCLDLR
                     YGENDLEFSVDKGKAIVRSKLFVWRWDVPIVISDIDGTITKSDALGHVMTMIGKDWTH
                     IGVAKLFTEISRNGYNIMYLTARSSGQSDSTRSYLESVEQNGCKLPNGPVILSPDRTM
                     AALRREVILKKPELFKIACLNDIRSIYVDKFEDYHSNNQLDGSNDLGLNNRLEDDFKP
                     TPFVAGFGNRITDALSYRTVGIPSSRIFTINPDGEVHMELLELAGYKSSYVDINELVD
                     QFFPPVKINDFDSRSVSSLQLGSPLSLSVDNMNKSENNLQYGTSNNKKNNNEISGTGY
                     NFDNIGDTSFTSSSNVDRSKYFRNNHFADKYNDVNFWREPLVNLEDLSDNSLESDTDL
                     ESDHKRLVLDKKSNNKKDRSLKINKKVSIIKGEDDDINFVQSSDSKNKNTPTMDSVMT
                     TPSKDKNTQYHHHNGKSPKELRKEEIGNRIYLELGSAFSSPRMSSMNESQSTFLDGTR
                     PMSQDSSRDDVSISSSMNMDRLTLNSQKNITPTASISKIQVNVLDNGETVENNSHGGS
                     DYSDYQSGDNEEATDDEFDEDDFVE"
     gene            <801572..>804313
                     /gene="TPHA0C03680"
                     /locus_tag="TPHA_0C03680"
                     /db_xref="GeneID:11533796"
     mRNA            <801572..>804313
                     /gene="TPHA0C03680"
                     /locus_tag="TPHA_0C03680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684906.1"
                     /db_xref="GeneID:11533796"
     CDS             801572..804313
                     /gene="TPHA0C03680"
                     /locus_tag="TPHA_0C03680"
                     /inference="similar to DNA sequence:INSDC:YMR164C"
                     /note="similar to Saccharomyces cerevisiae MSS11
                     (YMR164C); ancestral locus Anc_2.346"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684954.1"
                     /db_xref="GeneID:11533796"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="UniProtKB/TrEMBL:G8BQK8"
                     /translation="MILPTTNEDDTKSSSNDNNNTNDDDDSRNGIKSEENSVRTAKHS
                     EPFPTQKHPKYNFDVVVSDATARNLKQLLLSHMYNYLLTHKHLETAKQFLKEADVPLL
                     TGNAEINDESNSFRGNAGVDGEPALNPNIKLEDDQIYRQKVENQTPMTSKKRLSSYSQ
                     NDLNPRELLAAKMLMDSKNSFLLEWWEQFSTVYNFIDGQDIESIKKAETLKQDKITSL
                     LPQAQINTLSSSNFGSMPYMGMQQKQSQLQQQQQIQQLQQQQQQNFQNGFVNNIDKNN
                     VNMEKQSTQTQRMNQQKLQYQWQLQQQLQMKLQRQMRNQPMPVTNQNMSKKNSGVTDI
                     NVNNNSSDTNDNNEYANHGNGTGNLKDPAFIHNSIPLQNYSPNSNTNIYSQQQQPLVD
                     NNFGIDRANRRSSRAISNELNNMINFEKQLKLQRQMLESNKSANNDGDNYNENSNADS
                     TKSSKNEKSIGDVDSSQVMDWSKSQKERVKVMKEQQQNLIQQHVTQQQRGKNSNLEDK
                     SEKNKAVKDNVNINDNDNINPIQNNSDVDMRNQYMMMVQMMMMSKGDQQLHQGKQQIP
                     QQMQNSMIPQQLQHFQLQQLQMQMQMKQFSKDQMKNSSTNTNNNNNNNNNNNNNNNNN
                     NNNNNNNNNNNNNNNNNNNNNSNNTIMSISPKMTSTDNSIDATVNTVVSMGSSRQPKS
                     KNTQSNKKPVAEPKKRKKKTEISRSSTPIGTTKFISENNSIANVESINRNQDSGALKQ
                     VQSSGFPIMKFNNNPNVISPNPEKIYPSYSKDSSRRKSPTSNNFSSSQTQTGETSNQR
                     KKKRRKTKGSTPTIANSVSGQPPFPNSIDGLAETDDASLLNKDLTSEFNNLPNTVFNE
                     NSMDMTFGFDVNPNSNDIGNNDLALNIDLMNFSNNPMGMDDFQLFDKDNLPNNLMDN"
     gene            <805106..>807418
                     /gene="TPHA0C03690"
                     /locus_tag="TPHA_0C03690"
                     /db_xref="GeneID:11533483"
     mRNA            <805106..>807418
                     /gene="TPHA0C03690"
                     /locus_tag="TPHA_0C03690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684907.1"
                     /db_xref="GeneID:11533483"
     CDS             805106..807418
                     /gene="TPHA0C03690"
                     /locus_tag="TPHA_0C03690"
                     /inference="similar to DNA sequence:INSDC:YMR163C"
                     /note="similar to Saccharomyces cerevisiae INP2 (YMR163C);
                     ancestral locus Anc_2.347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684955.1"
                     /db_xref="GeneID:11533483"
                     /db_xref="GOA:G8BQK9"
                     /db_xref="InterPro:IPR026235"
                     /db_xref="InterPro:IPR026859"
                     /db_xref="UniProtKB/TrEMBL:G8BQK9"
                     /translation="MKPQYGFPKLHFAGLQIYSDSDNYIENNAIKLQKEELCDINYQL
                     DHKDNDVRLSIGQSEELTPVMGDNGFDRLSTSIPHMRNVTDWTMSTLNEHSPSFANLD
                     VFENIKKVDSNNSNNINSAKIISNEHIAKYFRPLPTRNNNDFLEEFRYTIISSNILND
                     SEGYRFKFDIKNSILDFHSSKSANTKKRNSILYHTKYGICKSISGDKFKLYRTFNYSK
                     TIINSLRIIRYLSNKRKLEKTKYNNANENSFIIKTICFILICINISSHQQFFYNQCIK
                     YKFMINLKEFLKILQKSDDLIHKYHNVSKELAIYKPLIQKHHHRDINLYKRPDSDIEF
                     NNSEKEFELTLNKINEILTSVLNLQFHQVLKHVIEILPMTDKTELLKYCEIYAIDLPT
                     LYEYINFPAPSIKNKIDRFDTLKKIMLLCLLSITEAKVTYSNNSIVINQISNIFGVIP
                     DDIIATNISRNTLIKNIKDATIIIKNMEEAISPFIQVLVANRNLLYLSIDSQDDNSMS
                     KQESQKLTQDESNHNFLLINIINQTKSLEKAFLGLSSTELKKNEEMNSITNHISNILE
                     TWVSMIDKDSISCQKAETTNIGIVNNRFSIDVYNSDRESSVKILDTDILKKQIDIKEV
                     GENTNDIFDVEQVDDFEYAGDENQSVLFFTNEEDFYNSSNKLNKSGISTQKMSTREMT
                     DEELRQKLDQKISILAAENRKVKEKLRTKKSFDLLRNENSNILYSDFKSLKKQGNLDT
                     RSRSSRLRNYSSEETIPIIYELKALFDAGS"
     gene            complement(<807607..>809028)
                     /gene="TPHA0C03700"
                     /locus_tag="TPHA_0C03700"
                     /db_xref="GeneID:11535205"
     mRNA            complement(<807607..>809028)
                     /gene="TPHA0C03700"
                     /locus_tag="TPHA_0C03700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684908.1"
                     /db_xref="GeneID:11535205"
     CDS             complement(807607..809028)
                     /gene="TPHA0C03700"
                     /locus_tag="TPHA_0C03700"
                     /inference="similar to DNA sequence:INSDC:YDL103C"
                     /note="similar to Saccharomyces cerevisiae QRI1 (YDL103C);
                     ancestral locus Anc_2.348"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684956.1"
                     /db_xref="GeneID:11535205"
                     /db_xref="GOA:G8BQL0"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BQL0"
                     /translation="MTYIKETYVDSNQQHLFEHFDDLTDVEQTELLNNLKVISDRISP
                     HKLVEDCQNAIALSETNKHSTSVISSLPESSYYSIIGNKKEEEEYRKLGLEAISKGEV
                     AVILMAGGQGTRLGSSQPKGCYDIGLPSHKSLFQIQAEKILRLQQLTGSKHDIPWYIM
                     TSKPTRQTTEQYFKDNSYFNLKKSQITFFNQGTLPAFDLNGEKLYLGSKTELVESPDG
                     NGGLYRAMVENNLLEDFHKKNIKHVYMYCVDNVLSKVADPVFIGFAIKYNFKLATKAV
                     RKRDAAESVGIIATKDGKPCVIEYSEISQELSEAIDETGLLKLRAANIVNHYYSVELF
                     DQQLTNWCDNMVYHIAKKKIPYFDPKTGKISKPTEPNGIKLEQFIFDVFPSVNIKDFG
                     CLEVERSHEFAPLKNASGSANDNPETSRTAYMNLGTSWLKDSGADVKDNVLVEVSGTL
                     SYSGENLQQYRGQIFDINDTILE"
     gene            complement(<809578..>812016)
                     /gene="TPHA0C03710"
                     /locus_tag="TPHA_0C03710"
                     /db_xref="GeneID:11533769"
     mRNA            complement(<809578..>812016)
                     /gene="TPHA0C03710"
                     /locus_tag="TPHA_0C03710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684909.1"
                     /db_xref="GeneID:11533769"
     CDS             complement(809578..812016)
                     /gene="TPHA0C03710"
                     /locus_tag="TPHA_0C03710"
                     /inference="similar to DNA sequence:INSDC:YMR160W"
                     /note="similar to Saccharomyces cerevisiae YMR160W;
                     ancestral locus Anc_2.353"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684957.1"
                     /db_xref="GeneID:11533769"
                     /db_xref="UniProtKB/TrEMBL:G8BQL1"
                     /translation="MDSEEGWGWYMWSRKKPPPQEDTQGNADANANTNTHIETHDNTN
                     EEETALENQERWYHQVWNKIPSFKREDEADFVNNINFKSHLDLNAKQIDILRNEVQTN
                     VNNNNLCNNTWVWYKAYNPLSKNSQDSEGEFHNDTDGIVSMMNTGSSRIPIPFQTYPF
                     PTNQNAIGNKIYIKKSLILPSSSPSDYMHELPKQTKFANSFKNYYNYPHENHLYIKSA
                     AFDKESKLIKDKEKILIISLVGNLPEHYEKSSIGYQRNSNYLSCKLANSLIDKNKNCQ
                     IETLSFQSPLNLIDLNEALQQCISLLKNYENLFKEVQSIFFVGIYHSIPLLIVLATHI
                     LKRHNVLDFNKQTNVGILAFESNLEGYRFWDHNSDLKQNEDTTSNKNTATNESNNISE
                     QDKENNEEILFSEDYNKIQQQREKQLFQYASKREQEVLQNIRSYRKLNSIESLYLQKN
                     LDWLLYNWKPFRLTLFGKLYDNFMTVSQKLALDFIHPKIIRNIWCDGKYLDINTKFPQ
                     NVFEEDVHLKSLQFDSKIKLPKKRLFEIELINDLLLLTNLGYNDFLPFFKSISPFFIS
                     RSFNDNTLPPTVAKKLNTEQKAWLSEMNDKFKITTNNTTNIPIDKTKQDNANNNNHDL
                     YSLPLEVSSLFQFLEYCYYEDIKSNGLLKIFDSIYDDDEVYKCFIENTLNTRAPLFQK
                     HLTLSNDHSTPKSIFRIMNQYDLVWKLHEALSEFLTIKNLPQQERQVEKLKFFISVNL
                     FNSFETSMMTKDENKKIFDRSNRESQTRISNLWKAYRDWDPQTTGLKQLKNIMSVFLL
                     YNNPQQLINDLSKK"
     gene            <812335..>812709
                     /gene="TPHA0C03720"
                     /locus_tag="TPHA_0C03720"
                     /db_xref="GeneID:11533925"
     mRNA            <812335..>812709
                     /gene="TPHA0C03720"
                     /locus_tag="TPHA_0C03720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684910.1"
                     /db_xref="GeneID:11533925"
     CDS             812335..812709
                     /gene="TPHA0C03720"
                     /locus_tag="TPHA_0C03720"
                     /inference="similar to DNA sequence:INSDC:YMR159C"
                     /note="similar to Saccharomyces cerevisiae ATG16
                     (YMR159C); ancestral locus Anc_2.354"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684958.1"
                     /db_xref="GeneID:11533925"
                     /db_xref="InterPro:IPR013923"
                     /db_xref="UniProtKB/TrEMBL:G8BQL2"
                     /translation="MADTDEIDKLLVNRLSNRDIVESRYKELFHDLNKPTEDDNQTQD
                     LVDELKQELFKRDSELKKLDDINKVLRHANENSNNEIISLNIENNIMNEKYNKLEVEY
                     NKLIKRWLSKVEKDVQDMNGML"
     gene            complement(<812835..>813320)
                     /gene="TPHA0C03730"
                     /locus_tag="TPHA_0C03730"
                     /db_xref="GeneID:11533955"
     mRNA            complement(<812835..>813320)
                     /gene="TPHA0C03730"
                     /locus_tag="TPHA_0C03730"
                     /product="mitochondrial 37S ribosomal protein MRPS8"
                     /transcript_id="XM_003684911.1"
                     /db_xref="GeneID:11533955"
     CDS             complement(812835..813320)
                     /gene="TPHA0C03730"
                     /locus_tag="TPHA_0C03730"
                     /inference="similar to DNA sequence:INSDC:YMR158W"
                     /note="similar to Saccharomyces cerevisiae MRPS8
                     (YMR158W); ancestral locus Anc_2.357"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS8"
                     /protein_id="XP_003684959.1"
                     /db_xref="GeneID:11533955"
                     /db_xref="GOA:G8BQL3"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="UniProtKB/TrEMBL:G8BQL3"
                     /translation="MSLVKLANTCAHIQNCSRVRIPLISIPYTGLHLQFAYNLYKNGF
                     VSSIQKGSTKSPDDSIVDVTPDNIATRRIWMNLKYKENKPIISSCRLISKPNLRISLT
                     YQEMQQLSAGKSIRLIKPLQPGELILIRTKDPNTKKDVLMDINEAIDKRLNGEVLCRV
                     N"
     gene            <813654..>814433
                     /gene="TPHA0C03740"
                     /locus_tag="TPHA_0C03740"
                     /db_xref="GeneID:11533478"
     mRNA            <813654..>814433
                     /gene="TPHA0C03740"
                     /locus_tag="TPHA_0C03740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684912.1"
                     /db_xref="GeneID:11533478"
     CDS             813654..814433
                     /gene="TPHA0C03740"
                     /locus_tag="TPHA_0C03740"
                     /inference="similar to DNA sequence:INSDC:YMR157C"
                     /note="similar to Saccharomyces cerevisiae YMR157C;
                     ancestral locus Anc_2.358"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684960.1"
                     /db_xref="GeneID:11533478"
                     /db_xref="UniProtKB/TrEMBL:G8BQL4"
                     /translation="MLTLIGKNCVRTPALVKNTIVPLSRRPISNIATRRWYSNNEHHK
                     SKDAMPSIWKLLGLSALGSGVFILASRNLDRKKNGLVQEQNAVGGLRRRVAMYQPGEL
                     TVRVVMDADVTKLPPTAHCVDTVGLLRAALVDENDPYQPLLAELAQHTDSDNNNNTDN
                     DTKSNADIGRLIRELPSGLLVRLLAREFQASVSVGDTVYVTNFPFPDEHDGRDRDCLQ
                     DILRFESDVSEIDQLLVAKLDPADSRPAVAYYRTVGKVATV"
     gene            <814891..>817290
                     /gene="TPHA0C03750"
                     /locus_tag="TPHA_0C03750"
                     /db_xref="GeneID:11533921"
     mRNA            <814891..>817290
                     /gene="TPHA0C03750"
                     /locus_tag="TPHA_0C03750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684913.1"
                     /db_xref="GeneID:11533921"
     CDS             814891..817290
                     /gene="TPHA0C03750"
                     /locus_tag="TPHA_0C03750"
                     /inference="similar to DNA sequence:INSDC:YDL095W"
                     /note="similar to Saccharomyces cerevisiae PMT1 (YDL095W);
                     ancestral locus Anc_2.362"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684961.1"
                     /db_xref="GeneID:11533921"
                     /db_xref="GOA:G8BQL5"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027004"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:G8BQL5"
                     /translation="MAKKPGKTQNSQAQSQRASKKNKIPADEPSPSLLQAIDQDPVLP
                     FEVKDGPERPFLQIDTEIDEQTDKSAPDRKEKIVQLRTMNTKVERLLVLSLVLIASYV
                     RLKNLSWPNSVVFDEVHFGKFAAKYVKNQFFFDVHPPLAKMLFAYFSSMAGFKGDFLF
                     SKIGEEFPSDTPYVFMRLFAAVSGLFTVLLMYFTLRSSGIRMWVAYLVTLCFAVENSF
                     VTISRYILLDSPLMLFIAAAAYAFKKSQLYPALSFNGSRYLLATGVALGFAVASKWVG
                     LFTIAWVGALCAIRLMFYLGDLTIPISKTIKIALSKLIFLLVVPFILYATFFYVHFET
                     LINDGDGSAFFSPGFRMTLKGNNIPQNVYSDVGVGSVVTLRHLGTHGGYLHSHTATYE
                     TGSKQQQVTCYGHLDDNNKWLIELANRPGVTLNSFQNITDGEKIKLFHINTQHRLHSH
                     DHKPPVSSNSDWQKEISCYGFAGFNGDWNDDWTVEIDKRKSTPGDAQKVVKAIDTKFR
                     LRHSSGCYLFSHKTKLPKWGFEQQEVTCAHSGKPHLTLWQIEGSESAVLPSDSKRTSY
                     SIPNFWSKFIESHKVMWNINKGLTATHVYQSYPQEWPLLQRGISYWGNHNRQVYLFGN
                     AILWWSVSFAVVLFAIVSAVELILWHLGSPVLNEPHVMNYHIQYVEYILGFLAHYIPS
                     FLMQRQMFLHHYLPAYYFGILAFAHAFDITVTYVCKKKRVGQVLALIFTIVVVAFYYY
                     YSPIIYGTEWTKEQCKKTQWFHGWDYNCNGFVDDLTEYATIPTTTTTTAAETAAAAAA
                     N"
     gene            complement(<817611..>819224)
                     /gene="TPHA0C03760"
                     /locus_tag="TPHA_0C03760"
                     /db_xref="GeneID:11533470"
     mRNA            complement(<817611..>819224)
                     /gene="TPHA0C03760"
                     /locus_tag="TPHA_0C03760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684914.1"
                     /db_xref="GeneID:11533470"
     CDS             complement(817611..819224)
                     /gene="TPHA0C03760"
                     /locus_tag="TPHA_0C03760"
                     /inference="similar to DNA sequence:INSDC:YMR155W"
                     /note="similar to Saccharomyces cerevisiae YMR155W;
                     ancestral locus Anc_2.363"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684962.1"
                     /db_xref="GeneID:11533470"
                     /db_xref="GOA:G8BQL6"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G8BQL6"
                     /translation="MNLRRVLADPRVRAFIGSNIVTLGAGTPYLYSYYAPQLIERCNI
                     PISTTSGLSLSLNIGSSLFGFIAGMIVDKNPRVACLIGSIGTFIAYTILGYCYEYRIS
                     NFFLLSLSLSLLGFCSVCGLYSAVTCCTINFPKYRGTAGAFPVSLYALSGLVFSNLCP
                     FFFGTDIRNTFRFLSIVCSVMLLIGALTIVVLKTPNSMEIPEYELSSQAEAMTPELNS
                     QIFAEPKEPSTPILQPSISKFSSPRESLLSPKSAANPLVIHTLDHRQFSTFDSTVPIN
                     SYQDSIDHTFTDQQNEKRTVNSVIVALKDYRFYIHFFILATLQGIGQMYIYSVGYIVQ
                     ANTEKIDIGGTSAKLEKMQSLQVSILSLMSFSGRLVSGPISDILVKRYRCQRLWNIIF
                     CSLLTLFASWMILSNSSTHRETDTSTLNTSNYSTISYCSMLFGLGFGIMFGSFPSIIA
                     EAFGSEGFSTIWGLSTSGGIVTVKFFASLLGNELSHKADSLTGICQEGSPCYTDTFTT
                     VRYSTVLVLVFTLALMFNIHNKSKKNTYN"
     gene            <819776..>820216
                     /gene="TPHA0C03770"
                     /locus_tag="TPHA_0C03770"
                     /db_xref="GeneID:11533473"
     mRNA            <819776..>820216
                     /gene="TPHA0C03770"
                     /locus_tag="TPHA_0C03770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684915.1"
                     /db_xref="GeneID:11533473"
     CDS             819776..820216
                     /gene="TPHA0C03770"
                     /locus_tag="TPHA_0C03770"
                     /inference="similar to DNA sequence:INSDC:YDL092W"
                     /note="similar to Saccharomyces cerevisiae SRP14
                     (YDL092W); ancestral locus Anc_2.364"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684963.1"
                     /db_xref="GeneID:11533473"
                     /db_xref="GOA:G8BQL7"
                     /db_xref="InterPro:IPR003210"
                     /db_xref="InterPro:IPR009018"
                     /db_xref="UniProtKB/TrEMBL:G8BQL7"
                     /translation="MVNSGCLSSEDFLLKVAEYFKISNERNIAVRLTLKRLVEHDEVE
                     LKPEYDVTNQPAYDVSTQAQSLSVTSIKPNNNDREYSLLVRASYGSHKGKNKCSTIIS
                     AGSLDKFWQDYSSVVRTNMDGLVKKKKKKRSTKTALKSKKSVKN"
     gene            complement(<820347..>821600)
                     /gene="TPHA0C03780"
                     /locus_tag="TPHA_0C03780"
                     /db_xref="GeneID:11533456"
     mRNA            complement(<820347..>821600)
                     /gene="TPHA0C03780"
                     /locus_tag="TPHA_0C03780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684916.1"
                     /db_xref="GeneID:11533456"
     CDS             complement(820347..821600)
                     /gene="TPHA0C03780"
                     /locus_tag="TPHA_0C03780"
                     /inference="similar to DNA sequence:INSDC:YDL090C"
                     /note="similar to Saccharomyces cerevisiae RAM1 (YDL090C);
                     ancestral locus Anc_2.366"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684964.1"
                     /db_xref="GeneID:11533456"
                     /db_xref="GOA:G8BQL8"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR026872"
                     /db_xref="UniProtKB/TrEMBL:G8BQL8"
                     /translation="MERNLNRFKFINNKLLGRKKPIIERELSSEEEMDVISDTSDYQT
                     ETIADRNEVLKDCLPLLEDPDLESKLNRDFLKMYLTAAFSLQLPSQMTALDASQPWIL
                     YWVANSLYMLDAAWLTDDHKKRLKEKIFVISPDGGPFAGGIGQLPHVAATYAAINTLT
                     LCDNIDNSWDLVNRDAILNWLLSIKQKNGGFKTSFTVGENDTRGVYCALSIASLLNII
                     TPELTENVLEYLIACQNFEGGFGGCPQEDEAHGGYTFCAVAALAILGKLDSINIPKLI
                     EWCATKQYNEEKGFCGRSNKLVDGCYSFWVGGTIAILEAYGYGDYIFDHDSLREYILR
                     CCQDDKMPGLRDKPGKRPDFYHTNYVLSGLAITEYKFDILDKTNATSIIVKKRDNIGY
                     SELNPVNPIYGIPIDVASKIYDHFR"
     gene            complement(<822142..>823614)
                     /gene="TPHA0C03790"
                     /locus_tag="TPHA_0C03790"
                     /db_xref="GeneID:11535230"
     mRNA            complement(<822142..>823614)
                     /gene="TPHA0C03790"
                     /locus_tag="TPHA_0C03790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684917.1"
                     /db_xref="GeneID:11535230"
     CDS             complement(822142..823614)
                     /gene="TPHA0C03790"
                     /locus_tag="TPHA_0C03790"
                     /inference="similar to DNA sequence:INSDC:YDL088C,YMR153W"
                     /note="similar to Saccharomyces cerevisiae ASM4 (YDL088C)
                     and NUP53 (YMR153W); ancestral locus Anc_2.369"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684965.1"
                     /db_xref="GeneID:11535230"
                     /db_xref="InterPro:IPR007846"
                     /db_xref="UniProtKB/TrEMBL:G8BQL9"
                     /translation="MFNSGTSSNNNRFSNVSINFLQPSEDTSQQQGNQQKTYHQLQNN
                     SQQSYIQLNNKNKPLFANDLQSQFDTNMKGQEPEWFNNPKKRNIPQNVIRRNVNENNE
                     LGKQSSTITSSTSFSSSSNALTTNSGFENMSFGSRKSTNLFNSKNAQNKNLEGNNILV
                     DSNEAPPTLSLLDWQREEEFGVSSKLGNNSSGIFMESLTSSNIASGLSPSLSSTNSSN
                     QILSASAFDSKPVSSLFTSQEVSGTSRFEENNSNTITPSSSTMHEGAVLVFGYPESIS
                     NSIISHFAKFGNILEDFQVLRSTSGITASTLKTFTQNINNNNEMKKKYPIYTGDGWVK
                     LTYDSNSSAIRALQENGIVIGGSLVGCIPYSKAAVEQLASCKIEKSDDIGNFNFSSTN
                     NINFKTPLHNNNDKDDRTNSPSELNGNTKTPSYLSHRLDIKDGKSLFLHNANTNNHNF
                     LRTLEMKMRHQEELNIQHKQQQTAGLLHKVNDWLFGWNDL"
     gene            complement(<824251..>825003)
                     /gene="TPHA0C03800"
                     /locus_tag="TPHA_0C03800"
                     /db_xref="GeneID:11533633"
     mRNA            complement(<824251..>825003)
                     /gene="TPHA0C03800"
                     /locus_tag="TPHA_0C03800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684918.1"
                     /db_xref="GeneID:11533633"
     CDS             complement(824251..825003)
                     /gene="TPHA0C03800"
                     /locus_tag="TPHA_0C03800"
                     /inference="similar to DNA sequence:INSDC:YDL087C"
                     /note="similar to Saccharomyces cerevisiae LUC7 (YDL087C);
                     ancestral locus Anc_2.370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684966.1"
                     /db_xref="GeneID:11533633"
                     /db_xref="GOA:G8BQM0"
                     /db_xref="InterPro:IPR004882"
                     /db_xref="UniProtKB/TrEMBL:G8BQM0"
                     /translation="MARAVDEQRKVLDQLMGQEGIRSGERRRYHKSNYNHNDIELQDA
                     RVCKAYLVGECPFDLFIGTKQSMGNCPQLHLTKHKLQYEALKKEGKEFLEFEREYFVV
                     LSKFVNDCNGLIQSALKNLEHTVEEKERIKQVTEELDILDSKIGLMDQEIECLMHTNE
                     VTKAMAQSVKLEEFRKQRKLLAAKVRSITENVGQMAQQKLQVCEVCGAYLSRLDTDRR
                     LADHFLGKIHIGYLKMREQLDILKQKQKYRLR"
     gene            <825668..>826441
                     /gene="TPHA0C03810"
                     /locus_tag="TPHA_0C03810"
                     /db_xref="GeneID:11533788"
     mRNA            <825668..>826441
                     /gene="TPHA0C03810"
                     /locus_tag="TPHA_0C03810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684919.1"
                     /db_xref="GeneID:11533788"
     CDS             825668..826441
                     /gene="TPHA0C03810"
                     /locus_tag="TPHA_0C03810"
                     /inference="similar to DNA sequence:INSDC:YPL033C"
                     /note="similar to Saccharomyces cerevisiae YPL033C;
                     ancestral locus Anc_2.371"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684967.1"
                     /db_xref="GeneID:11533788"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8BQM1"
                     /translation="MFDLNGIYNSMKSFYDLCWLGKSLNPKDVVVLLGGSDAFGTQLC
                     QQLINEDVVVVNIDSLDNSNELLLDINSPKQQYYFIPCDSFEDVNHMKSAINKVAQTK
                     LTPTIFLNNINFEFETILKDSNTECNDLSSDYVKYFQKTIMINLENVMVSTKYFLNNF
                     INPDFYYVINVSIDIKDVYSWEGSRFRTSKMALNQYHDSLVSELNEMYWEKNLDIKNI
                     LFYLPYKHLNYSEYVSSCKQLSINAVSHLKNGERGPIQL"
     gene            <826793..>827347
                     /gene="TPHA0C03820"
                     /locus_tag="TPHA_0C03820"
                     /db_xref="GeneID:11533915"
     mRNA            <826793..>827347
                     /gene="TPHA0C03820"
                     /locus_tag="TPHA_0C03820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684920.1"
                     /db_xref="GeneID:11533915"
     CDS             826793..827347
                     /gene="TPHA0C03820"
                     /locus_tag="TPHA_0C03820"
                     /inference="similar to DNA sequence:INSDC:YMR150C"
                     /note="similar to Saccharomyces cerevisiae IMP1 (YMR150C);
                     ancestral locus Anc_2.374"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684968.1"
                     /db_xref="GeneID:11533915"
                     /db_xref="GOA:G8BQM2"
                     /db_xref="InterPro:IPR000223"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019756"
                     /db_xref="InterPro:IPR019757"
                     /db_xref="InterPro:IPR019759"
                     /db_xref="InterPro:IPR026730"
                     /db_xref="InterPro:IPR028360"
                     /db_xref="UniProtKB/TrEMBL:G8BQM2"
                     /translation="MTTTIGSILTVSSYFLRSICFLHISHSYIYEFTETRGESMLPTL
                     AVQNDYVHVVKKYKNGRGCKLGDCIVAVKPTDPNHRVCKRITGMPGDYILVDPSDSIY
                     REKSDSDEPFNTYIKVPNGHVWVTGDNLAHSLDSRTYNSIPMGLIKGKIVAANDFNQP
                     FWNGSLSNILGFRKIQNTFIDEES"
     gene            complement(<827478..>828314)
                     /gene="TPHA0C03830"
                     /locus_tag="TPHA_0C03830"
                     /db_xref="GeneID:11535222"
     mRNA            complement(<827478..>828314)
                     /gene="TPHA0C03830"
                     /locus_tag="TPHA_0C03830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684921.1"
                     /db_xref="GeneID:11535222"
     CDS             complement(827478..828314)
                     /gene="TPHA0C03830"
                     /locus_tag="TPHA_0C03830"
                     /inference="similar to DNA sequence:INSDC:YMR149W"
                     /note="similar to Saccharomyces cerevisiae SWP1 (YMR149W);
                     ancestral locus Anc_2.375"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684969.1"
                     /db_xref="GeneID:11535222"
                     /db_xref="GOA:G8BQM3"
                     /db_xref="InterPro:IPR008814"
                     /db_xref="UniProtKB/TrEMBL:G8BQM3"
                     /translation="MQISNVLALLFIFTYRCLALKASNCKISLLGDEKNSLSIDSIES
                     TNSNPAVQDVINVSKLDAIIEFSYEVSEAYDQTHLLIGYPEANLESSLEGIVIKDGDK
                     TKILYKIEFSNLSKALLSKSIIEQSPITVSLLLARNGDSKNILNEVFQVQLAKDIKVN
                     YEAPSRYGIKDEITFSFRELESTAPEYICKVFSVVMAVAALALLVTWLTSGVISSVKF
                     PSGSQFIYFIVFIGLIGGIEFVFTQYFLGSSIFETLYYTALLAAPAVLIGTKFLRGFN
                     EL"
     gene            complement(<828846..>829637)
                     /gene="TPHA0C03840"
                     /locus_tag="TPHA_0C03840"
                     /db_xref="GeneID:11533775"
     mRNA            complement(<828846..>829637)
                     /gene="TPHA0C03840"
                     /locus_tag="TPHA_0C03840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684922.1"
                     /db_xref="GeneID:11533775"
     CDS             complement(828846..829637)
                     /gene="TPHA0C03840"
                     /locus_tag="TPHA_0C03840"
                     /inference="similar to DNA sequence:INSDC:YMR087W"
                     /note="similar to Saccharomyces cerevisiae YMR087W;
                     ancestral locus Anc_2.474"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684970.1"
                     /db_xref="GeneID:11533775"
                     /db_xref="InterPro:IPR002589"
                     /db_xref="InterPro:IPR028071"
                     /db_xref="UniProtKB/TrEMBL:G8BQM4"
                     /translation="MLRIILCDSNTELTKLWHKSLPKILIEKRQLRIINDNFKNLTTR
                     YITTNKIDGVDANRCSVVSPGNSFGFLGGGFDLALYENYGKKPFEDWVRSKLNHEYKP
                     VGSLTIFDTHEYPNHKIDAVRYIQHIPTMITPSKPLASSTADNSNLIQLVFNTMWVAL
                     NNVPEDVNTIIIPGLCTGYAGVSIELSTKVTSFAITLFYMRTRISKDLLNKLIMIHMG
                     NDYIPFYSKVIESELNTLGLKYSDLKALESCNEKIIFPAQLLRLL"
     gene            complement(<829920..>833090)
                     /gene="TPHA0C03850"
                     /locus_tag="TPHA_0C03850"
                     /db_xref="GeneID:11535199"
     mRNA            complement(<829920..>833090)
                     /gene="TPHA0C03850"
                     /locus_tag="TPHA_0C03850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684923.1"
                     /db_xref="GeneID:11535199"
     CDS             complement(829920..833090)
                     /gene="TPHA0C03850"
                     /locus_tag="TPHA_0C03850"
                     /inference="similar to DNA sequence:INSDC:YKL105C,YMR086W"
                     /note="similar to Saccharomyces cerevisiae YKL105C and
                     YMR086W; ancestral locus Anc_2.476"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684971.1"
                     /db_xref="GeneID:11535199"
                     /db_xref="UniProtKB/TrEMBL:G8BQM5"
                     /translation="MFRSRRLSRQPEKPVNLGALAAASAIGNAMSGNGRTVDANKIPQ
                     YNTNDPYSRRSSGIYGSNLSVDRTSSMRLNSLSKKEKSPSVRHENRKRNNQNSSRNNS
                     LTNNKLHTRKSVDSLPRSSSMPNSQQKNNITSESTLRKQKRISSVTSSVRYNSIDSVN
                     SINSNDTRTNSINNNKHNRRRTSKASDVDVKKTFQEFGGGQVPNVLTRSTSMMIKKYI
                     PGPNGLVAVNVEVPVEQPVTSKVLRRSVSTANLVSNSRERALTSKTSTQSLKETTKMS
                     SRSSSLSSLSSSKSLKKTAPKEYTMKYDSPNDRRTSSLSSQNSHSPVSKNLKALNESH
                     EMHSFTTRQHKTFSDDVSQPLMESALEEETEIELENDTTRFSVKPSFDKTNSINHPII
                     DQSEMNSVAESSTPSKISLGKIEIESSLKSKNKFEDNSNYLFRQEIQNTKEDNNNRDI
                     KRDSISTVEDDLSPKRKEMRRLISDSILLEESMNDTNSELSTLEKNNSSKSESDFNNQ
                     SDIQNNIDDNNSTGIAPIDKRISRISVTSSDYASLNDEKKEILKLFDDFNNGAQESDV
                     EDENVKEVEEDKLEYLDLNSVTSTLEDRKSLSSSQDRENTIIIEGNGKESNTEQAGQD
                     KKAEETEHEEPYDVSSAAVNENYHTSYLDTYDTSTDSNRDSNLIAIDNISIGDKSEEI
                     IPSREEEPKKETSKLAKNIRESSPFFKPDVKAGELTSVAASSKKNKRNSKISPIKSAM
                     KKNTSNLNLVLNYNDNPSAANQAYLSLTTAENTRLNSGLTSSENVLRKPATLKSNRNS
                     KIINYPRSQSINSDINGLKTKNDPQINIDRYSKSNINSNYQASQSEQDNIPKRHPGRK
                     QKKTVTGTRQPIQKQSNRMSMQAANTQLYPNEPAPKRSSFEKQRNIDSKMGFKSMSLR
                     DRLENEQGSEQQSHQHSALADIAANGWKSRFVDSDDDDSDFMGILNAPKPLYMEAGTM
                     DRSLSEVNSQKISNKKSKLSLRSASMVDKVSGPATNVQPFEKQPTRMTMSSQSLQKNN
                     DEYQSTPEKKTFGTKLKKLFGRKKDK"
     gene            complement(<833740..>835455)
                     /gene="TPHA0C03870"
                     /locus_tag="TPHA_0C03870"
                     /db_xref="GeneID:11533989"
     mRNA            complement(<833740..>835455)
                     /gene="TPHA0C03870"
                     /locus_tag="TPHA_0C03870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684924.1"
                     /db_xref="GeneID:11533989"
     CDS             complement(833740..835455)
                     /gene="TPHA0C03870"
                     /locus_tag="TPHA_0C03870"
                     /inference="similar to DNA sequence:INSDC:YKL100C"
                     /note="similar to Saccharomyces cerevisiae YKL100C;
                     ancestral locus Anc_2.481"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684972.1"
                     /db_xref="GeneID:11533989"
                     /db_xref="GOA:G8BQM6"
                     /db_xref="InterPro:IPR006639"
                     /db_xref="InterPro:IPR007369"
                     /db_xref="UniProtKB/TrEMBL:G8BQM6"
                     /translation="MRESIDSIKNYIWAFLVKNSSPELPHIDNDDLKNIFEKVNDILQ
                     SKQSTVNYKFEKLTNELGFMITKLVFSYSVYINYFILTVLALSLVIVGSFGSITSIPY
                     TALPPTKIHPLFHPTDLDVDQDCHIVYKNDKDSKKKHDIMDEKHAIILPITSSIALCG
                     LYIVIKKFEVQWLKYVMWMLTLNMKIVNLPSTKFVVTYIFHAFSRTLTSITRKWDPLS
                     YSPRFRLTLSDDNEAINANSGIITNFGYKEYLESDDSKLYYQATIDEIDKDSSIKFFY
                     RREFIEPSSVTAKRQIFNIYFDNASFYAFIFSLISTVMYHYFSDNWLMTNIVSVNMAI
                     WAISNLKLKNLRSGTLILVALFFYDIFFVFGTDVMVTVATNIDLPVKLTVPTKFNTSE
                     SKFEFAMLGLGDIALPGMFIAMCYKFDIWKYHYDNTDTEFHLLNKKYAGKYFIVACAS
                     YTLALVTCMVALTIYNTAQPALLYIVPSLVISTVLTALISREFNLFWTFQYDTIELGE
                     NMLEVEDTDKGVSTKAMTYAEYIMTDNDEDDNEDYTEEDALMDEKYSDYDSEDTDDTI
                     SMSQE"
     gene            <835920..>836909
                     /gene="TPHA0C03880"
                     /locus_tag="TPHA_0C03880"
                     /db_xref="GeneID:11533810"
     mRNA            <835920..>836909
                     /gene="TPHA0C03880"
                     /locus_tag="TPHA_0C03880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684925.1"
                     /db_xref="GeneID:11533810"
     CDS             835920..836909
                     /gene="TPHA0C03880"
                     /locus_tag="TPHA_0C03880"
                     /inference="similar to DNA sequence:INSDC:YKL098W"
                     /note="similar to Saccharomyces cerevisiae YKL098W;
                     ancestral locus Anc_2.483"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684973.1"
                     /db_xref="GeneID:11533810"
                     /db_xref="UniProtKB/TrEMBL:G8BQM7"
                     /translation="MDDKLKTLVAFRNILQFSIILRRSFVCIINEDQQNIDQTLLLKN
                     SEIIETRIGEDYEGIDIEILDKFEIIPPVHRQRIKISIISNVEDLESKDQINLVRYLR
                     APGLNHIFIGLLYFDCTNARTKETIATQDWLRNSIWMSCVIKDMKHIEMYDELLSSGN
                     NDTRYAKINLAQQRLLDDIHVDPRVKRYVLDVIVHLRMHTLSYKQKGGGIHPRSLEDV
                     ILLSKVIRLSQFAAVELKTSTNDPDVKKKTPTLYIMSEHIRLAALMYFPFHLILIRDS
                     SMDVSVSYGSNKELIDDFIEKLHTINDAVDRQNPLLIQEIVIRDVLRKVIPPI"
     gene            <837758..>839224
                     /gene="TPHA0C03890"
                     /locus_tag="TPHA_0C03890"
                     /db_xref="GeneID:11534118"
     mRNA            <837758..>839224
                     /gene="TPHA0C03890"
                     /locus_tag="TPHA_0C03890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684926.1"
                     /db_xref="GeneID:11534118"
     CDS             837758..839224
                     /gene="TPHA0C03890"
                     /locus_tag="TPHA_0C03890"
                     /inference="similar to DNA sequence:INSDC:YKL096W-A"
                     /note="similar to Saccharomyces cerevisiae CWP2
                     (YKL096W-A); ancestral locus Anc_2.484"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684974.1"
                     /db_xref="GeneID:11534118"
                     /db_xref="UniProtKB/TrEMBL:G8BQM8"
                     /translation="MKFSIHFFLFCIYFNFVKCDSAEFSLSLVRTGASYNGDQIYVSD
                     DTLVINFEDNSSGTEFKGVVTDLGYIKLADGSYIYIDENKNLRTTTDSNEATTNFSVR
                     SGYLAYNNDASFYVLPVDDSYVFKVGYTTDSSFDSVLAKCSDSNGNTISSFEPNPASV
                     QVIISTATNSAVAPNVYVTVSGSTTSVTSAIMSSINSMTSVSGSSSKSAEFSMMTIRS
                     GSQFQYNGVYINSTDNTLRVSASSAAAGRELTQFSGHITGEGYIRCFNGGYMSVGNDK
                     TLKCTDETNSVIVGFSVSGGHLQYNSEDSFFANTTGTANYLKLGYADGSENLGLVIRA
                     VDTSGVVIADFSGSDSSKGTSRQMSSTEAVSTHTNPKSSASVSSAGIKTPSVTSSFAL
                     PTAILIDTSFLANEPFTNGSFGSKSPSLSPSMKPSTSVTSTTSVGRSTLVTSSTRQSS
                     SPTPVSSRTASNDAIPSVASLRIMAQIIPFAVANLLFL"
     gene            <840289..>841620
                     /gene="TPHA0C03910"
                     /locus_tag="TPHA_0C03910"
                     /db_xref="GeneID:11533828"
     mRNA            <840289..>841620
                     /gene="TPHA0C03910"
                     /locus_tag="TPHA_0C03910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684927.1"
                     /db_xref="GeneID:11533828"
     CDS             840289..841620
                     /gene="TPHA0C03910"
                     /locus_tag="TPHA_0C03910"
                     /inference="similar to DNA sequence:INSDC:YKL096W"
                     /note="similar to Saccharomyces cerevisiae CWP1 (YKL096W);
                     ancestral locus Anc_2.485"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684975.1"
                     /db_xref="GeneID:11533828"
                     /db_xref="UniProtKB/TrEMBL:G8BQM9"
                     /translation="MLSNFFLFALFALMFNLVKADSEVFSLTLVRDGALFNNDVVYIS
                     SNTLVIAGSTSTNSGTLLDGVVTDLGYIKLTDGSYIYIDADKNLKTTTDVSQATTNFS
                     ISSGALLYNNEAAFYVVPGNGAYVFKVGYTTDTMALAVLVNCYGSDNELLSDFAPNAA
                     SVQAIIATATNSAVAPGVHVTASNDVSFNSTSSSSVSTVAPESDETDSQSFGLITINS
                     GSQFQYLSVYFNKLDGVLYASASSSSTDDEILFDAVLTKHGYVALSNGDYLYVGDDDI
                     LMASNDTSKAKSGFSISDGHLILGSAGFYINADTNPYAIRVGDSTDSNDVFVALKTVN
                     ATASSISGLQESGVSLSSSTSTASTTASTTASTTASTTASTTASTTASTTASTTASSS
                     VEHTKSALNDVTASSTFSTSTLHSIDAASNGASSIKGMTGFITVLIAYIFI"
     gene            <842008..>842832
                     /gene="TPHA0C03920"
                     /locus_tag="TPHA_0C03920"
                     /db_xref="GeneID:11535291"
     mRNA            <842008..>842832
                     /gene="TPHA0C03920"
                     /locus_tag="TPHA_0C03920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684928.1"
                     /db_xref="GeneID:11535291"
     CDS             842008..842832
                     /gene="TPHA0C03920"
                     /locus_tag="TPHA_0C03920"
                     /inference="similar to DNA sequence:INSDC:YKL095W"
                     /note="similar to Saccharomyces cerevisiae YJU2 (YKL095W);
                     ancestral locus Anc_2.486"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684976.1"
                     /db_xref="GeneID:11535291"
                     /db_xref="InterPro:IPR007590"
                     /db_xref="UniProtKB/TrEMBL:G8BQN0"
                     /translation="MSERKAINKYYPPDYNPIEAEKQARKLAKKLKTKNRNVVTIRLM
                     TPFSMKCLKCSEFIPKSRKFNGKKELIPERYLDTIKIYRLSIKCPACNNLISFKTDPK
                     SSDYVMEIGGVRNHFSKTEEDNQKGNKTETVDEALERLLKVQKEEEQELTGENDVEDK
                     MELLEQKLTQLQKQQQDDEELERMKKNSYIRMKQTPHIGVEQKDDSKDIIMDNEYERK
                     AEQAFSNNNTNLNESKIDFDDPENKTFFKKNNLIKVHKKKVIKKVNPLGISIKKKK"
     gene            <843179..>844108
                     /gene="TPHA0C03930"
                     /locus_tag="TPHA_0C03930"
                     /db_xref="GeneID:11533969"
     mRNA            <843179..>844108
                     /gene="TPHA0C03930"
                     /locus_tag="TPHA_0C03930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684929.1"
                     /db_xref="GeneID:11533969"
     CDS             843179..844108
                     /gene="TPHA0C03930"
                     /locus_tag="TPHA_0C03930"
                     /inference="similar to DNA sequence:INSDC:YKL094W"
                     /note="similar to Saccharomyces cerevisiae YJU3 (YKL094W);
                     ancestral locus Anc_2.487"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684977.1"
                     /db_xref="GeneID:11533969"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BQN1"
                     /translation="MSEYPYEPKTTIPKVEFEEFDGAKFAYMLWPSYAEDNQIRQAKA
                     RVLIVHGFGEYTQIYYRMMDKLSVNGFESFFFDQRGTGETSPGKLKGLTNERYTFNDL
                     NHFISTNLVECKEKGIPLFLWGHSMGGGIVLNYACTGKHKDDIKSFIVSGPLVVLHPH
                     SAPNKITIFFSSLLAKCLPNFRIDTGLDLEGITSDSSYRQFLANDPMSVPLYGSFRQI
                     YDFLERGKALYYNKDNRLSKITAPLFIQHGKDDTINDPRGSQKVYDFLKSNGNVKLQF
                     YENARHSILSLEADNTFETVFNDLVDWLNLYSK"
     gene            complement(<844251..>844688)
                     /gene="TPHA0C03940"
                     /locus_tag="TPHA_0C03940"
                     /db_xref="GeneID:11533822"
     mRNA            complement(<844251..>844688)
                     /gene="TPHA0C03940"
                     /locus_tag="TPHA_0C03940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684930.1"
                     /db_xref="GeneID:11533822"
     CDS             complement(844251..844688)
                     /gene="TPHA0C03940"
                     /locus_tag="TPHA_0C03940"
                     /inference="similar to DNA sequence:INSDC:YIR005W"
                     /note="similar to Saccharomyces cerevisiae IST3 (YIR005W);
                     ancestral locus Anc_7.159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684978.1"
                     /db_xref="GeneID:11533822"
                     /db_xref="GOA:G8BQN2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BQN2"
                     /translation="MNKIKSINAINASELNSGILDASLSWHDEYRDQAYVYIGGLNKE
                     LTEHDILTIFSQFGVPTDIKLVRDKETSESKGFAYLKYEDQRSCVLAIDNLNGSKIAG
                     RNIVVDHVFYEYRDDDLEYRNAVKSELERNDKVNTDKLSITEN"
     gene            <845209..>848181
                     /gene="TPHA0C03950"
                     /locus_tag="TPHA_0C03950"
                     /db_xref="GeneID:11533954"
     mRNA            <845209..>848181
                     /gene="TPHA0C03950"
                     /locus_tag="TPHA_0C03950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684931.1"
                     /db_xref="GeneID:11533954"
     CDS             845209..848181
                     /gene="TPHA0C03950"
                     /locus_tag="TPHA_0C03950"
                     /inference="similar to DNA sequence:INSDC:YMR080C"
                     /note="similar to Saccharomyces cerevisiae NAM7 (YMR080C);
                     ancestral locus Anc_2.489"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684979.1"
                     /db_xref="GeneID:11533954"
                     /db_xref="GOA:G8BQN3"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018999"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BQN3"
                     /translation="MEDTTNVLYQPENVQDLDGFASEGNSFNDSEDEAQLHLNLNSKV
                     ELRENADDFGSNGHSGHAHNEIQVSSAEHACGYCGIDSPTSVVKCNTCKKWFCNSKNG
                     SLSGSHIVNHLVLSHHNVVSLHPDSDLGDTVLECYNCGCKNAFLLGFVSAKSEAVVVL
                     LCRIPCAQTKNVNWDTDQWQPIIENRQFLSWVAEEPTEEEKLTSRLITPSQISKLEAK
                     WRSNKDATINDIDIPESQEEIVSVLLRYQDAYEYQRSYGPLIKLEADYDKQLKESQAL
                     EHISIEWSIALNNRHMASFALSTFESNELKVAVGDEMILRYSGMQHPEWEGRGYIVHL
                     PNSFKDEFSLELKPSKTPPPIHLGTGFTAEFIWKGTSYDRMQDALKTFAVDKKSISGY
                     LYYKILGHEVLDIAFDVPIPKELSIPHFAQLNASQASAVANVLQKPLSLIQGPPGTGK
                     TVTSATIVYHLSKSHKDRILVCAPSNVAVDHLATKLRDLGLKVVRLTAKSREDVESSV
                     SNLALHNLVARAAKGELRKLLKLKEEVGELSASDTKKFVKLLRKTESEIMKKADVVCC
                     TCVGAGDKRLDTKFRTVLIDESTQASEPECLIPIIKGAKQVILVGDHQQLGPVILERK
                     AGDAGLKQSLFERLISLGHIPIRLEVQYRMNPYLSEFPSNMFYEGSLQNGVTIEQRTV
                     SASSFPWPIHEIPMMFWANFGREEISANGTSYLNRIEAMNCERIITKLFKDGVKPEQI
                     GVITPYEGQRAYILQYMQMNGSLDKELYINVEVASVDAFQGREKDYIILSCVRANEQQ
                     AIGFLSDPRRLNVGLTRAKYGLVILGNPRSLSRNSLWNHLLIHFREKGCLVEGSLDNL
                     QLCTVELTRSYQKKRNPNKFDFNMAANMGEFNSFNDFDTQSLLSFAGGNASAAAMFNN
                     SFGQTNDWPNNFNNNEYGSGYYSPVNDNKQQMPQGESFSKFDSSLSRNLQENKGARSR
                     YEPTEISNLNNEMSSLGF"
     gene            complement(<848460..>851348)
                     /gene="TPHA0C03960"
                     /locus_tag="TPHA_0C03960"
                     /db_xref="GeneID:11533490"
     mRNA            complement(<848460..>851348)
                     /gene="TPHA0C03960"
                     /locus_tag="TPHA_0C03960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684932.1"
                     /db_xref="GeneID:11533490"
     CDS             complement(848460..851348)
                     /gene="TPHA0C03960"
                     /locus_tag="TPHA_0C03960"
                     /inference="similar to DNA sequence:INSDC:YKL092C"
                     /note="similar to Saccharomyces cerevisiae BUD2 (YKL092C);
                     ancestral locus Anc_2.490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684980.1"
                     /db_xref="GeneID:11533490"
                     /db_xref="GOA:G8BQN4"
                     /db_xref="InterPro:IPR001936"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:G8BQN4"
                     /translation="MMKQDTLPPAADHQIVTEFEQKYDVYWSLDSIDWNETDTVKINT
                     KGQLIAINTSTLNSTTLINNLQDCKINLSKYTNDSLRIKIDGFNKKTIYLRVSDSTVL
                     NKLLDCLLVWSSFKNFGIFNKLIYYQETLSSDQSIIYENVDDCKYSDNKISQKVNIKI
                     LTDGLLRIYSTEEEGQNALLKSIDVRTILESQIDKLLGHNVKGIIIYSNEREGEELKL
                     QFISMADYTKVWELLYKFTIKSYYSNKNEKIENYLKLSHSFKINIIEAKLEPESFEGD
                     FSYYCSIQLSEDLPTNFKTTTLSNYDVLDNSTLFWRESFSCDKSVNIDTLKLNLIKIN
                     NETQHCNTIGSAIIYLNKLTDIKSLQRLPLKSEDSTNNQIGDICFQVEYMKKNILINS
                     MDPYKNFEKNLKNTNMSDILSYITQRTSNLTHTELIEISVPLIDAFQCLGKENSWLQS
                     LMNYEIMNITVKLKSTDNASAIINTIFRGNSLLTISTEYLFNMTGKIYLVETMRSVIT
                     DILNTNEVIELDENRLRKTYQGKTNKSMEELISDNKLKLSYWVEKIWKNLYTTIEKMP
                     IEIKKALKSLKTSLEEILISQINVDRGTKEKIILNSISSFLFLRYLCPILLNPNLFGI
                     TNKIPNENVRRTLTLITKVLLHFSTLTHFGNKEPWMLCMNDFIDDNNDDLHNFIDKIV
                     NTSNNSDGNGGNIKSTVDFYEPTSLDLTEFNLIGVDPNTLESNFYTIKKCFKYTDVIN
                     LLVTFMLNEDREPSDHIPMSNLSMSTIMSDIPFEINSESCQQFHNDNTGTLSSLKRHK
                     LILNENATEVELASIHDTYSSSHSEIGNMSILLNSASIVHTKIKSLLNTTFQLEYPSA
                     SLSRLDPYFIKLTNSTYINKHDSLYIENNPGKDIKTKNYFQLQPFEVKNIPLNSNKYV
                     KCITDAASSSPRSKASRFSRMFLGATSNAPDSEQTSNKIGKWLRWDRH"
     gene            complement(<852794..>853714)
                     /gene="TPHA0C03970"
                     /locus_tag="TPHA_0C03970"
                     /db_xref="GeneID:11533926"
     mRNA            complement(<852794..>853714)
                     /gene="TPHA0C03970"
                     /locus_tag="TPHA_0C03970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684933.1"
                     /db_xref="GeneID:11533926"
     CDS             complement(852794..853714)
                     /gene="TPHA0C03970"
                     /locus_tag="TPHA_0C03970"
                     /inference="similar to DNA sequence:INSDC:YKL091C,YMR079W"
                     /note="similar to Saccharomyces cerevisiae YKL091C and
                     SEC14 (YMR079W); ancestral locus Anc_2.491"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684981.1"
                     /db_xref="GeneID:11533926"
                     /db_xref="GOA:G8BQN5"
                     /db_xref="InterPro:IPR001071"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:G8BQN5"
                     /translation="MDTVVAQEKEFLESYPQVCAAGSLPGTPGNLTKEQESALEQLKE
                     ILIAKEYKLRLDDSTLLRFLRARKFDVNLSLEMYENCEKWRKEYGTDSILTDFHYDEK
                     PIVAKYYPQYYHKTDKEGRPVYFEELGAVNLPEMLKITTQERMLKNLVWEYESFVKYR
                     LPASSRAFNSLVETSCTVLDLKGISISSAYNVISYVKEASVIGQNYYPERMGKFYIIN
                     APFGFSAAFKLFKPFLDPVTVSKIFILGSSYKKELLKQIPEENLPVKFGGKSEVDESQ
                     GGLYLSDIGPWRNAEFIGPEGEAPHAFSMN"
     gene            complement(<855236..>856279)
                     /gene="TPHA0C03980"
                     /locus_tag="TPHA_0C03980"
                     /db_xref="GeneID:11533918"
     mRNA            complement(<855236..>856279)
                     /gene="TPHA0C03980"
                     /locus_tag="TPHA_0C03980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684934.1"
                     /db_xref="GeneID:11533918"
     CDS             complement(855236..856279)
                     /gene="TPHA0C03980"
                     /locus_tag="TPHA_0C03980"
                     /inference="similar to DNA sequence:INSDC:YGL040C"
                     /note="similar to Saccharomyces cerevisiae HEM2 (YGL040C);
                     ancestral locus Anc_4.70"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684982.1"
                     /db_xref="GeneID:11533918"
                     /db_xref="GOA:G8BQN6"
                     /db_xref="InterPro:IPR001731"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G8BQN6"
                     /translation="MPHTAEYINFEGTSNNVEITSILSGGYNHPLLREWQNERQLTTN
                     MLIFPIFLSDIEDDETAIDSLPNIKRFGVNKIVAYLKPLVEKGLRSVILFGVPLKEGA
                     KDAYGTNADDPNGPVIQGIKILKKNFPNLYIICDVCLCEYTSHGHCGILDDSGAIDLN
                     PSVSRIAAVAINYAKAGAHCVAPSDMIDGRIQMIKKGLLSNGLANKTFVLSYSAKFSG
                     NLYGPFRDAACSSPSSGDRKCYQLPSGGRGLARRALKRDLQEGADGIIVKPSTFYLDI
                     MRDAAEICHDLPVCAYHVSGEFAMLHAAAEKNVVDLKTIVLESHQGFLRAGARLIITY
                     FAPELLDWLKESQ"
     gene            complement(<856750..>857711)
                     /gene="TPHA0C03990"
                     /locus_tag="TPHA_0C03990"
                     /db_xref="GeneID:11533829"
     mRNA            complement(join(<856750..857037,857583..>857711))
                     /gene="TPHA0C03990"
                     /locus_tag="TPHA_0C03990"
                     /product="60S ribosomal protein L14"
                     /transcript_id="XM_003684935.1"
                     /db_xref="GeneID:11533829"
     CDS             complement(join(856750..857037,857583..857711))
                     /gene="TPHA0C03990"
                     /locus_tag="TPHA_0C03990"
                     /inference="similar to DNA sequence:INSDC:YHL001W,YKL006W"
                     /note="similar to Saccharomyces cerevisiae RPL14B
                     (YHL001W) and RPL14A (YKL006W); ancestral locus Anc_2.505"
                     /codon_start=1
                     /product="60S ribosomal protein L14"
                     /protein_id="XP_003684983.1"
                     /db_xref="GeneID:11533829"
                     /db_xref="GOA:G8BQN7"
                     /db_xref="InterPro:IPR002784"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:G8BQN7"
                     /translation="MSTDSIVKASNWRLVEVGRVVLVKTGPSAGKLAAIVEIINQKKV
                     LIDGPETGVPRQTVILGHVVLTPLTFALTRGARTATVSKKWSSAGVTEKWATSTWAKK
                     IAQRERRAALSDFERFQVMVLRKQKRFAVKKALAKA"
     gene            <859537..>860010
                     /gene="TPHA0C04000"
                     /locus_tag="TPHA_0C04000"
                     /db_xref="GeneID:11533974"
     mRNA            join(<859537..859572,859753..>860010)
                     /gene="TPHA0C04000"
                     /locus_tag="TPHA_0C04000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684936.1"
                     /db_xref="GeneID:11533974"
     CDS             join(859537..859572,859753..860010)
                     /gene="TPHA0C04000"
                     /locus_tag="TPHA_0C04000"
                     /inference="similar to DNA sequence:INSDC:YKL006C-A"
                     /note="similar to Saccharomyces cerevisiae SFT1
                     (YKL006C-A); ancestral locus Anc_2.504"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684984.1"
                     /db_xref="GeneID:11533974"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:G8BQN8"
                     /translation="MSTSNYPQLEGRNDQQLESLANKLATFRNINQEIGDQAVNDNSL
                     INSLSNSFDSMLNNLKHTSGRLTRSLKSGSNIWRMVGLALLTFFILYNLYKFF"
     gene            complement(<860247..>861044)
                     /gene="TPHA0C04010"
                     /locus_tag="TPHA_0C04010"
                     /db_xref="GeneID:11533481"
     mRNA            complement(<860247..>861044)
                     /gene="TPHA0C04010"
                     /locus_tag="TPHA_0C04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684937.1"
                     /db_xref="GeneID:11533481"
     CDS             complement(860247..861044)
                     /gene="TPHA0C04010"
                     /locus_tag="TPHA_0C04010"
                     /inference="similar to DNA sequence:INSDC:YKL007W"
                     /note="similar to Saccharomyces cerevisiae CAP1 (YKL007W);
                     ancestral locus Anc_2.503"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684985.1"
                     /db_xref="GeneID:11533481"
                     /db_xref="GOA:G8BQN9"
                     /db_xref="InterPro:IPR002189"
                     /db_xref="InterPro:IPR017865"
                     /db_xref="UniProtKB/TrEMBL:G8BQN9"
                     /translation="MASQFDSVIADIISDAPSGEITEIYEDLIKIVGESAKESILEAI
                     EQYNIRNCIPIEVEGKQIIISEYNKDGVKFIDPITAISFSVDHLNRTGFDIGSSDISL
                     SSVQEEIVKNLNEYTASDFSGEVTFGVYPIPNEEDKTSIIISSTKYNASNFWNGEWKS
                     KYIFDSSSNSLEGEIDVDVHFYEDGNVSFKSNKKINLSSVNDAVSALKEVEVEFEKEL
                     DSSFSDLNEKQFKSLRRKLPITRSKVNWGKAIGNYRLGKDAAQGITN"
     gene            complement(<861629..>863086)
                     /gene="TPHA0C04020"
                     /locus_tag="TPHA_0C04020"
                     /db_xref="GeneID:11533830"
     mRNA            complement(<861629..>863086)
                     /gene="TPHA0C04020"
                     /locus_tag="TPHA_0C04020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684938.1"
                     /db_xref="GeneID:11533830"
     CDS             complement(861629..863086)
                     /gene="TPHA0C04020"
                     /locus_tag="TPHA_0C04020"
                     /inference="similar to DNA sequence:INSDC:YHL002W"
                     /note="similar to Saccharomyces cerevisiae HSE1 (YHL002W);
                     ancestral locus Anc_2.502"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684986.1"
                     /db_xref="GeneID:11533830"
                     /db_xref="GOA:G8BQP0"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="UniProtKB/TrEMBL:G8BQP0"
                     /translation="MSSKIREKINKATSSSLREDNWQYILDVCDAIRKDPEDYGNQAV
                     ECILMNLKQNDANVIMRTLSLILSMAENCGSRIKQQIDNKRIIAVLNDLIENPIVHVT
                     VKTKLVEIVRQLSKSFKSDPSLRYISDFYKQIKSNRKYSHLITNVKSKSASSTRNVRP
                     PSDINLRSNDEDEDFQKALRLSLREFEVEKEKNESKVSQSQPEMQAQTHTQALQQSQI
                     LQQNGQPQKPNIIRKVRAMYELISQEENELSFRKGDVITVLEQVYRDWWRGTLHGKIG
                     IFPLNYVTPIIELSNEDIIKENQQENNILSQKANIDQLQDYLQNMKNTGDLNLQDQQV
                     NDLYGSVTPLRPQIAKMIGKYSQKKDDLTSLRQVLANAEVDYNKLLDRAASAYIPPPT
                     PQSQVYQSAYDNRVELPQQPAQINSNMAPHTLQQPYNNYPHAPQQISSQYMPPQQVQS
                     QNIPSQLQYSIQNQQYPQYQNQNLPQPQPQPQNNQ"
     gene            <864403..>865677
                     /gene="TPHA0C04030"
                     /locus_tag="TPHA_0C04030"
                     /db_xref="GeneID:11533973"
     mRNA            <864403..>865677
                     /gene="TPHA0C04030"
                     /locus_tag="TPHA_0C04030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684939.1"
                     /db_xref="GeneID:11533973"
     CDS             864403..865677
                     /gene="TPHA0C04030"
                     /locus_tag="TPHA_0C04030"
                     /inference="similar to DNA sequence:INSDC:YHL003C,YKL008C"
                     /note="similar to Saccharomyces cerevisiae LAG1 (YHL003C)
                     and LAC1 (YKL008C); ancestral locus Anc_2.501"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684987.1"
                     /db_xref="GeneID:11533973"
                     /db_xref="GOA:G8BQP1"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="InterPro:IPR013599"
                     /db_xref="InterPro:IPR016439"
                     /db_xref="UniProtKB/TrEMBL:G8BQP1"
                     /translation="MSDDKGTNHHDNGDNMSLKPVVKTRSRRTSSVGNINLGDTISSI
                     STMKLTKEQKLASKERLKELNRNIDNNDKDLARKIWLSYLEINYRRVWLTPLLILLIV
                     YFAYYTSGNKTESNPLYQFINISYQVGDTDQYGKGIKDLSFVAFHMVFFTFLREFLMD
                     AIIKPITINKLKITKTHKVKRIMEQVYSIIYYGTSGPFGIYIMYHSDLWLFKTETMYA
                     TYPNFYNSYLYKFFYLGQASFWAQQACVLVLQLEKPRKDYNELIFHHVVTLLLIWSSY
                     VFHFTRMGLAIYITMDVSDLFLSLSKLSNYLELGCTPVIFFIFIAVWVYLRHIVNIKI
                     LWSVLTEFRTVGSYTLNFATSQYKCWISLPIVFTLIAALQLVNLYWLFLIFRILYRLI
                     WLDIQKDERSESSSEDEDTPSSEFHSESKEDI"
     gene            complement(<865873..>866589)
                     /gene="TPHA0C04040"
                     /locus_tag="TPHA_0C04040"
                     /db_xref="GeneID:11533509"
     mRNA            complement(<865873..>866589)
                     /gene="TPHA0C04040"
                     /locus_tag="TPHA_0C04040"
                     /product="mRNA turnover protein MRT4"
                     /transcript_id="XM_003684940.1"
                     /db_xref="GeneID:11533509"
     CDS             complement(865873..866589)
                     /gene="TPHA0C04040"
                     /locus_tag="TPHA_0C04040"
                     /inference="similar to DNA sequence:INSDC:YKL009W"
                     /note="similar to Saccharomyces cerevisiae MRT4 (YKL009W);
                     ancestral locus Anc_2.498"
                     /codon_start=1
                     /product="mRNA turnover protein MRT4"
                     /protein_id="XP_003684988.1"
                     /db_xref="GeneID:11533509"
                     /db_xref="GOA:G8BQP2"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="UniProtKB/TrEMBL:G8BQP2"
                     /translation="MPRSKRSKLVTLAQTDKKGRENKERIFDEIRESLDTFRYCWILY
                     LDDVRTPVLQDIRTAWTGSKLILGKRKVLEKALGENRENEYKENIFKLSKLCKGVTGL
                     LFTNEDVETTKAYFESYTRMDYSRPNSRAPLTFTIPEGIVYSRGGQVPIEEDVPMVHS
                     LEPTLRNKFEIPTKIKAGKITLEAPYLVCEEGKKLDVKQALILKQFGVAASEFKVKVV
                     AYYDNESTTVETVNINMEED"
     gene            <867505..>871926
                     /gene="TPHA0C04050"
                     /locus_tag="TPHA_0C04050"
                     /db_xref="GeneID:11535263"
     mRNA            <867505..>871926
                     /gene="TPHA0C04050"
                     /locus_tag="TPHA_0C04050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684941.1"
                     /db_xref="GeneID:11535263"
     CDS             867505..871926
                     /gene="TPHA0C04050"
                     /locus_tag="TPHA_0C04050"
                     /inference="similar to DNA sequence:INSDC:YKL010C"
                     /note="similar to Saccharomyces cerevisiae UFD4 (YKL010C);
                     ancestral locus Anc_2.497"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684989.1"
                     /db_xref="GeneID:11535263"
                     /db_xref="GOA:G8BQP3"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BQP3"
                     /translation="MRDNHEANDQNGDHENADDWDYSGNDEGDEHSSNNNHLDSIDYD
                     DYYDGDELQDDDDADEMPEDEEEDENDYNHESDLDGEIDMPSFRGGAAVFEELLGNMG
                     NSHTVFRRNAERQSGSTNGDSDGITHIDDDNTETSNTRQIPGNIQDLFSMFQNNMFTG
                     AIPGAGNSGRVKRLKKLVDNIVNAEEDPYIAMESLRELSEQLLMMNQIVIDRVLPVEE
                     LLESLINIFRNPLLIEQLELQLMAGRCLHSLFEVDPDCMSIAIEKDIVVTLQSKLEEI
                     SYIDLAEQVLETLEYISRVHCKDILEAGNLLTYIQFFDFFTIHAQRKAISCIVNACSK
                     LEIKYFPIIQEIMPLLQTIFLQNVDDNIMTKLINIICCICAGLNKHFNFDELFTIETA
                     NKIIYLISSYDLSVDNKVKCIDILSIFVIKSEAISLGFLNSNKAVPMVLKCIENYENK
                     THAKDNESETKENTFFNETLMFVPDNLLISLSRFLTVLLPEEPDNSLTHANALLDKSK
                     FKKDELQDMLLEMIPILIGIYINTVDYSIKSYASLALLRSICQLNSASLEAVKEKIVL
                     LFEPSFFKMLENNIHLTNNKLETYISLELLTILVVLFSDFEAIFMDTIKKEGILDYIK
                     SLYYKIELLDVKEINQMDVDSENETNNARDEFNNDSDNDSAIQHSYDEMNVPDFVKPK
                     LIKFDIFRYETQAQMTTRVLNMSNFLYQKVKSVSVVENDKISAIKNVLNKLKQYDIQN
                     YSYNDWVDIWTLLKSTMFKNGSNISSYELTTSGLLKTLVEVLSSSDMHIKRFFLEVFE
                     SKLEELVSILQSALSKLEDISILESGLQGDEGGISSLSKEVEVQLVYKSDGVKDNIPI
                     NLRSVKVSIHSIASLKMLNDFLKHKVAQSMFLTSLLPGFKNETTNSENAMASLKNIDF
                     KFSIGENKFSSNETIFGAIYRHWTETHNETNLNSMWLEVPTIYYEKVEEDDDDETEML
                     NNISNNIKPKFDGSLVEDLLEFLKILKDSKLPNELFINSKISGKLSRQLDEPLIVASG
                     VLPSWVLQLTKNYHFLFPFDIRMFYLQCSSFGYGRLIERWLFRSGRMKDQSSDNPLQQ
                     LGTLTKNKVKLSRDNLFASGLKTIDKYGSNRNTLEIEYIDEEGTGLGPTLEFYASMSL
                     EFAKPLLDIWLCDEEVGNTDTKFIEQELFPKPLSTCSDANKTIELFRILGKFIAKSML
                     DGRIVDFRFKEVFFQLLHERIVADDTKNSSRKQILYSLDILSLVDTNLSQSLKYLYNN
                     MSDNDIIKGLDLNFVLPGKQIVEIIDGGNNILVTSDNVEKYITGVIDQMLYTGIEKQL
                     DAFIKGFSECFPYKNLLILTPKELVELFGKEEEDWSESTLYSSIKAEHGYTMDSQTVH
                     DLINILKYFNINQRRLFSQFLTGSPKLPIGGFKCLKPKLTVVLKTPEDNLTPDQVLPS
                     VMTCANYLKLPKYSSKEILKSRIDQAMREGSGAFLLS"
     gene            complement(<872085..>873509)
                     /gene="TPHA0C04060"
                     /locus_tag="TPHA_0C04060"
                     /db_xref="GeneID:11533922"
     mRNA            complement(<872085..>873509)
                     /gene="TPHA0C04060"
                     /locus_tag="TPHA_0C04060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684942.1"
                     /db_xref="GeneID:11533922"
     CDS             complement(872085..873509)
                     /gene="TPHA0C04060"
                     /locus_tag="TPHA_0C04060"
                     /inference="similar to DNA sequence:INSDC:YKL090W"
                     /note="similar to Saccharomyces cerevisiae CUE2 (YKL090W);
                     ancestral locus Anc_2.494"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684990.1"
                     /db_xref="GeneID:11533922"
                     /db_xref="InterPro:IPR002625"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="UniProtKB/TrEMBL:G8BQP4"
                     /translation="MEDNDTISPIELLKSIFRDHSIATIKKALEGSNNDIELASSMIL
                     SDKSDTLQDVNIVNDELESELDRLSKIFPSIEKVEIEKLLKDSNGKYDIIPELLNLEH
                     IHSQDIQDQRKLQNSIVEDQNQKKILDNTAWVSKDQYTNEIVKYTFVSKETASHFYYK
                     NACNFLLAILDIIQSTLNPIEAVKNPSSSNLKGNLKELRKNKFNGKIMGGKVQTNNSL
                     AHFKRGDKNQNMYSLLNDGLPINSEETDPISTASMIDDELVNDLIRNNSCIGSLNRHT
                     IYQFFIFYKGDIEKTVALALLFIQNNYKDLETLQNSVVLTFNSKEILRSPQGKKSNIS
                     SKSTQNKLLPKSSLQKKGFVNTSNFNLASEMVDHLFENYRLDFHGFLPNEAILTLQHS
                     LNIWWSSEMDEREVAVQKLSTSKVMNVKPLQVITGRGIHSANGISQVRIKVKKYLVDQ
                     GFIFLEEGSYFIVEGKASTVANRI"
     gene            complement(873797..873870)
                     /gene="TPHA0Ctrna8V"
                     /locus_tag="TPHA_0Ctrna8V"
                     /db_xref="GeneID:11533671"
     tRNA            complement(873797..873870)
                     /gene="TPHA0Ctrna8V"
                     /locus_tag="TPHA_0Ctrna8V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:11533671"
     gene            complement(<876703..>877347)
                     /gene="TPHA0C04070"
                     /locus_tag="TPHA_0C04070"
                     /db_xref="GeneID:11533988"
     mRNA            complement(<876703..>877347)
                     /gene="TPHA0C04070"
                     /locus_tag="TPHA_0C04070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684943.1"
                     /db_xref="GeneID:11533988"
     CDS             complement(876703..877347)
                     /gene="TPHA0C04070"
                     /locus_tag="TPHA_0C04070"
                     /inference="similar to DNA sequence:INSDC:YMR077C"
                     /note="similar to Saccharomyces cerevisiae VPS20
                     (YMR077C); ancestral locus Anc_2.492a"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684991.1"
                     /db_xref="GeneID:11533988"
                     /db_xref="GOA:G8BQP5"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:G8BQP5"
                     /translation="MGQKGSRPQITQTDKAILELKRSKDNIHKFTKRTEQLINDERQT
                     LKVLIKENPVDYKQNTKIRFLLKRIHYQEDLVQKASDQLTNLENMVSNIEFKIIEKRF
                     VDGLKSGNEILKKMNREFGDVNNLMDDVQNQIDYQNEIDNVLSTSIVGINNYEDEVDK
                     ELEHLEQEVNPSAKEVERLPSIVNVANLKENNNIEEKLNEMPDSKREKIAILDS"
     gene            complement(<877717..>880140)
                     /gene="TPHA0C04080"
                     /locus_tag="TPHA_0C04080"
                     /db_xref="GeneID:11533766"
     mRNA            complement(<877717..>880140)
                     /gene="TPHA0C04080"
                     /locus_tag="TPHA_0C04080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684944.1"
                     /db_xref="GeneID:11533766"
     CDS             complement(877717..880140)
                     /gene="TPHA0C04080"
                     /locus_tag="TPHA_0C04080"
                     /inference="similar to DNA sequence:INSDC:YMR078C"
                     /note="similar to Saccharomyces cerevisiae CTF18
                     (YMR078C); ancestral locus Anc_2.492"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684992.1"
                     /db_xref="GeneID:11533766"
                     /db_xref="GOA:G8BQP6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BQP6"
                     /translation="MDNNGLEFTLNLENSILFQQPDNTSKKEIGSKNDNDAKMSTTQA
                     NDVDKLFFNSISGVKIELKRKENIKDSIKQGLFENENSKIWKNDDTYGININELHDRI
                     ESNRHSEEKFNLVKEDKDVQHGKLQAKKGTSTLWVEKWKPRKFIELVGNEATNRRVLF
                     WLRQWTPVVFKETLPINHKILNSKKGKDYNDTVQFEDPFHRPFKKILLIHGTPGIGKT
                     SVAHIIAKQQGYTVNEINASDERSGTFVKEKIHNDLFSNTFENKPICLIADEIDGSIE
                     NGFIKVLLDILRNDKIATNYYLSNLEKINRRSKTDKEASQIRKKLKHLLMRPIICICN
                     NLYSSSLEKLRPFCEIIPFKKPSEKAIIERLSYILEKESTNKHEGQIDVELLKTIIDS
                     SQNDLRNCINNLQFFCLDRNTNRGTGNISKDFKSSWFKVVNEIFQKDSQISNKLQMKN
                     LMKTLEVQGGMDKIISGCFSMYLQVKYTDNGLLKPSKISDWLYFNDAIDHSLYNSGIS
                     NGGELQRYNSAVALKFFDFFSDIGNKNDIRIKSHDFEVKQLIKGNNEIVKLLLSRIAT
                     NNPSLSTFVNKKSLIFDILPILDSLVSYDLSSMHNSITKNKIYDNLIETINSYQLLLN
                     KSSIANILSTHNFSNVNENSKDNYLGSLDMNRQILALDPPINKIVLFDPKSALNVTNK
                     RPYTLNLLLAKIEETKAKKRHRDMVMSQSSHLNEAKYKKQKQDVAVVSSAESTTSSTS
                     TVDFFKSQYNLMTKKNEKELGRNSTSNELTNANVNSSGEQHIRIWVKYKEGFSNAVRK
                     NVNWNNFWE"
     gene            complement(<880526..>881644)
                     /gene="TPHA0C04090"
                     /locus_tag="TPHA_0C04090"
                     /db_xref="GeneID:11533672"
     mRNA            complement(<880526..>881644)
                     /gene="TPHA0C04090"
                     /locus_tag="TPHA_0C04090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684945.1"
                     /db_xref="GeneID:11533672"
     CDS             complement(880526..881644)
                     /gene="TPHA0C04090"
                     /locus_tag="TPHA_0C04090"
                     /inference="similar to DNA sequence:INSDC:YKR076W"
                     /note="similar to Saccharomyces cerevisiae ECM4 (YKR076W);
                     ancestral locus Anc_5.667"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684993.1"
                     /db_xref="GeneID:11533672"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR016639"
                     /db_xref="UniProtKB/TrEMBL:G8BQP7"
                     /translation="MSKQWASKDDGAFKRQVSSFRENICHEHPIYKPAKGRYWLYVSL
                     ACPWAHRTLITRALKGLIPIIGVSIVHWHMDEKGWRFLTSEDQEVPFDINKASTINGG
                     IETTNLNEYTPTGHIANDSSRPMIDGTIEPLYIYKRLSDLYYKSNPDYSARFTVPVLW
                     DKETQTIVNNESAEILRMFNSGVFDEFVEDKSSIVVKDLYPTKLQKDIDELNTWIYDN
                     INNGVYKSGFSEKQEVYEKEVTNVFFHLDKVERILHENYKNLETKYGKAEVSKHLDEY
                     FLLNNTLTEVDVRLYTTIVRFDPIYVQHFKCNFTTIRAGYPFIHKWLKNLYWNYDAFG
                     KTTDFNHIKLHYSRSHPRINPLGITPLGPKPDILQMNE"
     gene            complement(<882172..>882774)
                     /gene="TPHA0C04100"
                     /locus_tag="TPHA_0C04100"
                     /db_xref="GeneID:11533657"
     mRNA            complement(<882172..>882774)
                     /gene="TPHA0C04100"
                     /locus_tag="TPHA_0C04100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684946.1"
                     /db_xref="GeneID:11533657"
     CDS             complement(882172..882774)
                     /gene="TPHA0C04100"
                     /locus_tag="TPHA_0C04100"
                     /inference="similar to DNA sequence:INSDC:YKL001C"
                     /note="similar to Saccharomyces cerevisiae MET14
                     (YKL001C); ancestral locus Anc_2.510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684994.1"
                     /db_xref="GeneID:11533657"
                     /db_xref="GOA:G8BQP8"
                     /db_xref="InterPro:IPR002891"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BQP8"
                     /translation="MATNITWHPNLTYDERKQLRNQDGCTIWLTGLSASGKSTIACAL
                     EQKLLNKKLSAYRLDGDNIRFGLNKDLGFTEEDRNENIRRISEVSRLFADACTISISS
                     FISPYKADRNRARELHKEAGLKFIEVFVDVPLDIAEKRDPKGLYKKAREGIIKEFTGI
                     SAPYEAPESPELHLKTHLKSVEECADDIYNYLVKELIIPA"
     gene            complement(<883710..>884822)
                     /gene="TPHA0C04110"
                     /locus_tag="TPHA_0C04110"
                     /db_xref="GeneID:11533795"
     mRNA            complement(<883710..>884822)
                     /gene="TPHA0C04110"
                     /locus_tag="TPHA_0C04110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684947.1"
                     /db_xref="GeneID:11533795"
     CDS             complement(883710..884822)
                     /gene="TPHA0C04110"
                     /locus_tag="TPHA_0C04110"
                     /inference="similar to DNA sequence:INSDC:YKR005C"
                     /note="similar to Saccharomyces cerevisiae YKR005C;
                     ancestral locus Anc_2.515"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684995.1"
                     /db_xref="GeneID:11533795"
                     /db_xref="UniProtKB/TrEMBL:G8BQP9"
                     /translation="MEFCLLQNFNKNVGKCKFCITVDKNHFNDIDNCECIKYLNNIYS
                     FHCHKTGSNPERTINTFNDLDDHESDDGGNELSYMIFNDIFENNVVYRKPLIFELKSY
                     IHEYLKFMEKSYEKMYKFENYHYSSSIPTPFTKIYETIKHPLTSYQAITILTNITFPL
                     IKTIETTLNLTSTDCTLINSYCYTTIPTTLWSTILSTSLKTETYDKIKCFKFYTTIDD
                     TITSTYTKTFYNYYYDTTTETEVEENTILKYKNQMSTIIETNIEDVYTTVFVGKKTIT
                     DFNKIVVYTTETSTDILKNTNTNILTVTKTIGGPVVTKTTTMTSTTTDIDVKKTVTTE
                     TTTKIKKKKLVTVSTKWKSRTITQYSTTLTTTTLTI"
     gene            <886083..>886319
                     /gene="TPHA0C04120"
                     /locus_tag="TPHA_0C04120"
                     /db_xref="GeneID:11533655"
     mRNA            <886083..>886319
                     /gene="TPHA0C04120"
                     /locus_tag="TPHA_0C04120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684948.1"
                     /db_xref="GeneID:11533655"
     CDS             886083..886319
                     /gene="TPHA0C04120"
                     /locus_tag="TPHA_0C04120"
                     /inference="similar to DNA sequence:INSDC:YHR001W-A"
                     /note="similar to Saccharomyces cerevisiae QCR10
                     (YHR001W-A); ancestral locus Anc_2.520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684996.1"
                     /db_xref="GeneID:11533655"
                     /db_xref="InterPro:IPR019182"
                     /db_xref="UniProtKB/TrEMBL:G8BQQ0"
                     /translation="MINYISKAAFKKSPHFGRLSFGNLINYSPNLLLWGGAWAASIAV
                     FTEGWPLFQDAFYKKIPYFGQHWIVEIPPEDKQH"
     gene            complement(<886804..>888405)
                     /gene="TPHA0C04130"
                     /locus_tag="TPHA_0C04130"
                     /db_xref="GeneID:11533658"
     mRNA            complement(<886804..>888405)
                     /gene="TPHA0C04130"
                     /locus_tag="TPHA_0C04130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684949.1"
                     /db_xref="GeneID:11533658"
     CDS             complement(886804..888405)
                     /gene="TPHA0C04130"
                     /locus_tag="TPHA_0C04130"
                     /inference="similar to DNA sequence:INSDC:YBR288C"
                     /note="similar to Saccharomyces cerevisiae APM3 (YBR288C);
                     ancestral locus Anc_2.522"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684997.1"
                     /db_xref="GeneID:11533658"
                     /db_xref="GOA:G8BQQ1"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:G8BQQ1"
                     /translation="MYISIYITDINNVLVFEQLLNPVAPSFNELWSKLQNLYPDISGD
                     NNDKATCSSIFSNDKYINCRLGKNLELYRYCSNVNKLYFWCLVSGRLNSKEQLYPFVI
                     MEELEQSLMTYFEKEELTITKLVNNYDRISLILYWLFDGGEPTVGKRYNNWIKHNIPS
                     KYDFSKVINNTAHNIQIALQKSQKQQSNFPYQDMNFDSNVAVPWRMRNVDHVNNELYL
                     DLVESIHVVLETKKRKSSYANSTMKIVTGNIIGKALVKSVLNGNPIVEMKIDMAGNDL
                     ESIFLHECVKSKDVDKDQEFENTKLIKFLPPDGSFKLFDYNINLNTTENTKKEFNAFN
                     NRLGLVTASFEDGIGMKNDEFQLTLNISNSTKVQSIQNLQIEIIFLPKFQRSEEDLFN
                     SSKNEANDDSINKEGINNLSKNNSDLGKVDYKIKMLRSSHGRFENSLSPNKCSWIFDK
                     ETNVGITPVLTGCVEYTDKNPNKKMILSHILLNYSYNGELASGMKIQSLEIQSGLKAG
                     KGKSLFKGVKYSTTIEELKLRSRKI"
     gene            <888825..>891695
                     /gene="TPHA0C04140"
                     /locus_tag="TPHA_0C04140"
                     /db_xref="GeneID:11533660"
     mRNA            <888825..>891695
                     /gene="TPHA0C04140"
                     /locus_tag="TPHA_0C04140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684950.1"
                     /db_xref="GeneID:11533660"
     CDS             888825..891695
                     /gene="TPHA0C04140"
                     /locus_tag="TPHA_0C04140"
                     /inference="similar to DNA sequence:INSDC:YBR289W"
                     /note="similar to Saccharomyces cerevisiae SNF5 (YBR289W);
                     ancestral locus Anc_2.523"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684998.1"
                     /db_xref="GeneID:11533660"
                     /db_xref="GOA:G8BQQ2"
                     /db_xref="InterPro:IPR006939"
                     /db_xref="UniProtKB/TrEMBL:G8BQQ2"
                     /translation="MSNLSIKQRSHLFQDTSMNNVTNNNNNSNSNNSVNYNNDNNSSN
                     NNNNNNNNNNNNNSNNNSNMNQQQNPFNNIGTPSFNIQQISPQILQNLTPQQLQLIQQ
                     RHQQLLRSRIQQAQQNQQNKQKQQQQQKQQQHQQQQQHQQQQQQQQQQQQQQQQEQQR
                     LKQQEQQTQPRQQQQQQFDSKQDMKQANTTRKQSKSSQVQQMKNAEPTEGNQNGFQLP
                     FNLPPQIAQLPLPMQQQVLASLKQQAIQKNNPSVVTAITMAQEQLQQQIQRIQQRQQV
                     TQQGKEPTQTQGPQSLANKSQQKTQKVNSGSGTQRKQLQSKRKTSNIPNKLQNVQQLQ
                     QYAPPQKMELPAFQTIKYNPPEAMIPYQGYWSDKQATTDTLLYEQITQRDKSNRMDQS
                     KEQNGYPPFSIFGFSDKEYTAKLWHNLKYYEGSKEVRMASIRSTSQNVPSVSIWGNGY
                     AGYGNGNTNTKTKIISGINDDHRPIIPDKMLDMYKHAMTEVSEDLIPIRLEFDHERDK
                     FSLRDTLLWNRNDTLLDVDDFVDHMLMDYRFDPEFSSQISDIISQSIKEQIIDFQPNP
                     YTNIQDERIGGDDMRVRIKFDIVIGQSQLVDQIEWDISNPDNDPEEFATSMCNELELP
                     GEFQTAIAHSIREQVHAYHKYLALLGYKFDGSAVEDADIRSRILPNITVDNIYRASAD
                     SKLYTPNLLTISAAELERLDKDKDRDSRRKRRQGRFNRRGVVITSNTSSIVGTNSGTP
                     LGIGGNNAVLNSSSGTPTEVLLPDITDALRTFRTPIPSTVLPGGLDLGPSVESFELKA
                     TTTSNPRPDKPKLQMPSCYIVDHIPGKSLLLSITVPKKENLKLRMNATNRTTIVPHNY
                     TATKSVISNVKQEAGHESSTSRKQLPDNAMDISPPTTMEPQVNRPITMDKVDVNTSSN
                     TINKETESKIDTELNPISSINHTTTGPQKINEDGQVESKTSA"
     gene            <892446..>893459
                     /gene="TPHA0C04150"
                     /locus_tag="TPHA_0C04150"
                     /db_xref="GeneID:11533956"
     mRNA            <892446..>893459
                     /gene="TPHA0C04150"
                     /locus_tag="TPHA_0C04150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684951.1"
                     /db_xref="GeneID:11533956"
     CDS             892446..893459
                     /gene="TPHA0C04150"
                     /locus_tag="TPHA_0C04150"
                     /inference="similar to DNA sequence:INSDC:YBR290W"
                     /note="similar to Saccharomyces cerevisiae BSD2 (YBR290W);
                     ancestral locus Anc_2.524"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003684999.1"
                     /db_xref="GeneID:11533956"
                     /db_xref="InterPro:IPR019325"
                     /db_xref="UniProtKB/TrEMBL:G8BQQ3"
                     /translation="MNNLEMSLATSTQADMNENDHVNNQMDQQSTDTDEESPISERVA
                     EREVLLDLQEGSSNSNVNGSSLENNSIDVDGTSVTNGNTSSNYNIQAGGIRGKTNRYL
                     LTLGRHFNVLDRFFHKPTEVNDQHGASYDGVFSNLTAKPTPEVPEEVNEDFPPTYTDA
                     ANDMSPSYYGANADGTNMFYDEICIEGLPVGNVANLIWNIIVSTSFQFIGFLITYVLH
                     TSHAAKQGSRFGLGLTFIGYGYSMVPSDVTSKVGKGTIINRVKVSNPNDYDDLRIDEQ
                     NENLDTFTSTLSHGVQEEKKSLPLLAIVVGGLGLYISIKSLIDYVKVKRMEKKYLAQD
                     DPV"
     gene            complement(<893885..>895204)
                     /gene="TPHA0C04160"
                     /locus_tag="TPHA_0C04160"
                     /db_xref="GeneID:11533449"
     mRNA            complement(<893885..>895204)
                     /gene="TPHA0C04160"
                     /locus_tag="TPHA_0C04160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684952.1"
                     /db_xref="GeneID:11533449"
     CDS             complement(893885..895204)
                     /gene="TPHA0C04160"
                     /locus_tag="TPHA_0C04160"
                     /inference="similar to DNA sequence:INSDC:YHR003C,YKL027W"
                     /note="similar to Saccharomyces cerevisiae YHR003C and
                     YKL027W; ancestral locus Anc_2.527"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685000.1"
                     /db_xref="GeneID:11533449"
                     /db_xref="GOA:G8BQQ4"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8BQQ4"
                     /translation="MVGKDTWKVVTATALVSIAASKCVEIAWKKYNFKQGSKLENKIE
                     KVLDTTKYDDNLFREQLARNYAFLGEEGMQKLKDQYFVVVGAGGVGSWVVTMLVRSGC
                     QRIKVIDFDQVSLSSLNRHSCADLRDVGTPKVECLKNHLLKIAPWCNIEAVNELWTIE
                     NADRLIFGDGKPTFIIDCIDNIDTKVDLLEYVFKHKIELISSGGASTKSDPTRINVAD
                     MTLTEEDPLARSVRRRLKKRGITTGIPVVFSAEKPDPRKAQLLPLPDNEYEKGKVDEL
                     SALRNFRVRILPVLGTMPGIFGLTIATWVLTKVSGYPIEPIEGKNRIKIYDGIYQSLA
                     GQMTRIGMPDQRVPIALREIGYIVEEMFRGKSPVSGFSTRLALSKWDPTKPVSLQNVV
                     LLTKEEQQEHEKRVLNGDETIESVYPQEVIDLVNQRFAEESYYSQFR"
     gene            <896879..>898795
                     /gene="TPHA0C04170"
                     /locus_tag="TPHA_0C04170"
                     /db_xref="GeneID:11535228"
     mRNA            <896879..>898795
                     /gene="TPHA0C04170"
                     /locus_tag="TPHA_0C04170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684953.1"
                     /db_xref="GeneID:11535228"
     CDS             896879..898795
                     /gene="TPHA0C04170"
                     /locus_tag="TPHA_0C04170"
                     /inference="similar to DNA sequence:INSDC:YKL029C"
                     /note="similar to Saccharomyces cerevisiae MAE1 (YKL029C);
                     ancestral locus Anc_2.529"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685001.1"
                     /db_xref="GeneID:11535228"
                     /db_xref="GOA:G8BQQ5"
                     /db_xref="InterPro:IPR001891"
                     /db_xref="InterPro:IPR012301"
                     /db_xref="InterPro:IPR012302"
                     /db_xref="InterPro:IPR015884"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8BQQ5"
                     /translation="MLRSKATSILKRTDFSSILRTNKRFVSTIKDISFESRSQDDITL
                     PEKQKSLFEQKFQNKKPSQDRLNVNGSIECSLHGFTLLDSPLFNKGTAFTKEERDQFG
                     LSGLLPPKVSTLEEQLERNYKLLCELKTPLEKNDFMTHLRMQNKVLYFAMVKKYIREL
                     VPIIYTPTEGDAIAKYSDRLKRPEGVFLNINEPEKVEENLAAYGDAKDVDYIVVTDSE
                     GILGIGDQGVGGIRISVSKMALMTLCGGIHPGRVLPVCLDVGTNNQELLNNDLYTGNR
                     FPRVRGEAYDKLVDAFITGVKKQFPNAILHFEDFGVKNARRLLEKYRNKVPCFNDDIQ
                     GTGAVVTASLIAALKHTNRDLKKSKILIYGAGSAGIGIADQIASHMVTHGLSLQEARS
                     NIYLINRKGLILESNVATSSPAQHVYAKPDQDWEGVDTASLQNLIKHIQPTCLVGCST
                     KAGAFTKECIQEMHKHNSRPIVFPLSNPTRLHEAVPEDVMKWTNNEALVATGSPFKPV
                     NGYRISENNNCFSFPGIGLGSMLAKASIISDKMISAAVDELASLSPLEENNSKPGLLP
                     PLEVITETSARVATAVLLQALEEGTARVEENDTKIPRDFDECLEWVKESMWQPIYRPM
                     TKVNYDPSIHTQQT"
     gene            <899260..>900054
                     /gene="TPHA0C04180"
                     /locus_tag="TPHA_0C04180"
                     /db_xref="GeneID:11533791"
     mRNA            <899260..>900054
                     /gene="TPHA0C04180"
                     /locus_tag="TPHA_0C04180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684954.1"
                     /db_xref="GeneID:11533791"
     CDS             899260..900054
                     /gene="TPHA0C04180"
                     /locus_tag="TPHA_0C04180"
                     /inference="similar to DNA sequence:INSDC:YMR069W"
                     /note="similar to Saccharomyces cerevisiae NAT4 (YMR069W);
                     ancestral locus Anc_2.532"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685002.1"
                     /db_xref="GeneID:11533791"
                     /db_xref="GOA:G8BQQ6"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G8BQQ6"
                     /translation="MDDIVKFVKIVDSHYPDEIYVNKNLTKLVKKIIVVDSETEDIKN
                     SAELYNGRYLTYSQNKEECEIEFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQ
                     EMKTEGLIYVVYHLEDEKKTVSLYLSFTLTKESGFLPDIDVFSPVIYLYEIQLTPEVR
                     NNGLGTKLIAGYLKDCLVDVHENIHKDIIGIELTVFSDNTNAIRFYETIGMKLTPDSP
                     NDKTINYGHRIKTRSQNSSKKGSSSDKPTSLSVVKKPDYYLYYLPL"
     gene            <901757..>903010
                     /gene="TPHA0C04190"
                     /locus_tag="TPHA_0C04190"
                     /db_xref="GeneID:11533786"
     mRNA            <901757..>903010
                     /gene="TPHA0C04190"
                     /locus_tag="TPHA_0C04190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684955.1"
                     /db_xref="GeneID:11533786"
     CDS             901757..903010
                     /gene="TPHA0C04190"
                     /locus_tag="TPHA_0C04190"
                     /inference="similar to DNA sequence:INSDC:YMR070W"
                     /note="similar to Saccharomyces cerevisiae MOT3 (YMR070W);
                     ancestral locus Anc_2.533"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685003.1"
                     /db_xref="GeneID:11533786"
                     /db_xref="GOA:G8BQQ7"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BQQ7"
                     /translation="MSRSNRLLYDESEVPPINRLQRNYYYQNHDYVSNNILHQRSNRI
                     EQNHLVSNSHLFANANNNTLKAFSNRSTKQSTVVHNNSIHPYNNINHFNNNAAGLHNY
                     SNKLSVAKLIDSAHEDNLHLQRNALHPPYTQSQASSSLLSLPQPNFHNYQQQQQDFQN
                     TNMKYQPWNSPVYNTNTNYLSKLNHGNNHFPSIQHPNHIANTLPVPYPKTSATYYHPN
                     KILPDPNESQPVQQHPMPQYKKATILFTSNGTENKSNQRHSNTENDSNHSIHEQQNSL
                     QDNDQAYASKSPKQDFEYLFCSTNLSTFIQDSQKKLFRYKRAKKIKFYECKVCHKTFK
                     RNSWLKRHFFSHSKLKNFSCNWCSGKYKRKDNLVQHIRKKHRDKTNKEPNELENKSDE
                     PVVNVTSTPGLIDTDSQLLNDVSEK"
     gene            <903722..>904309
                     /gene="TPHA0C04200"
                     /locus_tag="TPHA_0C04200"
                     /db_xref="GeneID:11535240"
     mRNA            <903722..>904309
                     /gene="TPHA0C04200"
                     /locus_tag="TPHA_0C04200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684956.1"
                     /db_xref="GeneID:11535240"
     CDS             903722..904309
                     /gene="TPHA0C04200"
                     /locus_tag="TPHA_0C04200"
                     /inference="similar to DNA sequence:INSDC:YKL032C,YMR072W"
                     /note="similar to Saccharomyces cerevisiae IXR1 (YKL032C)
                     and ABF2 (YMR072W); ancestral locus Anc_2.535"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685004.1"
                     /db_xref="GeneID:11535240"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:G8BQQ8"
                     /translation="MNSSILSRQLSQTSRRTLVSTNAKLFSTIPSVQLQASAFQLAKK
                     SKGKKVNDAPPRPGSAYMMWVKHIRPEFANEHPNEKPTGIVKLMAQHWKTLSDSEKEP
                     FYQAYNKALATYQEKKRAYEATLPPKRPAGPFISFCKDNRTKVLNENPHLSTIEATQK
                     IAELWKSASETEKAQYLESYKTALHEWQSKYGKTA"
     gene            complement(<904651..>905070)
                     /gene="TPHA0C04210"
                     /locus_tag="TPHA_0C04210"
                     /db_xref="GeneID:11533760"
     mRNA            complement(<904651..>905070)
                     /gene="TPHA0C04210"
                     /locus_tag="TPHA_0C04210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684957.1"
                     /db_xref="GeneID:11533760"
     CDS             complement(904651..905070)
                     /gene="TPHA0C04210"
                     /locus_tag="TPHA_0C04210"
                     /inference="similar to DNA sequence:INSDC:YMR074C"
                     /note="similar to Saccharomyces cerevisiae YMR074C;
                     ancestral locus Anc_2.537"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685005.1"
                     /db_xref="GeneID:11533760"
                     /db_xref="GOA:G8BQQ9"
                     /db_xref="InterPro:IPR002836"
                     /db_xref="UniProtKB/TrEMBL:G8BQQ9"
                     /translation="MDPELQALREARLAELKRGNNASGQSPNGGAENGKNAAVGSDIA
                     SFLEPQALERLSRVSLVRPERAQAVEMYIKQLLGSGQLSHKISEDEIVQILNGIAREQ
                     KKKNDVKIIFNRREQNYDNSLRNNSNDDDDEDDDFFD"
     gene            <906713..>908722
                     /gene="TPHA0C04220"
                     /locus_tag="TPHA_0C04220"
                     /db_xref="GeneID:11535232"
     mRNA            <906713..>908722
                     /gene="TPHA0C04220"
                     /locus_tag="TPHA_0C04220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684958.1"
                     /db_xref="GeneID:11535232"
     CDS             906713..908722
                     /gene="TPHA0C04220"
                     /locus_tag="TPHA_0C04220"
                     /inference="similar to DNA sequence:INSDC:YMR075W"
                     /note="similar to Saccharomyces cerevisiae RCO1 (YMR075W);
                     ancestral locus Anc_2.538"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685006.1"
                     /db_xref="GeneID:11535232"
                     /db_xref="GOA:G8BQR0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:G8BQR0"
                     /translation="MSNLSNMQPQQLQTSSSVDLSSKESTSTQNSDSDRNTSDNNGSR
                     RGRPKRTSSKNIDYDLKKRKIIPSDTNYFSARENKHNDSDTSKEDSEKKKIPDVKLIE
                     TDENGKIININDEEILSDIKNGATGLSLSQSPTEKIKKDSLWNYKKIVLPEEYKDFDV
                     KNNKYLSMLETKKSDNLTSSSIIRPYHKPKDIHNLERSKSLYKYYEGNNFADFNQHAT
                     HQKNAHVIKKVKDTVLKESKSKLFGQSSISAVEDTNNDNGADAIDNDDFCSTCQQSGS
                     FLCCDTCPRSFHFLCLNPPLDPDNLPEGDWSCPQCVFKAKNPTIAAYKKSEREFIAEL
                     PNKNKLFGKLLFNIQSQNSKQFQLPNTIKDTFENVKANARGQYQDEKEKTPLTERQIF
                     GTPYGQSITKLDGYTPELHIDPESGEFLICYHCQKTKMGTWENYETESRLIMRCDYCQ
                     TPWHLNCLPDVPRASLKNLGNKWKCPLHMPELQNKIKHIETYRRLSRNQTYVEPIQSS
                     GFRNNGDIEIELDEIIEPVKTTQFNENYNEASIPPVPIYREDAIKLDFLDKIQKAKSA
                     EKFNFFKTQEILIDKLISASKEPKNTFKNTELQSNIDDISSLIYFKLGNSRFKKLWNF
                     KELCNVASGELNQVKYSNEELQQLTFIKQILESKPKEEVLKFLNL"
     gene            complement(<908823..>912662)
                     /gene="TPHA0C04230"
                     /locus_tag="TPHA_0C04230"
                     /db_xref="GeneID:11535231"
     mRNA            complement(<908823..>912662)
                     /gene="TPHA0C04230"
                     /locus_tag="TPHA_0C04230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684959.1"
                     /db_xref="GeneID:11535231"
     CDS             complement(908823..912662)
                     /gene="TPHA0C04230"
                     /locus_tag="TPHA_0C04230"
                     /inference="similar to DNA sequence:INSDC:YMR076C"
                     /note="similar to Saccharomyces cerevisiae PDS5 (YMR076C);
                     ancestral locus Anc_2.539"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685007.1"
                     /db_xref="GeneID:11535231"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BQR1"
                     /translation="MSKKVKLKFKKSILSTSDNIISTDELVNRLSILHEELSSLVQDE
                     TDPESVNSYCNDLVNRKLIKHRDAGVRAFVACCLSDILRIYAPDAPYTDTQLTDVFKL
                     FLAQFEELGESENGYYIQQTYVITRLLEYRSIVLLTDLPSAMKLLERLFSIFYDNSKS
                     YNPKLFKVIGGILGEVISEYEAVPTSVLKIIFNKFLTYNPSSIPKGLGTSANCGYEVT
                     LILCESYGSRMTRYFTKYYSEVLYELTNDDENLYVDKNEISKVLDKLHNLLIKVWETV
                     PDMIAPVTGFVYHELCSENDLFRQKSTDLVGKLLSIKSEINLVTTYQDVFNAWLSKIA
                     DISVSVRMQWVNTIPDILSVRKDISEAINKGISKTLIDSENMIRKESILLFDKLSIEV
                     IWENITNPSIYMSLLRFSREKNREVREVCNSILAKLFEKSRKSIKRTQNNKEIWEIID
                     KIPSTIFDLYYINDPKINEQADDILFKYIFPLDVNDKQRVSRLLDIVSTLSGKSLTSF
                     FAFNKRQLQISLALSKFVDFSKKVNDKEDDSSSIADAVVKLPKTINWLSSGLSDSKIA
                     EAALNAVMELNDKRIFYLLQTCVNPDVKFSTWNNSFSELMTKLKDPNLLRHRDISSAS
                     LIIPRDIAKQFRILLYRGSPILFNSSNIPYLLSTGDTHNAALKRRLLDEISTLNPQQL
                     KGQIKTLMSVVKSENQTSDGDMTLSLGETLKTLYKIGKTMVNDIAFDDTFFYTKLKDY
                     ASGKSPLIAKYATKLIALSPDAVGTLNELKISILPLNKKSENFTSNINVLSEIFKFYP
                     HILDENSTDIVGYLIKEVLLSNEGILTISDSDSWIDDDAVFSEENNILNAKLSSLKLF
                     TNKLRSITIESDHKELTTAFINKTMKLFFYLIASGGELISETKDDAHATPDNYQTRMR
                     LCAGLQVLKCAKLPILNDFIKPADIIRLVNLVEDESLFVRKIFLDTLKKDLANEVISI
                     KFLPLIFFIAYEPDLSVKTSTKTWINFTFGKETFRKGTYFERALPRLIHAIAHHPDIV
                     ENFNKEGDEYLNNLATAIDYLMFYFDSVANQDNFNLLYYLSERVKNYQDKIKDDRDDD
                     DRTDAEASISMRSKRMYVIGELSQMILLQLKEKRGWQHSAYPGKLNLPGDLFQPFNTT
                     KEAQASFKTYINEKQASRLLSNVKAKVSRIIHSSQTQKQRAQKKLLAMENQPPIKNKT
                     KLKVKKRRYNDESDDSGSDSDINGDDDGVYKPSSKLKKVQTINARRKNLRERKEIDYN
                     VDDDIIDENSASITNII"
     gene            complement(<913162..>914808)
                     /gene="TPHA0C04240"
                     /locus_tag="TPHA_0C04240"
                     /db_xref="GeneID:11533673"
     mRNA            complement(<913162..>914808)
                     /gene="TPHA0C04240"
                     /locus_tag="TPHA_0C04240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684960.1"
                     /db_xref="GeneID:11533673"
     CDS             complement(913162..914808)
                     /gene="TPHA0C04240"
                     /locus_tag="TPHA_0C04240"
                     /inference="similar to DNA sequence:INSDC:YHL008C"
                     /note="similar to Saccharomyces cerevisiae YHL008C;
                     ancestral locus Anc_2.540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685008.1"
                     /db_xref="GeneID:11533673"
                     /db_xref="GOA:G8BQR2"
                     /db_xref="InterPro:IPR000292"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="InterPro:IPR024002"
                     /db_xref="UniProtKB/TrEMBL:G8BQR2"
                     /translation="MDLQYSSPNDAALAVVATAMKKSRLKLHILLLNSIVGGALFSSG
                     GFLYVGFNSENPKLVAENPGIGNFVGAVFYGIGLFYVIITGADLFNSNILFFTVGLLR
                     GAVTIYDLLISWFVSWLGNIAGTLFAAYVFLFLSGSGATAQWSEGSRQVLESKASFSF
                     IQVFLKGIAGNFYVCLAVYLQMMAKPIHVRYIMASLPIFTFVSLGYTHVVADMAVAYI
                     GLLNGADVSVGKYIWKLLVPGSIGNIIGGSAFGIIIPYFMHIVVVEMDKKELAIPEYE
                     ARDEHPELNTDSRVVRLKVPEADMDTETDTDAEAHVDDDVDEKNDTGSTMDQTSPYRG
                     SWAPPPDNSSIQDDSLYDSADTPKDFRRQPSLSRTGTHASRITIASAKSRAASHIIAS
                     PPGVFPILGMGKAPLKERQIQSGNYKASGDSESLQKVSTQKTERHYNRTSSSQRSMDS
                     NESKIYSTTQEIEDFETDKRLNYDVTRDKPGAALKRAVTNTIYKLTRTRTVESKLPQT
                     TQDMVVTDNQNMQTMNPSSSQASINQSIESYLSYVNSSID"
     gene            <915632..>917302
                     /gene="TPHA0C04250"
                     /locus_tag="TPHA_0C04250"
                     /db_xref="GeneID:11535269"
     mRNA            <915632..>917302
                     /gene="TPHA0C04250"
                     /locus_tag="TPHA_0C04250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684961.1"
                     /db_xref="GeneID:11535269"
     CDS             915632..917302
                     /gene="TPHA0C04250"
                     /locus_tag="TPHA_0C04250"
                     /inference="similar to DNA sequence:INSDC:YHL010C"
                     /note="similar to Saccharomyces cerevisiae YHL010C;
                     ancestral locus Anc_2.542"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685009.1"
                     /db_xref="GeneID:11535269"
                     /db_xref="GOA:G8BQR3"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR011422"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G8BQR3"
                     /translation="MAYYSVIVDYTEDQSDLNVPVDFEFDWRFSQIYYKEAIVGEMSE
                     QDKDSRPEDDLISSEYLGYGVIRLFKQKDNYEPGLELSRKIDDKDVIVIPGDDSMVCM
                     LFVPSYFTLHELLHFYIGDDIINTKVSNIRMLKHYKKNANILGCNFMVLLKFKDPIYA
                     KEFLNEFNGKKFSKMDPETCHIVAIKELVFKKTLFDKNMMKDTQLKDGIDDSSTLPYL
                     LKDPFTSNLAIEENRDEIELPTCPVCLEKMDSLVTGLITIPCSHTFHCQCLDKWKNSK
                     CPVCRHTNLNISRKLLIEQATSDWKCSVCDSVENLWMCLICGNVGCGRYNSKHAILHF
                     EMTSHCFAMDMRTQRVWDYAGDNYVHRLVQNEVDGKLVEVGNIGSTLNTPSDRNKNEN
                     LVTNLMRNKEYHLEYVQVLISQLESQREYYELKLKDVSNKNNEEQQLQDLKDQLKSLK
                     LQLSQNEQATKKELEANNMMLSGFQANLDKSEKFIDNLKQEKMKLEEENKNLQEQLQD
                     LMFYLDTQNKFKDATEEEREGAVIIKQTGSTSTASKKKKNKKKKNRVL"
     gene            complement(<917526..>919799)
                     /gene="TPHA0C04260"
                     /locus_tag="TPHA_0C04260"
                     /db_xref="GeneID:11533959"
     mRNA            complement(<917526..>919799)
                     /gene="TPHA0C04260"
                     /locus_tag="TPHA_0C04260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684962.1"
                     /db_xref="GeneID:11533959"
     CDS             complement(917526..919799)
                     /gene="TPHA0C04260"
                     /locus_tag="TPHA_0C04260"
                     /inference="similar to DNA sequence:INSDC:YKL034W"
                     /note="similar to Saccharomyces cerevisiae TUL1 (YKL034W);
                     ancestral locus Anc_2.545"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685010.1"
                     /db_xref="GeneID:11533959"
                     /db_xref="GOA:G8BQR4"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G8BQR4"
                     /translation="MEIDVNTLVFITIILYIFYSTPSNEGITSEYEYNQLSLLKNQFS
                     IEYNNFMNLTYDSNFKNITGFKLSYADAANDPNTTATYPLDGKDYNSWYANENYMLLP
                     DSIINIINDQVWSRSNSDLSNVFPANISTTMYGSIINDANSTEHLTKIKMPIPKFYNN
                     AEHLGDINPPIGDDYVEDDEDAYFHKENVTFTKGEVTISLTHVDKLSSKPKGRDEKYF
                     NTQSDKWKFLETVIVFNDANENEQRTIRGKAIYDIQRGRIVSLTQSAKFHSIFAFPHY
                     SSMAKTEKENIFKDVKQLVSEYWETLDFVETLKATDFEEWGTSGESLCEYMVFLQLEP
                     WNQYTKEQLKIIDHELKWPTGLPANISSIPPIRIESGLIYSPDCGLKFHLDNVEGVRE
                     EIKISSARTLLLFLFFLEAVQLYLLLKQMQFTNTPSSINRVSFYTLALLQLIDATLTT
                     VILILAIAVRPIFIASMLCLLLSFSLAYVFGIRYLVTVTSSQVNEQNVGIMTLLRRVI
                     REENEERTVITEDLSTISSGLLGKIYFSLLAFMMFLIIASSWPKNIRKIVEYVILFIT
                     NSYWVPQIFRNTIKGISPLSARSNQNISMQRQNGIPLLWKYIVGTSVIRLLPIYYFFA
                     NPSNILRHHTDLKFVTILTLWLSIQILLLYSQDYFGSRWFLPKHAIPDGYSYHKPVLS
                     QELLEHGASENHTVDCAICMSEVPVYVKDIPETHAVDQQSYMVTPCNHIFHTACLENW
                     MGYKLQCPVCRAPLPPL"
     gene            complement(<920351..>921853)
                     /gene="TPHA0C04270"
                     /locus_tag="TPHA_0C04270"
                     /db_xref="GeneID:11535219"
     mRNA            complement(<920351..>921853)
                     /gene="TPHA0C04270"
                     /locus_tag="TPHA_0C04270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684963.1"
                     /db_xref="GeneID:11535219"
     CDS             complement(920351..921853)
                     /gene="TPHA0C04270"
                     /locus_tag="TPHA_0C04270"
                     /inference="similar to DNA sequence:INSDC:YHL012W,YKL035W"
                     /note="similar to Saccharomyces cerevisiae YHL012W and
                     UGP1 (YKL035W); ancestral locus Anc_2.546"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685011.1"
                     /db_xref="GeneID:11535219"
                     /db_xref="GOA:G8BQR5"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR016267"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BQR5"
                     /translation="MSTGKRHTKTQSSYAFESSTSNVAASQMRNALNKLDDTMPNDNA
                     ASARFQNELDSFFTLFRRYLIEKNSKNKLDWEKIKSPNPEEVVEYKIIEQQPENVSNL
                     SKLAVMKLNGGLGTSMGCVGPKSVIEVRDGNTFLDLSVRQIEYLNRQYDSDVPLLLMN
                     SFNTDKDTEHLIKKYSSNRIRIKSFNQSRFPRVFKDSLLPVPNDVNDSLDSWYPPGHG
                     DLFESLYASGELDALIDQGKEILFVSNGDNLGATVDLKILNHMIETNAEYIMELTDKT
                     RADVKGGTLISYDDQVRLLEVAQVPKEHIDDFKNIRKFKNFNTNNLWINIKAIKRLVE
                     QNALELEIIPNEKTISRNGHDVNVIQLETACGAAIRYFNGAHGVVVPRSRFLPVKTCS
                     DLLMVKSDLFYLEHGALKIDPSRFGPNPLIKLGSHFKKVNDFNQRISHIPRLLELDHL
                     TITGNVYLGKNVSLKGTVIIVCSDGQKIDIPNGSILENVVITGNLQILEH"
     gene            complement(<922743..>926132)
                     /gene="TPHA0C04280"
                     /locus_tag="TPHA_0C04280"
                     /db_xref="GeneID:11533790"
     mRNA            complement(<922743..>926132)
                     /gene="TPHA0C04280"
                     /locus_tag="TPHA_0C04280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684964.1"
                     /db_xref="GeneID:11533790"
     CDS             complement(922743..926132)
                     /gene="TPHA0C04280"
                     /locus_tag="TPHA_0C04280"
                     /inference="similar to DNA sequence:INSDC:YKL038W"
                     /note="similar to Saccharomyces cerevisiae RGT1 (YKL038W);
                     ancestral locus Anc_2.547"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685012.1"
                     /db_xref="GeneID:11533790"
                     /db_xref="GOA:G8BQR6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8BQR6"
                     /translation="MNSSMKRKEPDTRIQEPTHHDTQSHGSVSNNSDDLVSVTNSLNM
                     SPQKKKLRKASRACDQCRKRKIKCDYDNVSTVCNNCNKNNDKCTFERVQLKRGPSKGY
                     TKQHTVSPDVQQQPPPAQQPQIASGKSYAQSQVLLPPISQYFPTPNPTADANRNDQPF
                     WKVPFHELNNTSTLSGQTNARNSVDLSFQNNLQQTNTNDMLSSDNESVTPQNNNTINT
                     VPIIRSRSSSIPPFGKYKASTPTNSNGLTNSPNYLHQSLYSAYSQFSHLQNNQSANIA
                     FANNGLPIISQNILTSNNANLPLINPNYTNYRSKSRSGSFSIVSDAMSNPYNTKEKKR
                     SNSIKSTPSVSTARYSINNIITIDNNIHSIDAINDSTSLDHSNQKLEKKLILSSAASS
                     PKANHPNDKITQQSSLHQNQLNNNIVNNSQIGIMKTFNISDPDLNVSDFNTIMNFGKI
                     SDIDLINTYYEFIHINFPLIPINKRTLTNDILLINNSHPMNSKIINWFRNSLELLVRI
                     SLKKTNNQLNPTNIDKKDIGSNISKLDSNTSDDYNDENYEVYVNTINKIFQEMMILYP
                     TVRGNQERIDSSIKIVFLLTFIILNYIQILIGKKNTFLLSTTVTIFNDSNIPSYFLFR
                     DHLDDFSEHKIMYKRLYLLLIIFDSIQCVSYGTPTLITMPVDESLFIQLFDIKAFVKI
                     KKIAILSEEVLENWVVEENTIRLNCIMKGFRLSMILVQLSHHKLHQVNQESVVKYIED
                     IKQRSDFGLMQEKPDELMCLPEAFGKLLLIKQDLIVFLFSIIDLEKNKINFLNLDDFK
                     ELTNILCSMISTILMNLTLIMRLNPTNSIDYNFKPPTHIQTNNTDSIMINESSNNPSS
                     GSSTSNDDTSNDNVISKEKFKDSTTSTDFYRKLLGLNNDSDNILTDIKDLPRGCITPY
                     FIIIKSEMCNLRELIKELPTALIGIIIEATIHSQMKPEDDPELEMRNKSDSDSNSNAE
                     FKDDDNQTNVKARNIVVKLSNSMNEVVQITSLLSLINSNTGNTPYEDKKGNNANTVNG
                     NNNINSKNTNKYSQNVMNDNRKSNSKFNRDDTLEKSYCDLINKSDNGNLSQDYRSIEQ
                     DRIKIDNGKTIAKGSKTTTAVLQKVVHIAWKLLEDSELGWL"
     gene            <927088..>928005
                     /gene="TPHA0C04290"
                     /locus_tag="TPHA_0C04290"
                     /db_xref="GeneID:11533984"
     mRNA            <927088..>928005
                     /gene="TPHA0C04290"
                     /locus_tag="TPHA_0C04290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684965.1"
                     /db_xref="GeneID:11533984"
     CDS             927088..928005
                     /gene="TPHA0C04290"
                     /locus_tag="TPHA_0C04290"
                     /inference="similar to DNA sequence:INSDC:YHL013C"
                     /note="similar to Saccharomyces cerevisiae OTU2 (YHL013C);
                     ancestral locus Anc_2.548"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685013.1"
                     /db_xref="GeneID:11533984"
                     /db_xref="InterPro:IPR003323"
                     /db_xref="UniProtKB/TrEMBL:G8BQR7"
                     /translation="MAEDREALLRRHTKESKDLENRISSMKFGMKKTTRRQLNDRCNS
                     LRSELAERHTAELRHLDGEADADVDVVTPEMLLAQLDLAGDGAGSDKPQTGDVSPGLG
                     TGRKRRNRQKEKLARRQEEIERIKAEARAEAVEVPDYQAQEKRLIDGFLQQNGFVESE
                     VKPDGHCLFASVLDQLRVLDLVVPEVSASVQQLRSVACRYIQANKDNFIPFMFDERTG
                     ELNDIDEYVREMESTAKWGGELELLALSKSLNVTINVLVSDLSSNSTRFQKYNDAQDP
                     ATDTRDIYIVYYKYNYTLGEHYNSLHSTV"
     gene            <928160..>929422
                     /gene="TPHA0C04300"
                     /locus_tag="TPHA_0C04300"
                     /db_xref="GeneID:11533831"
     mRNA            <928160..>929422
                     /gene="TPHA0C04300"
                     /locus_tag="TPHA_0C04300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684966.1"
                     /db_xref="GeneID:11533831"
     CDS             928160..929422
                     /gene="TPHA0C04300"
                     /locus_tag="TPHA_0C04300"
                     /inference="similar to DNA sequence:INSDC:YHL014C"
                     /note="similar to Saccharomyces cerevisiae YLF2 (YHL014C);
                     ancestral locus Anc_2.549"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685014.1"
                     /db_xref="GeneID:11533831"
                     /db_xref="GOA:G8BQR8"
                     /db_xref="InterPro:IPR004396"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR013029"
                     /db_xref="InterPro:IPR023192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BQR8"
                     /translation="MSLLGRQTSNLRCGIVGLANVGKSTLFQAITNSHLGNPANYPFA
                     TINPLDYRIILPNSKLEYLQKKYSSEKIINSTLTLFDIAGLTRGASDGQGLGNKFLND
                     IRNVDAILHVVRGFEDEEIIHLEESVNSVRDLVLVNDELILKDLEFLENGIERLSKKL
                     KNKSGKHSNSKENWQLIEMEKELLELLQENLYEGKKITQIQKDWTSGENSILNRYNFL
                     TAKPSIILLNVNPHEYILSQLDPTKIKNLQLVQNWLNENSPKDIVLPFSGHFESQYNI
                     FKNNNDSNGFRKYISDLIKEYDLEKVSGTKIEVDKINHAIPTMIKKTKNILRLISYYT
                     CGPKEIREWLIREGTPANEAAGAIHSDLCDTFQNAEIIALRDLEQAPHELINEPYLKT
                     KGLIKRVGKNYIIQNDDIALFRATASKK"
     gene            931297..931368
                     /gene="TPHA0Ctrna7R"
                     /locus_tag="TPHA_0Ctrna7R"
                     /db_xref="GeneID:11533492"
     tRNA            931297..931368
                     /gene="TPHA0Ctrna7R"
                     /locus_tag="TPHA_0Ctrna7R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGA"
                     /db_xref="GeneID:11533492"
     gene            931388..931459
                     /gene="TPHA0Ctrna1D"
                     /locus_tag="TPHA_0Ctrna1D"
                     /db_xref="GeneID:11535323"
     tRNA            931388..931459
                     /gene="TPHA0Ctrna1D"
                     /locus_tag="TPHA_0Ctrna1D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:11535323"
     gene            <931642..>932248
                     /gene="TPHA0C04310"
                     /locus_tag="TPHA_0C04310"
                     /db_xref="GeneID:11533639"
     mRNA            join(<931642..931905,931907..>932248)
                     /gene="TPHA0C04310"
                     /locus_tag="TPHA_0C04310"
                     /product="hypothetical protein"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_003684967.1"
                     /db_xref="GeneID:11533639"
     CDS             join(931642..931905,931907..932248)
                     /gene="TPHA0C04310"
                     /locus_tag="TPHA_0C04310"
                     /inference="similar to DNA sequence:INSDC:YIL009C-A"
                     /artificial_location="low-quality sequence region"
                     /note="similar to Saccharomyces cerevisiae EST3
                     (YIL009C-A); ancestral locus Anc_7.128"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685015.1"
                     /db_xref="GeneID:11533639"
                     /db_xref="UniProtKB/TrEMBL:G8BQR9"
                     /translation="MPKIILPSKVNLSPDSIFLKPWIKEFIEDGKKNSIGKIGNLDEL
                     LNNTNVKLQLILKYPNQLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERN
                     YKIRITDQTKNCLFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYI
                     LSERRFNRLYPILQVNQVMIFDWDQVVTFENYPFVYSQIPY"
     gene            <932871..>934235
                     /gene="TPHA0C04320"
                     /locus_tag="TPHA_0C04320"
                     /db_xref="GeneID:11533654"
     mRNA            <932871..>934235
                     /gene="TPHA0C04320"
                     /locus_tag="TPHA_0C04320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684968.1"
                     /db_xref="GeneID:11533654"
     CDS             932871..934235
                     /gene="TPHA0C04320"
                     /locus_tag="TPHA_0C04320"
                     /inference="similar to DNA sequence:INSDC:YPL259C"
                     /note="similar to Saccharomyces cerevisiae APM1 (YPL259C);
                     ancestral locus Anc_7.127"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685016.1"
                     /db_xref="GeneID:11533654"
                     /db_xref="GOA:G8BQS0"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR018240"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:G8BQS0"
                     /translation="MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETG
                     VIPPCIMHKGIHYLFIKHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEE
                     SVRDNFVIIYELLDEMMDFGIPQITETKMLKKYITQKSFKLIKTSTSKKKKNAARPPA
                     ELTNSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPD
                     LKLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFEN
                     EKIITFIPPDGEFDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIA
                     NNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSV
                     DGVEPPKVRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTI
                     RLNK"
     gene            complement(<934432..>935061)
                     /gene="TPHA0C04330"
                     /locus_tag="TPHA_0C04330"
                     /db_xref="GeneID:11533945"
     mRNA            complement(<934432..>935061)
                     /gene="TPHA0C04330"
                     /locus_tag="TPHA_0C04330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684969.1"
                     /db_xref="GeneID:11533945"
     CDS             complement(934432..935061)
                     /gene="TPHA0C04330"
                     /locus_tag="TPHA_0C04330"
                     /inference="similar to DNA sequence:INSDC:YIL010W"
                     /note="similar to Saccharomyces cerevisiae DOT5 (YIL010W);
                     ancestral locus Anc_7.126"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685017.1"
                     /db_xref="GeneID:11533945"
                     /db_xref="GOA:G8BQS1"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:G8BQS1"
                     /translation="MTEVRRSSRIANKKIIHQADVKAEHSSKVSKKAKTTVKKTLSVS
                     KIETDLKETQKDDYEEIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRAST
                     PGCTRQACGFRDNFDDLKKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITI
                     LGCKKKPSGIIRSYFIFVDGKLKLKRVKVSPEVSITESKKEILDLVKEL"
     gene            <936055..>937671
                     /gene="TPHA0C04340"
                     /locus_tag="TPHA_0C04340"
                     /db_xref="GeneID:11535213"
     mRNA            <936055..>937671
                     /gene="TPHA0C04340"
                     /locus_tag="TPHA_0C04340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684970.1"
                     /db_xref="GeneID:11535213"
     CDS             936055..937671
                     /gene="TPHA0C04340"
                     /locus_tag="TPHA_0C04340"
                     /inference="similar to DNA sequence:INSDC:YER014W"
                     /note="similar to Saccharomyces cerevisiae HEM14
                     (YER014W); ancestral locus Anc_7.164"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685018.1"
                     /db_xref="GeneID:11535213"
                     /db_xref="GOA:G8BQS2"
                     /db_xref="InterPro:IPR004572"
                     /db_xref="InterPro:IPR027418"
                     /db_xref="UniProtKB/TrEMBL:G8BQS2"
                     /translation="MALANFTKLKSNSSIAVVGSGVSGLTFTYFLNKLRPDLKITILD
                     EQKKNGGWLYSYKFQDSNDNNKDVMLEKGPRTLRGKSLGTAIIIDIIKKLEQFEKVQT
                     ISPLSDANKKFLLDVNNNLVKVPNKILSFDSINLLFFNSLGKNIFTSIIGEPFRSKKI
                     LSKNDDETVSSFLNRRFGKSNSVSNNLMSAIYHGIYADDLNRMSLKKQIQHCSMLERT
                     YGSIIKSLFSSDSSSNAVQEQTELTRYDQHFNNKNSEIFKLNKQLEKFPMLGITGGLQ
                     SFPNMISNYLVNKCLPNVKIIREARVDNIEDSKDKVILNFDDEKNKPMEFDHVRVTSN
                     PMKLKSFFKGSKEIEEKLRNYNSVTTLLVNYYLPNKDVIKSRYHSFGYLVPQANENKN
                     SLLGVIFDSVIEKNFQSLEKGKNIVPNEYTKLTLMMGGHYLEKKNYTETQINDSQYWI
                     SNAKDCLSKHLGIDKQDLDNGHFEFTVAKNGIPQYFVGYMEWANDFEKLISDTYNNKV
                     SLGGMGFSRGPGVPDVVVDSLDNAIKLSGK"
     gene            <943187..>943957
                     /gene="TPHA0C04350"
                     /locus_tag="TPHA_0C04350"
                     /db_xref="GeneID:11535264"
     mRNA            <943187..>943957
                     /gene="TPHA0C04350"
                     /locus_tag="TPHA_0C04350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684971.1"
                     /db_xref="GeneID:11535264"
     CDS             943187..943957
                     /gene="TPHA0C04350"
                     /locus_tag="TPHA_0C04350"
                     /note="ancestral locus Anc_7.169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685019.1"
                     /db_xref="GeneID:11535264"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:G8BQS3"
                     /translation="MPVSPNQYMMANTSYTRSAPVTQGVRLPSIRNILSALPDNLPLQ
                     QKQQPQYTPAYTNAGAMTPVSHPNSRQNSFSSFNAYTNTDMNATASMDKQYDLNANLL
                     GRNSIPLLSSNYQIINQHSHMQLYQQLPQAHIQVQQQPKSIQAPMSPKEVSYPSPASE
                     FSTFKVKSNSTSNNNIHSKTKKKICTCKHHTDNGTRIPRPRNAFILFRQNLHHSLFGK
                     DKEQLLEQGSFKTNFQVSKEIGQRWRELSADEKNIGMI"
     gene            <944675..>945619
                     /gene="TPHA0C04360"
                     /locus_tag="TPHA_0C04360"
                     /db_xref="GeneID:11533611"
     mRNA            <944675..>945619
                     /gene="TPHA0C04360"
                     /locus_tag="TPHA_0C04360"
                     /product="mitochondrial 37S ribosomal protein MRPS5"
                     /transcript_id="XM_003684972.1"
                     /db_xref="GeneID:11533611"
     CDS             944675..945619
                     /gene="TPHA0C04360"
                     /locus_tag="TPHA_0C04360"
                     /inference="similar to DNA sequence:INSDC:YBR251W"
                     /note="similar to Saccharomyces cerevisiae MRPS5
                     (YBR251W); ancestral locus Anc_7.170"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS5"
                     /protein_id="XP_003685020.1"
                     /db_xref="GeneID:11533611"
                     /db_xref="GOA:G8BQS4"
                     /db_xref="InterPro:IPR000851"
                     /db_xref="InterPro:IPR005324"
                     /db_xref="InterPro:IPR013810"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:G8BQS4"
                     /translation="MFKRQFSTSLGNLKHYGDSILKKYYSPELLNSIKLAQSVIPTKP
                     DFKVSSNVKFHPPYLEDFSKIDSYWDYKPGLPHAHVSDVNEINTFEWDKVHQQLPGDG
                     LIIPPGVSRNIASGSDSAKLSGRTSKTMDVALGLHKQSGLNIEYITKKLDMKPLVTKR
                     VSNQTAKGKIASFYALVVVGDRNGMVGLGEGKSRETMSKAIFKAHWDGVRNLKEIPRY
                     ENRTIYGDIDYRYHGVKLFLRSGRPGFGLRVNHIIYEICECAGIKDLSGKVYKSRNDM
                     NVAKGTVEALLNSQKTLDEIALGRGKKIADVRSIYYSS"
     gene            complement(<945992..>947863)
                     /gene="TPHA0C04370"
                     /locus_tag="TPHA_0C04370"
                     /db_xref="GeneID:11533814"
     mRNA            complement(<945992..>947863)
                     /gene="TPHA0C04370"
                     /locus_tag="TPHA_0C04370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684973.1"
                     /db_xref="GeneID:11533814"
     CDS             complement(945992..947863)
                     /gene="TPHA0C04370"
                     /locus_tag="TPHA_0C04370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685021.1"
                     /db_xref="GeneID:11533814"
                     /db_xref="UniProtKB/TrEMBL:G8BQS5"
                     /translation="MTKLPQVKHQFQVPVLEYPVNNNHITGLKDIKLASLHYAASIAC
                     SVNAKYGFVPHERGEIPTKGMLRNLTNFAMLTNVAAYYAANAYLFIETLPSITPANSS
                     YLQRNQFYGLSKSELEEAKSMTYQAVYQQGIANFEAKASKTGQKFKIKKLSPEDQLKL
                     NFTMYLELLNGIKYGYIPHCYTFAYCVNSSQFHFNREFKTLVGTTINDYIKKCIIYIK
                     SDAEENLNYSRIIKVIKKRYSLHDVQSVLFSEEAHLNFENMKSYVFALGSETYHIMKP
                     FLVNSNLHDIKMNLRYSLMNKLTYLNEGLTNVLENSSSSTLSSSTSTNNSNDKNDEQR
                     FRATGNRVTKKRRKNMNNHLNGREIICCHCNNKILYCNDLNTAIKIDQQISSNENNFI
                     KNNYITNNFIKDDENVDNGIKKNLIEKEYLGNNNNNNNNNNIKAHWRKSFIKKISSYR
                     PPTMNIEQNVEINNNPFNEYFDSSFSFNGYDELFENMPIEQEKFNFEKILESVDFDIS
                     NTKNIIDSSNIYCASGETSMEETHDSIGIINTLTEIEGSSEEIEKSVNNSEDNKELYL
                     ITPRTMNSNENSDREVSPKDKFQEQNLKPINTDDNPIEFSNDNFMGWNVKYSNLEIE"
     gene            complement(949085..949155)
                     /gene="TPHA0Ctrna2G"
                     /locus_tag="TPHA_0Ctrna2G"
                     /db_xref="GeneID:11535226"
     tRNA            complement(949085..949155)
                     /gene="TPHA0Ctrna2G"
                     /locus_tag="TPHA_0Ctrna2G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11535226"
     gene            <950648..>951109
                     /gene="TPHA0C04380"
                     /locus_tag="TPHA_0C04380"
                     /db_xref="GeneID:11533515"
     mRNA            <950648..>951109
                     /gene="TPHA0C04380"
                     /locus_tag="TPHA_0C04380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684974.1"
                     /db_xref="GeneID:11533515"
     CDS             950648..951109
                     /gene="TPHA0C04380"
                     /locus_tag="TPHA_0C04380"
                     /inference="similar to DNA sequence:INSDC:YBR252W"
                     /note="similar to Saccharomyces cerevisiae DUT1 (YBR252W);
                     ancestral locus Anc_7.173"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685022.1"
                     /db_xref="GeneID:11533515"
                     /db_xref="GOA:G8BQS6"
                     /db_xref="InterPro:IPR008180"
                     /db_xref="InterPro:IPR008181"
                     /db_xref="InterPro:IPR029054"
                     /db_xref="UniProtKB/TrEMBL:G8BQS6"
                     /translation="MTQPNTKQQKMSHSLKIQLRSSDATVPTKGSSTAAGYDIYASQQ
                     CVIPSRGQGLVGTDISFTVPVGTYGRIAPRSGLAVKNGIQTGAGVVDRDYTGEVKVVL
                     FNHSEKDFEIKKGDRVAQLILEKIVDDAEIVVVESLEDSERGAGGFGSTGK"
     gene            complement(<951519..>952049)
                     /gene="TPHA0C04390"
                     /locus_tag="TPHA_0C04390"
                     /db_xref="GeneID:11535321"
     mRNA            complement(<951519..>952049)
                     /gene="TPHA0C04390"
                     /locus_tag="TPHA_0C04390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684975.1"
                     /db_xref="GeneID:11535321"
     CDS             complement(951519..952049)
                     /gene="TPHA0C04390"
                     /locus_tag="TPHA_0C04390"
                     /inference="similar to DNA sequence:INSDC:YBR254C"
                     /note="similar to Saccharomyces cerevisiae TRS20
                     (YBR254C); ancestral locus Anc_7.176"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685023.1"
                     /db_xref="GeneID:11535321"
                     /db_xref="GOA:G8BQS7"
                     /db_xref="InterPro:IPR006722"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:G8BQS7"
                     /translation="MSQYFAIIGKDDNPVYEAEFSGKLGPQGQIQGFPQDLKELNPFI
                     LHASLDIIEDLQWQPNLSLQGGAAGSGGSGGFLRSRNNTNASNCYLGKVDHFYGIIIT
                     AYLTYSGMKFVMLHGNSVSTTVQIDDNNVKSFYQDVHELYTKTILNPFYNVGDPISSA
                     SFDSRVRALARKYLGK"
     gene            <952567..>954447
                     /gene="TPHA0C04400"
                     /locus_tag="TPHA_0C04400"
                     /db_xref="GeneID:11534083"
     mRNA            <952567..>954447
                     /gene="TPHA0C04400"
                     /locus_tag="TPHA_0C04400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684976.1"
                     /db_xref="GeneID:11534083"
     CDS             952567..954447
                     /gene="TPHA0C04400"
                     /locus_tag="TPHA_0C04400"
                     /inference="similar to DNA sequence:INSDC:YBR255W"
                     /note="similar to Saccharomyces cerevisiae YBR255W;
                     ancestral locus Anc_7.177"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685024.1"
                     /db_xref="GeneID:11534083"
                     /db_xref="UniProtKB/TrEMBL:G8BQS8"
                     /translation="MSFTNQKDEVTIYNKMTTPETFASSNRPKSTVNIEGIKLLTKIL
                     VDNKQGLKDDLNYDINTVDNNNNIKSEKELLKKDIALNNGIISSQKNKILNEAARNTV
                     YISKGARANAERVRSYLDYFYAILERNMTIRNDGRHKHENIEGIYNPLQLIRNRKIRK
                     KYDESPPRVMFVSRSPIIAIKKFSSKPNRKFPWYVDISERASDLSWRTAHWNELIGPD
                     GEPWVKLPNSNHKYKHIKHFRTHSGHNHISTASFKKPSLVTHDSYGTSSKATEEDING
                     DKLQHNLNANLSPDMHDSVSDLSDEQKEESTQSERGRVKKLGKMIEKSKQWSKSPTFK
                     RKTMHLWKILLQIILERLTKGSSNISLNESVLESSQSTQNSINCNNTSPEQRSNNLQN
                     VPIKTIRNKNEKETLSKSSVNSQSNSLNVPMSSSRSSKIPKNTNMTVSDSYPHKELIL
                     DMQLQRYQKDIRYIKATIGIMQNRIQTHKKFKSCQLKKRIATLNVDDDSNAIGMANDI
                     LNIYNKKLDEVLKEGNDWNSKWINDYSIRVETLISSIDRIMTDVNTTLTLKLKLFQES
                     AEKHVSLRNLRARKFSKIGYKLLELFIVLFLWSIWFIVMIFRNIRFAFFLLLNVIKWL
                     LW"
     gene            complement(<954630..>955079)
                     /gene="TPHA0C04410"
                     /locus_tag="TPHA_0C04410"
                     /db_xref="GeneID:11533494"
     mRNA            complement(join(<954630..954932,955017..>955079))
                     /gene="TPHA0C04410"
                     /locus_tag="TPHA_0C04410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684977.1"
                     /db_xref="GeneID:11533494"
     CDS             complement(join(954630..954932,955017..955079))
                     /gene="TPHA0C04410"
                     /locus_tag="TPHA_0C04410"
                     /inference="similar to DNA sequence:INSDC:YBR255C-A"
                     /note="similar to Saccharomyces cerevisiae YBR255C-A;
                     ancestral locus Anc_7.178"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685025.1"
                     /db_xref="GeneID:11533494"
                     /db_xref="UniProtKB/TrEMBL:G8BQS9"
                     /translation="MGNEVQPVHYDPKNLKILSNDLVTQSLLGAGKGLLIAGSTALLL
                     NRFSPLFRNARIQVKTFYYVAWISYSSYFQADSHLLTFQSNVFKDEVKRRQKALDDAA
                     EKGIFLEEKDVIQSTIMKK"
     gap             955348..955563
                     /estimated_length=216
     gene            complement(<955828..>956925)
                     /gene="TPHA0C04420"
                     /locus_tag="TPHA_0C04420"
                     /db_xref="GeneID:11533462"
     mRNA            complement(<955828..>956925)
                     /gene="TPHA0C04420"
                     /locus_tag="TPHA_0C04420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684978.1"
                     /db_xref="GeneID:11533462"
     CDS             complement(955828..956925)
                     /gene="TPHA0C04420"
                     /locus_tag="TPHA_0C04420"
                     /inference="similar to DNA sequence:INSDC:YIR011C"
                     /note="similar to Saccharomyces cerevisiae STS1 (YIR011C);
                     ancestral locus Anc_7.179"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685026.1"
                     /db_xref="GeneID:11533462"
                     /db_xref="GOA:G8BQT0"
                     /db_xref="InterPro:IPR013868"
                     /db_xref="InterPro:IPR029449"
                     /db_xref="UniProtKB/TrEMBL:G8BQT0"
                     /translation="MSGSNMGFSFGFNSSSSVDNRSRLDKVGMVSRDVVFVSKDEGSM
                     GDAIGARVANKLQRQKRRFDAASSADGENNASKMTEVPTRKIIATTSVSNSRTNTNLN
                     NNSKRKDCLSSSISGQALPITRGIELMDKEQLQSLVVNLMNEHPQIQSHIHATLESTN
                     FQINKYLDSLKLKFDDIVNSIPYSRNNYYDNNANTLNDYAFVRMKPYILEFLNCLADY
                     VLDNIPPRVDNLHDSLKFLDCCTEMLLKLPRFDMASNNYYYDKCLEQLSYLWCNVIEL
                     VTKDLVILVNDEHLLVQYLDKLADYNDKSQGILQRPLQLFKALNLNFSNYVSRSHNTV
                     NPTQIGFNSSFSSSQISNSNDSGRRDTVVRE"
     gene            complement(<957425..>957916)
                     /gene="TPHA0C04430"
                     /locus_tag="TPHA_0C04430"
                     /db_xref="GeneID:11533468"
     mRNA            complement(<957425..>957916)
                     /gene="TPHA0C04430"
                     /locus_tag="TPHA_0C04430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684979.1"
                     /db_xref="GeneID:11533468"
     CDS             complement(957425..957916)
                     /gene="TPHA0C04430"
                     /locus_tag="TPHA_0C04430"
                     /inference="similar to DNA sequence:INSDC:YIL016W"
                     /note="similar to Saccharomyces cerevisiae SNL1 (YIL016W);
                     ancestral locus Anc_7.183"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685027.1"
                     /db_xref="GeneID:11533468"
                     /db_xref="GOA:G8BQT1"
                     /db_xref="InterPro:IPR003103"
                     /db_xref="UniProtKB/TrEMBL:G8BQT1"
                     /translation="MDLFQQLFDTDLKSLINKTQNDNLMATLCITGVTATLLAIFLLK
                     SSSAGKSKKGKKKKLKKQNMKVAKKPLTLEEKIEKVLGTYNTEYRDGINKLLETFDKS
                     EKQVYEKNYFNEMLLKLLIELDGVDLMDISDPERKTALKLRRKEAIKLIQGELNKLDN
                     LSQ"
     gene            complement(<958279..>961791)
                     /gene="TPHA0C04440"
                     /locus_tag="TPHA_0C04440"
                     /db_xref="GeneID:11534097"
     mRNA            complement(<958279..>961791)
                     /gene="TPHA0C04440"
                     /locus_tag="TPHA_0C04440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684980.1"
                     /db_xref="GeneID:11534097"
     CDS             complement(958279..961791)
                     /gene="TPHA0C04440"
                     /locus_tag="TPHA_0C04440"
                     /inference="similar to DNA sequence:INSDC:YFR031C"
                     /note="similar to Saccharomyces cerevisiae SMC2 (YFR031C);
                     ancestral locus Anc_7.186"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685028.1"
                     /db_xref="GeneID:11534097"
                     /db_xref="GOA:G8BQT2"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR027120"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BQT2"
                     /translation="MKVAELIIDGFKSYATRTVISEWDPQFNAITGLNGSGKSNILDA
                     ICFVLGISSMSTVRASNLQDLIYKRGQAGVTKASVTIVFDNSDKSKAPIGFETSLTIS
                     VTRQIVLGGTSKYLINGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE
                     ILALIEEAAGTKMFEDRREKAIRTMAKKETKLQENRTLLKEEIEPKLEKLRLEKRTFL
                     DFQETQTDLEETDRVVNAYDYHRLKSQKELFKETLSSKENKIKDLNSQISKLAEELES
                     LNEDFEEIRKKKNAEMDKNSNLSKLEEEENEIINETSKLNVLLKICSDNYKENVNKIQ
                     IHKKIIEDSSMELAKKADVYKKSKEDYKTLNDQLDTLKDLHKKKEDLLSTLSTGISST
                     GLTDGGYEAQLGKAKKSLNGYKISIKKSNMKIDLLRKELENNKPKLIQAEKENEVNIQ
                     NIKDCESNCSKLEADIANYGYDPKLIGELKRKENEIQQILYKLNNENEYLRRKVSNVD
                     FSYSNPEPNFDPKSVKGVAARLFTIDKQNYDSATALQVCAGGRLYNVVVDNETTASKL
                     LEKGRLRKRVTIIPLNKISARTIDNNTLNYAKQLAPGKVELALNLIGYEDEVAKALQF
                     IFGSSLICNDAETAKKITFNPKIRTRSITLDGDVYDPEGTLSGGSRTNTSSILVDIQK
                     YNESTEKINNYQNELKSIRKKLSEQEDIYKQTKELQNQLSLLNHKLEISKRNFGSNPA
                     SQVLKRNKDIQEEILICEKENETSYENSNALEKEIQSITKDLNEFNNDKGSKLKELKA
                     EVEKLSKEIETKDRHLDDKTELFQTLELETEQHNTDIETNTELVKQAEDTLKELKIEE
                     DSLIDSIKEQKNKLETVRAYLTKERKRLFDIDEETKDLERLLKSKHQLKNDNEIELQQ
                     LEHELKKFKNDSTNIEELIRRLIEENEWLNDDKLVEGVIGQHRGINLEEQRERAKQLR
                     VRFDKMKVKVNTNIMSMIESVEKKEAALITMIKTIEKDKVKIQDTITKLNEYKRDTLI
                     KTWKKVTVDFGNIFADLLPNSFAKLVPSEGKDITEGLEVKIKLGKLWKESLVELSGGQ
                     RSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKE
                     GMFNNANRVFRTRFQDGTSVVSIM"
     gene            complement(<962349..>963545)
                     /gene="TPHA0C04445"
                     /locus_tag="TPHA_0C04445"
                     /db_xref="GeneID:11533946"
     mRNA            complement(join(<962349..963109,963542..>963545))
                     /gene="TPHA0C04445"
                     /locus_tag="TPHA_0C04445"
                     /product="60S ribosomal protein L2"
                     /transcript_id="XM_003684981.1"
                     /db_xref="GeneID:11533946"
     CDS             complement(join(962349..963109,963542..963545))
                     /gene="TPHA0C04445"
                     /locus_tag="TPHA_0C04445"
                     /inference="similar to DNA
                     sequence:INSDC:YFR031C-A,YIL018W"
                     /note="similar to Saccharomyces cerevisiae RPL2A
                     (YFR031C-A) and RPL2B (YIL018W); ancestral locus
                     Anc_7.187"
                     /codon_start=1
                     /product="60S ribosomal protein L2"
                     /protein_id="XP_003685029.1"
                     /db_xref="GeneID:11533946"
                     /db_xref="GOA:G8BQT3"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR014726"
                     /db_xref="InterPro:IPR022666"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="InterPro:IPR022671"
                     /db_xref="UniProtKB/TrEMBL:G8BQT3"
                     /translation="MGRVIRNQRKGAGSIFTSHTRLRQGAAKLRSLDYAERHGYIRGV
                     VKQIIHDAGRGAPLAKVVFRDPYKFKLREEIFIANEGVHTGQFIYAGKKASLNVGNVL
                     PLGSVPEGTIISNVEERPGDRGAIARASGNYVIVIGHNTDDNKTRVRLPSGAKKIISS
                     DARGVIGVIAGGGRVDKPLLKAGRAFHKYKVKRNSWPKTRGVAMNPVDHPHGGGNHQH
                     IGKASTISRGAVAGQKAGLIAARRTGLLRGSQKTQD"
     gene            complement(<964539..>965540)
                     /gene="TPHA0C04450"
                     /locus_tag="TPHA_0C04450"
                     /db_xref="GeneID:11533489"
     mRNA            complement(<964539..>965540)
                     /gene="TPHA0C04450"
                     /locus_tag="TPHA_0C04450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684982.1"
                     /db_xref="GeneID:11533489"
     CDS             complement(964539..965540)
                     /gene="TPHA0C04450"
                     /locus_tag="TPHA_0C04450"
                     /inference="similar to DNA sequence:INSDC:YFR032C"
                     /note="similar to Saccharomyces cerevisiae YFR032C;
                     ancestral locus Anc_7.188"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685030.1"
                     /db_xref="GeneID:11533489"
                     /db_xref="GOA:G8BQT4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BQT4"
                     /translation="MVDSAENSSQANIENTNVNQEVVNEGVGVTEVLVNEATVVAADE
                     SDNKEIPRIYIGNLDYSATEDELFNFLKEYEVVSVIVPSHTVRGFLSSHVRPLGIAYA
                     DFNTVEKAKEVVEALSNKKFKNRKIKVKLYKPFKPDNLLKPKKKVSGGKQRRLTVLRR
                     YKQDDNEENKKKGSEEDDVSKKSYKVTQPTSIDTVYCGYLPKNTTDTDLREHFKGYNP
                     QEIWIFRTRTTKGPRHLQIHRHYTAALITLSTTEPIDKISEVSSEKKLLNKTITVKPA
                     YLSKIQEVRRIAEQNGLVEPPENDNQPEQQETVAVTDEQQVVPAAQENTNLSEIAVN"
     gene            complement(<966053..>966241)
                     /gene="TPHA0C04460"
                     /locus_tag="TPHA_0C04460"
                     /db_xref="GeneID:11535326"
     mRNA            complement(<966053..>966241)
                     /gene="TPHA0C04460"
                     /locus_tag="TPHA_0C04460"
                     /product="60S ribosomal protein L29"
                     /transcript_id="XM_003684983.1"
                     /db_xref="GeneID:11535326"
     CDS             complement(966053..966241)
                     /gene="TPHA0C04460"
                     /locus_tag="TPHA_0C04460"
                     /inference="similar to DNA sequence:INSDC:YFR032C-A"
                     /note="similar to Saccharomyces cerevisiae RPL29
                     (YFR032C-A); ancestral locus Anc_7.189"
                     /codon_start=1
                     /product="60S ribosomal protein L29"
                     /protein_id="XP_003685031.1"
                     /db_xref="GeneID:11535326"
                     /db_xref="GOA:G8BQT5"
                     /db_xref="InterPro:IPR002673"
                     /db_xref="UniProtKB/TrEMBL:G8BQT5"
                     /translation="MSKSKNHTAHNQTKKAHRNGIKKPRTYKYPSLKGVDPKFKRNHK
                     HALHGTQKALAAKRAAKN"
     gene            complement(<967705..>968061)
                     /gene="TPHA0C04470"
                     /locus_tag="TPHA_0C04470"
                     /db_xref="GeneID:11535234"
     mRNA            complement(<967705..>968061)
                     /gene="TPHA0C04470"
                     /locus_tag="TPHA_0C04470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684984.1"
                     /db_xref="GeneID:11535234"
     CDS             complement(967705..968061)
                     /gene="TPHA0C04470"
                     /locus_tag="TPHA_0C04470"
                     /inference="similar to DNA sequence:INSDC:YFR033C"
                     /note="similar to Saccharomyces cerevisiae QCR6 (YFR033C);
                     ancestral locus Anc_7.190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685032.1"
                     /db_xref="GeneID:11535234"
                     /db_xref="GOA:G8BQT6"
                     /db_xref="InterPro:IPR003422"
                     /db_xref="InterPro:IPR023184"
                     /db_xref="UniProtKB/TrEMBL:G8BQT6"
                     /translation="MFSVTEYLEDLKEAFIPTVAKAEDEVDEDEEEEDEDEDEEDEDE
                     ASDQMEALRKAALETPEGQELHKHYLDCVARVEKAKESPDYDSLDYKEDCVEEFFHLQ
                     HYSDSQIAPRLFSKLK"
     gene            complement(<968815..>970455)
                     /gene="TPHA0C04480"
                     /locus_tag="TPHA_0C04480"
                     /db_xref="GeneID:11533453"
     mRNA            complement(<968815..>970455)
                     /gene="TPHA0C04480"
                     /locus_tag="TPHA_0C04480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684985.1"
                     /db_xref="GeneID:11533453"
     CDS             complement(968815..970455)
                     /gene="TPHA0C04480"
                     /locus_tag="TPHA_0C04480"
                     /inference="similar to DNA sequence:INSDC:YFR034C"
                     /note="similar to Saccharomyces cerevisiae PHO4 (YFR034C);
                     ancestral locus Anc_7.191"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685033.1"
                     /db_xref="GeneID:11533453"
                     /db_xref="GOA:G8BQT7"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:G8BQT7"
                     /translation="MMVEDEDKDMNFGVEQASQSILDQVDAYLQDNIMTSNIGIKGNP
                     HSGVGAAGNDDSGVHTNVALQQAWGSIHLDDESFNNMMDYNILDKGIGSGGADVGHWS
                     GEGEPNVPLQLPNPPVPQDFIFSPMLDPNNAANDGKKKMSANSNASPFMVPFEPSSGV
                     VFANDNTGMINTPYLRGNKETKKNGSVSGSNSGGMQMVGGFSPLTSPAITPITTSKKV
                     VKNSPRMSLMNSNNGLPRNASHADTKRDKRTVKNGNSSTSTPNSVTNSHEVWDELMFR
                     LPVSSMSVSLSAGEQNKENDENVYETNTHGYPKVVLPSHSTTSFDKEDDHILDRNLLY
                     DNDDAYHEDNDCNNNENNEDIDNIKPRKNKTKQAHKNDIDIDTSSIGGGDTAKYVKTL
                     RATESPVIKPKVMSQSSWKKRQLSQSQMNNIVKDIKPYQYEASSLTASNELIGTINNM
                     EDAAASSMTDNSENSSSGNKMGGLKKVRTNDDETAKRNIHKAAEQERRNRLNLALNRL
                     KLLIPEDLKQSVEVPSKATTVELACQYIEQLKSQLQQK"
     gene            complement(<971240..>972298)
                     /gene="TPHA0C04490"
                     /locus_tag="TPHA_0C04490"
                     /db_xref="GeneID:11533500"
     mRNA            complement(<971240..>972298)
                     /gene="TPHA0C04490"
                     /locus_tag="TPHA_0C04490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684986.1"
                     /db_xref="GeneID:11533500"
     CDS             complement(971240..972298)
                     /gene="TPHA0C04490"
                     /locus_tag="TPHA_0C04490"
                     /inference="similar to DNA sequence:INSDC:YIL019W"
                     /note="similar to Saccharomyces cerevisiae FAF1 (YIL019W);
                     ancestral locus Anc_7.192"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685034.1"
                     /db_xref="GeneID:11533500"
                     /db_xref="UniProtKB/TrEMBL:G8BQT8"
                     /translation="MGGSGDEGDYARALEAQRRAFEAQFGSLESMGFDDKTKNIEEEG
                     SGSESDLGNSESDNDLSDESVDSELELESESEAGVEVESVKKEVVRKGPKVIKFQESF
                     RDGQFITPSKKEQKLVRSGKTLTQVKKTELKHAMEELDKNEDSDENEELEKENLENDL
                     QLQQFLRESHLLSSLNSGSSTTEAGSGARQTLQNMDSTHSKDITFQDDMLTGKARART
                     LEMRLNRLSKINGNAHKIGKLEKVPMQIRKGMVKSHVTKINRFEQEAKDGGIVLAKVK
                     KGQFRKIDATYKKDIERRIGTSIKTKDRQRNSMRKRGLKIQSVGRSTRNGLVISKQEI
                     ARINGTDKPKQKHKKGRR"
     gene            <972617..>973405
                     /gene="TPHA0C04500"
                     /locus_tag="TPHA_0C04500"
                     /db_xref="GeneID:11535202"
     mRNA            <972617..>973405
                     /gene="TPHA0C04500"
                     /locus_tag="TPHA_0C04500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684987.1"
                     /db_xref="GeneID:11535202"
     CDS             972617..973405
                     /gene="TPHA0C04500"
                     /locus_tag="TPHA_0C04500"
                     /inference="similar to DNA sequence:INSDC:YIL020C"
                     /note="similar to Saccharomyces cerevisiae HIS6 (YIL020C);
                     ancestral locus Anc_7.193"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685035.1"
                     /db_xref="GeneID:11535202"
                     /db_xref="GOA:G8BQT9"
                     /db_xref="InterPro:IPR006062"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR011858"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G8BQT9"
                     /translation="MTKFVGCIDLHNGQVKQIVGATLTQKESDVPVTNFVSNKPSSYF
                     SRLYKDNNIEGCHVIKLGPNNDTAALEALKQSPNFLQVGGGINDSNCLEWLQYASKVI
                     VTSWLFDDNGKFLMGRLQELSSKCGADRIVVDLSCRRTSDTKWIVAMNKWQKLTDLEL
                     NEETFIELSQYTDEFLIHAADVEGLSNGIDEALVEKLYQWTKNIAKPLKIVYAGGAKS
                     VTDLDLVNRLSKGKVDLTYGSSLDLFGGNLVKFDDCCAWNNSHK"
     gene            complement(<973590..>974522)
                     /gene="TPHA0C04510"
                     /locus_tag="TPHA_0C04510"
                     /db_xref="GeneID:11533638"
     mRNA            complement(<973590..>974522)
                     /gene="TPHA0C04510"
                     /locus_tag="TPHA_0C04510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684988.1"
                     /db_xref="GeneID:11533638"
     CDS             complement(973590..974522)
                     /gene="TPHA0C04510"
                     /locus_tag="TPHA_0C04510"
                     /inference="similar to DNA sequence:INSDC:YIL021W"
                     /note="similar to Saccharomyces cerevisiae RPB3 (YIL021W);
                     ancestral locus Anc_7.194"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685036.1"
                     /db_xref="GeneID:11533638"
                     /db_xref="GOA:G8BQU0"
                     /db_xref="InterPro:IPR001514"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="InterPro:IPR011262"
                     /db_xref="InterPro:IPR011263"
                     /db_xref="UniProtKB/TrEMBL:G8BQU0"
                     /translation="MSDEGPQVKIREATKDNVDFIVSNVDLAMANAFRRVMIAEIPTL
                     AIDSVEVISNTTVLADEFIAHRLGLVPLQSADIEQLEYSRDCFCEDHCDKCSVVLTLQ
                     ALGESESTTNVYSKDLVIVSDLLGRNIGHPIIQDKEGNGVLICKLRKGQELKFTCIAK
                     KGIAKEHAKWGPAAAIEFEYDPWNKLKHTEYWYEQDAAKEWPQSKNCEYEDPPNEGSE
                     FDYKAKADTFYMNVETIGTVTSDQVIVRGIDILQKKVASILLALNRLDQDKVNYAGNN
                     NVNNGEMDGEDITMNGTENDPYASGNNNSYDGAW"
     gene            <975080..>975487
                     /gene="TPHA0C04520"
                     /locus_tag="TPHA_0C04520"
                     /db_xref="GeneID:11533504"
     mRNA            <975080..>975487
                     /gene="TPHA0C04520"
                     /locus_tag="TPHA_0C04520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684989.1"
                     /db_xref="GeneID:11533504"
     CDS             975080..975487
                     /gene="TPHA0C04520"
                     /locus_tag="TPHA_0C04520"
                     /inference="similar to DNA
                     sequence:INSDC:Scer_YGOB_ADL119W"
                     /note="similar to Saccharomyces cerevisiae ADL119W
                     (Scer_YGOB_ADL119W); ancestral locus Anc_7.195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685037.1"
                     /db_xref="GeneID:11533504"
                     /db_xref="UniProtKB/TrEMBL:G8BQU1"
                     /translation="MAESKLASNIDSGNGSNVPQETLKVPDVRLEQSFNNALQKEAEK
                     QRVAKLKKEGLDDSKILQIQKNEPATVTKYIVWKVILRDMILMPFIQGALFTGLLMAV
                     KPWLRGVVGNGRRFGSYIYKLVLGKDLVKPKDH"
     gene            complement(<975677..>976927)
                     /gene="TPHA0C04530"
                     /locus_tag="TPHA_0C04530"
                     /db_xref="GeneID:11533488"
     mRNA            complement(<975677..>976927)
                     /gene="TPHA0C04530"
                     /locus_tag="TPHA_0C04530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684990.1"
                     /db_xref="GeneID:11533488"
     CDS             complement(975677..976927)
                     /gene="TPHA0C04530"
                     /locus_tag="TPHA_0C04530"
                     /inference="similar to DNA sequence:INSDC:YIL022W"
                     /note="similar to Saccharomyces cerevisiae TIM44
                     (YIL022W); ancestral locus Anc_7.196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685038.1"
                     /db_xref="GeneID:11533488"
                     /db_xref="GOA:G8BQU2"
                     /db_xref="InterPro:IPR007379"
                     /db_xref="InterPro:IPR017303"
                     /db_xref="UniProtKB/TrEMBL:G8BQU2"
                     /translation="MSRSILTKRTNLLLGHNVAYFSTSTVLRNGGGKTPIQIFRETFK
                     KEWEKSQELQDNIKTLQDASGRLGQSEAYKKAKEAYVKAQQSSTIVSKTLKKTGETVE
                     DLAKKTWDSEIGKSTRKVVSQGAKKIDESFEPVRQTQVYKEVSEVIDDGESSRYGGFI
                     SKEQRRKKREADLASGKRVRATKSNEEAGTAIVATNVESKESFGKKIDDFKEKTVVGK
                     TMKSFKVRVWDENENPLIVVLRTISNKISGFFAETESSRVYSQFKLMDPTFSNAAFTK
                     HLRDYIIPEVLEAYVKGDEVVLKKWFSEAPFNVYAAQQKELRKQQLFTDGRILDIRGV
                     DIVSAKLLAPQDIPVLVVGCRAQELHLYRKVKTGELGAGDESNIMMSSYAMVFTRDPD
                     NIDDDETEGWKILEFVRGGSRQFT"
     gene            <977635..>980451
                     /gene="TPHA0C04540"
                     /locus_tag="TPHA_0C04540"
                     /db_xref="GeneID:11535203"
     mRNA            <977635..>980451
                     /gene="TPHA0C04540"
                     /locus_tag="TPHA_0C04540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684991.1"
                     /db_xref="GeneID:11535203"
     CDS             977635..980451
                     /gene="TPHA0C04540"
                     /locus_tag="TPHA_0C04540"
                     /inference="similar to DNA sequence:INSDC:YIL031W"
                     /note="similar to Saccharomyces cerevisiae ULP2 (YIL031W);
                     ancestral locus Anc_7.197"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685039.1"
                     /db_xref="GeneID:11535203"
                     /db_xref="GOA:G8BQU3"
                     /db_xref="InterPro:IPR003653"
                     /db_xref="UniProtKB/TrEMBL:G8BQU3"
                     /translation="MIKNMNNLNNITPNNQKRFNELNQDFEVIESSPLKRINNLKHRQ
                     QEHRHNGLLFSSPNIEINKQRTLKDSTTTESNLDKQYQNMKIKFNLTGFFYILDGENN
                     THKFRNSLLNFKQIKSEDFKIKIRSEDNNIKITFDDLLKQSEKIIFDMNTTTMGIILK
                     EKINLNEKLNSRLILWMNSDISGLDKKLNKIKTLILKSIELSGYETKINLNITGTKYE
                     IEKLLKLQALEDYKILELDKIKNLDTLTSMDNSNNLKKRHIYSFTSTAPTMVDKNRIE
                     NSPEPNMINTPITNKNNDNSIFNNTSPIIEKKKGIAPFKFLWNSQKNSLSSYSYSNLR
                     DSSPNIPNEILKETIDNTVTNYEQKIALPNEMTKEDIYDICEVPAIFKPNLVYKFNDG
                     TTFTITNQDFKCLYNNDWANDMILDFFIKYFIEESITKNIINENDVSIMSSFFYLKLI
                     SDPTNYYKNVKKWVNNSNLFNKKFIVIPLNISYHWLGCIIINFDKVYNFFQNNINELD
                     QNILTIADIPKINILTFDSLSQADAKNIVPIKQFILNYLEDKCNLSLPDEVVEIKKCL
                     VPQQSNFSDCGFHVISNIRTFFEDPGETIKIWNMTDPGEYKNCPEKINDFFGFNKHRN
                     ERENYRAILLHLQRNQVKRKLLEDAFQEKESQNTEDDEDFEIVSNCDIKHKNSNSLSQ
                     DEEVVRNEEEDRIDDNYNIDNNDNNTVTHNLLPNNDDIASDQKQPLTYGDEGRDSINE
                     VLKTNEVTSRNILETSPPIPDNELPYTGTTSKYFGESRLKSRQSHIDIISSAPTEGPN
                     EGGNYYPRESQAIDEPVSDKFMVNQSSANSSVFFNGRRTMSDDDLNNADNNALNNQPK
                     LSDNVEGNITIIESDISDAEGLPVSEMNTSSIPFKSEHVNILLTKRHDTNHYENIRNT
                     LNSEYEEQDDDEEDNSNDIEVISL"
     gene            complement(980646..980718)
                     /gene="TPHA0Ctrna3K"
                     /locus_tag="TPHA_0Ctrna3K"
                     /db_xref="GeneID:11533928"
     tRNA            complement(980646..980718)
                     /gene="TPHA0Ctrna3K"
                     /locus_tag="TPHA_0Ctrna3K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:11533928"
     gene            <983249..>984970
                     /gene="TPHA0C04560"
                     /locus_tag="TPHA_0C04560"
                     /db_xref="GeneID:11533913"
     mRNA            <983249..>984970
                     /gene="TPHA0C04560"
                     /locus_tag="TPHA_0C04560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684992.1"
                     /db_xref="GeneID:11533913"
     CDS             983249..984970
                     /gene="TPHA0C04560"
                     /locus_tag="TPHA_0C04560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685040.1"
                     /db_xref="GeneID:11533913"
                     /db_xref="GOA:G8BQU4"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BQU4"
                     /translation="MINISGRRFSRLFKISAIVLCVFIISAVFLSSNRGLYNVTGLEN
                     NNEPSFASDPSIKKTFSSIFDAIKKHSPDKEVVRKKNDNCLLDGTVGTGNNDVKNWHR
                     LSQKSMEGCLELSDSEINTLKSKHDAYIQSLEEIAVEKIHYKGKGIAIVGGGKFSLLA
                     FLVVKTIRKFETTLPIEIFIPPQDVEDELEFCQQLLPEDNAKCIYLSDILPSQDIKKY
                     EFKRYQYKSLAILASSFDDLLLIDADNFPIKNLDGIFDNEPYTSTGLILWPDFWRRSA
                     NPKFYEITGIELDTKKRVRNAIDDLTPPEVYTEDFSKLADVPFHDFSGTLPDPSTESG
                     QMMINKGKHMKTLLLALYYNVNGPSWYYPILSQGAAGEGDKETVIAAALHNKAKFYQV
                     KFKTGVEGYHQSNGRGFRGVAMLQHDFVQDFARYEDATARIKELYSTESFKQFDSGYS
                     IDAFYEKYISQVNTDIPEEKRKIDVLFVHSHLPKFDPVPLWQSQDLIEDGKHFRSYTS
                     LKKINYFDIELQNFEIFDKYICQDTIAFPYIKNEVKDADMPDLCNYIKNRLSYLQETH
                     ESVTSVA"
     gene            <985491..>987071
                     /gene="TPHA0C04570"
                     /locus_tag="TPHA_0C04570"
                     /db_xref="GeneID:11533640"
     mRNA            <985491..>987071
                     /gene="TPHA0C04570"
                     /locus_tag="TPHA_0C04570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684993.1"
                     /db_xref="GeneID:11533640"
     CDS             985491..987071
                     /gene="TPHA0C04570"
                     /locus_tag="TPHA_0C04570"
                     /inference="similar to DNA sequence:INSDC:YDL101C"
                     /note="similar to Saccharomyces cerevisiae DUN1 (YDL101C);
                     ancestral locus Anc_2.352"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685041.1"
                     /db_xref="GeneID:11533640"
                     /db_xref="GOA:G8BQU5"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BQU5"
                     /translation="MNKREYSDTEEVGNESTLVVKKQHLNQNLAIYPDATDPQTDDNR
                     NNILLANFMSLIPGKEQTLKILEKSETVIGRSRSCDIILDEVDISTKHCKLVLLEMPL
                     GNENRKLLNIIDTSRNGTYINGNKLVKKDYVLKNGDRVIFGKKCSFLFKYASESPIVA
                     VNSVHANNDDVNLDVENTDDGKFKKPQFGFTSSQQLKRKPQQKSKVLSVFDKYIVGKE
                     LGSGHYAIVKEGINKQTGKSVAIKIFHPQLNDDQKKNHQFREETDILMRVQHKNIVNL
                     LDSFVEPISKMQIQKYLVLDKIDDGELFDRIVRKTNLSQPETKALFKQILSGLKYLHG
                     KNIIHRDIKPENILLNVRRRQSPDEIQTGPWDDDEIDIQVKIADFGLAKFTGEMQFTN
                     TLCGTPSYVAPEILTKQGHSSKVDVWSAGVLLYVCLCGFPPFSDQLGPPSLKDQILQG
                     KFAFYSPYWDDIDDTVLHLISNLLVVNPVQRFSIEHCINHPWFNDIRENSFSSRMKRL
                     QISDKQKLPKTYSELSKL"
     gene            complement(<987239..>990529)
                     /gene="TPHA0C04580"
                     /locus_tag="TPHA_0C04580"
                     /db_xref="GeneID:11535287"
     mRNA            complement(<987239..>990529)
                     /gene="TPHA0C04580"
                     /locus_tag="TPHA_0C04580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684994.1"
                     /db_xref="GeneID:11535287"
     CDS             complement(987239..990529)
                     /gene="TPHA0C04580"
                     /locus_tag="TPHA_0C04580"
                     /inference="similar to DNA sequence:INSDC:YDL102W"
                     /note="similar to Saccharomyces cerevisiae POL3 (YDL102W);
                     ancestral locus Anc_2.351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685042.1"
                     /db_xref="GeneID:11535287"
                     /db_xref="GOA:G8BQU6"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR025687"
                     /db_xref="UniProtKB/TrEMBL:G8BQU6"
                     /translation="MSSLKRPGEEEESELQVAVHDKKIKLQSHDHGVGSEPVSTIEII
                     PSDRFRKVKEQGFKAKDADLHGTQMESAFEKELLEMEHEAAIVDEQASIDTYGREPVA
                     SDFSPDTHDISFQQLDCDQTMLSGSTDENTPFIVRFFGVTQEGHSILCNVTGFKHYLY
                     VPSPIAQEQTDKQDLDGFVKYINEQLDNCVDSIEITQRQSIWGYSGDTKLPFWKVYLK
                     NPHMINKLRTSFEKGYFTYKSWFSNGTTTYDNIAYTLRLMIDCGIVGMSWITLPKSKY
                     KLITEQNKISNCQLEVSINYRDLISHPAEGDWSHSAPLRILSFDIECAGRIGVFPEPE
                     HDSVIQIANVVSIAGAKRPFIRNVFTVDTCSPITGSHIFSHEKEEDMLRQWREFVVKA
                     DPDVIIGYNTSNFDLPYLIDRAKALKVNEFPYFGRLVNVNQEVKESTFSSKAYGTRSS
                     KNVNIDGRLQLDLLQFVQREYKLRSYTLNAVSAHFLGEQKEDVHYSIITDLQNGDSET
                     RRRLAVYCLKDAYLPLRLLENLMALVNYTEMSRVTGVPFSYLLSRGQQIKVVSQLFRK
                     CLEIDTLIPNMGSQGSDEQYEGATVIEPIRGYYDLPIATLDFNSLYPSIMMAHNLCYT
                     TLCNRETVQRLDLKLNEDYIITPNNDYFVTTKKRHGILPIILNELISARKRAKNDLKN
                     EKDPFKRDVLNGRQLALKISANSVYGFTGATVGKLPCLAISSSVTAFGRDMIMTTKNA
                     VQEKYSIKNGYKNDAVVVYGDTDSVMVKFGTSDLGEAMELGTEAAAYVSSLFKDPINL
                     EFEKAYFPYLLINKKRYAGLYWTKTEKYDKLDQKGLASVRRDSCPLVSIVMNKVLKMI
                     LIERNVDGALAYIKSVIDELLHNKADISKLIISKTLAPNYTNPQPHQVLTERMKRRDG
                     VGPNVGDRVDYIIIGGNDKLYNRAEDPLYALEHNIQVDSRYYLTNQLQNPIISIIAPI
                     IGEKQANSMFVVKSIKINTGTMKGGLMGFMKKVEVCRYCKGPLTKGESPLCSNCKERS
                     GELYMKTLYEVRDLQEKFARVWTQCQRCAGTLHNEVLCSNKNCDIFYMRVKVKKELQE
                     KVEQLNKW"
     gene            <991298..>991999
                     /gene="TPHA0C04590"
                     /locus_tag="TPHA_0C04590"
                     /db_xref="GeneID:11533602"
     mRNA            <991298..>991999
                     /gene="TPHA0C04590"
                     /locus_tag="TPHA_0C04590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684995.1"
                     /db_xref="GeneID:11533602"
     CDS             991298..991999
                     /gene="TPHA0C04590"
                     /locus_tag="TPHA_0C04590"
                     /inference="similar to DNA sequence:INSDC:YMR161W"
                     /note="similar to Saccharomyces cerevisiae HLJ1 (YMR161W);
                     ancestral locus Anc_2.350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685043.1"
                     /db_xref="GeneID:11533602"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:G8BQU7"
                     /translation="MSTVNFTSEQEKVALEVLSKEKHAFYDILNVQKSADSVEIKKSY
                     RKLAIKLHPDKNPHPKAGEAFKVINRAFEVLSDDEKRSVFDRIGRDPDDRTVPGGGAG
                     AGSGSGFEDMFFRGNGGHPFQRHPGNAMPPEDIFDFLFNMNGGGSPFGAPFGGGATTF
                     TFGGPGGFKVYTNGGGNGNPFFQPNRSHQRRRAAQQPQNGDPAERNDVYDTFRVILPF
                     LVLFLVPLLERLLFG"
     gene            complement(<992304..>997514)
                     /gene="TPHA0C04600"
                     /locus_tag="TPHA_0C04600"
                     /db_xref="GeneID:11534084"
     mRNA            complement(<992304..>997514)
                     /gene="TPHA0C04600"
                     /locus_tag="TPHA_0C04600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684996.1"
                     /db_xref="GeneID:11534084"
     CDS             complement(992304..997514)
                     /gene="TPHA0C04600"
                     /locus_tag="TPHA_0C04600"
                     /inference="similar to DNA sequence:INSDC:YMR162C"
                     /note="similar to Saccharomyces cerevisiae DNF3 (YMR162C);
                     ancestral locus Anc_2.349"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685044.1"
                     /db_xref="GeneID:11534084"
                     /db_xref="GOA:G8BQU8"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:G8BQU8"
                     /translation="MVNSQDKRKRADSLRTQLFNKNLFEKFQETNNDSIELSSVQENE
                     DPAGIQLNINTTDNYKVMDDYTNYDKNVIENRAAIHNNERDDVFIMNNEIEIIEIDEG
                     ESNDKSDDDLDEIYAYIENNIFIDYLNYMLDLILNRSRHVHSKNGRHIPISLNYKHIL
                     EYQKYTDPKRQLLIDERFNKPYCSNIIRSSRYSIFSFLPRQLYFQFSKLANVYFFVIA
                     ILQMIPGWSTTGRYTTIVPLCVFMAISMAREGWDDYKRHRLDKEENNHIATVLRTDTM
                     ENNDKDTYIQNTQYSASMVDNRVFDTRYLPQGINDHKKSNNAEEDESFTNLKLLKEKY
                     DVKEHDIPWKDIKVGDFVLLRQDDWIPADILLLASDNTNNECFVETMALDGETNLKLK
                     QPHSKINKTCRSVSGLVNINAKAILEDPNTDLYNFEGAVDLFEPDKKVFSKYPIGPNN
                     VIYRGSILRNTKTVVGMVMFTGEETKIRMNALKNPRTKAPKLQRKINLIVLFMIVVVA
                     CVSFFSYYGHVLGDRKSIKGNVAWYLFEKNAGVAPSIMAFIIMYNTMIPLSLYVTMEI
                     IKVMQSKFMEWDIDMYHQETDTPCESKAATILEELGQVSYIFSDKTGTLTDNKMLFRK
                     FNIYGSSWLHITDNDNNVGQSNDVNEVNTTTSNAEIDVVSVTNKSLLRKFDFENERTI
                     NIRDEDEDDEPYANAMTGPRPSIEYKGNSAAIFTGRPSMRSLYQAKKSIDIKKQIRSG
                     LENEMNFKRITPKISEASSIMEHTQEMKTSFDLIKFIQTNPTNKFAEKAKFFILSLAL
                     CHSCLPKKINKDDIFDHDEVDAIEYQSSSPDELALITAARELGYVVINKNSSILTIKM
                     YPNGFENDPILEEFEILNYIDFDSQRKRMSVLVRMPSDNDRVLLICKGADNVILERLR
                     NRRLVHQKIEESDLNIRDRKDAEAELIIDQRRSLERLVGEDNISSNRLRNSMASEARG
                     SLGLYAIKHSLSSKNRSSNRFDTEMQIDSLDQILDVVNSPSREIDAVVSKSRLSIHQQ
                     QIEKYGYRASLDYKSSYNSSGIIDKGSKLGENEIYEKLTTSITTEKDIMDYVGGEELL
                     DDEEYVLEKTLQSLDDFSTEGLRTLLYSYKWIPNNEYNSWAIRYNEAKTSLIDRALKI
                     AAVGEEIEDKLELLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYS
                     CKLIYDYSTVVILTIKDGNILSKLNAISQEIDSGSIAHCVLVIDGATLAMYESNPTLM
                     AVFIELCTKTDSVICCRASPSQKALIVTNIRNTKKDLVTLAIGDGANDIAMIQSADIG
                     VGIAGKEGLQAARTADFSIGQFRFLLKLLLVHGRYNYIRTCKFILCTFYKELAFYLTQ
                     VIFQKYTLFSGTSLYESFSLSMFNTLFTSLPVLCIGMFEEDLRPATLLTVPELYATGR
                     LSKEFNFFIVSQWMIQGGIDALLVGFLGIYIYGFSALKDNTLYPLGSINFTAIVILVN
                     VKAQFLEMNNRNWLTFASVIISCGGWLIWLVALPVLNSNDVIYDVPNGFIHNFGRDIT
                     FWCSVLVLSLLTITLHIVYKTVKILISPSDADTFAILEQRSDIRKTLEFGAYNEMKQG
                     WTWKKDPNSFKRYQAKVFGEKNKSNDKVAGSALGNDDDLHSINSINSIDFERSFLPDQ
                     YDPNEYEILPSGKIIRRTSVNETFGSRKENKVMNSSVIRQKLLKKLNFNREKPEDIQA
                     IVEQRLQSLE"
     gene            complement(<998175..>999416)
                     /gene="TPHA0C04610"
                     /locus_tag="TPHA_0C04610"
                     /db_xref="GeneID:11533927"
     mRNA            complement(<998175..>999416)
                     /gene="TPHA0C04610"
                     /locus_tag="TPHA_0C04610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684997.1"
                     /db_xref="GeneID:11533927"
     CDS             complement(998175..999416)
                     /gene="TPHA0C04610"
                     /locus_tag="TPHA_0C04610"
                     /inference="similar to DNA sequence:INSDC:YDL105W"
                     /note="similar to Saccharomyces cerevisiae NSE4 (YDL105W);
                     ancestral locus Anc_2.342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685045.1"
                     /db_xref="GeneID:11533927"
                     /db_xref="GOA:G8BQU9"
                     /db_xref="InterPro:IPR014854"
                     /db_xref="InterPro:IPR027786"
                     /db_xref="InterPro:IPR029225"
                     /db_xref="UniProtKB/TrEMBL:G8BQU9"
                     /translation="MSKRSQDEPLTGSQNKRTKTNIEKENNATTEDDYTVLQGYKQLE
                     EEMTNGLVRVARTGAINIAFENLEAADILFSKVKGTRNNGLLAHDAKAMVNISKLAEL
                     SVRNLKFDDTRSLVNLDDILKSSKKYMLKDYFKENDIKAPVFVTNTMIDLENENEDED
                     DSDNTQDIGPNQIHSLGNDRTDQFRQQAIRQKYLKQFANYNDFMQFNWYKLGALYDSI
                     SKKPTTTGHFVGPFSVIPKVRAVPERNINDSLLNGRVVATTVDKITSSSLSETQDTTT
                     PEQVIKCFKKLKKKLQSKSNNNENENPEGCDKDGEVNRINLFKFVINPNSFSATIENL
                     FYTSFLIKEGKLIMEEDKNDGLPYLLIKEHNPKGKKDSKIQEIEEGNKREHQQHHIIY
                     QLDMPTWRKLIDTFEITESFL"
     gene            complement(<999801..>1002557)
                     /gene="TPHA0C04620"
                     /locus_tag="TPHA_0C04620"
                     /db_xref="GeneID:11535318"
     mRNA            complement(<999801..>1002557)
                     /gene="TPHA0C04620"
                     /locus_tag="TPHA_0C04620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684998.1"
                     /db_xref="GeneID:11535318"
     CDS             complement(999801..1002557)
                     /gene="TPHA0C04620"
                     /locus_tag="TPHA_0C04620"
                     /inference="similar to DNA sequence:INSDC:YGL141W"
                     /note="similar to Saccharomyces cerevisiae HUL5 (YGL141W);
                     ancestral locus Anc_2.335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685046.1"
                     /db_xref="GeneID:11535318"
                     /db_xref="GOA:G8BQV0"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="UniProtKB/TrEMBL:G8BQV0"
                     /translation="MFNFNGQSKRRNINLSTNNRASKKELLAQAQKEREKRALAKKEQ
                     NAIIIIQNVLRKVRDTRSVLDTCLKSKDETILVHLIPIFGRRLLSYISKDDLKYILTV
                     SNNYSLSYKNSFYNIKLLEILGSFSDGDEELIIETFNDLNPRFPVSEMFVSQVTNMLL
                     TSYSTSEVIFLSVSKFIRKWNILSSPNSLDLFCLHSDIRKTSDNLMSFYKHLAQYAIF
                     PLHIVDNRHLLNNICIQYSNERGNRSLQLLIAQYLDLSTFNAADYNDLKDIHILFESN
                     YISQLMAYMDLGANKFDALNTIVNYVSLAKCFKTENSILITILAKENFVRSIFNQLID
                     NSQNTFETKEPIFILFIHLIEVYLLITTDQELLNNRKTITIKELKLFSAKLRDYVFVT
                     LWNPKPDTDSKQTIDISLHLLRQLYLRDTRLKFCATNKDLKFWNSNDKEFLQVNIFKC
                     LEIFEKLYREYILTHSQTSDEHMIDKVAGISSDISINVFEIMKNDSSINLNARQFKKF
                     EILIKTPFFISFEDRVDIFYTFIAFDKHRLSLDSDYNISNNFSIWDTGNEQGVPTVSI
                     SRENLLEDAYNAYNNVGEQLKSKISVNFVNEFGPEAGIDGGGISKELLTSVTEEGFNS
                     DKYGLFRTNDNYELYPNPNVTLSKLNLILFLGKIVGKCLYDRVLIDVKFTEFFMKKIL
                     NYSNKLISSFDDLSSLDNVLYQNLVKLLNMDSNEVEALELTFEIADENNRQKVIELVP
                     NGSTKKVTKSNILQYIFAIADLKLNRQLYLPCLYFMKGMNMIIAPHWMEIFNPVELQM
                     LISGGDRDIDLEDLRENTIYGGFEQNDRTIQDFWQTLSDFEPSERVKFIKFVTSVPRG
                     PLQGFGSLTPKFGIRNSGTDKDRLPTASTCVNLLKLPNYQDKALLKQKLLYAINSGAR
                     FDLS"
     gene            <1002868..>1004637
                     /gene="TPHA0C04630"
                     /locus_tag="TPHA_0C04630"
                     /db_xref="GeneID:11533635"
     mRNA            <1002868..>1004637
                     /gene="TPHA0C04630"
                     /locus_tag="TPHA_0C04630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003684999.1"
                     /db_xref="GeneID:11533635"
     CDS             1002868..1004637
                     /gene="TPHA0C04630"
                     /locus_tag="TPHA_0C04630"
                     /inference="similar to DNA sequence:INSDC:YGL142C"
                     /note="similar to Saccharomyces cerevisiae GPI10
                     (YGL142C); ancestral locus Anc_2.334"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685047.1"
                     /db_xref="GeneID:11533635"
                     /db_xref="GOA:G8BQV1"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:G8BQV1"
                     /translation="MVSYRQFRSNFKYFLFIFIFRLFNACITHTYFQADEFWQSLEPA
                     HLRAFGYGHLTWEWKFGLRSYAFPLFFEIGYRLCSLLTVVITKLIDCLISINLGSSLI
                     VGLNIFDMSKPLEDQIEYFLVLYIPKLIMVVLATIGEFYTIILSRKLYLLTLDKQKDM
                     KGQGAYNVMNITLIFTLSNFFNCFAITRTFINSFEMVLTSVALYYWDWTQGKLINSRS
                     YSFSLFVAIFTCLQRPSNGIIWIVLGVCLLINLISQKRYQAIVDLGLKIATVFFVAFA
                     LNTMIDYYFYRELRFPIFRFIQFNFTSPLSTFYGISPWHFHIFQSVPIVLGYSIPFFT
                     FGMASKLTISSQSYVQDPFSVIKFTSIINLLAYSCLLHKEFRFIYALQPMFTIISVFG
                     YLKFLETFKMSQTKLFRLLKYVVPAVVILLSFTICKYHEAGSIDVMKFLHNEARLESV
                     GFIMPCHSTPWQSYLHRNDIKDLWAITCEPPLHLLVETNASTKLESYMDESDILYDNI
                     LAFFKENFSNSIFSEPITRSVKGEYNHEWPDILVVFEHLDDIFLKNYLHGSEYKEYKR
                     FFNTLSHWDHRREGDIIVYKRNA"
     gene            complement(<1004694..>1005833)
                     /gene="TPHA0C04640"
                     /locus_tag="TPHA_0C04640"
                     /db_xref="GeneID:11535284"
     mRNA            complement(<1004694..>1005833)
                     /gene="TPHA0C04640"
                     /locus_tag="TPHA_0C04640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685000.1"
                     /db_xref="GeneID:11535284"
     CDS             complement(1004694..1005833)
                     /gene="TPHA0C04640"
                     /locus_tag="TPHA_0C04640"
                     /inference="similar to DNA sequence:INSDC:YDL107W"
                     /note="similar to Saccharomyces cerevisiae MSS2 (YDL107W);
                     ancestral locus Anc_2.333"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685048.1"
                     /db_xref="GeneID:11535284"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G8BQV2"
                     /translation="MSRTVNSIIRLYSRVSRTTRPSFDHVFPKAKTIKSILFELDSKH
                     TYSKLLPVYKWNYEHMDDESPRELDAKSSKGISSNDYMLMKKVLERIRKDTKSANKNL
                     LALENALLDKAVDMGNEDAIAIISFDTLKNPENNDVVDVEYANKLVKNLYENSHPLTI
                     KLTGDLLMKAGDDKLAEKNYMKFIKMQDNTALAGEVYGYLGRIHLRKPDIHKAEEYFR
                     KSIKYSRLENAVFSYYYLSQIYIDTNPLRARSYLEVSATQGFKEAFKSLGYLEMKYFD
                     DIDKAYEWFRLGVELNDLESYFGFFDCNVKLKEWSSAKKCLNALNQLSKTSDTTKQLV
                     EKFISQRKDIVSTLDTKLATKNSISSGHSKSQTPAKDNTSDRWSV"
     gene            complement(<1006190..>1007119)
                     /gene="TPHA0C04650"
                     /locus_tag="TPHA_0C04650"
                     /db_xref="GeneID:11533501"
     mRNA            complement(<1006190..>1007119)
                     /gene="TPHA0C04650"
                     /locus_tag="TPHA_0C04650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685001.1"
                     /db_xref="GeneID:11533501"
     CDS             complement(1006190..1007119)
                     /gene="TPHA0C04650"
                     /locus_tag="TPHA_0C04650"
                     /inference="similar to DNA sequence:INSDC:YDL108W"
                     /note="similar to Saccharomyces cerevisiae KIN28
                     (YDL108W); ancestral locus Anc_2.332"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685049.1"
                     /db_xref="GeneID:11533501"
                     /db_xref="GOA:G8BQV3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BQV3"
                     /translation="MSDKIVSEYTKEKKVGEGTYAVVYLGTKQSTGRKIAIKEIKTSE
                     FKDGLDMSAIREVKYLQEINHINVIELVDIFMAYNNLNLVLEYLPTDLEVVIKDQNIL
                     FTPADIKSWMLMTLRGVYHCHRNFILHRDLKPNNLLISPDGQIKVADFGLARAIPAPY
                     DVLTSNVVTRWYRAPELLLGAKHYTSAVDVWSLGIIFAELMLRIPYLPGQNDVDQIDV
                     TFRALGTPTDKDWPGVSKFSTYTQLQTYPPPSRDELRKRFIAASENALDLMSGMLTMN
                     PQKRWTTIQCLQSEYFTELPPPSDPSTIKLNKD"
     gene            <1007488..>1008738
                     /gene="TPHA0C04660"
                     /locus_tag="TPHA_0C04660"
                     /db_xref="GeneID:11534071"
     mRNA            <1007488..>1008738
                     /gene="TPHA0C04660"
                     /locus_tag="TPHA_0C04660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685002.1"
                     /db_xref="GeneID:11534071"
     CDS             1007488..1008738
                     /gene="TPHA0C04660"
                     /locus_tag="TPHA_0C04660"
                     /inference="similar to DNA sequence:INSDC:YGL143C"
                     /note="similar to Saccharomyces cerevisiae MRF1 (YGL143C);
                     ancestral locus Anc_2.331"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685050.1"
                     /db_xref="GeneID:11534071"
                     /db_xref="GOA:G8BQV4"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="InterPro:IPR005139"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:G8BQV4"
                     /translation="MFFSNGLVMRRFGKLSGTLTRGITLQNVTVGSFRRWHSIAAEAK
                     FKELNPSIVQKAKQHCLDMKAMETEMYNGVVFDDNRQKLFARISSISDSYQKYNDNLE
                     LYKGLLDMMKTDLSLKEDAEKELEELLPELNASSNVLLQKLLPPHEFADKPCIVELRP
                     GVGGIEAMIFAQDLLNMYIGFCNANKWKHHIITKNENESGNGIVDAILSIDEPGSYDI
                     IRMEVGVHRVQRIPATETKGRVHTSTAAVVVLPKLSDGSEKESADYERTFKPDDIRID
                     VMRARGKGGQHVNTTDSAVRLTHFPSGIVVSMQDERSQHKNKAKAFTILRAKLAERER
                     LEKEANERNIRKDQVTTIDRSDKIRTYNYPQNRVTDHRNGLTLYALDAVITGERLSEV
                     IEAQTRHDADLRANQLLNEPISTE"
     gene            <1009187..>1011304
                     /gene="TPHA0C04670"
                     /locus_tag="TPHA_0C04670"
                     /db_xref="GeneID:11535212"
     mRNA            <1009187..>1011304
                     /gene="TPHA0C04670"
                     /locus_tag="TPHA_0C04670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685003.1"
                     /db_xref="GeneID:11535212"
     CDS             1009187..1011304
                     /gene="TPHA0C04670"
                     /locus_tag="TPHA_0C04670"
                     /inference="similar to DNA sequence:INSDC:YDL109C,YGL144C"
                     /note="similar to Saccharomyces cerevisiae YDL109C and
                     ROG1 (YGL144C); ancestral locus Anc_2.330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685051.1"
                     /db_xref="GeneID:11535212"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BQV5"
                     /translation="MPEVKNDSDVLYYNTSQVKVGEIERYIITFNLYEGDVIPEDISL
                     ESLWVEVKNTEGLSYRAAYLIGPFTLYCDVKTSNYHHSQKIISSLDEPKYEPNLQPQQ
                     TFKAELSLHEIKRQYVWIVDIVSQIIFTSTTQTGFEISIKRPLCLVGGEVVPLSADSF
                     NVNRLNTLDIWNLPLQIYTKQEKKHLVILTHGLHSNTTSDMSYIMEQIYKTQVNFPNE
                     QIIVKGFTKNVCQTEKGVKYLGTNLAKYIIDELYDPSVTKISFIGHSLGGLIQSFAIA
                     YIAVIYPWFFDKVQPINFITLASPLLGIVTDNPKYINLLLSFGVIGKTGQDLKLERDN
                     STTEPKLANKCDIDNDPLLFKLPGDPLNQALQLFKRRTVYANAINDGLVPLYSSALLY
                     LDYENVTDELRLATEYDDLDDSAEIESILSGEAMSSNYYDENLQALKKTFVSPITKIL
                     NIWNPQTYLSKNSSKLPRLSMFKSATSILIPPLPDREFILDPSTRSKVILHDRIYTEE
                     YINEIDKEFENPYLNDTNMLLKAFTIARGKGGDFEQKLEERIARMWHKNLSWRKVVVA
                     LKPDAHNNILVRRRFVNAHGWLVIDHLIENHFMAEENNIELAASDETYKSSINNHIAS
                     TAKILDITSNIEPNKKYSWLTRKEAESIFDEGPTGMISTVSEMFDSFAKTSLSGEIDR
                     NNNQNKIVPDNTLFGDGNSDMIL"
     gene            <1011837..>1012310
                     /gene="TPHA0C04680"
                     /locus_tag="TPHA_0C04680"
                     /db_xref="GeneID:11533941"
     mRNA            <1011837..>1012310
                     /gene="TPHA0C04680"
                     /locus_tag="TPHA_0C04680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685004.1"
                     /db_xref="GeneID:11533941"
     CDS             1011837..1012310
                     /gene="TPHA0C04680"
                     /locus_tag="TPHA_0C04680"
                     /inference="similar to DNA sequence:INSDC:YDL110C"
                     /note="similar to Saccharomyces cerevisiae TMA17
                     (YDL110C); ancestral locus Anc_2.328"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685052.1"
                     /db_xref="GeneID:11533941"
                     /db_xref="UniProtKB/TrEMBL:G8BQV6"
                     /translation="MSGASGMRGAIKIEDFKVAIRTMSDGEIEQIKREVLNSLRHLES
                     STKRLNKYIIHLKGESNDANIDEYNDIVDAEEFNNIDQSDLELFEESVRENGTILDNY
                     NQRIDIINDEQIYRKSGKKVSDSSIQLENRKKGLSTDIDMDNSDVDIVAPNSMYL"
     gene            complement(<1012616..>1013848)
                     /gene="TPHA0C04690"
                     /locus_tag="TPHA_0C04690"
                     /db_xref="GeneID:11535233"
     mRNA            complement(<1012616..>1013848)
                     /gene="TPHA0C04690"
                     /locus_tag="TPHA_0C04690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685005.1"
                     /db_xref="GeneID:11535233"
     CDS             complement(1012616..1013848)
                     /gene="TPHA0C04690"
                     /locus_tag="TPHA_0C04690"
                     /inference="similar to DNA sequence:INSDC:YMR270C"
                     /note="similar to Saccharomyces cerevisiae RRN9 (YMR270C);
                     ancestral locus Anc_8.825"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685053.1"
                     /db_xref="GeneID:11535233"
                     /db_xref="InterPro:IPR019622"
                     /db_xref="UniProtKB/TrEMBL:G8BQV7"
                     /translation="MSTSSNENESDDEFQDNENIKNSFSALDSLENEAFGSEKETTEV
                     GDSKKNLDKNDLAIFESAKEILETLEHTQRTDLALHLYSSYLLRTLLYKANEKRHIAE
                     IDLLYTTQVKENWVSWPNSNTIIDPKTDKLYEDDIGKKTQIYDDIIVDKGQILTQNMK
                     KEQIEDINLNFDVLPGEVSTNALIHGSHMMERELDAYWQKIISESAISNNDYLDIDTM
                     NIPSTISDHILSKLDLFFEGLHNQVAQQTSINIKQSIDDGHIVISQPDKVAEIKENKH
                     IELDFHDVILRSCDMGENMQEIYMKCLQLFNDIPKTFDKQHFKLPKHYLKKFSPAPKK
                     HNLEVEEAIKNSRKDFIAIEDVLKKTTIKSKQKAKLAFKNRKNTELNINKKVFYKIQG
                     PSLIDLEDLDYTVKDALL"
     gene            <1014321..>1015133
                     /gene="TPHA0C04700"
                     /locus_tag="TPHA_0C04700"
                     /db_xref="GeneID:11533764"
     mRNA            <1014321..>1015133
                     /gene="TPHA0C04700"
                     /locus_tag="TPHA_0C04700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685006.1"
                     /db_xref="GeneID:11533764"
     CDS             1014321..1015133
                     /gene="TPHA0C04700"
                     /locus_tag="TPHA_0C04700"
                     /inference="similar to DNA sequence:INSDC:YML105C"
                     /note="similar to Saccharomyces cerevisiae SEC65
                     (YML105C); ancestral locus Anc_8.826"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685054.1"
                     /db_xref="GeneID:11533764"
                     /db_xref="GOA:G8BQV8"
                     /db_xref="InterPro:IPR002778"
                     /db_xref="InterPro:IPR022938"
                     /db_xref="UniProtKB/TrEMBL:G8BQV8"
                     /translation="MPKLEEIENYDDIDNMEMDLAELDPSLNTPIAPKIVTTVVRSQD
                     LEDNKEPPLVPLSDNSEQINFINPQTGQVEGSARMSKQELQEVKGFQVIYPCYFDVNR
                     SHKEGRRVSKELAVENPLAKTVADAVRELGVLCIFEGDKCHPQDFGNPGRVRVLIKEQ
                     GTTVVTASSYSSGGKRQLLNDIAKYLQKNPTTIEKLREIPYGPEFDNIEFKRVPKVKG
                     FKMNDIVPLHSSYLMGHPMVKGLYDAPPPPVTHANTQGKLKMPKNKYKVVRR"
     gene            complement(<1015392..>1016525)
                     /gene="TPHA0C04710"
                     /locus_tag="TPHA_0C04710"
                     /db_xref="GeneID:11535267"
     mRNA            complement(<1015392..>1016525)
                     /gene="TPHA0C04710"
                     /locus_tag="TPHA_0C04710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685007.1"
                     /db_xref="GeneID:11535267"
     CDS             complement(1015392..1016525)
                     /gene="TPHA0C04710"
                     /locus_tag="TPHA_0C04710"
                     /inference="similar to DNA sequence:INSDC:YMR272C"
                     /note="similar to Saccharomyces cerevisiae SCS7 (YMR272C);
                     ancestral locus Anc_8.829"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685055.1"
                     /db_xref="GeneID:11535267"
                     /db_xref="GOA:G8BQV9"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="InterPro:IPR014430"
                     /db_xref="UniProtKB/TrEMBL:G8BQV9"
                     /translation="MAESNPSKTLELFSSEKFQSHNTEDDCWVSVKDRLIYDVSKFVQ
                     ENKDVPVEDAVLKRAGKDISDLLETKSFKFVDDKYLVGYLANSTEEARLLTNKDHKVE
                     VNLKDGTYDSTVFVKELPSEEHFTISTDYKKDFVDHHFLDLEKPLLMQMLTGNFTREF
                     YIDQIHRPRHYGKGSAKLFGNWLEPISLTPWWLIPIIWGPVVVYHFYVGAQHMHPLSA
                     VFFYFLGIFVWTFIEYCLHRFLFHLDDWVPQHNFFYTIHFLLHGVHHYLPMDQYRLVV
                     PPALFVVLCTPFYKAVFALLPLYVAYVGFAGGLTGYIIYDLTHYFIHHVKLPRVFRKI
                     KKHHLEHHYKNYQLGFGVSNYFWDLVFGTYLGPDSPASIMRTK"
     gene            complement(<1017585..>1020803)
                     /gene="TPHA0C04720"
                     /locus_tag="TPHA_0C04720"
                     /db_xref="GeneID:11535320"
     mRNA            complement(<1017585..>1020803)
                     /gene="TPHA0C04720"
                     /locus_tag="TPHA_0C04720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685008.1"
                     /db_xref="GeneID:11535320"
     CDS             complement(1017585..1020803)
                     /gene="TPHA0C04720"
                     /locus_tag="TPHA_0C04720"
                     /inference="similar to DNA sequence:INSDC:YML109W,YMR273C"
                     /note="similar to Saccharomyces cerevisiae ZDS2 (YML109W)
                     and ZDS1 (YMR273C); ancestral locus Anc_8.831"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685056.1"
                     /db_xref="GeneID:11535320"
                     /db_xref="InterPro:IPR013941"
                     /db_xref="UniProtKB/TrEMBL:G8BQW0"
                     /translation="MNGNTDMETNIESRNPAMLKAVQYLDREIKNVNHLKRFSIGSMD
                     MLIDPELEYRISNTVTKDIESEKPKRRSVLLLNTFASSDDVPTKAHSKAPNIGIMQSN
                     IDYSNDLVNMSIQRRRSSTRQFPTFSKYKESVPVYNEEKVDSTNAVKWVRADQHPNVS
                     PSKQLNEVLENLHIEDKQVTKKDRLSITYKKNKSSIVRRPSKLRHSSNDESFDSDIED
                     PSFTKDHDTFSFENESSFSTNDQTDISITRFDSRDTINSNGNSNHRLSLKNITDELTR
                     ISNDAGLVDSDAINLAQSLGLTSSYQNNINDFYDDKNLAIYDSTINESSNMETFNEQD
                     KILNLNSENSKGGTFAVNGMKVPMRSSLRRSKFNTYRYSRNNQKDSDIPEKKEIENPY
                     MGSQHISEEKSDVTEIQVALSNNQNALVSPERNNDKISFKDSQKDYLTKPIEEKADAD
                     EQSGSSPVSDFQDIYDHYRQPSSEWEDEIFNASKNPESSISLNGNLVALPELASSKYQ
                     TSNVMGEEGEYLDKVTHDHTQETSFETDDINNEVNNNYADDRIQMNATEYLNNSEQHT
                     ISENDIHESSSELQHSENLISSQEQRDSFIQNGDTNLREVRSTQKHHYRRGGWAWFNN
                     KTKESFNSSLHSLNKNTTSSGNRGSTELNDNETSTEAGHSLHNKAPGKSRNRNIFKLH
                     DKTNDAHSYKNVTDNESSAVDSSSANIKNSLGKLNDLFKRKTSGKLHRTSHDAVSTAI
                     EQDSDLSAFEKVRKSSSSSFNKLRKSSSKISVSESGRQDTTASSTRTEPIEPALPNQS
                     AYHIEAHGDQVELETHNNPKKHAQILPVSPASERTDDSSVLDASGPLTESRNTPLNGL
                     QPAITIKTTRQPDPHTHAVAPRAETPPSGKNSANLPTKNGRQRRKTGAYSTSTRVSKT
                     PKRSSRGQQASTNGNGPAPVTSTLPLRKLTFADVPPTGRANGPVQFMDSTFGFPLPLL
                     TRSTIIMFENRLPISVERAIYRLSHLKLGDTKKELRQQVLLSNFMYAYLHLVNHSLYL
                     EQYGLGADGSGAAPDSLAADTSGKDAEIRLTVDTHASRTVFG"
     gene            <1022636..>1023520
                     /gene="TPHA0C04740"
                     /locus_tag="TPHA_0C04740"
                     /db_xref="GeneID:11533949"
     mRNA            <1022636..>1023520
                     /gene="TPHA0C04740"
                     /locus_tag="TPHA_0C04740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685009.1"
                     /db_xref="GeneID:11533949"
     CDS             1022636..1023520
                     /gene="TPHA0C04740"
                     /locus_tag="TPHA_0C04740"
                     /inference="similar to DNA sequence:INSDC:YML110C"
                     /note="similar to Saccharomyces cerevisiae COQ5 (YML110C);
                     ancestral locus Anc_8.833"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685057.1"
                     /db_xref="GeneID:11533949"
                     /db_xref="GOA:G8BQW1"
                     /db_xref="InterPro:IPR004033"
                     /db_xref="InterPro:IPR023576"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BQW1"
                     /translation="MLKVASFKNYVNFANAKTIGRLFSSNNALNKVDGGKFTDFGSKM
                     VPLAEKQKLVGGVFSSVASKYDIMNDVMSLGIHRCWKDHFINKLDAGKRPNSDTPLSF
                     IDVAGGSGDIAFGLLDHAEEKFHDTQSTMDIIDINPDMLKEGEKRALEQNKYYNNPRV
                     RFMIQNGEVLDAIESNSKDIYTVSFGIRNFTDIQAGLNTAHRVLKPGGIFYCLEFSKI
                     ENGLVDFGYQQWAKVLPFMGSVIANDYDSYQYLVESIERFPDQETFKYMIEKAGFQSV
                     GYENLTFGTCAIHWGIKV"
     gene            complement(<1023732..>1026674)
                     /gene="TPHA0C04750"
                     /locus_tag="TPHA_0C04750"
                     /db_xref="GeneID:11533774"
     mRNA            complement(<1023732..>1026674)
                     /gene="TPHA0C04750"
                     /locus_tag="TPHA_0C04750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685010.1"
                     /db_xref="GeneID:11533774"
     CDS             complement(1023732..1026674)
                     /gene="TPHA0C04750"
                     /locus_tag="TPHA_0C04750"
                     /inference="similar to DNA sequence:INSDC:YML111W,YMR275C"
                     /note="similar to Saccharomyces cerevisiae BUL2 (YML111W)
                     and BUL1 (YMR275C); ancestral locus Anc_8.834"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685058.1"
                     /db_xref="GeneID:11533774"
                     /db_xref="InterPro:IPR007519"
                     /db_xref="InterPro:IPR007520"
                     /db_xref="InterPro:IPR022794"
                     /db_xref="UniProtKB/TrEMBL:G8BQW2"
                     /translation="MTGQNNVIRPPLRTAHTENVLRGRLPANSSSSNLRTSLSKSKEA
                     KQWIRSASASNLLRSYKSKNNDQSLNNVDGMTPSTGTSTNKESSSSNEGALYLQTNDS
                     NTFVDVLPSFEMYNTLHRHIPQGNVDPDRHDFPPSYQEVQTQRESILPRQDHPELLNL
                     EQQQCSYNRTNITLSSSSNIENVPNGEDIITPLNFSGTNLHSLSSSNLNSLHPLSTQH
                     LNIQPYPTMQHGIASNISSRTSGDPGTDSNTPEDDLNDNDNIFIDKLYTLPKLTTPVE
                     IDIRITKQASFPHEKPEEESILKEYTSGDIIHGYCIIENRSSQPLKFEMFYVTLEAYT
                     SVIDRTKGKRTVKRFLRMVDLSASWSYSNMILSSGVNVVAGDVDYDNSIIGLNNNRVL
                     EPGKKYKKFFMFKLPNQLLDITCKQEQFQHCLLPPSFGIDKYRNNGRYSGIKVNNVLG
                     CGHLGIKGSPILTYDMLDDNLSINYTVDARIVGKDIKTHKLNIMKEQVYNIRVIPFGF
                     SSKISNKKPTEQINELIKLVEERLEALDRIFQKLEKKEPISNSDIRGTEVYGTLEGTA
                     NLGSKELLERKIRHMYISNRECSDTGLNSSKDLKNLHPQDKFVESELNYKIKSKPKSS
                     SSLFSTFLGSSQPSSSSTASKTSPTSTKSEKAGLIVLTCDVPKQSLPYWSPSLLRKTN
                     VYENKNSYNQENWNNLQSTIPDDEKDLLSKLDIHLTCIQSNNSMPHDPPDIHSVTTEL
                     ICITVKSDNSIPVKLEQDLLMNEKKMKTTQSLFSEYVQKIKTYKKKFNENLAELNELY
                     NSSRTFTSSREIKFSDFISGQLHNDIESIANLNISIIQLNDIFKKQVDTLKSQSDSIS
                     ANSNIHSAGNSSTSVGSLYPSRSGGTNILSATFSGSTQHTSSKASTQSRMKDQLTHDW
                     VQCKQLQYERELSVNIEYAPDIKETLIPSFESCLCARFYLVRVYVKFEHHAGVAMIDI
                     PVDVKKLT"
     gene            complement(<1027735..>1028682)
                     /gene="TPHA0C04760"
                     /locus_tag="TPHA_0C04760"
                     /db_xref="GeneID:11533464"
     mRNA            complement(<1027735..>1028682)
                     /gene="TPHA0C04760"
                     /locus_tag="TPHA_0C04760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685011.1"
                     /db_xref="GeneID:11533464"
     CDS             complement(1027735..1028682)
                     /gene="TPHA0C04760"
                     /locus_tag="TPHA_0C04760"
                     /inference="similar to DNA sequence:INSDC:YML112W"
                     /note="similar to Saccharomyces cerevisiae CTK3 (YML112W);
                     ancestral locus Anc_8.835"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685059.1"
                     /db_xref="GeneID:11533464"
                     /db_xref="InterPro:IPR024637"
                     /db_xref="UniProtKB/TrEMBL:G8BQW3"
                     /translation="MDSFEARLKFIQVLKSLSKTLNTILTYAPGSNSDSFNLSGSINM
                     SGSKTAAVDPIQFYVTCCDEHYEDFQQCLFDTTSKMDSLDRLNVLIYYCKLIEMLKYL
                     VDNSTGGLESKKHILNKVLLASIDKLYMLMLPGNEIKSLVNLNECINRFVDMNQLAGN
                     IISDEEMKQMRQAFQRHSSTSATQISEAWYTVPDTEADTAGDYEKSFRTTLTLLNDRI
                     GKQRLFYQQFANSEPIPCQEQGTAATQITLHRMENDRERHKKLKEHSWFIKRDTDRSM
                     LSANEFEKLWDNTTGELTIEDLNNMQELHDISQQSYLTM"
     gene            complement(<1029507..>1030451)
                     /gene="TPHA0C04770"
                     /locus_tag="TPHA_0C04770"
                     /db_xref="GeneID:11535288"
     mRNA            complement(<1029507..>1030451)
                     /gene="TPHA0C04770"
                     /locus_tag="TPHA_0C04770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685012.1"
                     /db_xref="GeneID:11535288"
     CDS             complement(1029507..1030451)
                     /gene="TPHA0C04770"
                     /locus_tag="TPHA_0C04770"
                     /inference="similar to DNA sequence:INSDC:YML113W"
                     /note="similar to Saccharomyces cerevisiae DAT1 (YML113W);
                     ancestral locus Anc_8.836"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685060.1"
                     /db_xref="GeneID:11535288"
                     /db_xref="UniProtKB/TrEMBL:G8BQW4"
                     /translation="MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRKDGSLGTAV
                     NVHNATGGGKNIKNARSKKTTSTKAATAVASATAKPKRKYVKKKKPKTEDYLTTPISG
                     FQTVHELAGPNGSLITMDSGNGVITNNNYNNNRNISSRDLEALDALRELTTSPTFTTF
                     NDIPLRATSSAFNNASIQNMATMPLPRLDMLSQNQNNNLSQAQNNKFFSQRMMNLPKD
                     DFMNNSTIQTKNLLNINQQNVPNINVELPHLHAIGDTMSFQNNISNNSFPMNTYQNTN
                     MNLNLHSNVDQNGNANISHFMNNRNTDSMANNQYAYNG"
     gap             1031469..1031539
                     /estimated_length=71
     gene            <1031751..>1033328
                     /gene="TPHA0C04780"
                     /locus_tag="TPHA_0C04780"
                     /db_xref="GeneID:11535319"
     mRNA            <1031751..>1033328
                     /gene="TPHA0C04780"
                     /locus_tag="TPHA_0C04780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685013.1"
                     /db_xref="GeneID:11535319"
     CDS             1031751..1033328
                     /gene="TPHA0C04780"
                     /locus_tag="TPHA_0C04780"
                     /inference="similar to DNA sequence:INSDC:YML115C"
                     /note="similar to Saccharomyces cerevisiae VAN1 (YML115C);
                     ancestral locus Anc_8.842"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685061.1"
                     /db_xref="GeneID:11535319"
                     /db_xref="InterPro:IPR005109"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BQW5"
                     /translation="MKFSPLKLFRFSRNSYKLPLSEKTKEKRKNRDFRLLPKYSKFKV
                     TNFRDKVSNFNVALSVILLCIFIAKTISVNVSIYKYNSFVHEEETETVTFDTQVLTAP
                     EYYNYDFHDYNLDTISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSV
                     DIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVS
                     DCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSKLYLKYMKKE
                     YLQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRA
                     RNWLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQ
                     PYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKDGDPNQVVDVDG
                     VGGVSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEP
                     SDDDLMAIATKEKERTA"
     gene            complement(<1033653..>1035323)
                     /gene="TPHA0C04790"
                     /locus_tag="TPHA_0C04790"
                     /db_xref="GeneID:11535275"
     mRNA            complement(<1033653..>1035323)
                     /gene="TPHA0C04790"
                     /locus_tag="TPHA_0C04790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685014.1"
                     /db_xref="GeneID:11535275"
     CDS             complement(1033653..1035323)
                     /gene="TPHA0C04790"
                     /locus_tag="TPHA_0C04790"
                     /inference="similar to DNA sequence:INSDC:YML116W,YMR279C"
                     /note="similar to Saccharomyces cerevisiae ATR1 (YML116W)
                     and YMR279C; ancestral locus Anc_8.843"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685062.1"
                     /db_xref="GeneID:11535275"
                     /db_xref="GOA:G8BQW6"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8BQW6"
                     /translation="MDSKNNNNKAAIAASTYEIGRSDSDSDNSTVNSSQKIDSSEQVV
                     PTDSEKYFATVRSSESLSVSSQKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIM
                     NIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSII
                     CGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAP
                     LGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVPDNVPTNTNNLKMDW
                     IGSAVGVVGLLLFSFVWNQAPMDGWDKAYIIVLLVISVILIIAFFIYEINYAEVPLLP
                     KAITGNRHIIMILLAIFMGWGTFGIWSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFT
                     IASCVGFLIKIIRPSIILVISITGFTMGNLIFAVTPADQTYWRNTFGMMLLLPLGMDL
                     SFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSFCLGVATTVEKQINSSGDDLLKGY
                     RAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLANDIESSIERTG"
     gene            <1036962..>1038554
                     /gene="TPHA0C04800"
                     /locus_tag="TPHA_0C04800"
                     /db_xref="GeneID:11533803"
     mRNA            <1036962..>1038554
                     /gene="TPHA0C04800"
                     /locus_tag="TPHA_0C04800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685015.1"
                     /db_xref="GeneID:11533803"
     CDS             1036962..1038554
                     /gene="TPHA0C04800"
                     /locus_tag="TPHA_0C04800"
                     /inference="similar to DNA sequence:INSDC:YML120C"
                     /note="similar to Saccharomyces cerevisiae NDI1 (YML120C);
                     ancestral locus Anc_8.854"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685063.1"
                     /db_xref="GeneID:11533803"
                     /db_xref="GOA:G8BQW7"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:G8BQW7"
                     /translation="MLSRVNKTHDVTLWKKLHSLTRKSLSTTTLLRQEAPPSSQEHLS
                     GTSSFKTVSFLSTDEKHHKTKKSVVILGSGWGAISFLKNIDATKYDVSIISPRNYFLF
                     TPLLPSTPAGTVDEKSIIEPVINFASKKKGSITYIEAEAKAINPDRNTVTVDSMTTVA
                     TLKAKDSSSHDSVAGLKRAEPFEVKYDYLITAVGAEPNTFGVKGVEEYGHFLKEIPNS
                     LEIRRKFAENIEKANLLPKGDPERKRLLSIVVVGGGPTGVETAGELQDYVSQDLKKFL
                     PSLAEEVQIHLVEALPVVLNMFEKKLSSYAQSVLEKTTIKLHLKTAVGKVEKDHLIAK
                     TKKPDGTVEEQKIGYGTLIWATGNKARPVVTDLFTKIPEQNQSTRALNVNQFLQVKGS
                     KNIFAIGDNAFCGLPPTAQVAHQQAEYLCKNFDKMEKIDGFHNTLLKKTEKFDLPFEE
                     NGFKPFNYIHLGALAYLGSERAIANITYGKRSFYTGGGLITFYVWRILYLSMILSARS
                     RFKVISDWLKLTFFKRDFFKGL"
     gene            complement(<1038869..>1039846)
                     /gene="TPHA0C04810"
                     /locus_tag="TPHA_0C04810"
                     /db_xref="GeneID:11535303"
     mRNA            complement(<1038869..>1039846)
                     /gene="TPHA0C04810"
                     /locus_tag="TPHA_0C04810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685016.1"
                     /db_xref="GeneID:11535303"
     CDS             complement(1038869..1039846)
                     /gene="TPHA0C04810"
                     /locus_tag="TPHA_0C04810"
                     /inference="similar to DNA sequence:INSDC:YML121W"
                     /note="similar to Saccharomyces cerevisiae GTR1 (YML121W);
                     ancestral locus Anc_8.855"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685064.1"
                     /db_xref="GeneID:11535303"
                     /db_xref="GOA:G8BQW8"
                     /db_xref="InterPro:IPR006762"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BQW8"
                     /translation="MSSNNRKKLLLMGRSGSGKSSMRSIVFSNYSAFDTRRLGATIDV
                     EHSHLRFLGNMTLNLWDCGGQDVFMENYFTKQKDHIFQMVQVLIHVFDVESQEVIKDI
                     EIFTRALKELKKYSPDAKIFVLLHKMDLVQLDKRYELFEIMMKKLQQASAEYGFPHLV
                     GYPTSIWDESLYKAWSQIVCSLIPNIGVHQATLKKLQNTLNAVEIILFERSTFLVICS
                     SNSTNVYTSDNSALKNINNSKNDTIEKNNNGQQLILDPKRFEKISNIMKNFKQSCSKL
                     KCGFKILVLNDNIYVSELSSNMICFMVLKDSNVPHELILENIRKAKQYF"
     gene            <1040241..>1041701
                     /gene="TPHA0C04820"
                     /locus_tag="TPHA_0C04820"
                     /db_xref="GeneID:11535236"
     mRNA            <1040241..>1041701
                     /gene="TPHA0C04820"
                     /locus_tag="TPHA_0C04820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685017.1"
                     /db_xref="GeneID:11535236"
     CDS             1040241..1041701
                     /gene="TPHA0C04820"
                     /locus_tag="TPHA_0C04820"
                     /inference="similar to DNA sequence:INSDC:YHR190W"
                     /note="similar to Saccharomyces cerevisiae ERG9 (YHR190W);
                     ancestral locus Anc_8.857"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685065.1"
                     /db_xref="GeneID:11535236"
                     /db_xref="GOA:G8BQW9"
                     /db_xref="InterPro:IPR002060"
                     /db_xref="InterPro:IPR006449"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR019845"
                     /db_xref="UniProtKB/TrEMBL:G8BQW9"
                     /translation="MVKITEVICHPIETRSSLLLKLFRCERIYEDVTINVEEDINGKP
                     TKNLVACYELLRKTSKSFYLMILQLHPNIRNIVMIYYLVLRALDTIEDRPNLEATEKT
                     SLLEQFHLQLGDVKAESNEKNSILDGEYSIINQFQIVLNEYNKLEKFYKVIIRDSAQK
                     MGTGMSKYLFIESDAKDSLNTVKEYNEYCHYVAGVVGEGLSKIFVKLQFNFDNSNHLI
                     INERLKLYEHLGLFLQKTNIIRSFHKDYEKYNKSYWPREIWIKYIDNSKDAKLATIED
                     LINSNKRIDCLNEMIINAVSDHMKEILLYISLIEEQSIFEFCAVPQVMAIATLAMLYN
                     NDKVFTSDNEQLKIRKTETGYILYNCRTLLNVTTAIKFYLSQMLKKSKGSNRNDKLAT
                     MVMELDGIIDYKMFPEEAKNPVTDGVREDDYNIFSKQRNDKIDKKTNEIDFKIEENNF
                     LMILWLAAIIIAVAVYFVFFFEPPTLRVHPIDTDQA"
     gene            <1043390..>1045186
                     /gene="TPHA0C04830"
                     /locus_tag="TPHA_0C04830"
                     /db_xref="GeneID:11533630"
     mRNA            <1043390..>1045186
                     /gene="TPHA0C04830"
                     /locus_tag="TPHA_0C04830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685018.1"
                     /db_xref="GeneID:11533630"
     CDS             1043390..1045186
                     /gene="TPHA0C04830"
                     /locus_tag="TPHA_0C04830"
                     /inference="similar to DNA sequence:INSDC:YML123C"
                     /note="similar to Saccharomyces cerevisiae PHO84
                     (YML123C); ancestral locus Anc_8.858"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685066.1"
                     /db_xref="GeneID:11533630"
                     /db_xref="GOA:G8BQX0"
                     /db_xref="InterPro:IPR004738"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8BQX0"
                     /translation="MNYSESEKHDLQNNPKVPKEALTEGGNAAFHNFINDFAHVDDPL
                     ERRRLALEKIDNASFGWYHVKAILVAGVGFLTDAYDIFAINLGVSMLSYVYWKGSIPS
                     SSQTLLKVSTSVGTVIGQVSFGAAADIIGRKKVYGSELIIVICATILQCTSAHSPAIN
                     FVAILTTYRIIMGIGIGGDYPLSSIISAEFATTKWRGAIMGAVFANQAWGQIAGGIIA
                     LICIAAYKDDLIHANSGAECDLVCQKACDQMWRILIGFGALPGMIALYFRLTIPESPR
                     YQLDVNLRDSVVEYHNLDAPVHSGSDISENEKTAAKIEERSHDGIDIENSTDEELYAP
                     PKASFKDFCDHFKQWKHFKILLGTAGCWFMLDVAFYGLSLNNAVIVEAIGYASSKNVY
                     YKLYNSAVGNLILICAGSLPGYWASVFTIDIIGRKPIQTFGFFILTVLFCVIGFAYHR
                     LTPNSLLGLYIVCQFFQNFGPNTTTFIIPGEIFPTRYRSTAHGISAASGKVGAIIAQT
                     VLGTLINHNCARDGKPTNCWLPHVMEIFALFMLCGLGLSFLIPETKRMTLEEISEKYH
                     GEVDLTKLAERNLNYNKNSVIMSKDNGSQIDV"
     gene            <1046086..>1047429
                     /gene="TPHA0C04840"
                     /locus_tag="TPHA_0C04840"
                     /db_xref="GeneID:11535225"
     mRNA            <1046086..>1047429
                     /gene="TPHA0C04840"
                     /locus_tag="TPHA_0C04840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685019.1"
                     /db_xref="GeneID:11535225"
     CDS             1046086..1047429
                     /gene="TPHA0C04840"
                     /locus_tag="TPHA_0C04840"
                     /inference="similar to DNA sequence:INSDC:YML124C,YML085C"
                     /note="similar to Saccharomyces cerevisiae TUB3 (YML124C)
                     and TUB1 (YML085C); ancestral locus Anc_8.859"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685067.1"
                     /db_xref="GeneID:11535225"
                     /db_xref="GOA:G8BQX1"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002452"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:G8BQX1"
                     /translation="MREVVSINVGQAGCQIGNACWELYSLEHGIMPDGYLQEGLTKPK
                     GGEEGFSTFFYETGAGKFVPRAVYVDLEPNVIDEVRTGAYKDFFHPEQLINGKEDAAN
                     NYARGHYTVGRELLDEILDRVRKISDQCDGLQGFLFTHSLGGGTGSGLGSLILEHLSM
                     DYGKKSKLEFAVYPSPQTSTSVVEPYNTVLTTHTTLEHADCTFMVDNDAIYDMCKKHL
                     DIPRPTFSNLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPI
                     SSKSKATHESNTVAEITNACFESSNQMVKCEPKNGKYMANCLLYRGDVVTKDVQSAVA
                     TIKNKKTVQMVDWCPTGFKIGICYEPPTSTPSSQLASIDRAVCMLSNTTAIAEAWKRI
                     DHKFDLMYSKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADSFEEDEEF"
     gene            <1049003..>1050403
                     /gene="TPHA0C04850"
                     /locus_tag="TPHA_0C04850"
                     /db_xref="GeneID:11533450"
     mRNA            <1049003..>1050403
                     /gene="TPHA0C04850"
                     /locus_tag="TPHA_0C04850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685020.1"
                     /db_xref="GeneID:11533450"
     CDS             1049003..1050403
                     /gene="TPHA0C04850"
                     /locus_tag="TPHA_0C04850"
                     /inference="similar to DNA sequence:INSDC:YML126C"
                     /note="similar to Saccharomyces cerevisiae ERG13
                     (YML126C); ancestral locus Anc_8.864"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685068.1"
                     /db_xref="GeneID:11533450"
                     /db_xref="GOA:G8BQX2"
                     /db_xref="InterPro:IPR010122"
                     /db_xref="InterPro:IPR013528"
                     /db_xref="InterPro:IPR013746"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="UniProtKB/TrEMBL:G8BQX2"
                     /translation="MTDTKRQKTADQPTRPQNIGIKGIEIYIPNQYVSQTELEEYDGV
                     SAGKYTIGLGQTNMAFVNDREDIYSMCLTVCSNLIKNYNIDTNKIGRLEVGTETLIDK
                     SKSVKSVLTQLFPGNGDLEGIDTVNACYGGTNALFSSLNWIDSQYWDGRDAIVVCGDI
                     AIYDKGAARPTGGAGTVALWIGSDAPLAFDSVRSSYMEHAYDFYKPDFTSEYPVVDGH
                     FSLRCYVKALDQVYETYLKKAITKGLISETENKPLTEYFDYNVFHVPTCKLVAKSYGR
                     MMFNDCKRNHAYYPTDGSVSQEEISAWDTIDYEESLFDKALEKKFVTLSKRLYNEKVA
                     KSLTVPTNVGNLYTASVFSSLASLIYYVGSDALQNKRIGLFSYGSGLAASLYSCKVVG
                     DVSKIAQVLNLDAKLNTLRSQLTPKQYEDAIALREAAHLQKDFKPNGSTDLLQAGTYY
                     LSAVDDKFRRTYEVKQ"
     gap             1051941..1052119
                     /estimated_length=179
     gene            <1052610..>1056797
                     /gene="TPHA0C04870"
                     /locus_tag="TPHA_0C04870"
                     /db_xref="GeneID:11533517"
     mRNA            <1052610..>1056797
                     /gene="TPHA0C04870"
                     /locus_tag="TPHA_0C04870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685021.1"
                     /db_xref="GeneID:11533517"
     CDS             1052610..1056797
                     /gene="TPHA0C04870"
                     /locus_tag="TPHA_0C04870"
                     /inference="similar to DNA sequence:INSDC:YML091C"
                     /note="similar to Saccharomyces cerevisiae RPM2 (YML091C);
                     ancestral locus Anc_8.865"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685069.1"
                     /db_xref="GeneID:11533517"
                     /db_xref="InterPro:IPR013888"
                     /db_xref="UniProtKB/TrEMBL:G8BQX3"
                     /translation="MVFKSFKSKVNIRRLSQSYTSTPNAAPFLNHHGAATDVFFFNSN
                     QHLNDNNHDNNDSQSNNKNDSNTYNGNDNLKYSNRNSKNSGKNYNINNSSKFIVPLLL
                     TSTATTTNNNSATTTAATATPRRNSHLTSQNTTVAVASPSSIKSTDFPQNKHMKYLRQ
                     TNLVVKRRQKYLLSSNLKNNILRFHNNNYTTIPTTNTLIGNSIINYNNLNGQFSLKDY
                     KKNQHYKKKAFYSTKTNYSNDNISNDELFKNNNNNNITNDVDNNGKHPLQENHDNEQN
                     IEDNWPWEENESYLNKETFLDSHSQKIKENFNNENYEIILPLYQSIKRNDCIPSLETY
                     YQIIFSIINRKFDSNDINYKMYQILSIYEDIIIKHKMKPTEDIYNLILQSLFTSSIKL
                     KNTKNGLDFYRIAIEIFLQIHSKYNLSNDLVIKNLLIATNCYPNVDSKLMNTEKLINT
                     INSIPTFSIEQNYKFYYNSLINYSILKNDLYSFNKLSTDYELLIEDFTTKRNNNLITD
                     DYQIWSLIILGNILIKGDINYATQIFETKLNEISSLTSNKNEIFQLVKNFILSVSIVN
                     PNHGYELLSTFKSNISWFPDFDYYFYLRLLNYSLKDWDLTKKYYNSLYALPLPEKVEK
                     SDIFNDNYIFDNKTLLSDDMDINENCIHDFLIAQAFQCSDSEMIQNLIHESIVKKFKF
                     NDLKTYEVVFEIFKGNKNIYSDDFIKSFIELHGDLIKEEYFKERNLISNDMEHEEMFH
                     THNLTILDSFVNLILQKKIYGETNETSIFTSKFFKSYCNLSNIFNVYTLTNLKICINH
                     INKDLLTNSYDYSSILDFYSKMILKINRVDLLLNIHGNLNEGNGIENNKNSNDILKIN
                     FDPLLLNSFNEFKVQVHDEFKEFMNKYKDLHFEPSLLSSSVSQAIKLFDFSTDIDHYF
                     TGNLGDWDKSYPISLGPVIRKSEHTGIREFNQLYKNGYKFDFETYRALFSSKNLSTFL
                     TKDMVINAVKTCMAEHQVLELKNLIKLMVHNLNLDSIRSLILKDKDILSDNLINNLNN
                     TSLMKLIKSHTEQQDYLNNNNTSMEEFNNFLTDIKFPHNFATIKAQTTFFESISMIYM
                     TLYKQHQFDKIIEFNKVSPVQNLYLLLFSYLKTNDLSSFKENYRLYKSKLSEEDSVML
                     LATYYNSLSKTDEAIETIQNFVQKNNLETIPSKLNDIYSNALFNLKFINPSKAAKLIQ
                     SVKITNEYQLSNILSYYSNDFPSMMLHFENFRSKHFNISKQNVLEIILQSYCSILSKS
                     TKLSKNSKDLNHFDLYIENYFKFKCYLMDSHLTTNEINKIIDIWYHVKPSALSSLVNN
                     IMESIHLDPERNTLYILNDFSFTFRPTELRSLINQIKMYYVKEQKNGEQKLPLLTKID
                     NSLNFINDTYKLEGIVI"
     gene            complement(<1057043..>1058833)
                     /gene="TPHA0C04880"
                     /locus_tag="TPHA_0C04880"
                     /db_xref="GeneID:11534079"
     mRNA            complement(<1057043..>1058833)
                     /gene="TPHA0C04880"
                     /locus_tag="TPHA_0C04880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685022.1"
                     /db_xref="GeneID:11534079"
     CDS             complement(1057043..1058833)
                     /gene="TPHA0C04880"
                     /locus_tag="TPHA_0C04880"
                     /inference="similar to DNA sequence:INSDC:YML127W"
                     /note="similar to Saccharomyces cerevisiae RSC9 (YML127W);
                     ancestral locus Anc_8.866"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685070.1"
                     /db_xref="GeneID:11534079"
                     /db_xref="GOA:G8BQX4"
                     /db_xref="InterPro:IPR003150"
                     /db_xref="UniProtKB/TrEMBL:G8BQX4"
                     /translation="MDNFQPMVNTQVMGENTEVTNGNMFSNMAATPIRVSRNESSGLV
                     DFSGFTATSTSSVASTLAKLNIFQNLPKETSKGVDGLSRMKMSVQSNLPEEIKWGLKK
                     YLAYSNKAPYLISLKDMPDLLPIFKAFIQSMVPIVDNFDKPITINAKDEVSNADPLTV
                     LQFGLNSLLILRNLAQDTDSVQVLVKDSSIKEFILFILTKYETLFINKDTEKQIYHSN
                     VSFANELIHYVLDIMEAVSSYMAPAKLDDPFFKSLITLLNYTKDRYLVISILRSLSRL
                     LVRSKSDELSAAENLDEKSLSAIVSFLLIDCDIELVTASLDFLYQYILPGNERISKLI
                     NDPIRMTQLSAILPKLLTSNIPLPNYEQIDNHEIRLIKRLKPAPPKDAPPIDDKLFNE
                     LIAIQEPLRSIMWLRCCFEPINEAEVTQITLWRTYEAKFSLAVREKTGKKLLPAVEFI
                     KNVSNAFSNASAMVITDPATSKKRFVIKGIQPRFTSLSLREAEEEHAKRITNSSSDIK
                     KSVNNNITEEDDTIKPVEQNVLPELVFPQKLSDISNATATFLCLLSNDTKGHGLQFCQ
                     SIKPLIIHKLVNVPPLTTALSEYMENTKLL"
     gene            <1059964..>1061454
                     /gene="TPHA0C04890"
                     /locus_tag="TPHA_0C04890"
                     /db_xref="GeneID:11535289"
     mRNA            <1059964..>1061454
                     /gene="TPHA0C04890"
                     /locus_tag="TPHA_0C04890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685023.1"
                     /db_xref="GeneID:11535289"
     CDS             1059964..1061454
                     /gene="TPHA0C04890"
                     /locus_tag="TPHA_0C04890"
                     /inference="similar to DNA sequence:INSDC:YML128C"
                     /note="similar to Saccharomyces cerevisiae MSC1 (YML128C);
                     ancestral locus Anc_8.867"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685071.1"
                     /db_xref="GeneID:11535289"
                     /db_xref="InterPro:IPR018803"
                     /db_xref="UniProtKB/TrEMBL:G8BQX5"
                     /translation="MRLVFVLTLFALCEKSALAFGNSQQSAFNVEKWTHEDILEYLKD
                     EADELKDLSSQTYEYLKDHLAHKLSFGHEQRTATDVASDTYHGYKGRVCEWLVDTWTT
                     NAIHKLLDSAGIDFDPNVSRDELIKIFRDNFDVACKKLNASGYYPSTKFYSEWTLQEL
                     QDWLERFGIEYSNDIKNKRDDLVALVKKNAYQASEYAEEKRMDLMKKLNENAGDELFD
                     KKTGKLNKDVFEHWSNVDLQNWLEDHGISYDKAKVKGKKNHKYLIKIAEDNINLLQDD
                     VDWYFQKLHQTASPILYKPANYMSQLYDVAAGNTGMRKFTPTWLQYFYDKLKYNWHCH
                     FSDVDKLNTDSWSKERLQEFLDVRGVKYHTLTTKRSLRKLVQKNKDKPIIKNEENVAK
                     LFNKLGLSNVHDWLTETTLKEKSDKLSKDSQTWKNSIIEKWYQTLDTWTVDELSDYLN
                     SFGIVSNPTATKNELIEMIKSNTKSFFGFPEPQPFYKRWYNGLFYR"
     gene            <1061972..>1062181
                     /gene="TPHA0C04900"
                     /locus_tag="TPHA_0C04900"
                     /db_xref="GeneID:11533808"
     mRNA            <1061972..>1062181
                     /gene="TPHA0C04900"
                     /locus_tag="TPHA_0C04900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685024.1"
                     /db_xref="GeneID:11533808"
     CDS             1061972..1062181
                     /gene="TPHA0C04900"
                     /locus_tag="TPHA_0C04900"
                     /inference="similar to DNA sequence:INSDC:YML129C"
                     /note="similar to Saccharomyces cerevisiae COX14
                     (YML129C); ancestral locus Anc_8.868"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685072.1"
                     /db_xref="GeneID:11533808"
                     /db_xref="InterPro:IPR029208"
                     /db_xref="UniProtKB/TrEMBL:G8BQX6"
                     /translation="MAKYAWYTRASDTIHRLTVLGLVGGSVYMVGGLGYTMYINGKNY
                     EKQVTATKLDQNEARELEGSVTSAE"
     gene            complement(<1062455..>1063126)
                     /gene="TPHA0C04910"
                     /locus_tag="TPHA_0C04910"
                     /db_xref="GeneID:11533628"
     mRNA            complement(<1062455..>1063126)
                     /gene="TPHA0C04910"
                     /locus_tag="TPHA_0C04910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685025.1"
                     /db_xref="GeneID:11533628"
     CDS             complement(1062455..1063126)
                     /gene="TPHA0C04910"
                     /locus_tag="TPHA_0C04910"
                     /note="ancestral locus Anc_8.869"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685073.1"
                     /db_xref="GeneID:11533628"
                     /db_xref="InterPro:IPR006735"
                     /db_xref="InterPro:IPR027799"
                     /db_xref="UniProtKB/TrEMBL:G8BQX7"
                     /translation="MGADGGSVNKNYNLKLQIQKDKDVPKDDDTKEYIKQSRWNYCAL
                     KSNEFLTLPLVSDYRGNLYNKTSILEWLLEKDKQKAYSAQQIDKFKHIKRLNDIVQLN
                     GLTETVSDENENRRVIKCDFGDDVFIGTLNPNSNATNAQKNFVYISPCGDVMQRNALG
                     LMKKSERKCPSCLNVYKSTDIIPINSEDPQMLKVLEDRMTTLKKQNIYHNGKARKLAD
                     PKKGS"
     gene            <1063428..>1064117
                     /gene="TPHA0C04920"
                     /locus_tag="TPHA_0C04920"
                     /db_xref="GeneID:11533636"
     mRNA            <1063428..>1064117
                     /gene="TPHA0C04920"
                     /locus_tag="TPHA_0C04920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685026.1"
                     /db_xref="GeneID:11533636"
     CDS             1063428..1064117
                     /gene="TPHA0C04920"
                     /locus_tag="TPHA_0C04920"
                     /note="ancestral locus Anc_8.870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685074.1"
                     /db_xref="GeneID:11533636"
                     /db_xref="GOA:G8BQX8"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR009145"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BQX8"
                     /translation="MDRRYQQRNQYHRQDEKERCLFYYKVGVCRHGNKCSKSHTSPNR
                     SHTIVLLNLVDFPRNADVTTSNTATTTTDESDKSTQETKPNKPTTKNKSTPPIDDKEY
                     DSIYEDLYIELAKYGRIMEMYICDNGNDHLRGNVYVRYSSEQNARDANNELNTRWFNG
                     KPIYCDLTHIHDFGEAICRKPEEKSGCERGDHCNFMHIRKPSPQLQTDLENAQRKKFQ
                     LNSNPYISKRA"
     gene            <1064804..>1065556
                     /gene="TPHA0C04930"
                     /locus_tag="TPHA_0C04930"
                     /db_xref="GeneID:11535253"
     mRNA            <1064804..>1065556
                     /gene="TPHA0C04930"
                     /locus_tag="TPHA_0C04930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685027.1"
                     /db_xref="GeneID:11535253"
     CDS             1064804..1065556
                     /gene="TPHA0C04930"
                     /locus_tag="TPHA_0C04930"
                     /inference="similar to DNA sequence:INSDC:YML092C"
                     /note="similar to Saccharomyces cerevisiae PRE8 (YML092C);
                     ancestral locus Anc_8.871"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685075.1"
                     /db_xref="GeneID:11535253"
                     /db_xref="GOA:G8BQX9"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8BQX9"
                     /translation="MADRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVI
                     IATEKKTSSSLALTEDISKISALTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYG
                     EYPSTKLLVSEIAKVMQEATQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWK
                     ATSIGKGSTAAKTFLEKRWNNELELEDAIHIALLTLKESVEGEFNGDTIEIAVVGDEN
                     NDLLGYKGVEGEVGPRFRKLSPQEINDRLAAL"
     gene            complement(<1065955..>1066519)
                     /gene="TPHA0C04940"
                     /locus_tag="TPHA_0C04940"
                     /db_xref="GeneID:11535221"
     mRNA            complement(join(<1065955..1066415,1066504..>1066519))
                     /gene="TPHA0C04940"
                     /locus_tag="TPHA_0C04940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685028.1"
                     /db_xref="GeneID:11535221"
     CDS             complement(join(1065955..1066415,1066504..1066519))
                     /gene="TPHA0C04940"
                     /locus_tag="TPHA_0C04940"
                     /inference="similar to DNA sequence:INSDC:YML094W"
                     /note="similar to Saccharomyces cerevisiae GIM5 (YML094W);
                     ancestral locus Anc_8.873"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685076.1"
                     /db_xref="GeneID:11535221"
                     /db_xref="GOA:G8BQY0"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR011599"
                     /db_xref="UniProtKB/TrEMBL:G8BQY0"
                     /translation="MSSQKIDLSKLNAEQLAAVKQQFDQELQHFTQSLQALNVAKNKF
                     TECIEDIKVTSSTDNENQKLLIPATASLYVPGKIIDNKKFLVDIGTGYYVEKDADKAI
                     EFYQKKINKLSTESTQIQNIIKEKSQSSFAIEQQIREAAIRQNHEAAKEQPAQNEA"
     gene            complement(<1067043..>1068620)
                     /gene="TPHA0C04950"
                     /locus_tag="TPHA_0C04950"
                     /db_xref="GeneID:11533971"
     mRNA            complement(<1067043..>1068620)
                     /gene="TPHA0C04950"
                     /locus_tag="TPHA_0C04950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685029.1"
                     /db_xref="GeneID:11533971"
     CDS             complement(1067043..1068620)
                     /gene="TPHA0C04950"
                     /locus_tag="TPHA_0C04950"
                     /inference="similar to DNA sequence:INSDC:YML096W"
                     /note="similar to Saccharomyces cerevisiae YML096W;
                     ancestral locus Anc_8.875"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685077.1"
                     /db_xref="GeneID:11533971"
                     /db_xref="GOA:G8BQY1"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR001962"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8BQY1"
                     /translation="MCGILLHYNPINNGSLEDEIIEIPEGSDDLKSCSDKSPIFNEIV
                     PYIARRGPNYQMFRVFKSEQISWYSSILSLRKPFTKQSIEVNDRYILQFNGELYNNEI
                     HGISDTTYFVNCLKTALDEKDIINILRTLEGEFAYTIFDSKKKLVYFGRDTIGKRSLG
                     YKLDYETNELYISSATGDVEGFKNCVGGIVYIYNIEKKQLDEENMIREPYTVSAEVDE
                     GESRANELIAKLYDSLYESVEKRVLSIHPAHIEASPVAVLFSGGLDCSVIVALICEVM
                     KSKSKYSNHTIELLNVGFENPRVGLQPKDAPDRKLAVSSTEVLKELYPEIDIKLVEVD
                     VSYEEYVKLKPYVIKLMYPKVTEMDLSIAIAFYFASRGAGFITNYEEHTRIPYKRKGI
                     VLFSGLGADELYGGYHKFANKSREELVEELTKQINNIHDRNLNRDDKVSADNGIEVRY
                     PFLDEYVVNFSTKEIPINYKINKKILRDLAKAKLHLEAISEEPKRAIQFGAKSAKMTK
                     DGNKHGTDIIKLEEMLN"
     gene            <1069045..>1070661
                     /gene="TPHA0C04960"
                     /locus_tag="TPHA_0C04960"
                     /db_xref="GeneID:11533498"
     mRNA            <1069045..>1070661
                     /gene="TPHA0C04960"
                     /locus_tag="TPHA_0C04960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685030.1"
                     /db_xref="GeneID:11533498"
     CDS             1069045..1070661
                     /gene="TPHA0C04960"
                     /locus_tag="TPHA_0C04960"
                     /inference="similar to DNA sequence:INSDC:YML097C"
                     /note="similar to Saccharomyces cerevisiae VPS9 (YML097C);
                     ancestral locus Anc_8.876"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685078.1"
                     /db_xref="GeneID:11533498"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR013995"
                     /db_xref="UniProtKB/TrEMBL:G8BQY2"
                     /translation="MSFKDNILNEFDPLANNNNASRSSDSASNINEPHKESIDDENKK
                     TNDGGHIKPVVNKNNVKNTNKDDINILSDIPAINAERETETVVSNNLKEKHQYGDNDR
                     VNNADHLPVAQINETKEEIDSNDNYYDFQEFLEQFKKPTAEPLVKYTRSFLHNFLTQR
                     SIWTTKEQTKLINDFKVFIFDKFLIYEPFKSMDKTSLNNAQEGIEKLIMGKLYNNCYS
                     PNLKKLLKNKLIKLDDGHEQDLEDDLLIKRKFSEFGFIKPTYLDISFKDANKKSNIII
                     DRFINISGQELDKINKFKSPRDKIVCILNSCKVIFSILKHNKLEQNGADSFIPFLIYS
                     LLKNKIMNLPSNLNYIERFRHEKFIKGEASYYFSSLQAAVNFIMNMDKSSLTIDNEEE